F493773

General Info

Members Datasets Scaffolds Average Seq Length
1413 698 1180 253

Family's Representative Sequence

Representative Sequence 3300053142|Ga0500577_0000058|Ga0500577_0000058_24248_25108
Length 286
Sequence LHRKREKLLGCDQRERRRNARRADGFGTPMDRTDLPPTVPVGDVXXDAPRGFMARIRNYFLTGLIVAGPIAITFYLTWWFVTWVDALVRPLVPEAYRPEQYLPYGIPGSGLIVAFVALTLLGFLTANLIGRSLVDLGENLLGRMPVVRAIYRGLKQVFETLFSGNGSSFRRVGLVEFPSPGMWSIVLISQPPSVEIANSLPGEDEHISVFLPCAPNPTTGFFFYVPKSKIIDIDMSAEDAATLIMSAGVVQPGSDPQKKIAALAEMAQAARMANTAAPMQVPAKVD

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2643221651 Afipia sp. Root123D2 Isolate Unclassified
29 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
30 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
31 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
32 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
33 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
34 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
35 2791355199
36 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
37 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
38 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
39 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
40 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
41 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
42 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
43 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
44 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
45 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
46 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
47 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
48 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
49 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
50 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
51 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
52 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
53 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
54 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
55 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
56 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
57 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
58 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
59 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
60 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
61 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
62 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
63 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
64 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
65 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
66 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
67 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
68 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
69 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
70 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
71 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
72 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
73 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
74 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
75 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
76 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
77 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
78 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
79 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
80 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
81 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
82 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
83 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
84 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
85 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
86 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
87 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
88 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
89 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
90 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
91 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
92 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
93 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
94 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
95 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
96 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
97 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
98 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
99 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
100 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
101 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
102 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
103 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
104 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
105 2904699407
106 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
107 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
108 2906610324
109 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
110 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
111 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
112 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
113 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
114 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
115 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
116 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
117 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
118 2922368715
119 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
120 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
121 2922425934
122 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
123 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
124 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
125 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
126 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
127 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
128 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
129 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
130 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
131 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
132 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
133 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
134 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
135 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
136 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
137 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
138 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
139 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
140 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
141 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
142 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
143 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
144 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
145 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
146 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
147 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
148 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
149 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
150 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
151 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
152 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
153 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
154 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
155 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
156 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
157 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
158 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
159 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
160 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
161 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
162 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
163 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
164 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
165 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
166 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
167 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
168 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
169 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
170 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
171 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
172 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
173 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
174 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
175 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
176 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
177 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
178 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
179 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
180 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
181 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
182 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
183 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
184 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
185 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
186 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
187 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
188 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
189 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
190 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
191 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
192 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
193 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
194 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
195 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
196 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
197 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
198 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
199 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
200 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
201 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
202 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
203 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
204 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
205 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
206 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
207 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
208 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
209 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
210 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
211 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
212 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
213 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
214 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
215 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
216 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
217 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
218 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
219 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
220 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
221 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
222 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
223 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
224 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
225 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
226 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
227 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
228 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
229 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
230 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
231 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
232 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
233 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
234 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
235 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
236 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
237 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
238 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
239 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
240 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
241 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
242 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
243 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
244 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
245 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
246 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
247 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
248 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
249 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
250 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
251 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
252 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
253 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
254 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
255 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
256 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
257 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
258 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
259 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
260 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
261 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
262 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
263 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
264 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
265 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
266 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
267 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
268 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
269 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
270 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
271 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
272 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
273 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
274 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
275 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
276 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
277 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
278 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
279 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
280 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
281 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
282 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
283 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
284 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
285 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
286 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
287 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
288 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
289 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
290 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
291 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
292 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
293 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
294 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
295 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
296 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
297 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
298 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
299 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
300 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
301 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
302 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
303 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
304 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
305 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
306 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
307 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
308 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
309 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
310 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
311 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
312 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
313 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
314 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
315 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
316 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
317 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
318 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
321 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
324 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
326 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
374 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
375 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
376 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
377 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
383 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
384 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
385 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
386 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
387 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
388 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
389 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
390 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
391 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
392 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
393 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
394 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
395 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
396 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
397 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
398 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
399 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
400 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
401 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
402 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
403 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
404 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
405 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
406 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
407 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
408 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
409 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
410 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
411 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
412 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
413 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
414 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
415 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
416 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
417 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
418 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
419 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
420 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
421 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
422 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
423 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
424 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
425 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
426 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
427 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
428 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
429 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
430 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
431 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
432 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
433 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
434 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
435 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
436 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
437 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
438 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
439 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
440 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
441 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
442 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
443 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
444 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
445 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
446 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
447 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
448 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
449 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
450 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
451 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
452 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
453 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
454 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
455 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
456 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
457 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
458 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
459 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
460 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
461 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
462 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
463 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
464 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
465 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
466 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
467 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
468 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
469 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
470 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
471 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
472 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
473 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
474 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
475 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
476 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
477 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
478 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
479 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
480 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
481 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
482 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
483 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
484 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
485 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
486 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
487 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
488 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
489 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
490 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
491 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
492 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
493 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
494 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
495 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
496 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
497 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
498 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
499 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
500 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
501 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
502 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
503 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
504 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
505 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
506 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
507 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
508 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
509 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
510 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
511 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
512 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
513 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
514 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
515 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
516 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
517 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
518 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
519 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
520 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
521 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
522 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
523 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
524 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
525 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
526 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
527 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
528 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
529 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
530 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
531 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
532 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
533 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
534 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
535 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
536 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
537 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
538 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
539 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
540 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
541 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
542 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
543 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
544 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
545 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
546 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
547 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
548 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
549 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
550 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
551 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
552 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
553 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
554 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
555 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
556 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
557 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
558 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
559 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
562 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
563 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
564 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
565 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
566 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
567 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
568 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
569 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
570 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
571 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
572 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
573 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
574 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
575 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
576 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
577 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
578 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
579 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
580 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
582 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
583 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
584 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
585 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
586 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
587 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
588 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
589 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
590 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
591 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
592 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
593 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
594 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
595 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
596 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
597 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
598 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
599 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
600 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
601 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
602 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
603 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
604 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
605 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
606 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
607 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
608 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
609 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
610 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
611 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
612 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
613 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
614 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
615 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
616 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
617 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
618 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
619 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
620 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
621 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
622 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
623 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
624 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
625 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
626 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
627 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
628 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
629 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
630 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
631 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
632 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
633 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
634 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
635 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
636 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
637 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
638 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
639 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
640 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
641 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
642 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
643 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
644 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
645 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
646 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
647 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
648 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
649 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
650 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
651 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
652 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
653 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
654 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
655 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
656 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
657 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
658 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
659 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
660 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
661 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
662 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
663 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
664 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
665 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
666 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
667 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
668 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
669 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
670 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
671 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
672 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
673 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
674 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
675 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
676 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
677 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
678 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
679 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
680 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
681 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
682 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
683 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
684 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
685 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
686 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
687 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
688 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
689 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
690 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
691 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
692 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
693 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
694 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
695 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
696 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
697 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
698 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.45
Metatranscriptomes 0.36
Isolates 16.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.81
Nodule 12.74
Rhizoplane 4.32
Rhizosphere 58.67
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10011169 3300001989 Bacteria 3318
2 JGI24737J22298_10046391 3300001990 Bacteria 1326
3 JGI24735J21928_10066513 3300002067 Bacteria 1034
4 JGI25406J46586_10000004 3300003203 Bacteria 149772
5 JGI25165J46597_1010878 3300003214 Bacteria 1315
6 JGI25153J46596_10001121 3300003215 Bacteria 16242
7 JGI25153J46596_10002750 3300003215 Bacteria 10011
8 JGI25153J46596_10002825 3300003215 Bacteria 9869
9 JGI25153J46596_10008914 3300003215 Bacteria 4733
10 JGI25160J50197_1002027 3300003354 Bacteria 9658
11 JGI25160J50197_1014597 3300003354 Bacteria 2621
12 JGI25160J50197_1015874 3300003354 Bacteria 2452
13 JGI25404J52841_10000996 3300003659 Bacteria 4650
14 JGI25404J52841_10026278 3300003659 Bacteria 1253
15 Ga0055542_1008165 3300003762 Bacteria 2065
16 Ga0055524_1045785 3300003775 Bacteria 1048
17 Ga0055531_10044317 3300003794 Bacteria 1248
18 Ga0065165_1000394 3300005262 Bacteria 70991
19 Ga0065165_1010648 3300005262 Bacteria 3942
20 Ga0065165_1013090 3300005262 Bacteria 3322
21 Ga0065165_1030460 3300005262 Bacteria 1716
22 Ga0065165_1036596 3300005262 Bacteria 1496
23 Ga0070658_10055088 3300005327 Bacteria 3230
24 Ga0070658_10158173 3300005327 Bacteria 1900
25 Ga0070676_10219328 3300005328 Bacteria 1255
26 Ga0070683_100000652 3300005329 Bacteria 25052
27 Ga0070683_100001741 3300005329 Bacteria 16946
28 Ga0070683_100448812 3300005329 Bacteria 1230
29 Ga0070690_100162646 3300005330 Bacteria 1531
30 Ga0070670_100368031 3300005331 Bacteria 1265
31 Ga0068869_100100381 3300005334 Bacteria 2188
32 Ga0070680_100019780 3300005336 Bacteria 5339
33 Ga0070680_100073065 3300005336 Bacteria 2820
34 Ga0070680_100319565 3300005336 Bacteria 1318
35 Ga0068868_100144046 3300005338 Bacteria 1958
36 Ga0070660_100053501 3300005339 Bacteria 3114
37 Ga0070660_100292611 3300005339 Bacteria 1334
38 Ga0070660_100325791 3300005339 Bacteria 1262
39 Ga0070660_100374332 3300005339 Bacteria 1175
40 Ga0070691_10071209 3300005341 Bacteria 1688
41 Ga0070661_100390503 3300005344 Bacteria 1099
42 Ga0070661_100412282 3300005344 Bacteria 1070
43 Ga0070668_100106427 3300005347 Bacteria 2228
44 Ga0070668_100133855 3300005347 Bacteria 1992
45 Ga0070671_100057432 3300005355 Bacteria 3238
46 Ga0070671_100429508 3300005355 Bacteria 1132
47 Ga0070674_100108900 3300005356 Bacteria 2031
48 Ga0070674_100286605 3300005356 Bacteria 1308
49 Ga0070673_100412447 3300005364 Bacteria 1209
50 Ga0070673_100687102 3300005364 Bacteria 939
51 Ga0070659_100267786 3300005366 Bacteria 1419
52 Ga0070709_10000247 3300005434 Bacteria 34839
53 Ga0070709_10001245 3300005434 Bacteria 13920
54 Ga0070709_10013557 3300005434 Bacteria 4587
55 Ga0070709_10013963 3300005434 Bacteria 4530
56 Ga0070709_10573529 3300005434 Bacteria 866
57 Ga0070714_100002813 3300005435 Bacteria 12843
58 Ga0070714_100018248 3300005435 Bacteria 5695
59 Ga0070714_100078278 3300005435 Bacteria 2873
60 Ga0070714_100174819 3300005435 Bacteria 1951
61 Ga0070714_100335359 3300005435 Bacteria 1417
62 Ga0070713_100015159 3300005436 Bacteria 5748
63 Ga0070713_100035160 3300005436 Bacteria 4031
64 Ga0070713_100057996 3300005436 Bacteria 3227
65 Ga0070713_100141130 3300005436 Bacteria 2134
66 Ga0070713_100215823 3300005436 Bacteria 1739
67 Ga0070713_100625935 3300005436 Bacteria 1024
68 Ga0070710_10000979 3300005437 Bacteria 13573
69 Ga0070710_10016239 3300005437 Bacteria 3785
70 Ga0070710_10018757 3300005437 Bacteria 3565
71 Ga0070710_10061787 3300005437 Bacteria 2134
72 Ga0070701_10156475 3300005438 Bacteria 1317
73 Ga0070711_100013370 3300005439 Bacteria 5155
74 Ga0070711_100066238 3300005439 Bacteria 2529
75 Ga0070711_100119442 3300005439 Bacteria 1947
76 Ga0070711_100282960 3300005439 Bacteria 1313
77 Ga0070694_100374031 3300005444 Bacteria 1109
78 Ga0070708_100172862 3300005445 Bacteria 2018
79 Ga0070663_100007669 3300005455 Bacteria 6585
80 Ga0070663_100012373 3300005455 Bacteria 5396
81 Ga0070663_100058807 3300005455 Bacteria 2761
82 Ga0070663_100156959 3300005455 Bacteria 1749
83 Ga0070663_100199845 3300005455 Bacteria 1559
84 Ga0070663_100255846 3300005455 Bacteria 1387
85 Ga0070678_100012438 3300005456 Bacteria 5290
86 Ga0070678_100460397 3300005456 Bacteria 1115
87 Ga0070662_100328034 3300005457 Bacteria 1250
88 Ga0070681_10005973 3300005458 Bacteria 11794
89 Ga0070681_10317721 3300005458 Bacteria 1467
90 Ga0070681_10457618 3300005458 Bacteria 1188
91 Ga0068867_100034125 3300005459 Bacteria 3687
92 Ga0070685_10416625 3300005466 Bacteria 934
93 Ga0070707_100269455 3300005468 Bacteria 1656
94 Ga0070698_100190960 3300005471 Bacteria 1986
95 Ga0070679_100059281 3300005530 Bacteria 3815
96 Ga0070679_100124368 3300005530 Bacteria 2562
97 Ga0070679_100254685 3300005530 Bacteria 1711
98 Ga0070679_100319828 3300005530 Bacteria 1501
99 Ga0070679_100395056 3300005530 Bacteria 1329
100 Ga0070679_100432121 3300005530 Bacteria 1262
101 Ga0070679_100606594 3300005530 Bacteria 1038
102 Ga0070679_100662334 3300005530 Bacteria 986
103 Ga0070684_100001124 3300005535 Bacteria 19191
104 Ga0070684_100002282 3300005535 Bacteria 14130
105 Ga0068853_100148198 3300005539 Bacteria 2111
106 Ga0068853_100169905 3300005539 Bacteria 1972
107 Ga0068853_100190357 3300005539 Bacteria 1864
108 Ga0068853_100261663 3300005539 Bacteria 1591
109 Ga0070693_100030193 3300005547 Bacteria 2962
110 Ga0070693_100116009 3300005547 Bacteria 1654
111 Ga0070693_100205784 3300005547 Bacteria 1281
112 Ga0070665_100131331 3300005548 Bacteria 2506
113 Ga0070665_100154903 3300005548 Bacteria 2293
114 Ga0070665_100185286 3300005548 Bacteria 2082
115 Ga0070665_100250822 3300005548 Bacteria 1771
116 Ga0070665_100391937 3300005548 Bacteria 1397
117 Ga0070665_100511034 3300005548 Bacteria 1213
118 Ga0070665_100695863 3300005548 Bacteria 1029
119 Ga0068855_100085961 3300005563 Bacteria 3638
120 Ga0068855_100088315 3300005563 Bacteria 3581
121 Ga0068855_100213638 3300005563 Bacteria 2166
122 Ga0068855_100548497 3300005563 Bacteria 1252
123 Ga0068855_100602110 3300005563 Bacteria 1185
124 Ga0070664_100084318 3300005564 Bacteria 2743
125 Ga0070664_100363863 3300005564 Bacteria 1318
126 Ga0068857_100027761 3300005577 Bacteria 4992
127 Ga0068857_100092655 3300005577 Bacteria 2705
128 Ga0068857_100177335 3300005577 Bacteria 1939
129 Ga0068854_100396225 3300005578 Bacteria 1141
130 Ga0068856_100006007 3300005614 Bacteria 11948
131 Ga0068856_100006164 3300005614 Bacteria 11765
132 Ga0068856_100058656 3300005614 Bacteria 3802
133 Ga0068856_100162321 3300005614 Bacteria 2245
134 Ga0068856_100463638 3300005614 Bacteria 1288
135 Ga0068856_100488290 3300005614 Bacteria 1252
136 Ga0068852_100024877 3300005616 Bacteria 4844
137 Ga0068852_100026594 3300005616 Bacteria 4706
138 Ga0068852_100223513 3300005616 Bacteria 1792
139 Ga0068852_100245240 3300005616 Bacteria 1714
140 Ga0068852_100252297 3300005616 Bacteria 1691
141 Ga0068852_100470325 3300005616 Bacteria 1247
142 Ga0068852_100563289 3300005616 Bacteria 1141
143 Ga0068864_100119863 3300005618 Bacteria 2351
144 Ga0068864_100208257 3300005618 Bacteria 1799
145 Ga0068861_100216164 3300005719 Bacteria 1617
146 Ga0068861_100297022 3300005719 Bacteria 1397
147 Ga0068863_100316017 3300005841 Bacteria 1517
148 Ga0068858_100047111 3300005842 Bacteria 3997
149 Ga0068858_100165501 3300005842 Bacteria 2083
150 Ga0068860_100002150 3300005843 Bacteria 20778
151 Ga0081455_10004224 3300005937 Bacteria 16189
152 Ga0081455_10024799 3300005937 Bacteria 5545
153 Ga0081455_10034743 3300005937 Bacteria 4513
154 Ga0081455_10058007 3300005937 Bacteria 3279
155 Ga0081455_10117367 3300005937 Bacteria 2103
156 Ga0081455_10282495 3300005937 Bacteria 1199
157 Ga0081538_10003572 3300005981 Bacteria 14631
158 Ga0081538_10034900 3300005981 Bacteria 3315
159 Ga0081538_10197342 3300005981 Bacteria 833
160 Ga0081540_1000683 3300005983 Bacteria 31759
161 Ga0081540_1006439 3300005983 Bacteria 8546
162 Ga0081540_1009891 3300005983 Bacteria 6512
163 Ga0081540_1011684 3300005983 Bacteria 5850
164 Ga0081540_1013357 3300005983 Bacteria 5343
165 Ga0081540_1019314 3300005983 Bacteria 4148
166 Ga0081540_1024144 3300005983 Bacteria 3534
167 Ga0081540_1031817 3300005983 Bacteria 2891
168 Ga0081540_1117739 3300005983 Bacteria 1109
169 Ga0081539_10000080 3300005985 Bacteria 222745
170 Ga0081539_10000152 3300005985 Bacteria 160005
171 Ga0081539_10020634 3300005985 Bacteria 4442
172 Ga0081539_10089448 3300005985 Bacteria 1594
173 Ga0070717_10001828 3300006028 Bacteria 14867
174 Ga0070717_10024964 3300006028 Bacteria 4748
175 Ga0070717_10047705 3300006028 Bacteria 3510
176 Ga0070717_10228756 3300006028 Bacteria 1637
177 Ga0070717_10291934 3300006028 Bacteria 1448
178 Ga0070717_10339160 3300006028 Bacteria 1342
179 Ga0075365_10005882 3300006038 Bacteria 6674
180 Ga0075365_10021338 3300006038 Bacteria 4039
181 Ga0075365_10055199 3300006038 Bacteria 2636
182 Ga0075365_10204633 3300006038 Bacteria 1383
183 Ga0075368_10039758 3300006042 Bacteria 1845
184 Ga0075368_10045234 3300006042 Bacteria 1738
185 Ga0075363_100031431 3300006048 Bacteria 2753
186 Ga0075363_100052519 3300006048 Bacteria 2176
187 Ga0075364_10035235 3300006051 Bacteria 3234
188 Ga0075364_10049228 3300006051 Bacteria 2748
189 Ga0075364_10163150 3300006051 Bacteria 1505
190 Ga0070715_10028685 3300006163 Bacteria 2235
191 Ga0070715_10029991 3300006163 Bacteria 2195
192 Ga0070715_10106893 3300006163 Bacteria 1314
193 Ga0070716_100003314 3300006173 Bacteria 7568
194 Ga0070716_100441460 3300006173 Bacteria 946
195 Ga0070712_100043218 3300006175 Bacteria 3102
196 Ga0070712_100058182 3300006175 Bacteria 2719
197 Ga0070712_100531675 3300006175 Bacteria 989
198 Ga0075362_10095584 3300006177 Bacteria 1384
199 Ga0075367_10055588 3300006178 Bacteria 2349
200 Ga0075367_10061796 3300006178 Bacteria 2236
201 Ga0075369_10060432 3300006186 Bacteria 1653
202 Ga0075369_10070240 3300006186 Bacteria 1541
203 Ga0075369_10075854 3300006186 Bacteria 1485
204 Ga0075366_10037086 3300006195 Bacteria 2876
205 Ga0075366_10138086 3300006195 Bacteria 1473
206 Ga0075366_10405195 3300006195 Bacteria 839
207 Ga0097621_100072481 3300006237 Bacteria 2849
208 Ga0075370_10008424 3300006353 Bacteria 5306
209 Ga0075370_10015344 3300006353 Bacteria 4100
210 Ga0075370_10020659 3300006353 Bacteria 3602
211 Ga0068871_100363378 3300006358 Bacteria 1282
212 Ga0075428_100171201 3300006844 Bacteria 2353
213 Ga0075428_100277708 3300006844 Bacteria 1802
214 Ga0075430_100083282 3300006846 Bacteria 2680
215 Ga0075431_100169347 3300006847 Bacteria 2245
216 Ga0068865_100066760 3300006881 Bacteria 2539
217 Ga0099825_1033686 3300006941 Bacteria 1966
218 Ga0099824_1004774 3300006942 Bacteria 19390
219 Ga0099822_1001842 3300006943 Bacteria 25496
220 Ga0099795_10088120 3300007788 Bacteria 1199
221 Ga0105240_10005091 3300009093 Bacteria 19694
222 Ga0105240_10041630 3300009093 Bacteria 5861
223 Ga0105240_10098304 3300009093 Bacteria 3565
224 Ga0105240_10641619 3300009093 Bacteria 1165
225 Ga0105245_10069555 3300009098 Bacteria 3192
226 Ga0105245_10119829 3300009098 Bacteria 2457
227 Ga0105247_10018856 3300009101 Bacteria 4142
228 Ga0114129_10866194 3300009147 Bacteria 1147
229 Ga0105243_10098298 3300009148 Bacteria 2424
230 Ga0105241_10034947 3300009174 Bacteria 3779
231 Ga0105241_10082432 3300009174 Bacteria 2521
232 Ga0105241_10543789 3300009174 Bacteria 1042
233 Ga0105241_10666452 3300009174 Bacteria 946
234 Ga0105242_10269003 3300009176 Bacteria 1543
235 Ga0105248_10227239 3300009177 Bacteria 2101
236 Ga0105248_10356480 3300009177 Bacteria 1647
237 Ga0105237_10003248 3300009545 Bacteria 19434
238 Ga0105237_10214974 3300009545 Bacteria 1922
239 Ga0105237_10238473 3300009545 Bacteria 1820
240 Ga0105237_10314453 3300009545 Bacteria 1569
241 Ga0105237_10369246 3300009545 Bacteria 1440
242 Ga0105237_10370470 3300009545 Bacteria 1437
243 Ga0105237_10571842 3300009545 Bacteria 1137
244 Ga0105238_10016317 3300009551 Bacteria 7517
245 Ga0105238_10036661 3300009551 Bacteria 4986
246 Ga0105238_10230488 3300009551 Bacteria 1829
247 Ga0105249_10369636 3300009553 Bacteria 1457
248 Ga0099796_10015790 3300010159 Bacteria 2215
249 Ga0105239_10057214 3300010375 Bacteria 4277
250 Ga0105239_10323066 3300010375 Bacteria 1740
251 Ga0105239_10335010 3300010375 Bacteria 1707
252 Ga0105239_10359532 3300010375 Bacteria 1644
253 Ga0105239_10374794 3300010375 Bacteria 1609
254 Ga0105246_10082752 3300011119 Bacteria 2292
255 Ga0105246_10375714 3300011119 Bacteria 1173
256 Ga0157373_10066939 3300013100 Bacteria 2540
257 Ga0157370_10102433 3300013104 Bacteria 2681
258 Ga0157370_10388545 3300013104 Bacteria 1285
259 Ga0157370_10430605 3300013104 Bacteria 1213
260 Ga0157370_10633019 3300013104 Bacteria 978
261 Ga0157369_10008681 3300013105 Bacteria 11650
262 Ga0157369_10017985 3300013105 Bacteria 7931
263 Ga0157369_10044826 3300013105 Bacteria 4812
264 Ga0157374_10036354 3300013296 Bacteria 4510
265 Ga0157374_10454849 3300013296 Bacteria 1282
266 Ga0157378_10212703 3300013297 Bacteria 1834
267 Ga0163162_10325077 3300013306 Bacteria 1670
268 Ga0163162_10426113 3300013306 Bacteria 1459
269 Ga0157372_10260539 3300013307 Bacteria 2014
270 Ga0157372_10344185 3300013307 Bacteria 1737
271 Ga0157372_10354872 3300013307 Bacteria 1708
272 Ga0157372_10367736 3300013307 Bacteria 1676
273 Ga0157372_10499081 3300013307 Bacteria 1419
274 Ga0157375_10071721 3300013308 Bacteria 3478
275 Ga0157375_10124674 3300013308 Bacteria 2689
276 Ga0157375_10406530 3300013308 Bacteria 1528
277 Ga0163163_10611968 3300014325 Bacteria 1153
278 Ga0157380_10526034 3300014326 Bacteria 1155
279 Ga0157379_10104499 3300014968 Bacteria 2542
280 Ga0157379_10126237 3300014968 Bacteria 2302
281 Ga0157379_11022356 3300014968 Bacteria 789
282 Ga0157376_10011916 3300014969 Bacteria 6430
283 Ga0157376_10410937 3300014969 Bacteria 1311
284 Ga0157376_10724233 3300014969 Bacteria 1002
285 Ga0163161_10399211 3300017792 Bacteria 1102
286 Ga0197907_11314946 3300020069 Bacteria 1317
287 Ga0214544_1000508 3300021320 Bacteria 71511
288 Ga0214542_1000365 3300021321 Bacteria 78664
289 Ga0214545_1000211 3300021324 Bacteria 78664
290 Ga0214543_1001183 3300021327 Bacteria 49477
291 Ga0213873_10011081 3300021358 Bacteria 1919
292 Ga0213872_10069664 3300021361 Bacteria 1586
293 Ga0213874_10015237 3300021377 Bacteria 2025
294 Ga0213876_10000691 3300021384 Bacteria 23782
295 Ga0213875_10000007 3300021388 Bacteria 562717
296 Ga0224712_10034960 3300022467 Bacteria 1852
297 Ga0209677_100698 3300025253 Bacteria 17141
298 Ga0209677_103323 3300025253 Bacteria 5301
299 Ga0209148_1000372 3300025254 Bacteria 54982
300 Ga0209233_1002279 3300025261 Bacteria 7148
301 Ga0209233_1004360 3300025261 Bacteria 4826
302 Ga0209233_1008000 3300025261 Bacteria 3304
303 Ga0209233_1008576 3300025261 Bacteria 3151
304 Ga0209455_1004512 3300025272 Bacteria 4528
305 Ga0209564_1005852 3300025295 Bacteria 6838
306 Ga0209564_1008399 3300025295 Bacteria 5099
307 Ga0209564_1019612 3300025295 Bacteria 2518
308 Ga0209564_1035276 3300025295 Bacteria 1451
309 Ga0209758_1000021 3300025297 Bacteria 697691
310 Ga0209758_1001014 3300025297 Bacteria 37166
311 Ga0209758_1001422 3300025297 Bacteria 28330
312 Ga0209758_1002016 3300025297 Bacteria 21858
313 Ga0209758_1004009 3300025297 Bacteria 12732
314 Ga0209758_1012938 3300025297 Bacteria 4609
315 Ga0209758_1018304 3300025297 Bacteria 3442
316 Ga0209758_1037457 3300025297 Bacteria 1874
317 Ga0209256_1001447 3300025299 Bacteria 24507
318 Ga0209256_1025700 3300025299 Bacteria 1710
319 Ga0207426_1000229 3300025302 Bacteria 128596
320 Ga0207426_1001382 3300025302 Bacteria 20547
321 Ga0207426_1006133 3300025302 Bacteria 5293
322 Ga0207426_1041902 3300025302 Bacteria 1416
323 Ga0209257_1001279 3300025304 Bacteria 30788
324 Ga0207692_10001184 3300025898 Bacteria 9666
325 Ga0207692_10008480 3300025898 Bacteria 4252
326 Ga0207642_10207765 3300025899 Bacteria 1086
327 Ga0207710_10016522 3300025900 Bacteria 3123
328 Ga0207688_10121644 3300025901 Bacteria 1524
329 Ga0207647_10003251 3300025904 Bacteria 12198
330 Ga0207647_10007587 3300025904 Bacteria 7819
331 Ga0207685_10042424 3300025905 Bacteria 1708
332 Ga0207685_10049735 3300025905 Bacteria 1612
333 Ga0207699_10004578 3300025906 Bacteria 6608
334 Ga0207699_10026734 3300025906 Bacteria 3185
335 Ga0207645_10422101 3300025907 Bacteria 899
336 Ga0207643_10128219 3300025908 Bacteria 1507
337 Ga0207705_10031591 3300025909 Bacteria 3781
338 Ga0207705_10074220 3300025909 Bacteria 2469
339 Ga0207654_10040486 3300025911 Bacteria 2626
340 Ga0207654_10179272 3300025911 Bacteria 1381
341 Ga0207654_10422380 3300025911 Bacteria 930
342 Ga0207707_10000542 3300025912 Bacteria 38408
343 Ga0207707_10044879 3300025912 Bacteria 3852
344 Ga0207707_10055246 3300025912 Bacteria 3454
345 Ga0207707_10069675 3300025912 Bacteria 3065
346 Ga0207695_10000015 3300025913 Bacteria 803205
347 Ga0207695_10016962 3300025913 Bacteria 8498
348 Ga0207695_10250860 3300025913 Bacteria 1669
349 Ga0207671_10001686 3300025914 Bacteria 25022
350 Ga0207671_10045398 3300025914 Bacteria 3250
351 Ga0207671_10049902 3300025914 Bacteria 3099
352 Ga0207671_10144655 3300025914 Bacteria 1834
353 Ga0207671_10199253 3300025914 Bacteria 1563
354 Ga0207671_10230629 3300025914 Bacteria 1452
355 Ga0207693_10019439 3300025915 Bacteria 5402
356 Ga0207693_10020846 3300025915 Bacteria 5211
357 Ga0207693_10025787 3300025915 Bacteria 4658
358 Ga0207693_10216415 3300025915 Bacteria 1505
359 Ga0207693_10366656 3300025915 Bacteria 1127
360 Ga0207693_10372682 3300025915 Bacteria 1117
361 Ga0207663_10000743 3300025916 Bacteria 14534
362 Ga0207663_10022593 3300025916 Bacteria 3598
363 Ga0207663_10054348 3300025916 Bacteria 2507
364 Ga0207663_10082825 3300025916 Bacteria 2106
365 Ga0207663_10370328 3300025916 Bacteria 1089
366 Ga0207663_10383965 3300025916 Bacteria 1070
367 Ga0207660_10154574 3300025917 Bacteria 1765
368 Ga0207660_10409907 3300025917 Bacteria 1092
369 Ga0207657_10006256 3300025919 Bacteria 12380
370 Ga0207657_10161573 3300025919 Bacteria 1819
371 Ga0207657_10194332 3300025919 Bacteria 1635
372 Ga0207657_10342906 3300025919 Bacteria 1179
373 Ga0207649_10107123 3300025920 Bacteria 1861
374 Ga0207649_10215858 3300025920 Bacteria 1364
375 Ga0207652_10004715 3300025921 Bacteria 11056
376 Ga0207652_10027091 3300025921 Bacteria 4775
377 Ga0207652_10200912 3300025921 Bacteria 1794
378 Ga0207652_10257196 3300025921 Bacteria 1575
379 Ga0207652_10323061 3300025921 Bacteria 1393
380 Ga0207694_10156445 3300025924 Bacteria 1839
381 Ga0207694_10190923 3300025924 Bacteria 1664
382 Ga0207694_10281121 3300025924 Bacteria 1367
383 Ga0207700_10021828 3300025928 Bacteria 4380
384 Ga0207700_10042066 3300025928 Bacteria 3347
385 Ga0207700_10052102 3300025928 Bacteria 3058
386 Ga0207700_10054384 3300025928 Bacteria 3004
387 Ga0207700_10117624 3300025928 Bacteria 2150
388 Ga0207700_10132212 3300025928 Bacteria 2039
389 Ga0207700_10506981 3300025928 Bacteria 1068
390 Ga0207700_10508051 3300025928 Bacteria 1067
391 Ga0207664_10017290 3300025929 Bacteria 5283
392 Ga0207664_10030551 3300025929 Bacteria 4115
393 Ga0207664_10034194 3300025929 Bacteria 3913
394 Ga0207664_10058755 3300025929 Bacteria 3060
395 Ga0207664_10190703 3300025929 Bacteria 1764
396 Ga0207664_10419397 3300025929 Bacteria 1192
397 Ga0207706_10127345 3300025933 Bacteria 2239
398 Ga0207665_10002246 3300025939 Bacteria 13042
399 Ga0207665_10050311 3300025939 Bacteria 2802
400 Ga0207691_10234993 3300025940 Bacteria 1586
401 Ga0207711_10025416 3300025941 Bacteria 4969
402 Ga0207711_10078698 3300025941 Bacteria 2876
403 Ga0207711_10778332 3300025941 Bacteria 891
404 Ga0207689_10090689 3300025942 Bacteria 2511
405 Ga0207689_10239339 3300025942 Bacteria 1500
406 Ga0207661_10040524 3300025944 Bacteria 3661
407 Ga0207661_10480208 3300025944 Bacteria 1134
408 Ga0207679_10245126 3300025945 Bacteria 1520
409 Ga0207667_10013962 3300025949 Bacteria 9174
410 Ga0207667_10164839 3300025949 Bacteria 2278
411 Ga0207667_10211168 3300025949 Bacteria 1989
412 Ga0207667_10689967 3300025949 Bacteria 1024
413 Ga0207712_10100821 3300025961 Bacteria 2146
414 Ga0207668_10105748 3300025972 Bacteria 2101
415 Ga0207668_10205216 3300025972 Bacteria 1572
416 Ga0207640_10109328 3300025981 Bacteria 1956
417 Ga0207640_10130436 3300025981 Bacteria 1816
418 Ga0207640_10203984 3300025981 Bacteria 1501
419 Ga0207658_10089179 3300025986 Bacteria 2387
420 Ga0207703_10040144 3300026035 Bacteria 3744
421 Ga0207703_10234020 3300026035 Bacteria 1648
422 Ga0207639_10196994 3300026041 Bacteria 1725
423 Ga0207678_10027583 3300026067 Bacteria 4955
424 Ga0207678_10028548 3300026067 Bacteria 4870
425 Ga0207678_10029406 3300026067 Bacteria 4795
426 Ga0207678_10056344 3300026067 Bacteria 3383
427 Ga0207678_10174693 3300026067 Bacteria 1834
428 Ga0207708_10076715 3300026075 Bacteria 2564
429 Ga0207708_10345253 3300026075 Bacteria 1220
430 Ga0207702_10003081 3300026078 Bacteria 15478
431 Ga0207702_10036786 3300026078 Bacteria 4095
432 Ga0207702_10340520 3300026078 Bacteria 1433
433 Ga0207641_10172250 3300026088 Bacteria 1977
434 Ga0207641_10429054 3300026088 Bacteria 1274
435 Ga0207648_10210859 3300026089 Bacteria 1724
436 Ga0207674_10034941 3300026116 Bacteria 5250
437 Ga0207674_10170778 3300026116 Bacteria 2128
438 Ga0207674_10213186 3300026116 Bacteria 1880
439 Ga0207675_100070518 3300026118 Bacteria 3266
440 Ga0207683_10087032 3300026121 Bacteria 2778
441 Ga0207683_10332279 3300026121 Bacteria 1393
442 Ga0207698_10033737 3300026142 Bacteria 3723
443 Ga0207698_10058032 3300026142 Bacteria 2997
444 Ga0207698_10144517 3300026142 Bacteria 2055
445 Ga0209389_1000041 3300027296 Bacteria 123983
446 Ga0209389_1000177 3300027296 Bacteria 49952
447 Ga0209589_1000003 3300027357 Bacteria 629130
448 Ga0209589_1000072 3300027357 Bacteria 98789
449 Ga0209489_100003 3300027361 Bacteria 663105
450 Ga0209489_100031 3300027361 Bacteria 184074
451 Ga0209700_100003 3300027363 Bacteria 663105
452 Ga0209700_100010 3300027363 Bacteria 395269
453 Ga0209179_1001806 3300027512 Bacteria 2731
454 Ga0209179_1030993 3300027512 Bacteria 1095
455 Ga0209588_1016853 3300027671 Bacteria 2260
456 Ga0268266_10002176 3300028379 Bacteria 21461
457 Ga0268266_10020579 3300028379 Bacteria 5621
458 Ga0268266_10033715 3300028379 Bacteria 4352
459 Ga0268266_10241882 3300028379 Bacteria 1666
460 Ga0268266_10286276 3300028379 Bacteria 1533
461 Ga0268265_10127289 3300028380 Bacteria 2110
462 Ga0268264_10000162 3300028381 Bacteria 148472
463 Ga0268264_10303835 3300028381 Bacteria 1503
464 Ga0265323_10002662 3300028653 Bacteria 8063
465 Ga0265336_10000852 3300028666 Bacteria 15879
466 Ga0307517_10000419 3300028786 Bacteria 72682
467 Ga0307517_10259351 3300028786 Bacteria 1011
468 Ga0265338_10045157 3300028800 Bacteria 4055
469 Ga0265340_10066870 3300031247 Bacteria 1709
470 Ga0307513_10103307 3300031456 Bacteria 2867
471 Ga0307513_10245603 3300031456 Bacteria 1591
472 Ga0307509_10249461 3300031507 Bacteria 1560
473 Ga0307508_10244124 3300031616 Bacteria 1393
474 Ga0265314_10003550 3300031711 Bacteria 15057
475 Ga0307516_10008049 3300031730 Bacteria 11984
476 Ga0307516_10327093 3300031730 Bacteria 1203
477 Ga0307410_10293668 3300031852 Bacteria 1280
478 Ga0307410_10310420 3300031852 Bacteria 1248
479 Ga0307406_10057670 3300031901 Bacteria 2492
480 Ga0307409_100167133 3300031995 Bacteria 1932
481 Ga0307409_100651119 3300031995 Bacteria 1047
482 Ga0307411_10100612 3300032005 Bacteria 2043
483 Ga0307507_10014311 3300033179 Bacteria 9481
484 Ga0307510_10016740 3300033180 Bacteria 8651
485 Ga0307510_10025604 3300033180 Bacteria 6800
486 Ga0307510_10033199 3300033180 Bacteria 5800
487 Ga0307510_10112169 3300033180 Bacteria 2465
488 Ga0373926_0023829 3300035083 Bacteria 2128
489 Ga0373928_0006084 3300035084 Bacteria 2315
490 Ga0373934_0031937 3300035086 Bacteria 2064
491 Ga0373923_0003846 3300035111 Bacteria 4887
492 Ga0373936_0002352 3300035113 Bacteria 7077
493 Ga0373936_0127476 3300035113 Bacteria 1091
494 Ga0373939_0046801 3300035114 Bacteria 1326
495 Ga0373941_0006333 3300035115 Bacteria 2846
496 Ga0373945_0013610 3300035116 Bacteria 2718
497 Ga0373953_0011610 3300035117 Bacteria 3097
498 Ga0373953_0064738 3300035117 Bacteria 1500
499 Ga0373954_0009272 3300035118 Bacteria 4330
500 Ga0373954_0083438 3300035118 Bacteria 1529
501 Ga0373956_0039768 3300035119 Bacteria 2085
502 Ga0373956_0067322 3300035119 Bacteria 1630
503 Ga0373946_0252510 3300035171 Bacteria 861
504 Ga0373955_0043303 3300035172 Bacteria 2421
505 Ga0373942_0096343 3300035207 Bacteria 899
506 Ga0373924_0052083 3300035410 Bacteria 1698
507 Ga0373931_0011783 3300035691 Bacteria 4227
508 Ga0373931_0284787 3300035691 Bacteria 1016
509 Ga0373935_0000164 3300035692 Bacteria 30791
510 Ga0373935_0064822 3300035692 Bacteria 2343
511 Ga0373935_0118799 3300035692 Bacteria 1763
512 Ga0373935_0175039 3300035692 Bacteria 1470
513 Ga0373935_0279372 3300035692 Bacteria 1175
514 Ga0373935_0452322 3300035692 Bacteria 928
515 Ga0373927_0000977 3300035695 Bacteria 21745
516 Ga0373927_0031976 3300035695 Bacteria 3427
517 Ga0373927_0063185 3300035695 Bacteria 2394
518 Ga0373927_0173132 3300035695 Bacteria 1415
519 Ga0373933_0000686 3300035724 Bacteria 20889
520 Ga0373933_0031003 3300035724 Bacteria 3099
521 Ga0373933_0066047 3300035724 Bacteria 2191
522 Ga0373947_0003339 3300035725 Bacteria 9502
523 Ga0373947_0006259 3300035725 Bacteria 6919
524 Ga0373937_0018073 3300036401 Bacteria 6289
525 Ga0373937_0125556 3300036401 Bacteria 2393
526 Ga0310112_016313 3300036458 Bacteria 1055
527 Ga0372808_014125 3300036459 Bacteria 1138
528 Ga0310109_016196 3300036534 Bacteria 1010
529 Ga0373925_0092678 3300037068 Bacteria 2311
530 Ga0373925_0165182 3300037068 Bacteria 1745
531 Ga0373925_0192286 3300037068 Bacteria 1619
532 Ga0395899_0019671 3300037312 Bacteria 5126
533 Ga0395899_0020079 3300037312 Bacteria 5069
534 Ga0395900_0000917 3300037418 Bacteria 38740
535 Ga0395898_0018861 3300037466 Bacteria 7029
536 Ga0395898_0086189 3300037466 Bacteria 3027
537 Ga0395898_0332905 3300037466 Bacteria 1448
538 Ga0395898_0363657 3300037466 Bacteria 1380
539 Ga0395905_0015528 3300037471 Bacteria 7237
540 Ga0395905_0139633 3300037471 Bacteria 2280
541 Ga0395905_0589380 3300037471 Bacteria 1013
542 Ga0395905_0592593 3300037471 Bacteria 1010
543 Ga0436364_0108567 3300037853 Bacteria 1708
544 Ga0436364_0120722 3300037853 Bacteria 21173
545 Ga0436364_0462513 3300037853 Bacteria 906
546 Ga0436364_1124077 3300037853 Bacteria 4443
547 Ga0436364_1513198 3300037853 Bacteria 3265
548 Ga0395901_0010786 3300038443 Bacteria 9261
549 Ga0395901_0151265 3300038443 Bacteria 2439
550 Ga0395901_0199004 3300038443 Bacteria 2100
551 Ga0395901_0267252 3300038443 Bacteria 1779
552 Ga0436365_0169079 3300039437 Bacteria 2056
553 Ga0436365_0847601 3300039437 Bacteria 4655
554 Ga0436365_1698108 3300039437 Bacteria 3471
555 Ga0436365_1855737 3300039437 Bacteria 2258
556 Ga0436360_1064741 3300039438 Bacteria 952
557 Ga0436361_0810566 3300039447 Bacteria 2642
558 Ga0436363_0891931 3300039450 Bacteria 1055
559 Ga0436363_1148126 3300039450 Bacteria 1911
560 Ga0436363_1284550 3300039450 Bacteria 846
561 Ga0436363_1567676 3300039450 Bacteria 6306
562 Ga0436362_0209602 3300039453 Bacteria 2146
563 Ga0436362_1238172 3300039453 Bacteria 1076
564 Ga0439465_0065966 3300041413 Bacteria 1206
565 Ga0466969_0153801 3300044656 Bacteria 1059
566 Ga0466972_0000532 3300044658 Bacteria 18735
567 Ga0466972_0113042 3300044658 Bacteria 1282
568 Ga0466966_0000615 3300044684 Bacteria 22621
569 Ga0466961_0000007 3300044693 Bacteria 146374
570 Ga0466963_0081869 3300044694 Bacteria 2187
571 Ga0466968_0298917 3300044735 Bacteria 774
572 Ga0466970_0118892 3300044765 Bacteria 1447
573 Ga0466957_0100383 3300044842 Bacteria 1824
574 Ga0466960_0004498 3300044901 Bacteria 5459
575 Ga0466960_0191535 3300044901 Bacteria 1113
576 Ga0466967_0056365 3300045976 Bacteria 3464
577 Ga0466967_0159550 3300045976 Bacteria 2115
578 Ga0466967_0566753 3300045976 Bacteria 1119
579 Ga0495617_004700 3300046452 Bacteria 4938
580 Ga0495627_055398 3300046453 Bacteria 1184
581 Ga0495592_0013585 3300046454 Bacteria 6195
582 Ga0495592_0033422 3300046454 Bacteria 3879
583 Ga0495592_0168698 3300046454 Bacteria 1500
584 Ga0495603_0005902 3300046455 Bacteria 7319
585 Ga0495603_0034275 3300046455 Bacteria 3052
586 Ga0495603_0044412 3300046455 Bacteria 2652
587 Ga0495603_0060537 3300046455 Bacteria 2237
588 Ga0495603_0061209 3300046455 Bacteria 2223
589 Ga0495603_0185812 3300046455 Bacteria 1202
590 Ga0495603_0201246 3300046455 Bacteria 1151
591 Ga0495629_0000087 3300046459 Bacteria 81337
592 Ga0495629_0020296 3300046459 Bacteria 4744
593 Ga0495629_0028710 3300046459 Bacteria 3949
594 Ga0495629_0112904 3300046459 Bacteria 1894
595 Ga0495629_0229070 3300046459 Bacteria 1281
596 Ga0495629_0476057 3300046459 Bacteria 844
597 Ga0495638_0025097 3300046460 Bacteria 3877
598 Ga0495638_0048710 3300046460 Bacteria 2651
599 Ga0495638_0181733 3300046460 Bacteria 1199
600 Ga0495641_0056274 3300046461 Bacteria 1783
601 Ga0495641_0209349 3300046461 Bacteria 874
602 Ga0495651_0006121 3300046462 Bacteria 9188
603 Ga0495651_0058185 3300046462 Bacteria 2966
604 Ga0495651_0187273 3300046462 Bacteria 1459
605 Ga0495651_0344547 3300046462 Bacteria 986
606 Ga0495650_0050059 3300046471 Bacteria 1730
607 Ga0495650_0113136 3300046471 Bacteria 1006
608 Ga0495580_0155451 3300046472 Bacteria 1584
609 Ga0495582_0000818 3300046473 Bacteria 17225
610 Ga0495582_0017171 3300046473 Bacteria 3961
611 Ga0495582_0023689 3300046473 Bacteria 3357
612 Ga0495582_0167152 3300046473 Bacteria 1252
613 Ga0495605_0046987 3300046474 Bacteria 2119
614 Ga0495605_0103455 3300046474 Bacteria 1306
615 Ga0495639_0000022 3300046475 Bacteria 72037
616 Ga0495639_0021590 3300046475 Bacteria 2819
617 Ga0495662_0000161 3300046476 Bacteria 26325
618 Ga0495664_0008978 3300046477 Bacteria 5586
619 Ga0495664_0010436 3300046477 Bacteria 5212
620 Ga0495664_0025321 3300046477 Bacteria 3454
621 Ga0495664_0300687 3300046477 Bacteria 969
622 Ga0495585_0204695 3300046492 Bacteria 1003
623 Ga0495594_0000275 3300046499 Bacteria 25366
624 Ga0495607_0076704 3300046501 Bacteria 1848
625 Ga0495607_0081498 3300046501 Bacteria 1777
626 Ga0495583_0031803 3300046506 Bacteria 2554
627 Ga0495583_0095735 3300046506 Bacteria 1273
628 Ga0495606_0002311 3300046507 Bacteria 22456
629 Ga0495608_0010519 3300046511 Bacteria 6456
630 Ga0495608_0118648 3300046511 Bacteria 1697
631 Ga0495616_0096958 3300046513 Bacteria 1388
632 Ga0495618_0346680 3300046514 Unclassified 916
633 Ga0495620_0043676 3300046515 Bacteria 1951
634 Ga0495628_0001747 3300046516 Bacteria 19762
635 Ga0495628_0017546 3300046516 Bacteria 5954
636 Ga0495628_0032115 3300046516 Bacteria 4241
637 Ga0495628_0155477 3300046516 Bacteria 1740
638 Ga0495628_0335630 3300046516 Bacteria 1113
639 Ga0495630_0003318 3300046517 Bacteria 11208
640 Ga0495630_0069212 3300046517 Bacteria 2654
641 Ga0495637_0151663 3300046520 Bacteria 874
642 Ga0495643_0038350 3300046522 Bacteria 2624
643 Ga0495644_0018106 3300046523 Bacteria 2690
644 Ga0495648_0001225 3300046524 Bacteria 25650
645 Ga0495648_0003338 3300046524 Bacteria 14157
646 Ga0495648_0097817 3300046524 Bacteria 1627
647 Ga0495663_0121971 3300046525 Bacteria 873
648 Ga0495642_0140679 3300046528 Bacteria 1042
649 Ga0495652_0032273 3300046529 Bacteria 4581
650 Ga0495652_0090656 3300046529 Bacteria 2501
651 Ga0495652_0471319 3300046529 Bacteria 875
652 Ga0495654_0013914 3300046530 Bacteria 4294
653 Ga0495665_0000105 3300046531 Bacteria 39366
654 Ga0495665_0037812 3300046531 Bacteria 2575
655 Ga0495640_0022475 3300046533 Bacteria 4608
656 Ga0495640_0044182 3300046533 Bacteria 3099
657 Ga0495640_0189730 3300046533 Bacteria 1307
658 Ga0495586_0032919 3300046535 Bacteria 2781
659 Ga0495587_0028494 3300046536 Bacteria 3396
660 Ga0495587_0130240 3300046536 Bacteria 1438
661 Ga0495587_0212808 3300046536 Bacteria 1091
662 Ga0495645_0004709 3300046543 Bacteria 9318
663 Ga0495645_0007422 3300046543 Bacteria 7629
664 Ga0495645_0009152 3300046543 Bacteria 6921
665 Ga0495645_0039319 3300046543 Bacteria 3450
666 Ga0495622_0021392 3300046557 Bacteria 3011
667 Ga0495622_0029620 3300046557 Bacteria 2558
668 Ga0495622_0036742 3300046557 Bacteria 2283
669 Ga0495622_0075623 3300046557 Bacteria 1552
670 Ga0495622_0131755 3300046557 Bacteria 1138
671 Ga0495622_0175124 3300046557 Bacteria 963
672 Ga0495633_0041642 3300046558 Bacteria 2183
673 Ga0495633_0086773 3300046558 Bacteria 1455
674 Ga0495633_0139772 3300046558 Bacteria 1120
675 Ga0495667_0008571 3300046559 Bacteria 6939
676 Ga0495656_0039223 3300046615 Bacteria 1966
677 Ga0495656_0042288 3300046615 Bacteria 1907
678 Ga0495656_0069335 3300046615 Bacteria 1562
679 Ga0495634_0032749 3300046642 Bacteria 3573
680 Ga0495634_0070435 3300046642 Bacteria 2305
681 Ga0495634_0139749 3300046642 Bacteria 1538
682 Ga0495634_0279136 3300046642 Bacteria 1015
683 Ga0495611_0081812 3300046648 Bacteria 1486
684 Ga0495611_0201000 3300046648 Bacteria 929
685 Ga0495635_0000359 3300046663 Bacteria 28977
686 Ga0495635_0008606 3300046663 Bacteria 7124
687 Ga0495635_0018462 3300046663 Bacteria 4867
688 Ga0495635_0024280 3300046663 Bacteria 4226
689 Ga0495635_0054715 3300046663 Bacteria 2748
690 Ga0495659_0118649 3300046664 Bacteria 1039
691 Ga0495588_0067236 3300046674 Bacteria 1860
692 Ga0495588_0111581 3300046674 Bacteria 1440
693 Ga0495657_0022842 3300046675 Bacteria 4475
694 Ga0495657_0033017 3300046675 Bacteria 3607
695 Ga0495599_0022485 3300046678 Bacteria 3937
696 Ga0495599_0074439 3300046678 Bacteria 2120
697 Ga0495599_0078082 3300046678 Bacteria 2067
698 Ga0495623_0039468 3300046679 Bacteria 3017
699 Ga0495646_0030813 3300046680 Bacteria 3347
700 Ga0495647_0002828 3300046681 Bacteria 5511
701 Ga0495647_0009627 3300046681 Bacteria 3279
702 Ga0495647_0035007 3300046681 Bacteria 1884
703 Ga0495658_0002969 3300046683 Bacteria 8503
704 Ga0495658_0045638 3300046683 Bacteria 2460
705 Ga0495658_0378929 3300046683 Bacteria 901
706 Ga0495658_0468509 3300046683 Bacteria 805
707 Ga0495669_0117580 3300046684 Bacteria 1245
708 Ga0495613_0024571 3300046689 Bacteria 4489
709 Ga0495613_0027201 3300046689 Bacteria 4256
710 Ga0495613_0122217 3300046689 Bacteria 1869
711 Ga0495624_0001105 3300046690 Bacteria 21345
712 Ga0495624_0056555 3300046690 Bacteria 2468
713 Ga0495624_0168393 3300046690 Bacteria 1337
714 Ga0495624_0281662 3300046690 Bacteria 1004
715 Ga0495624_0349439 3300046690 Bacteria 889
716 Ga0495670_0005738 3300046691 Bacteria 6087
717 Ga0495670_0206820 3300046691 Bacteria 1040
718 Ga0495671_0269545 3300046692 Bacteria 821
719 Ga0495649_0084615 3300046694 Bacteria 1693
720 Ga0495600_0004522 3300046809 Bacteria 8332
721 Ga0495600_0041130 3300046809 Bacteria 3012
722 Ga0495600_0313018 3300046809 Bacteria 988
723 Ga0495600_0384587 3300046809 Bacteria 875
724 Ga0495581_0000889 3300047315 Bacteria 16000
725 Ga0495581_0017695 3300047315 Bacteria 4141
726 Ga0495604_0000837 3300047317 Bacteria 25702
727 Ga0495604_0004042 3300047317 Bacteria 11657
728 Ga0495604_0015252 3300047317 Bacteria 6134
729 Ga0495604_0023476 3300047317 Bacteria 4920
730 Ga0495604_0345809 3300047317 Bacteria 989
731 Ga0495674_0010563 3300047319 Bacteria 8740
732 Ga0495674_0016464 3300047319 Bacteria 6896
733 Ga0495674_0057715 3300047319 Bacteria 3397
734 Ga0495674_0081432 3300047319 Bacteria 2777
735 Ga0495674_0122521 3300047319 Bacteria 2196
736 Ga0495672_0019081 3300047320 Bacteria 4534
737 Ga0495672_0048346 3300047320 Bacteria 2522
738 Ga0495676_0033591 3300047321 Bacteria 4318
739 Ga0495676_0060406 3300047321 Bacteria 2971
740 Ga0495676_0343591 3300047321 Bacteria 999
741 Ga0495680_0003829 3300047322 Bacteria 14610
742 Ga0495680_0095290 3300047322 Bacteria 2225
743 Ga0495683_0033407 3300047323 Bacteria 2618
744 Ga0495683_0142501 3300047323 Bacteria 1122
745 Ga0495687_031352 3300047443 Bacteria 2439
746 Ga0495687_032692 3300047443 Bacteria 2371
747 Ga0495675_0050477 3300047444 Bacteria 2644
748 Ga0495675_0315405 3300047444 Bacteria 926
749 Ga0495677_0090585 3300047445 Bacteria 1152
750 Ga0495673_0024739 3300047469 Bacteria 2894
751 Ga0495673_0053769 3300047469 Bacteria 1754
752 Ga0495673_0075219 3300047469 Bacteria 1411
753 Ga0495673_0089278 3300047469 Bacteria 1262
754 Ga0495684_0011995 3300047471 Bacteria 6682
755 Ga0495684_0079064 3300047471 Bacteria 2496
756 Ga0495684_0345170 3300047471 Bacteria 1058
757 Ga0495686_0060912 3300047472 Bacteria 2345
758 Ga0495686_0106475 3300047472 Bacteria 1686
759 Ga0495686_0164213 3300047472 Bacteria 1295
760 Ga0495686_0363171 3300047472 Bacteria 784
761 Ga0495593_0000213 3300047673 Bacteria 30598
762 Ga0495593_0048739 3300047673 Bacteria 2251
763 Ga0495593_0050152 3300047673 Bacteria 2212
764 Ga0495593_0058879 3300047673 Bacteria 2014
765 Ga0495602_0018479 3300048088 Bacteria 6960
766 Ga0495602_0421335 3300048088 Bacteria 948
767 Ga0495614_0044651 3300048089 Bacteria 1901
768 Ga0495615_0060520 3300048090 Bacteria 998
769 Ga0496100_0082160 3300048903 Bacteria 2178
770 Ga0496100_0351202 3300048903 Bacteria 1114
771 Ga0496100_0385911 3300048903 Bacteria 1064
772 Ga0496101_0007272 3300048904 Bacteria 7166
773 Ga0496101_0114579 3300048904 Bacteria 2033
774 Ga0496101_0143517 3300048904 Bacteria 1822
775 Ga0496102_0023382 3300048905 Bacteria 5488
776 Ga0496102_0119831 3300048905 Bacteria 2457
777 Ga0496102_0128475 3300048905 Bacteria 2370
778 Ga0496103_0011197 3300048906 Bacteria 5312
779 Ga0496103_0095313 3300048906 Bacteria 1880
780 Ga0496104_0000090 3300048907 Bacteria 87877
781 Ga0496104_0382235 3300048907 Bacteria 1321
782 Ga0496104_0472605 3300048907 Bacteria 1165
783 Ga0496105_0001807 3300048908 Bacteria 15303
784 Ga0496105_0008671 3300048908 Bacteria 7908
785 Ga0496105_0094063 3300048908 Bacteria 2475
786 Ga0496105_0134697 3300048908 Bacteria 2035
787 Ga0496105_0141805 3300048908 Bacteria 1978
788 Ga0496106_0080266 3300048909 Bacteria 2505
789 Ga0496106_0263772 3300048909 Bacteria 1379
790 Ga0496107_0076355 3300048910 Bacteria 2440
791 Ga0496107_0235158 3300048910 Bacteria 1363
792 Ga0496107_0238285 3300048910 Bacteria 1354
793 Ga0496107_0249609 3300048910 Bacteria 1320
794 Ga0496108_0094194 3300048911 Bacteria 2549
795 Ga0496108_0601391 3300048911 Bacteria 958
796 Ga0496109_0035526 3300048912 Bacteria 4497
797 Ga0496109_0424191 3300048912 Bacteria 1256
798 Ga0496109_0532331 3300048912 Bacteria 1109
799 Ga0496110_0038593 3300048913 Bacteria 4156
800 Ga0496110_0062301 3300048913 Bacteria 3294
801 Ga0496110_0683898 3300048913 Bacteria 927
802 Ga0496111_0042237 3300048914 Bacteria 3273
803 Ga0496111_0261468 3300048914 Bacteria 1284
804 Ga0496111_0374064 3300048914 Bacteria 1054
805 Ga0496111_0451870 3300048914 Bacteria 948
806 Ga0496112_0169300 3300048915 Bacteria 2150
807 Ga0496112_0201862 3300048915 Bacteria 1947
808 Ga0496112_0798834 3300048915 Bacteria 868
809 Ga0496113_0138153 3300048916 Bacteria 1916
810 Ga0496113_0253750 3300048916 Bacteria 1404
811 Ga0496113_0259287 3300048916 Bacteria 1389
812 Ga0496113_0309062 3300048916 Bacteria 1266
813 Ga0496114_0158685 3300048917 Bacteria 1965
814 Ga0496114_0186087 3300048917 Bacteria 1815
815 Ga0496114_0192471 3300048917 Bacteria 1785
816 Ga0496114_0222306 3300048917 Bacteria 1658
817 Ga0496114_0253237 3300048917 Bacteria 1549
818 Ga0496114_0269663 3300048917 Bacteria 1500
819 Ga0496114_0278699 3300048917 Bacteria 1474
820 Ga0496115_0034395 3300048918 Bacteria 4005
821 Ga0496115_0036742 3300048918 Bacteria 3879
822 Ga0496115_0047926 3300048918 Bacteria 3418
823 Ga0496115_0049795 3300048918 Bacteria 3354
824 Ga0496115_0117944 3300048918 Bacteria 2183
825 Ga0496115_0211341 3300048918 Bacteria 1602
826 Ga0496115_0228759 3300048918 Bacteria 1534
827 Ga0496115_0568665 3300048918 Bacteria 904
828 Ga0496116_0001513 3300048919 Bacteria 25797
829 Ga0496116_0044890 3300048919 Bacteria 2996
830 Ga0496116_0220623 3300048919 Bacteria 972
831 Ga0496117_0018780 3300048920 Bacteria 5711
832 Ga0496117_0050320 3300048920 Bacteria 2955
833 Ga0496117_0097052 3300048920 Bacteria 1878
834 Ga0496117_0099583 3300048920 Bacteria 1843
835 Ga0496117_0215115 3300048920 Bacteria 1074
836 Ga0496118_0003772 3300048921 Bacteria 18723
837 Ga0496118_0053399 3300048921 Bacteria 3072
838 Ga0496118_0058993 3300048921 Bacteria 2862
839 Ga0496118_0154757 3300048921 Bacteria 1428
840 Ga0496118_0158428 3300048921 Bacteria 1404
841 Ga0496119_0044789 3300048922 Bacteria 2781
842 Ga0496119_0125185 3300048922 Bacteria 1407
843 Ga0496119_0129507 3300048922 Bacteria 1377
844 Ga0496119_0160573 3300048922 Bacteria 1195
845 Ga0496120_0015096 3300048923 Bacteria 5111
846 Ga0496120_0016845 3300048923 Bacteria 4759
847 Ga0496120_0029408 3300048923 Bacteria 3355
848 Ga0496120_0194959 3300048923 Bacteria 985
849 Ga0496121_0000302 3300048924 Bacteria 102347
850 Ga0496121_0001399 3300048924 Bacteria 40824
851 Ga0496121_0001546 3300048924 Bacteria 38502
852 Ga0496121_0014891 3300048924 Bacteria 8200
853 Ga0496121_0027588 3300048924 Bacteria 5311
854 Ga0496121_0040888 3300048924 Bacteria 4061
855 Ga0496121_0082353 3300048924 Bacteria 2544
856 Ga0496121_0092827 3300048924 Bacteria 2352
857 Ga0496121_0098233 3300048924 Bacteria 2266
858 Ga0496121_0167265 3300048924 Bacteria 1601
859 Ga0496121_0188548 3300048924 Bacteria 1481
860 Ga0496121_0221919 3300048924 Bacteria 1330
861 Ga0496121_0245961 3300048924 Bacteria 1243
862 Ga0496122_0017367 3300048925 Bacteria 6733
863 Ga0496122_0105434 3300048925 Bacteria 1869
864 Ga0496122_0122205 3300048925 Bacteria 1676
865 Ga0496123_0024142 3300048926 Bacteria 4629
866 Ga0496123_0031821 3300048926 Bacteria 3830
867 Ga0496123_0171946 3300048926 Bacteria 1142
868 Ga0496124_0005111 3300048927 Bacteria 14940
869 Ga0496124_0102586 3300048927 Bacteria 2315
870 Ga0496125_0000847 3300048928 Bacteria 49025
871 Ga0496125_0001679 3300048928 Bacteria 30955
872 Ga0496125_0007002 3300048928 Bacteria 12067
873 Ga0496125_0012038 3300048928 Bacteria 8612
874 Ga0496125_0067791 3300048928 Bacteria 2810
875 Ga0496125_0232300 3300048928 Bacteria 1178
876 Ga0496125_0249609 3300048928 Bacteria 1121
877 Ga0496126_0004245 3300048929 Bacteria 17249
878 Ga0496126_0006546 3300048929 Bacteria 12970
879 Ga0496126_0006778 3300048929 Bacteria 12706
880 Ga0496126_0039491 3300048929 Bacteria 4378
881 Ga0496126_0041087 3300048929 Bacteria 4283
882 Ga0496126_0081901 3300048929 Bacteria 2852
883 Ga0496126_0142094 3300048929 Bacteria 2065
884 Ga0496126_0148315 3300048929 Bacteria 2012
885 Ga0496126_0168285 3300048929 Bacteria 1869
886 Ga0496126_0171434 3300048929 Bacteria 1848
887 Ga0496126_0180968 3300048929 Bacteria 1790
888 Ga0496126_0199798 3300048929 Bacteria 1689
889 Ga0496126_0227182 3300048929 Bacteria 1565
890 Ga0496126_0344484 3300048929 Bacteria 1220
891 Ga0496126_0411230 3300048929 Bacteria 1095
892 Ga0496126_0532671 3300048929 Bacteria 934
893 Ga0495682_0005454 3300049460 Bacteria 5285
894 Ga0501031_0003006 3300049568 Bacteria 10795
895 Ga0501031_0004506 3300049568 Bacteria 9037
896 Ga0501031_0034955 3300049568 Bacteria 3278
897 Ga0501031_0114201 3300049568 Bacteria 1764
898 Ga0501032_0000316 3300049569 Bacteria 40481
899 Ga0501032_0002923 3300049569 Bacteria 13280
900 Ga0501032_0037038 3300049569 Bacteria 3327
901 Ga0501032_0079106 3300049569 Bacteria 2189
902 Ga0501032_0114965 3300049569 Bacteria 1779
903 Ga0501032_0190779 3300049569 Bacteria 1339
904 Ga0501032_0220773 3300049569 Bacteria 1233
905 Ga0501033_0000025 3300049570 Bacteria 173634
906 Ga0501033_0000155 3300049570 Bacteria 65906
907 Ga0501033_0003921 3300049570 Bacteria 12072
908 Ga0501033_0120706 3300049570 Bacteria 1902
909 Ga0501034_0000177 3300049571 Bacteria 118966
910 Ga0501034_0000852 3300049571 Bacteria 45151
911 Ga0501034_0021638 3300049571 Bacteria 6550
912 Ga0501034_0057729 3300049571 Bacteria 3901
913 Ga0501034_0062059 3300049571 Bacteria 3752
914 Ga0501034_0149442 3300049571 Bacteria 2312
915 Ga0501034_0294457 3300049571 Bacteria 1560
916 Ga0501034_0347707 3300049571 Bacteria 1411
917 Ga0501034_0461010 3300049571 Bacteria 1187
918 Ga0501036_0000167 3300049572 Bacteria 43218
919 Ga0501036_0001075 3300049572 Bacteria 20707
920 Ga0501036_0016597 3300049572 Bacteria 6149
921 Ga0501036_0122137 3300049572 Bacteria 2199
922 Ga0501036_0189749 3300049572 Bacteria 1729
923 Ga0501036_0243932 3300049572 Bacteria 1506
924 Ga0501037_0000034 3300049573 Bacteria 126321
925 Ga0501037_0011935 3300049573 Bacteria 6399
926 Ga0501037_0043333 3300049573 Bacteria 3307
927 Ga0501037_0066838 3300049573 Bacteria 2618
928 Ga0501037_0097923 3300049573 Bacteria 2119
929 Ga0501037_0109198 3300049573 Bacteria 1993
930 Ga0501037_0124516 3300049573 Bacteria 1851
931 Ga0501037_0204089 3300049573 Bacteria 1396
932 Ga0501038_0000029 3300049574 Bacteria 132861
933 Ga0501038_0012457 3300049574 Bacteria 7772
934 Ga0501038_0023339 3300049574 Bacteria 5531
935 Ga0501038_0081654 3300049574 Bacteria 2723
936 Ga0501038_0206044 3300049574 Bacteria 1576
937 Ga0501038_0307885 3300049574 Bacteria 1242
938 Ga0501038_0441727 3300049574 Bacteria 1001
939 Ga0501038_0477700 3300049574 Bacteria 955
940 Ga0501038_0551754 3300049574 Bacteria 876
941 Ga0501039_0001343 3300049575 Bacteria 18000
942 Ga0501039_0194319 3300049575 Bacteria 1595
943 Ga0501039_0212404 3300049575 Bacteria 1521
944 Ga0501039_0215801 3300049575 Bacteria 1508
945 Ga0501039_0305089 3300049575 Bacteria 1252
946 Ga0501040_0053418 3300049576 Bacteria 2767
947 Ga0501040_0167562 3300049576 Bacteria 1555
948 Ga0501041_0166795 3300049577 Bacteria 1377
949 Ga0501042_0010208 3300049578 Bacteria 6284
950 Ga0501043_0000067 3300049579 Bacteria 93232
951 Ga0501043_0002466 3300049579 Bacteria 15653
952 Ga0501043_0014023 3300049579 Bacteria 6272
953 Ga0501043_0028876 3300049579 Bacteria 4353
954 Ga0501043_0035118 3300049579 Bacteria 3943
955 Ga0501043_0048514 3300049579 Bacteria 3338
956 Ga0501043_0170391 3300049579 Bacteria 1698
957 Ga0501046_0000479 3300049580 Bacteria 39962
958 Ga0501046_0016944 3300049580 Bacteria 6096
959 Ga0501046_0051707 3300049580 Bacteria 3241
960 Ga0501046_0055075 3300049580 Bacteria 3127
961 Ga0501046_0056324 3300049580 Bacteria 3087
962 Ga0501046_0106609 3300049580 Bacteria 2144
963 Ga0501047_0000010 3300049581 Bacteria 429357
964 Ga0501047_0000061 3300049581 Bacteria 137341
965 Ga0501047_0025620 3300049581 Bacteria 5670
966 Ga0501047_0075853 3300049581 Bacteria 3235
967 Ga0501047_0082984 3300049581 Bacteria 3080
968 Ga0501047_0205856 3300049581 Bacteria 1827
969 Ga0501047_0225034 3300049581 Bacteria 1731
970 Ga0501047_0331033 3300049581 Bacteria 1361
971 Ga0501048_0000009 3300049582 Bacteria 84404
972 Ga0501048_0000592 3300049582 Bacteria 25706
973 Ga0501048_0081398 3300049582 Bacteria 2284
974 Ga0501048_0355630 3300049582 Bacteria 1045
975 Ga0501067_0000132 3300049583 Bacteria 40720
976 Ga0501067_0007483 3300049583 Bacteria 6066
977 Ga0501068_0005703 3300049584 Bacteria 6822
978 Ga0501068_0075828 3300049584 Bacteria 2057
979 Ga0501068_0184432 3300049584 Bacteria 1320
980 Ga0501069_0044802 3300049585 Bacteria 2449
981 Ga0501069_0053916 3300049585 Bacteria 2239
982 Ga0501069_0066124 3300049585 Bacteria 2022
983 Ga0501069_0087548 3300049585 Bacteria 1760
984 Ga0501070_0000563 3300049586 Bacteria 33758
985 Ga0501070_0006160 3300049586 Bacteria 10226
986 Ga0501070_0051183 3300049586 Bacteria 3429
987 Ga0501070_0056293 3300049586 Bacteria 3260
988 Ga0501070_0061133 3300049586 Bacteria 3121
989 Ga0501070_0074060 3300049586 Bacteria 2818
990 Ga0501070_0309036 3300049586 Bacteria 1287
991 Ga0501070_0317015 3300049586 Bacteria 1269
992 Ga0501071_0131744 3300049587 Bacteria 1858
993 Ga0501072_0004340 3300049588 Bacteria 10765
994 Ga0501072_0030306 3300049588 Bacteria 4230
995 Ga0501073_0000365 3300049589 Bacteria 30467
996 Ga0501073_0013455 3300049589 Bacteria 5950
997 Ga0501074_0000087 3300049590 Bacteria 45234
998 Ga0501074_0005873 3300049590 Bacteria 8852
999 Ga0501074_0012930 3300049590 Bacteria 6068
1000 Ga0501074_0033923 3300049590 Bacteria 3700
1001 Ga0501074_0207947 3300049590 Bacteria 1394
1002 Ga0501075_0134328 3300049591 Bacteria 1885
1003 Ga0501076_0151083 3300049592 Bacteria 1889
1004 Ga0501079_0031799 3300049741 Bacteria 4055
1005 Ga0501079_0046540 3300049741 Bacteria 3347
1006 Ga0501079_0206972 3300049741 Bacteria 1532
1007 Ga0501080_0001547 3300049742 Bacteria 19438
1008 Ga0501080_0024882 3300049742 Bacteria 5552
1009 Ga0501080_0101908 3300049742 Bacteria 2663
1010 Ga0501080_0340849 3300049742 Bacteria 1354
1011 Ga0501080_0773938 3300049742 Bacteria 843
1012 Ga0501081_0187130 3300049743 Bacteria 1499
1013 Ga0501081_0255967 3300049743 Bacteria 1279
1014 Ga0501083_0009601 3300049744 Bacteria 6836
1015 Ga0501083_0014790 3300049744 Bacteria 5458
1016 Ga0501035_0001202 3300049822 Bacteria 26996
1017 Ga0501035_0022530 3300049822 Bacteria 5785
1018 Ga0501035_0040465 3300049822 Bacteria 4212
1019 Ga0501035_0057423 3300049822 Bacteria 3470
1020 Ga0501035_0083442 3300049822 Bacteria 2819
1021 Ga0501035_0086783 3300049822 Bacteria 2757
1022 Ga0501035_0090700 3300049822 Bacteria 2690
1023 Ga0501035_0095216 3300049822 Bacteria 2617
1024 Ga0501035_0174631 3300049822 Bacteria 1854
1025 Ga0501044_0000028 3300049823 Bacteria 179203
1026 Ga0501044_0011508 3300049823 Bacteria 9584
1027 Ga0501044_0018863 3300049823 Bacteria 7385
1028 Ga0501044_0047106 3300049823 Bacteria 4460
1029 Ga0501044_0084203 3300049823 Bacteria 3214
1030 Ga0501044_0095558 3300049823 Bacteria 2994
1031 Ga0501044_0117048 3300049823 Bacteria 2669
1032 Ga0501044_0118316 3300049823 Bacteria 2653
1033 Ga0501044_0343381 3300049823 Bacteria 1413
1034 Ga0501044_0349449 3300049823 Bacteria 1398
1035 Ga0501044_0568254 3300049823 Bacteria 1029
1036 Ga0501045_0012975 3300049824 Bacteria 5872
1037 Ga0501045_0251063 3300049824 Bacteria 1317
1038 nmdc:mga03n38_151_c1 3300050490 Bacteria 15238
1039 nmdc:mga03n38_77168_c1 3300050490 Bacteria 1556
1040 nmdc:mga00v17_190273_c1 3300050491 Bacteria 1325
1041 nmdc:mga00v17_250529_c1 3300050491 Bacteria 1148
1042 nmdc:mga0yw44_145904_c1 3300050492 Bacteria 1541
1043 nmdc:mga0yw44_232647_c1 3300050492 Bacteria 1223
1044 nmdc:mga0yw44_250654_c1 3300050492 Bacteria 1178
1045 nmdc:mga0yw44_42521_c1 3300050492 Bacteria 2710
1046 nmdc:mga0yw44_8194_c1 3300050492 Bacteria 5191
1047 nmdc:mga0k408_252587_c1 3300050493 Bacteria 1053
1048 nmdc:mga0k408_49683_c1 3300050493 Bacteria 2428
1049 nmdc:mga06z11_77970_c1 3300050494 Bacteria 1770
1050 nmdc:mga04h51_12545_c1 3300050495 Bacteria 2381
1051 nmdc:mga04h51_43071_c1 3300050495 Bacteria 1483
1052 nmdc:mga07m45_82734_c1 3300050496 Bacteria 1833
1053 nmdc:mga05p37_440457_c1 3300050507 Bacteria 1511
1054 nmdc:mga09592_509751_c1 3300050508 Bacteria 1035
1055 nmdc:mga0qj67_35476_c1 3300050509 Bacteria 3899
1056 nmdc:mga06r32_150534_c1 3300050510 Bacteria 2305
1057 nmdc:mga0n895_659362_c1 3300050512 Bacteria 1044
1058 nmdc:mga0n895_6973_c1 3300050512 Bacteria 9647
1059 nmdc:mga0n895_80495_c1 3300050512 Bacteria 3246
1060 nmdc:mga0a205_136311_c1 3300050515 Bacteria 2355
1061 nmdc:mga0a205_593874_c1 3300050515 Bacteria 960
1062 nmdc:mga0sz30_32196_c1 3300050516 Bacteria 2174
1063 nmdc:mga0sz30_4914_c1 3300050516 Bacteria 4870
1064 nmdc:mga0sz30_88943_c1 3300050516 Bacteria 1342
1065 Ga0495601_0004009 3300053077 Bacteria 8480
1066 Ga0495601_0141984 3300053077 Bacteria 1567
1067 Ga0495601_0159845 3300053077 Bacteria 1472
1068 Ga0495601_0199574 3300053077 Bacteria 1307
1069 Ga0495612_0004682 3300053078 Bacteria 5668
1070 Ga0495612_0009850 3300053078 Bacteria 3869
1071 Ga0495612_0031780 3300053078 Bacteria 2130
1072 Ga0495595_0076635 3300053084 Bacteria 1587
1073 Ga0495595_0149636 3300053084 Bacteria 1148
1074 Ga0495619_0001464 3300053085 Bacteria 15552
1075 Ga0495619_0051990 3300053085 Bacteria 2708
1076 Ga0495619_0054085 3300053085 Bacteria 2656
1077 Ga0495619_0185507 3300053085 Bacteria 1439
1078 Ga0500578_0083432 3300053086 Bacteria 2031
1079 Ga0500578_0097217 3300053086 Bacteria 1866
1080 Ga0500578_0147009 3300053086 Bacteria 1470
1081 Ga0500581_119900 3300053089 Bacteria 1271
1082 Ga0500646_0004603 3300053090 Bacteria 3488
1083 Ga0500646_0092678 3300053090 Bacteria 937
1084 Ga0500647_0178127 3300053091 Bacteria 977
1085 Ga0500583_0252757 3300053092 Bacteria 870
1086 Ga0500651_0065429 3300053093 Bacteria 2265
1087 Ga0500651_0079935 3300053093 Bacteria 2026
1088 Ga0500651_0165586 3300053093 Bacteria 1320
1089 Ga0500566_0000124 3300053094 Bacteria 40031
1090 Ga0500566_0000667 3300053094 Bacteria 19213
1091 Ga0500566_0001115 3300053094 Bacteria 15554
1092 Ga0500566_0058112 3300053094 Bacteria 2196
1093 Ga0500640_003612 3300053095 Bacteria 5452
1094 Ga0500641_0004297 3300053096 Bacteria 5026
1095 Ga0500641_0004927 3300053096 Bacteria 4731
1096 Ga0500641_0073989 3300053096 Bacteria 1438
1097 Ga0500641_0152540 3300053096 Bacteria 997
1098 Ga0500648_131185 3300053097 Bacteria 1359
1099 Ga0500650_0076908 3300053098 Bacteria 1559
1100 Ga0500554_000874 3300053102 Bacteria 5896
1101 Ga0500555_008678 3300053103 Bacteria 2899
1102 Ga0500555_015843 3300053103 Bacteria 2174
1103 Ga0500556_0000002 3300053104 Bacteria 773626
1104 Ga0500557_000042 3300053105 Bacteria 64422
1105 Ga0500562_015375 3300053108 Bacteria 1962
1106 Ga0500562_052905 3300053108 Bacteria 1087
1107 Ga0500562_092010 3300053108 Bacteria 823
1108 Ga0500572_000207 3300053111 Bacteria 20845
1109 Ga0500572_008732 3300053111 Bacteria 2377
1110 Ga0500572_046339 3300053111 Bacteria 1280
1111 Ga0500592_005237 3300053116 Bacteria 2062
1112 Ga0500594_0031337 3300053118 Bacteria 1402
1113 Ga0500595_000617 3300053119 Bacteria 21264
1114 Ga0500595_002072 3300053119 Bacteria 10245
1115 Ga0500595_011264 3300053119 Bacteria 3509
1116 Ga0500595_028323 3300053119 Bacteria 1910
1117 Ga0500607_038348 3300053121 Bacteria 2607
1118 Ga0500607_048414 3300053121 Bacteria 2273
1119 Ga0500608_004134 3300053122 Bacteria 5566
1120 Ga0500608_047265 3300053122 Bacteria 2067
1121 Ga0500614_002387 3300053123 Bacteria 4198
1122 Ga0500617_162167 3300053124 Bacteria 870
1123 Ga0500618_029100 3300053125 Bacteria 1305
1124 Ga0500642_0000010 3300053130 Bacteria 272552
1125 Ga0500642_0000112 3300053130 Bacteria 37891
1126 Ga0500642_0040984 3300053130 Bacteria 2000
1127 Ga0500652_000720 3300053131 Bacteria 11247
1128 Ga0500658_0098706 3300053134 Bacteria 1272
1129 Ga0500559_0000430 3300053136 Bacteria 29706
1130 Ga0500559_0000658 3300053136 Bacteria 23226
1131 Ga0500559_0001001 3300053136 Bacteria 17506
1132 Ga0500559_0123207 3300053136 Bacteria 1206
1133 Ga0500559_0128028 3300053136 Bacteria 1185
1134 Ga0500564_058794 3300053138 Bacteria 1747
1135 Ga0500573_0105885 3300053140 Bacteria 1578
1136 Ga0500577_0000058 3300053142 Bacteria 25148
1137 Ga0500586_019764 3300053145 Bacteria 2100
1138 Ga0500588_0047387 3300053146 Bacteria 1325
1139 Ga0500590_139487 3300053148 Bacteria 1110
1140 Ga0500603_000069 3300053150 Bacteria 24202
1141 Ga0500603_000345 3300053150 Bacteria 12107
1142 Ga0500604_0016566 3300053151 Bacteria 2031
1143 Ga0500616_0000069 3300053153 Bacteria 234334
1144 Ga0500616_0039187 3300053153 Bacteria 2556
1145 Ga0500619_011239 3300053154 Bacteria 2295
1146 Ga0500622_0000972 3300053156 Bacteria 24262
1147 Ga0500622_0011931 3300053156 Bacteria 4725
1148 Ga0500633_0063467 3300053160 Bacteria 1304
1149 Ga0500638_000353 3300053162 Bacteria 10587
1150 Ga0500638_001860 3300053162 Bacteria 6985
1151 Ga0500639_000057 3300053163 Bacteria 50484
1152 Ga0500639_014190 3300053163 Bacteria 4190
1153 Ga0500639_159142 3300053163 Bacteria 1030
1154 Ga0500636_0000061 3300053177 Bacteria 52521
1155 Ga0500636_0068146 3300053177 Bacteria 2066
1156 Ga0500636_0081739 3300053177 Bacteria 1860
1157 Ga0500636_0111476 3300053177 Bacteria 1545
1158 Ga0500637_0000078 3300053178 Bacteria 34790
1159 Ga0500637_0000494 3300053178 Bacteria 15279
1160 Ga0500637_0061873 3300053178 Bacteria 2145
1161 Ga0500637_0155603 3300053178 Bacteria 1319
1162 Ga0500637_0255200 3300053178 Bacteria 976
1163 Ga0500649_136169 3300053722 Bacteria 909
1164 Ga0500570_140124 3300053724 Bacteria 892
1165 Ga0500576_072629 3300053725 Bacteria 1474
1166 Ga0500625_019916 3300053729 Bacteria 3156
1167 Ga0500609_003186 3300053731 Bacteria 2319
1168 Ga0500656_021761 3300053732 Bacteria 800
1169 Ga0500596_000608 3300053735 Bacteria 6875
1170 Ga0500596_004863 3300053735 Bacteria 2423
1171 Ga0500596_019423 3300053735 Bacteria 1021
1172 Ga0500601_000332 3300053737 Bacteria 8637
1173 Ga0501084_0001341 3300054114 Bacteria 19442
1174 Ga0501084_0217929 3300054114 Bacteria 1610
1175 Ga0500661_000905 3300055283 Bacteria 5554
1176 Ga0500661_018213 3300055283 Bacteria 1252
1177 Ga0501082_0002555 3300060353 Bacteria 15940
1178 Ga0501082_0202825 3300060353 Bacteria 1726
1179 Ga0501082_0397004 3300060353 Bacteria 1203
1180 Ga0466962_0152306 3300061719 Bacteria 1122

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0461010 Ga0501034_0461010_468_1160 210
2 3300049742 Ga0501080_0101908 Ga0501080_0101908_29_721 210
3 3300049823 Ga0501044_0343381 Ga0501044_0343381_694_1386 210
4 3300053085 Ga0495619_0054085 Ga0495619_0054085_1810_2580 223
5 3300006175 Ga0070712_100531675 Ga0070712_1005316752 225
6 3300006844 Ga0075428_100277708 Ga0075428_1002777082 227
7 3300048918 Ga0496115_0228759 Ga0496115_0228759_600_1319 227
8 3300006028 Ga0070717_10291934 Ga0070717_102919342 228
9 3300037471 Ga0395905_0592593 Ga0395905_0592593_214_927 229
10 3300046455 Ga0495603_0034275 Ga0495603_0034275_2284_3000 230
11 3300046473 Ga0495582_0017171 Ga0495582_0017171_3166_3882 230
12 3300046557 Ga0495622_0131755 Ga0495622_0131755_359_1075 230
13 3300047320 Ga0495672_0048346 Ga0495672_0048346_998_1768 230
14 3300048929 Ga0496126_0004245 Ga0496126_0004245_3488_4204 230
15 3300049569 Ga0501032_0190779 Ga0501032_0190779_184_960 230
16 3300049572 Ga0501036_0189749 Ga0501036_0189749_397_1173 230
17 3300049573 Ga0501037_0011935 Ga0501037_0011935_5365_6141 230
18 3300049574 Ga0501038_0012457 Ga0501038_0012457_6561_7337 230
19 3300049580 Ga0501046_0055075 Ga0501046_0055075_980_1756 230
20 3300049581 Ga0501047_0331033 Ga0501047_0331033_85_861 230
21 3300049584 Ga0501068_0184432 Ga0501068_0184432_83_859 230
22 3300049822 Ga0501035_0057423 Ga0501035_0057423_494_1270 230
23 iso_pu_bacteria 2904699407 2904702814 230
24 iso_pu_bacteria 2922425934 2922429785 230
25 3300035692 Ga0373935_0279372 Ga0373935_0279372_105_896 231
26 3300041413 Ga0439465_0065966 Ga0439465_0065966_73_777 231
27 3300046459 Ga0495629_0229070 Ga0495629_0229070_414_1205 231
28 3300046642 Ga0495634_0070435 Ga0495634_0070435_1341_2132 231
29 3300047319 Ga0495674_0122521 Ga0495674_0122521_543_1334 231
30 3300048917 Ga0496114_0186087 Ga0496114_0186087_963_1757 231
31 3300048917 Ga0496114_0278699 Ga0496114_0278699_665_1456 231
32 3300005937 Ga0081455_10034743 Ga0081455_100347433 232
33 3300005985 Ga0081539_10089448 Ga0081539_100894482 232
34 3300006173 Ga0070716_100441460 Ga0070716_1004414602 232
35 3300028381 Ga0268264_10303835 Ga0268264_103038352 232
36 3300035115 Ga0373941_0006333 Ga0373941_0006333_1691_2467 232
37 3300037312 Ga0395899_0020079 Ga0395899_0020079_274_1047 232
38 3300038443 Ga0395901_0010786 Ga0395901_0010786_2023_2796 232
39 3300039453 Ga0436362_1238172 Ga0436362_1238172_239_976 232
40 3300046692 Ga0495671_0269545 Ga0495671_0269545_65_763 232
41 3300047444 Ga0495675_0315405 Ga0495675_0315405_57_755 232
42 3300048917 Ga0496114_0192471 Ga0496114_0192471_520_1293 232
43 3300049569 Ga0501032_0079106 Ga0501032_0079106_784_1557 232
44 3300049569 Ga0501032_0220773 Ga0501032_0220773_336_1112 232
45 3300049571 Ga0501034_0021638 Ga0501034_0021638_904_1677 232
46 3300049571 Ga0501034_0347707 Ga0501034_0347707_377_1153 232
47 3300049572 Ga0501036_0016597 Ga0501036_0016597_3212_3985 232
48 3300049573 Ga0501037_0043333 Ga0501037_0043333_1014_1790 232
49 3300049573 Ga0501037_0204089 Ga0501037_0204089_540_1313 232
50 3300049574 Ga0501038_0477700 Ga0501038_0477700_136_912 232
51 3300049580 Ga0501046_0016944 Ga0501046_0016944_2795_3568 232
52 3300049581 Ga0501047_0075853 Ga0501047_0075853_104_877 232
53 3300049581 Ga0501047_0082984 Ga0501047_0082984_2032_2805 232
54 3300049584 Ga0501068_0075828 Ga0501068_0075828_1254_2030 232
55 3300049585 Ga0501069_0066124 Ga0501069_0066124_1054_1830 232
56 3300049586 Ga0501070_0056293 Ga0501070_0056293_83_856 232
57 3300049586 Ga0501070_0061133 Ga0501070_0061133_1014_1790 232
58 3300049590 Ga0501074_0012930 Ga0501074_0012930_3627_4403 232
59 3300049741 Ga0501079_0206972 Ga0501079_0206972_221_997 232
60 3300049742 Ga0501080_0024882 Ga0501080_0024882_1355_2128 232
61 3300049822 Ga0501035_0086783 Ga0501035_0086783_27_800 232
62 3300049822 Ga0501035_0090700 Ga0501035_0090700_324_1100 232
63 3300049822 Ga0501035_0095216 Ga0501035_0095216_594_1367 232
64 3300050491 nmdc:mga00v17_190273_c1 nmdc:mga00v17_190273_c1_314_1024 232
65 3300050492 nmdc:mga0yw44_232647_c1 nmdc:mga0yw44_232647_c1_464_1207 232
66 3300050507 nmdc:mga05p37_440457_c1 nmdc:mga05p37_440457_c1_186_896 232
67 3300050508 nmdc:mga09592_509751_c1 nmdc:mga09592_509751_c1_306_1016 232
68 3300053091 Ga0500647_0178127 Ga0500647_0178127_234_932 232
69 3300053124 Ga0500617_162167 Ga0500617_162167_16_726 232
70 3300009147 Ga0114129_10866194 Ga0114129_108661942 233
71 3300009148 Ga0105243_10098298 Ga0105243_100982982 233
72 3300009177 Ga0105248_10227239 Ga0105248_102272392 233
73 3300013308 Ga0157375_10071721 Ga0157375_100717212 233
74 3300014326 Ga0157380_10526034 Ga0157380_105260342 233
75 3300035083 Ga0373926_0023829 Ga0373926_0023829_516_1223 233
76 3300035111 Ga0373923_0003846 Ga0373923_0003846_3286_3993 233
77 3300035113 Ga0373936_0127476 Ga0373936_0127476_247_954 233
78 3300035118 Ga0373954_0083438 Ga0373954_0083438_465_1172 233
79 3300035119 Ga0373956_0067322 Ga0373956_0067322_663_1370 233
80 3300035172 Ga0373955_0043303 Ga0373955_0043303_1342_2049 233
81 3300035695 Ga0373927_0173132 Ga0373927_0173132_70_777 233
82 3300035724 Ga0373933_0066047 Ga0373933_0066047_789_1496 233
83 3300035725 Ga0373947_0006259 Ga0373947_0006259_1541_2248 233
84 3300037068 Ga0373925_0192286 Ga0373925_0192286_845_1552 233
85 3300046459 Ga0495629_0028710 Ga0495629_0028710_3019_3726 233
86 3300046471 Ga0495650_0113136 Ga0495650_0113136_280_993 233
87 3300046473 Ga0495582_0023689 Ga0495582_0023689_2352_3059 233
88 3300046474 Ga0495605_0046987 Ga0495605_0046987_32_745 233
89 3300046475 Ga0495639_0021590 Ga0495639_0021590_1837_2544 233
90 3300046523 Ga0495644_0018106 Ga0495644_0018106_1408_2121 233
91 3300046529 Ga0495652_0471319 Ga0495652_0471319_62_769 233
92 3300046531 Ga0495665_0037812 Ga0495665_0037812_290_997 233
93 3300046533 Ga0495640_0044182 Ga0495640_0044182_17_724 233
94 3300046535 Ga0495586_0032919 Ga0495586_0032919_1225_1932 233
95 3300046558 Ga0495633_0041642 Ga0495633_0041642_899_1612 233
96 3300046615 Ga0495656_0039223 Ga0495656_0039223_81_794 233
97 3300046642 Ga0495634_0032749 Ga0495634_0032749_601_1308 233
98 3300046683 Ga0495658_0045638 Ga0495658_0045638_252_959 233
99 3300046689 Ga0495613_0122217 Ga0495613_0122217_651_1358 233
100 3300047471 Ga0495684_0011995 Ga0495684_0011995_3633_4340 233
101 3300048090 Ga0495615_0060520 Ga0495615_0060520_110_823 233
102 3300048905 Ga0496102_0119831 Ga0496102_0119831_29_742 233
103 3300048914 Ga0496111_0451870 Ga0496111_0451870_51_764 233
104 3300048917 Ga0496114_0269663 Ga0496114_0269663_248_955 233
105 3300048918 Ga0496115_0568665 Ga0496115_0568665_50_757 233
106 3300049572 Ga0501036_0001075 Ga0501036_0001075_17618_18391 233
107 3300049573 Ga0501037_0066838 Ga0501037_0066838_1654_2427 233
108 3300049579 Ga0501043_0002466 Ga0501043_0002466_11562_12335 233
109 3300049580 Ga0501046_0051707 Ga0501046_0051707_2250_3023 233
110 3300049581 Ga0501047_0000010 Ga0501047_0000010_93142_93915 233
111 3300049582 Ga0501048_0000592 Ga0501048_0000592_797_1570 233
112 3300049586 Ga0501070_0006160 Ga0501070_0006160_7822_8595 233
113 3300049590 Ga0501074_0033923 Ga0501074_0033923_2338_3111 233
114 3300049744 Ga0501083_0014790 Ga0501083_0014790_4204_4977 233
115 3300049823 Ga0501044_0011508 Ga0501044_0011508_1603_2376 233
116 3300053108 Ga0500562_052905 Ga0500562_052905_14_715 233
117 3300053732 Ga0500656_021761 Ga0500656_021761_38_745 233
118 3300005455 Ga0070663_100007669 Ga0070663_1000076692 234
119 3300005616 Ga0068852_100026594 Ga0068852_1000265944 234
120 3300009098 Ga0105245_10119829 Ga0105245_101198292 234
121 3300011119 Ga0105246_10082752 Ga0105246_100827522 234
122 3300011119 Ga0105246_10375714 Ga0105246_103757142 234
123 3300013307 Ga0157372_10260539 Ga0157372_102605392 234
124 3300014325 Ga0163163_10611968 Ga0163163_106119682 234
125 3300014968 Ga0157379_10126237 Ga0157379_101262372 234
126 3300014968 Ga0157379_11022356 Ga0157379_110223561 234
127 3300014969 Ga0157376_10011916 Ga0157376_100119164 234
128 3300025917 Ga0207660_10409907 Ga0207660_104099071 234
129 3300025949 Ga0207667_10164839 Ga0207667_101648391 234
130 3300026067 Ga0207678_10028548 Ga0207678_100285484 234
131 3300026142 Ga0207698_10058032 Ga0207698_100580322 234
132 3300035692 Ga0373935_0064822 Ga0373935_0064822_1538_2257 234
133 3300037471 Ga0395905_0015528 Ga0395905_0015528_3185_3889 234
134 3300037853 Ga0436364_0108567 Ga0436364_0108567_19_735 234
135 3300037853 Ga0436364_1513198 Ga0436364_1513198_1434_2201 234
136 3300039450 Ga0436363_1284550 Ga0436363_1284550_87_803 234
137 3300046452 Ga0495617_004700 Ga0495617_004700_1022_1738 234
138 3300046453 Ga0495627_055398 Ga0495627_055398_384_1094 234
139 3300046455 Ga0495603_0060537 Ga0495603_0060537_768_1478 234
140 3300046455 Ga0495603_0061209 Ga0495603_0061209_74_793 234
141 3300046461 Ga0495641_0209349 Ga0495641_0209349_95_814 234
142 3300046474 Ga0495605_0103455 Ga0495605_0103455_51_767 234
143 3300046492 Ga0495585_0204695 Ga0495585_0204695_234_950 234
144 3300046513 Ga0495616_0096958 Ga0495616_0096958_301_1011 234
145 3300046525 Ga0495663_0121971 Ga0495663_0121971_130_840 234
146 3300046648 Ga0495611_0201000 Ga0495611_0201000_20_730 234
147 3300046674 Ga0495588_0111581 Ga0495588_0111581_337_1047 234
148 3300046681 Ga0495647_0035007 Ga0495647_0035007_601_1320 234
149 3300047320 Ga0495672_0019081 Ga0495672_0019081_1138_1842 234
150 3300047323 Ga0495683_0033407 Ga0495683_0033407_45_752 234
151 3300047443 Ga0495687_032692 Ga0495687_032692_31_738 234
152 3300047469 Ga0495673_0075219 Ga0495673_0075219_79_792 234
153 3300047472 Ga0495686_0106475 Ga0495686_0106475_588_1292 234
154 3300047472 Ga0495686_0363171 Ga0495686_0363171_52_768 234
155 3300048903 Ga0496100_0351202 Ga0496100_0351202_33_755 234
156 3300048904 Ga0496101_0007272 Ga0496101_0007272_5458_6162 234
157 3300048905 Ga0496102_0023382 Ga0496102_0023382_2595_3299 234
158 3300048907 Ga0496104_0382235 Ga0496104_0382235_207_911 234
159 3300048908 Ga0496105_0134697 Ga0496105_0134697_43_747 234
160 3300048910 Ga0496107_0076355 Ga0496107_0076355_1225_1947 234
161 3300048910 Ga0496107_0235158 Ga0496107_0235158_290_994 234
162 3300048917 Ga0496114_0158685 Ga0496114_0158685_1073_1777 234
163 3300048918 Ga0496115_0049795 Ga0496115_0049795_2086_2790 234
164 3300048924 Ga0496121_0001546 Ga0496121_0001546_6736_7440 234
165 3300048924 Ga0496121_0167265 Ga0496121_0167265_457_1176 234
166 3300048924 Ga0496121_0188548 Ga0496121_0188548_12_734 234
167 3300048924 Ga0496121_0245961 Ga0496121_0245961_59_775 234
168 3300049573 Ga0501037_0097923 Ga0501037_0097923_335_1039 234
169 3300049579 Ga0501043_0028876 Ga0501043_0028876_1596_2300 234
170 3300049581 Ga0501047_0205856 Ga0501047_0205856_1014_1718 234
171 3300049586 Ga0501070_0051183 Ga0501070_0051183_1875_2579 234
172 3300049742 Ga0501080_0773938 Ga0501080_0773938_22_726 234
173 3300049822 Ga0501035_0083442 Ga0501035_0083442_592_1296 234
174 3300049823 Ga0501044_0084203 Ga0501044_0084203_1713_2417 234
175 3300050515 nmdc:mga0a205_593874_c1 nmdc:mga0a205_593874_c1_129_845 234
176 3300053096 Ga0500641_0152540 Ga0500641_0152540_266_982 234
177 3300053108 Ga0500562_092010 Ga0500562_092010_62_775 234
178 3300053119 Ga0500595_011264 Ga0500595_011264_2326_3042 234
179 3300053119 Ga0500595_028323 Ga0500595_028323_689_1393 234
180 3300053134 Ga0500658_0098706 Ga0500658_0098706_321_1037 234
181 3300053148 Ga0500590_139487 Ga0500590_139487_292_1008 234
182 3300005548 Ga0070665_100391937 Ga0070665_1003919372 235
183 3300044735 Ga0466968_0298917 Ga0466968_0298917_38_757 235
184 3300048908 Ga0496105_0141805 Ga0496105_0141805_551_1345 235
185 3300048910 Ga0496107_0238285 Ga0496107_0238285_227_1021 235
186 3300048918 Ga0496115_0047926 Ga0496115_0047926_680_1474 235
187 3300049574 Ga0501038_0206044 Ga0501038_0206044_56_874 235
188 3300048904 Ga0496101_0143517 Ga0496101_0143517_926_1720 236
189 3300048907 Ga0496104_0472605 Ga0496104_0472605_183_977 236
190 3300049823 Ga0501044_0117048 Ga0501044_0117048_283_1056 236
191 3300005329 Ga0070683_100000652 Ga0070683_10000065215 237
192 3300005530 Ga0070679_100606594 Ga0070679_1006065941 237
193 3300005535 Ga0070684_100001124 Ga0070684_1000011242 237
194 3300006195 Ga0075366_10405195 Ga0075366_104051951 237
195 3300005437 Ga0070710_10000979 Ga0070710_1000097911 238
196 3300006846 Ga0075430_100083282 Ga0075430_1000832822 238
197 3300006847 Ga0075431_100169347 Ga0075431_1001693472 238
198 3300025920 Ga0207649_10215858 Ga0207649_102158581 238
199 3300025939 Ga0207665_10050311 Ga0207665_100503112 238
200 3300037466 Ga0395898_0332905 Ga0395898_0332905_225_995 238
201 3300037853 Ga0436364_1124077 Ga0436364_1124077_413_1207 238
202 3300039437 Ga0436365_0847601 Ga0436365_0847601_1140_1934 238
203 3300046459 Ga0495629_0476057 Ga0495629_0476057_29_796 238
204 3300049570 Ga0501033_0120706 Ga0501033_0120706_804_1574 238
205 3300049575 Ga0501039_0212404 Ga0501039_0212404_79_849 238
206 3300049576 Ga0501040_0167562 Ga0501040_0167562_643_1413 238
207 3300049581 Ga0501047_0225034 Ga0501047_0225034_621_1430 238
208 3300049591 Ga0501075_0134328 Ga0501075_0134328_613_1383 238
209 3300049743 Ga0501081_0255967 Ga0501081_0255967_234_1004 238
210 3300049823 Ga0501044_0568254 Ga0501044_0568254_17_787 238
211 3300050509 nmdc:mga0qj67_35476_c1 nmdc:mga0qj67_35476_c1_1028_1795 238
212 3300050510 nmdc:mga06r32_150534_c1 nmdc:mga06r32_150534_c1_268_1035 238
213 3300005434 Ga0070709_10000247 Ga0070709_1000024711 239
214 3300005435 Ga0070714_100018248 Ga0070714_1000182485 239
215 3300005436 Ga0070713_100057996 Ga0070713_1000579962 239
216 3300005439 Ga0070711_100282960 Ga0070711_1002829601 239
217 3300006038 Ga0075365_10005882 Ga0075365_100058823 239
218 3300006042 Ga0075368_10039758 Ga0075368_100397582 239
219 3300006048 Ga0075363_100052519 Ga0075363_1000525192 239
220 3300006051 Ga0075364_10035235 Ga0075364_100352352 239
221 3300006178 Ga0075367_10061796 Ga0075367_100617962 239
222 3300017792 Ga0163161_10399211 Ga0163161_103992112 239
223 3300025916 Ga0207663_10054348 Ga0207663_100543481 239
224 3300025928 Ga0207700_10021828 Ga0207700_100218283 239
225 3300025929 Ga0207664_10034194 Ga0207664_100341943 239
226 3300046615 Ga0495656_0069335 Ga0495656_0069335_335_1108 239
227 3300050490 nmdc:mga03n38_77168_c1 nmdc:mga03n38_77168_c1_221_997 239
228 3300050494 nmdc:mga06z11_77970_c1 nmdc:mga06z11_77970_c1_716_1471 239
229 3300050495 nmdc:mga04h51_43071_c1 nmdc:mga04h51_43071_c1_416_1171 239
230 3300005981 Ga0081538_10034900 Ga0081538_100349002 240
231 3300005981 Ga0081538_10197342 Ga0081538_101973421 240
232 3300025916 Ga0207663_10370328 Ga0207663_103703281 240
233 3300046462 Ga0495651_0344547 Ga0495651_0344547_132_905 240
234 3300046536 Ga0495587_0212808 Ga0495587_0212808_176_949 240
235 3300048912 Ga0496109_0035526 Ga0496109_0035526_96_869 240
236 iso_pu_bacteria 2841949485 2841950313 240
237 3300021377 Ga0213874_10015237 Ga0213874_100152372 241
238 3300031247 Ga0265340_10066870 Ga0265340_100668702 241
239 3300031456 Ga0307513_10103307 Ga0307513_101033072 241
240 3300031456 Ga0307513_10245603 Ga0307513_102456032 241
241 3300035207 Ga0373942_0096343 Ga0373942_0096343_82_858 241
242 3300039450 Ga0436363_0891931 Ga0436363_0891931_233_1015 241
243 3300039450 Ga0436363_1567676 Ga0436363_1567676_1312_2094 241
244 3300048918 Ga0496115_0036742 Ga0496115_0036742_3062_3841 241
245 3300048929 Ga0496126_0180968 Ga0496126_0180968_326_1105 241
246 3300049574 Ga0501038_0551754 Ga0501038_0551754_62_850 241
247 3300049822 Ga0501035_0040465 Ga0501035_0040465_1350_2138 241
248 3300005439 Ga0070711_100066238 Ga0070711_1000662382 242
249 3300009177 Ga0105248_10356480 Ga0105248_103564802 242
250 3300013308 Ga0157375_10406530 Ga0157375_104065302 242
251 3300025914 Ga0207671_10144655 Ga0207671_101446552 242
252 3300025915 Ga0207693_10372682 Ga0207693_103726822 242
253 3300025916 Ga0207663_10082825 Ga0207663_100828252 242
254 3300025941 Ga0207711_10025416 Ga0207711_100254163 242
255 3300028786 Ga0307517_10000419 Ga0307517_1000041943 242
256 3300035117 Ga0373953_0064738 Ga0373953_0064738_300_1061 242
257 3300035118 Ga0373954_0009272 Ga0373954_0009272_1211_1972 242
258 3300035119 Ga0373956_0039768 Ga0373956_0039768_956_1717 242
259 3300035691 Ga0373931_0011783 Ga0373931_0011783_3420_4193 242
260 3300035692 Ga0373935_0175039 Ga0373935_0175039_304_1065 242
261 3300035724 Ga0373933_0031003 Ga0373933_0031003_1993_2754 242
262 3300036401 Ga0373937_0018073 Ga0373937_0018073_3964_4725 242
263 3300037068 Ga0373925_0165182 Ga0373925_0165182_410_1171 242
264 3300046462 Ga0495651_0187273 Ga0495651_0187273_604_1365 242
265 3300046477 Ga0495664_0300687 Ga0495664_0300687_101_862 242
266 3300046514 Ga0495618_0346680 Ga0495618_0346680_118_879 242
267 3300046516 Ga0495628_0001747 Ga0495628_0001747_11111_11872 242
268 3300046529 Ga0495652_0032273 Ga0495652_0032273_1257_2018 242
269 3300046533 Ga0495640_0189730 Ga0495640_0189730_217_978 242
270 3300046536 Ga0495587_0130240 Ga0495587_0130240_461_1222 242
271 3300046543 Ga0495645_0004709 Ga0495645_0004709_5710_6471 242
272 3300046663 Ga0495635_0018462 Ga0495635_0018462_2846_3607 242
273 3300046809 Ga0495600_0041130 Ga0495600_0041130_110_871 242
274 3300047317 Ga0495604_0004042 Ga0495604_0004042_455_1216 242
275 3300047319 Ga0495674_0057715 Ga0495674_0057715_1199_1960 242
276 3300047322 Ga0495680_0095290 Ga0495680_0095290_1397_2158 242
277 3300048906 Ga0496103_0011197 Ga0496103_0011197_61_834 242
278 3300048907 Ga0496104_0000090 Ga0496104_0000090_52919_53680 242
279 3300048908 Ga0496105_0001807 Ga0496105_0001807_551_1312 242
280 3300048909 Ga0496106_0080266 Ga0496106_0080266_471_1244 242
281 3300048910 Ga0496107_0249609 Ga0496107_0249609_236_1009 242
282 3300048913 Ga0496110_0038593 Ga0496110_0038593_963_1736 242
283 3300048914 Ga0496111_0042237 Ga0496111_0042237_2384_3157 242
284 3300048916 Ga0496113_0309062 Ga0496113_0309062_291_1064 242
285 3300048918 Ga0496115_0211341 Ga0496115_0211341_324_1085 242
286 3300048929 Ga0496126_0199798 Ga0496126_0199798_124_861 242
287 3300053077 Ga0495601_0004009 Ga0495601_0004009_3132_3893 242
288 3300053078 Ga0495612_0009850 Ga0495612_0009850_851_1612 242
289 3300053084 Ga0495595_0076635 Ga0495595_0076635_525_1286 242
290 3300053085 Ga0495619_0001464 Ga0495619_0001464_4703_5464 242
291 3300005983 Ga0081540_1024144 Ga0081540_10241442 243
292 3300021388 Ga0213875_10000007 Ga0213875_10000007139 243
293 3300025295 Ga0209564_1008399 Ga0209564_10083994 243
294 3300027296 Ga0209389_1000177 Ga0209389_100017727 243
295 3300027357 Ga0209589_1000072 Ga0209589_100007286 243
296 3300027361 Ga0209489_100031 Ga0209489_10003126 243
297 3300044658 Ga0466972_0113042 Ga0466972_0113042_321_1091 243
298 3300044901 Ga0466960_0004498 Ga0466960_0004498_2790_3560 243
299 3300046472 Ga0495580_0155451 Ga0495580_0155451_620_1414 243
300 3300048909 Ga0496106_0263772 Ga0496106_0263772_421_1188 243
301 3300048919 Ga0496116_0001513 Ga0496116_0001513_13676_14443 243
302 3300048928 Ga0496125_0012038 Ga0496125_0012038_3210_3977 243
303 3300050516 nmdc:mga0sz30_4914_c1 nmdc:mga0sz30_4914_c1_1070_1837 243
304 iso_pu_bacteria 2643221651 2644288493 243
305 3300005437 Ga0070710_10016239 Ga0070710_100162392 244
306 3300005981 Ga0081538_10003572 Ga0081538_1000357213 244
307 3300006028 Ga0070717_10228756 Ga0070717_102287562 244
308 3300006163 Ga0070715_10029991 Ga0070715_100299912 244
309 3300009545 Ga0105237_10370470 Ga0105237_103704701 244
310 3300037853 Ga0436364_0120722 Ga0436364_0120722_992_1774 244
311 3300039450 Ga0436363_1148126 Ga0436363_1148126_257_1042 244
312 3300048920 Ga0496117_0050320 Ga0496117_0050320_1993_2763 244
313 3300048924 Ga0496121_0040888 Ga0496121_0040888_702_1475 244
314 3300048926 Ga0496123_0031821 Ga0496123_0031821_486_1250 244
315 3300048927 Ga0496124_0102586 Ga0496124_0102586_685_1449 244
316 3300050492 nmdc:mga0yw44_8194_c1 nmdc:mga0yw44_8194_c1_3306_4100 244
317 3300053093 Ga0500651_0079935 Ga0500651_0079935_559_1329 244
318 3300053094 Ga0500566_0000667 Ga0500566_0000667_15271_16044 244
319 3300005530 Ga0070679_100432121 Ga0070679_1004321212 245
320 3300005937 Ga0081455_10004224 Ga0081455_100042248 245
321 3300048926 Ga0496123_0171946 Ga0496123_0171946_153_938 245
322 3300049571 Ga0501034_0000852 Ga0501034_0000852_26123_26893 245
323 3300049575 Ga0501039_0305089 Ga0501039_0305089_178_951 245
324 3300049577 Ga0501041_0166795 Ga0501041_0166795_171_944 245
325 3300049582 Ga0501048_0355630 Ga0501048_0355630_264_1031 245
326 3300049743 Ga0501081_0187130 Ga0501081_0187130_549_1322 245
327 3300049824 Ga0501045_0251063 Ga0501045_0251063_313_1080 245
328 3300026075 Ga0207708_10076715 Ga0207708_100767152 246
329 3300047472 Ga0495686_0060912 Ga0495686_0060912_124_894 246
330 3300049568 Ga0501031_0004506 Ga0501031_0004506_5834_6607 246
331 3300049569 Ga0501032_0037038 Ga0501032_0037038_1380_2153 246
332 3300049570 Ga0501033_0000155 Ga0501033_0000155_51795_52568 246
333 3300049578 Ga0501042_0010208 Ga0501042_0010208_3234_4007 246
334 3300049579 Ga0501043_0014023 Ga0501043_0014023_3894_4667 246
335 3300049822 Ga0501035_0022530 Ga0501035_0022530_229_1002 246
336 3300061719 Ga0466962_0152306 Ga0466962_0152306_100_885 246
337 iso_pu_bacteria 2824600985 2824608689 246
338 iso_pu_bacteria 2824609381 2824613963 246
339 iso_pu_bacteria 2824653114 2824660004 246
340 iso_pu_bacteria 2888419890 2888424033 246
341 iso_pu_bacteria 2935648319 2935649641 246
342 iso_pu_bacteria 2935656913 2935658844 246
343 iso_pu_bacteria 2936011229 2936012877 246
344 iso_pu_bacteria 2936019824 2936021441 246
345 iso_pu_bacteria 2936028420 2936030170 246
346 iso_pu_bacteria 2936046547 2936047635 246
347 iso_pu_bacteria 2936055302 2936057207 246
348 3300005539 Ga0068853_100148198 Ga0068853_1001481982 247
349 3300005563 Ga0068855_100213638 Ga0068855_1002136382 247
350 3300005577 Ga0068857_100177335 Ga0068857_1001773352 247
351 3300009545 Ga0105237_10314453 Ga0105237_103144531 247
352 3300013296 Ga0157374_10036354 Ga0157374_100363542 247
353 3300013306 Ga0163162_10426113 Ga0163162_104261132 247
354 3300021358 Ga0213873_10011081 Ga0213873_100110812 247
355 3300021384 Ga0213876_10000691 Ga0213876_1000069119 247
356 3300025912 Ga0207707_10069675 Ga0207707_100696753 247
357 3300025924 Ga0207694_10156445 Ga0207694_101564452 247
358 3300025949 Ga0207667_10689967 Ga0207667_106899672 247
359 3300026116 Ga0207674_10034941 Ga0207674_100349414 247
360 3300028653 Ga0265323_10002662 Ga0265323_100026628 247
361 3300028666 Ga0265336_10000852 Ga0265336_1000085212 247
362 3300028800 Ga0265338_10045157 Ga0265338_100451575 247
363 3300039453 Ga0436362_0209602 Ga0436362_0209602_646_1434 247
364 3300048088 Ga0495602_0421335 Ga0495602_0421335_17_769 247
365 3300048911 Ga0496108_0601391 Ga0496108_0601391_99_872 247
366 3300048912 Ga0496109_0424191 Ga0496109_0424191_80_853 247
367 3300048914 Ga0496111_0261468 Ga0496111_0261468_332_1105 247
368 3300048915 Ga0496112_0201862 Ga0496112_0201862_105_878 247
369 3300048918 Ga0496115_0034395 Ga0496115_0034395_2108_2881 247
370 3300048918 Ga0496115_0117944 Ga0496115_0117944_174_947 247
371 3300050512 nmdc:mga0n895_80495_c1 nmdc:mga0n895_80495_c1_1369_2154 247
372 iso_pu_bacteria 2513237104 2513718112 247
373 iso_pu_bacteria 2824704595 2824712428 247
374 iso_pu_bacteria 2824753945 2824762334 247
375 iso_pu_bacteria 2824763712 2824772540 247
376 iso_pu_bacteria 2841957949 2841958253 247
377 iso_pu_bacteria 2904711408 2904717439 247
378 3300005336 Ga0070680_100073065 Ga0070680_1000730652 248
379 3300005339 Ga0070660_100292611 Ga0070660_1002926112 248
380 3300005355 Ga0070671_100429508 Ga0070671_1004295081 248
381 3300005356 Ga0070674_100108900 Ga0070674_1001089002 248
382 3300005366 Ga0070659_100267786 Ga0070659_1002677861 248
383 3300005455 Ga0070663_100012373 Ga0070663_1000123731 248
384 3300005455 Ga0070663_100255846 Ga0070663_1002558462 248
385 3300005548 Ga0070665_100131331 Ga0070665_1001313312 248
386 3300005548 Ga0070665_100185286 Ga0070665_1001852862 248
387 3300005563 Ga0068855_100088315 Ga0068855_1000883152 248
388 3300005564 Ga0070664_100084318 Ga0070664_1000843182 248
389 3300005578 Ga0068854_100396225 Ga0068854_1003962252 248
390 3300005614 Ga0068856_100463638 Ga0068856_1004636381 248
391 3300005616 Ga0068852_100245240 Ga0068852_1002452402 248
392 3300005618 Ga0068864_100208257 Ga0068864_1002082572 248
393 3300005841 Ga0068863_100316017 Ga0068863_1003160172 248
394 3300005842 Ga0068858_100047111 Ga0068858_1000471114 248
395 3300005843 Ga0068860_100002150 Ga0068860_1000021504 248
396 3300009174 Ga0105241_10543789 Ga0105241_105437892 248
397 3300010375 Ga0105239_10359532 Ga0105239_103595323 248
398 3300025297 Ga0209758_1002016 Ga0209758_100201622 248
399 3300025899 Ga0207642_10207765 Ga0207642_102077652 248
400 3300025911 Ga0207654_10422380 Ga0207654_104223801 248
401 3300025914 Ga0207671_10045398 Ga0207671_100453982 248
402 3300025919 Ga0207657_10342906 Ga0207657_103429061 248
403 3300025940 Ga0207691_10234993 Ga0207691_102349932 248
404 3300025945 Ga0207679_10245126 Ga0207679_102451262 248
405 3300026035 Ga0207703_10040144 Ga0207703_100401443 248
406 3300026067 Ga0207678_10029406 Ga0207678_100294062 248
407 3300026078 Ga0207702_10340520 Ga0207702_103405202 248
408 3300026088 Ga0207641_10429054 Ga0207641_104290542 248
409 3300026121 Ga0207683_10332279 Ga0207683_103322792 248
410 3300028379 Ga0268266_10033715 Ga0268266_100337154 248
411 3300028380 Ga0268265_10127289 Ga0268265_101272892 248
412 3300028381 Ga0268264_10000162 Ga0268264_1000016216 248
413 3300035114 Ga0373939_0046801 Ga0373939_0046801_108_890 248
414 3300036459 Ga0372808_014125 Ga0372808_014125_60_839 248
415 3300046459 Ga0495629_0112904 Ga0495629_0112904_246_1028 248
416 3300046648 Ga0495611_0081812 Ga0495611_0081812_179_937 248
417 3300046809 Ga0495600_0384587 Ga0495600_0384587_75_857 248
418 3300048913 Ga0496110_0062301 Ga0496110_0062301_571_1353 248
419 3300048917 Ga0496114_0222306 Ga0496114_0222306_487_1260 248
420 3300048920 Ga0496117_0097052 Ga0496117_0097052_67_846 248
421 3300048921 Ga0496118_0003772 Ga0496118_0003772_11754_12533 248
422 3300048924 Ga0496121_0000302 Ga0496121_0000302_18375_19154 248
423 3300048925 Ga0496122_0017367 Ga0496122_0017367_4948_5730 248
424 3300048927 Ga0496124_0005111 Ga0496124_0005111_11408_12187 248
425 3300048929 Ga0496126_0006778 Ga0496126_0006778_7495_8277 248
426 3300048929 Ga0496126_0041087 Ga0496126_0041087_1491_2270 248
427 3300048929 Ga0496126_0532671 Ga0496126_0532671_171_920 248
428 3300049580 Ga0501046_0056324 Ga0501046_0056324_1515_2282 248
429 3300049581 Ga0501047_0025620 Ga0501047_0025620_3167_3934 248
430 3300049586 Ga0501070_0074060 Ga0501070_0074060_391_1158 248
431 3300049590 Ga0501074_0207947 Ga0501074_0207947_433_1200 248
432 3300049742 Ga0501080_0340849 Ga0501080_0340849_215_982 248
433 3300049823 Ga0501044_0047106 Ga0501044_0047106_792_1559 248
434 3300053177 Ga0500636_0111476 Ga0500636_0111476_277_1083 248
435 iso_pu_bacteria 2507262055 2507509081 248
436 iso_pu_bacteria 2508501009 2508543163 248
437 iso_pu_bacteria 2508501042 2508691088 248
438 iso_pu_bacteria 2511231028 2511393306 248
439 iso_pu_bacteria 2513237092 2513624444 248
440 iso_pu_bacteria 2513237094 2513643640 248
441 iso_pu_bacteria 2513237095 2513650101 248
442 iso_pu_bacteria 2513237102 2513701954 248
443 iso_pu_bacteria 2513237139 2513872345 248
444 iso_pu_bacteria 2513237161 2514014071 248
445 iso_pu_bacteria 2515154112 2515626511 248
446 iso_pu_bacteria 2517093001 2517101701 248
447 iso_pu_bacteria 2524023205 2524436851 248
448 iso_pu_bacteria 2528768022 2528850138 248
449 iso_pu_bacteria 2617270735 2617351401 248
450 iso_pu_bacteria 2617270741 2617376203 248
451 iso_pu_bacteria 2744054633 2745080214 248
452 iso_pu_bacteria 2791355196 2793063793 248
453 iso_pu_bacteria 2802429603 2805918051 248
454 iso_pu_bacteria 2816332527 2818243158 248
455 iso_pu_bacteria 2824617872 2824625547 248
456 iso_pu_bacteria 2824626560 2824631408 248
457 iso_pu_bacteria 2824635225 2824643350 248
458 iso_pu_bacteria 2824644064 2824651614 248
459 iso_pu_bacteria 2824661429 2824669897 248
460 iso_pu_bacteria 2824671348 2824678001 248
461 iso_pu_bacteria 2824679649 2824686875 248
462 iso_pu_bacteria 2824687955 2824694407 248
463 iso_pu_bacteria 2824696289 2824703156 248
464 iso_pu_bacteria 2824714736 2824722235 248
465 iso_pu_bacteria 2824723954 2824731614 248
466 iso_pu_bacteria 2824732956 2824739967 248
467 iso_pu_bacteria 2824746037 2824753339 248
468 iso_pu_bacteria 2824773399 2824780048 248
469 iso_pu_bacteria 2838122688 2838126238 248
470 iso_pu_bacteria 2841941048 2841943673 248
471 iso_pu_bacteria 2841966195 2841966694 248
472 iso_pu_bacteria 2841974524 2841975451 248
473 iso_pu_bacteria 2841983080 2841988410 248
474 iso_pu_bacteria 2842038055 2842039503 248
475 iso_pu_bacteria 2842045827 2842047551 248
476 iso_pu_bacteria 2844315083 2844318625 248
477 iso_pu_bacteria 2847930680 2847935744 248
478 iso_pu_bacteria 2847939898 2847946127 248
479 iso_pu_bacteria 2849076700 2849079728 248
480 iso_pu_bacteria 2857509624 2857513850 248
481 iso_pu_bacteria 2874590934 2874597217 248
482 iso_pu_bacteria 2874612657 2874616228 248
483 iso_pu_bacteria 2874620515 2874620843 248
484 iso_pu_bacteria 2874628541 2874629686 248
485 iso_pu_bacteria 2874645413 2874649450 248
486 iso_pu_bacteria 2876761206 2876763854 248
487 iso_pu_bacteria 2876771140 2876777986 248
488 iso_pu_bacteria 2876818435 2876822993 248
489 iso_pu_bacteria 2879074833 2879078743 248
490 iso_pu_bacteria 2879083081 2879090706 248
491 iso_pu_bacteria 2879099564 2879108265 248
492 iso_pu_bacteria 2879127579 2879132779 248
493 iso_pu_bacteria 2879142872 2879143495 248
494 iso_pu_bacteria 2881364244 2881366938 248
495 iso_pu_bacteria 2881665667 2881666343 248
496 iso_pu_bacteria 2885366525 2885372081 248
497 iso_pu_bacteria 2885409591 2885412025 248
498 iso_pu_bacteria 2888378607 2888383605 248
499 iso_pu_bacteria 2888388044 2888394355 248
500 iso_pu_bacteria 2903727486 2903728740 248
501 iso_pu_bacteria 2904666416 2904666943 248
502 iso_pu_bacteria 2906602504 2906608556 248
503 iso_pu_bacteria 2906626472 2906634125 248
504 iso_pu_bacteria 2906643746 2906644792 248
505 iso_pu_bacteria 2908775508 2908779674 248
506 iso_pu_bacteria 2922368715 2922373831 248
507 iso_pu_bacteria 2922393267 2922395910 248
508 iso_pu_bacteria 2929615660 2929617536 248
509 iso_pu_bacteria 2929624759 2929627241 248
510 iso_pu_bacteria 2932784394 2932787414 248
511 iso_pu_bacteria 2932794094 2932798471 248
512 iso_pu_bacteria 2932801729 2932803228 248
513 iso_pu_bacteria 2932809354 2932815128 248
514 iso_pu_bacteria 2932818245 2932820674 248
515 iso_pu_bacteria 2932828146 2932831721 248
516 iso_pu_bacteria 2933577622 2933579492 248
517 iso_pu_bacteria 2935608549 2935612047 248
518 iso_pu_bacteria 2935616580 2935622225 248
519 iso_pu_bacteria 2935638405 2935642866 248
520 iso_pu_bacteria 2935665750 2935667967 248
521 iso_pu_bacteria 2935675223 2935678962 248
522 iso_pu_bacteria 2935684952 2935688712 248
523 iso_pu_bacteria 2935694250 2935696069 248
524 iso_pu_bacteria 2935703347 2935706835 248
525 iso_pu_bacteria 2935713505 2935715731 248
526 iso_pu_bacteria 2935722832 2935725705 248
527 iso_pu_bacteria 2935732158 2935738016 248
528 iso_pu_bacteria 2935741537 2935747391 248
529 iso_pu_bacteria 2935750917 2935754034 248
530 iso_pu_bacteria 2935760218 2935763039 248
531 iso_pu_bacteria 2935769743 2935772517 248
532 iso_pu_bacteria 2935777560 2935785296 248
533 iso_pu_bacteria 2935785616 2935791850 248
534 iso_pu_bacteria 2935793552 2935799490 248
535 iso_pu_bacteria 2935801545 2935808486 248
536 iso_pu_bacteria 2935810662 2935812818 248
537 iso_pu_bacteria 2935819856 2935821520 248
538 iso_pu_bacteria 2935827899 2935830469 248
539 iso_pu_bacteria 2935837841 2935840500 248
540 iso_pu_bacteria 2935847175 2935850211 248
541 iso_pu_bacteria 2935855204 2935860707 248
542 iso_pu_bacteria 2935864058 2935865259 248
543 iso_pu_bacteria 2935873716 2935877856 248
544 iso_pu_bacteria 2935883170 2935888003 248
545 iso_pu_bacteria 2935908558 2935914285 248
546 iso_pu_bacteria 2935916978 2935924661 248
547 iso_pu_bacteria 2935926038 2935931941 248
548 iso_pu_bacteria 2935934488 2935940539 248
549 iso_pu_bacteria 2935942939 2935948481 248
550 iso_pu_bacteria 2935951376 2935957048 248
551 iso_pu_bacteria 2935959822 2935960159 248
552 iso_pu_bacteria 2935967501 2935973646 248
553 iso_pu_bacteria 2935975950 2935977413 248
554 iso_pu_bacteria 2935984226 2935989906 248
555 iso_pu_bacteria 2935992306 2935996191 248
556 iso_pu_bacteria 2936002035 2936006325 248
557 iso_pu_bacteria 2936037263 2936041406 248
558 iso_pu_bacteria 2940556831 2940560590 248
559 iso_pu_bacteria 2941531003 2941534391 248
560 iso_pu_bacteria 2941538514 2941541369 248
561 iso_pu_bacteria 3005483717 3005489213 248
562 iso_pu_bacteria 3005506211 3005509924 248
563 iso_pu_bacteria 3005594810 3005598790 248
564 iso_pu_bacteria 3005710791 3005714412 248
565 iso_pu_bacteria 3005718088 3005721937 248
566 iso_pu_bacteria 8006926726 8006927322 248
567 iso_pu_bacteria 8016511872 8016513852 248
568 iso_pu_bacteria 8016522445 8016530113 248
569 iso_pu_bacteria 8016530956 8016535356 248
570 iso_pu_bacteria 8016539877 8016548561 248
571 iso_pu_bacteria 8016548790 8016553568 248
572 iso_pu_bacteria 8016557553 8016561951 248
573 iso_pu_bacteria 8016566248 8016573692 248
574 iso_pu_bacteria 8016575299 8016577818 248
575 iso_pu_bacteria 8016583857 8016592418 248
576 iso_pu_bacteria 8016595262 8016599777 248
577 iso_pu_bacteria 8016603502 8016611041 248
578 iso_pu_bacteria 8016613128 8016613928 248
579 iso_pu_bacteria 8016622563 8016627176 248
580 iso_pu_bacteria 8016630954 8016631496 248
581 iso_pu_bacteria 8017057580 8017062621 248
582 iso_pu_bacteria 8019538911 8019544381 248
583 iso_pu_bacteria 8019547302 8019554274 248
584 iso_pu_bacteria 8019576017 8019582024 248
585 iso_pu_bacteria 8019586578 8019589707 248
586 iso_pu_bacteria 8019597564 8019601568 248
587 iso_pu_bacteria 8019608314 8019616989 248
588 iso_pu_bacteria 8019619141 8019627611 248
589 iso_pu_bacteria 8019629233 8019634962 248
590 iso_pu_bacteria 8019648815 8019657853 248
591 iso_pu_bacteria 8019659431 8019662797 248
592 iso_pu_bacteria 8019668869 8019672406 248
593 iso_pu_bacteria 8019678201 8019683799 248
594 iso_pu_bacteria 8019687851 8019689515 248
595 iso_pu_bacteria 8055742211 8055746849 248
596 iso_pu_bacteria 8056967851 8056972995 248
597 3300031711 Ga0265314_10003550 Ga0265314_100035508 249
598 3300039437 Ga0436365_0169079 Ga0436365_0169079_1103_1882 249
599 3300046524 Ga0495648_0003338 Ga0495648_0003338_2193_2999 249
600 3300049574 Ga0501038_0307885 Ga0501038_0307885_369_1118 249
601 3300049823 Ga0501044_0118316 Ga0501044_0118316_598_1347 249
602 3300003203 JGI25406J46586_10000004 JGI25406J46586_10000004117 250
603 3300003659 JGI25404J52841_10000996 JGI25404J52841_100009963 250
604 3300005434 Ga0070709_10013963 Ga0070709_100139633 250
605 3300005435 Ga0070714_100174819 Ga0070714_1001748191 250
606 3300005436 Ga0070713_100015159 Ga0070713_1000151594 250
607 3300005436 Ga0070713_100215823 Ga0070713_1002158232 250
608 3300005548 Ga0070665_100511034 Ga0070665_1005110341 250
609 3300005985 Ga0081539_10000080 Ga0081539_1000008010 250
610 3300006028 Ga0070717_10047705 Ga0070717_100477052 250
611 3300006175 Ga0070712_100058182 Ga0070712_1000581823 250
612 3300025906 Ga0207699_10026734 Ga0207699_100267342 250
613 3300025915 Ga0207693_10216415 Ga0207693_102164151 250
614 3300025928 Ga0207700_10052102 Ga0207700_100521022 250
615 3300025928 Ga0207700_10054384 Ga0207700_100543841 250
616 3300025929 Ga0207664_10058755 Ga0207664_100587553 250
617 3300025929 Ga0207664_10419397 Ga0207664_104193972 250
618 3300037853 Ga0436364_0462513 Ga0436364_0462513_25_789 250
619 3300046462 Ga0495651_0058185 Ga0495651_0058185_2003_2776 250
620 3300053177 Ga0500636_0081739 Ga0500636_0081739_263_1069 250
621 iso_pu_bacteria 2791355197 2793068307 250
622 iso_pu_bacteria 3005474847 3005479873 250
623 iso_pu_bacteria 3005587118 3005589962 250
624 3300005327 Ga0070658_10158173 Ga0070658_101581731 251
625 3300005435 Ga0070714_100078278 Ga0070714_1000782782 251
626 3300005439 Ga0070711_100119442 Ga0070711_1001194422 251
627 3300005445 Ga0070708_100172862 Ga0070708_1001728622 251
628 3300005983 Ga0081540_1011684 Ga0081540_10116842 251
629 3300006038 Ga0075365_10055199 Ga0075365_100551992 251
630 3300006175 Ga0070712_100043218 Ga0070712_1000432182 251
631 3300025915 Ga0207693_10020846 Ga0207693_100208462 251
632 3300025916 Ga0207663_10022593 Ga0207663_100225931 251
633 3300025928 Ga0207700_10508051 Ga0207700_105080512 251
634 3300037471 Ga0395905_0139633 Ga0395905_0139633_997_1764 251
635 3300046558 Ga0495633_0086773 Ga0495633_0086773_18_803 251
636 3300046615 Ga0495656_0042288 Ga0495656_0042288_667_1452 251
637 3300046664 Ga0495659_0118649 Ga0495659_0118649_168_956 251
638 3300046691 Ga0495670_0206820 Ga0495670_0206820_28_816 251
639 3300047323 Ga0495683_0142501 Ga0495683_0142501_316_1107 251
640 3300048924 Ga0496121_0001399 Ga0496121_0001399_36406_37176 251
641 3300048929 Ga0496126_0006546 Ga0496126_0006546_4775_5539 251
642 iso_pu_bacteria 2513237096 2513654445 251
643 iso_pu_bacteria 2513237098 2513673092 251
644 iso_pu_bacteria 2513237137 2513859247 251
645 iso_pu_bacteria 2513237141 2513893461 251
646 iso_pu_bacteria 2513237145 2513915376 251
647 iso_pu_bacteria 2517572143 2517892680 251
648 iso_pu_bacteria 2524023210 2524464538 251
649 iso_pu_bacteria 2524023228 2524538152 251
650 iso_pu_bacteria 2602042107 2603859048 251
651 iso_pu_bacteria 2667528175 2671117403 251
652 iso_pu_bacteria 2728368998 2728748633 251
653 iso_pu_bacteria 2857524615 2857527850 251
654 iso_pu_bacteria 2876808645 2876809671 251
655 iso_pu_bacteria 2879110137 2879118260 251
656 iso_pu_bacteria 2885374607 2885378498 251
657 iso_pu_bacteria 2885383462 2885389303 251
658 iso_pu_bacteria 2893066018 2893066415 251
659 iso_pu_bacteria 2903748898 2903750575 251
660 iso_pu_bacteria 2903768456 2903777238 251
661 iso_pu_bacteria 2904690495 2904696040 251
662 iso_pu_bacteria 2906610324 2906618312 251
663 iso_pu_bacteria 2906635258 2906641488 251
664 iso_pu_bacteria 2906660503 2906664393 251
665 iso_pu_bacteria 2908739725 2908743043 251
666 iso_pu_bacteria 2908756301 2908760674 251
667 iso_pu_bacteria 2919073203 2919075249 251
668 iso_pu_bacteria 2935630451 2935633415 251
669 iso_pu_bacteria 2941507105 2941510306 251
670 iso_pu_bacteria 2941515067 2941517957 251
671 iso_pu_bacteria 2941523033 2941525973 251
672 iso_pu_bacteria 8006933436 8006941030 251
673 iso_pu_bacteria 8006964411 8006970792 251
674 iso_pu_bacteria 8006973647 8006980769 251
675 iso_pu_bacteria 8019555841 8019557107 251
676 iso_pu_bacteria 8019565922 8019568192 251
677 iso_pu_bacteria 8056681323 8056685412 251
678 iso_pu_bacteria 8056689827 8056689950 251
679 3300002067 JGI24735J21928_10066513 JGI24735J21928_100665131 252
680 3300003214 JGI25165J46597_1010878 JGI25165J46597_10108782 252
681 3300003215 JGI25153J46596_10001121 JGI25153J46596_1000112110 252
682 3300003215 JGI25153J46596_10002750 JGI25153J46596_100027502 252
683 3300003215 JGI25153J46596_10002825 JGI25153J46596_1000282512 252
684 3300003215 JGI25153J46596_10008914 JGI25153J46596_100089144 252
685 3300003354 JGI25160J50197_1002027 JGI25160J50197_10020277 252
686 3300003354 JGI25160J50197_1014597 JGI25160J50197_10145972 252
687 3300003354 JGI25160J50197_1015874 JGI25160J50197_10158742 252
688 3300003762 Ga0055542_1008165 Ga0055542_10081652 252
689 3300003775 Ga0055524_1045785 Ga0055524_10457851 252
690 3300003794 Ga0055531_10044317 Ga0055531_100443171 252
691 3300005262 Ga0065165_1000394 Ga0065165_10003942 252
692 3300005262 Ga0065165_1010648 Ga0065165_10106483 252
693 3300005262 Ga0065165_1013090 Ga0065165_10130904 252
694 3300005262 Ga0065165_1030460 Ga0065165_10304602 252
695 3300005262 Ga0065165_1036596 Ga0065165_10365962 252
696 3300005327 Ga0070658_10055088 Ga0070658_100550882 252
697 3300005331 Ga0070670_100368031 Ga0070670_1003680311 252
698 3300005339 Ga0070660_100325791 Ga0070660_1003257911 252
699 3300005347 Ga0070668_100133855 Ga0070668_1001338552 252
700 3300005355 Ga0070671_100057432 Ga0070671_1000574322 252
701 3300005434 Ga0070709_10001245 Ga0070709_100012455 252
702 3300005434 Ga0070709_10013557 Ga0070709_100135572 252
703 3300005435 Ga0070714_100002813 Ga0070714_1000028132 252
704 3300005435 Ga0070714_100335359 Ga0070714_1003353592 252
705 3300005436 Ga0070713_100141130 Ga0070713_1001411302 252
706 3300005437 Ga0070710_10018757 Ga0070710_100187572 252
707 3300005437 Ga0070710_10061787 Ga0070710_100617872 252
708 3300005439 Ga0070711_100013370 Ga0070711_1000133704 252
709 3300005455 Ga0070663_100058807 Ga0070663_1000588072 252
710 3300005455 Ga0070663_100156959 Ga0070663_1001569592 252
711 3300005457 Ga0070662_100328034 Ga0070662_1003280341 252
712 3300005548 Ga0070665_100250822 Ga0070665_1002508224 252
713 3300005563 Ga0068855_100548497 Ga0068855_1005484972 252
714 3300005614 Ga0068856_100058656 Ga0068856_1000586562 252
715 3300005616 Ga0068852_100024877 Ga0068852_1000248772 252
716 3300005616 Ga0068852_100223513 Ga0068852_1002235131 252
717 3300005616 Ga0068852_100470325 Ga0068852_1004703252 252
718 3300005616 Ga0068852_100563289 Ga0068852_1005632892 252
719 3300005842 Ga0068858_100165501 Ga0068858_1001655012 252
720 3300006028 Ga0070717_10001828 Ga0070717_100018286 252
721 3300006038 Ga0075365_10021338 Ga0075365_100213384 252
722 3300006048 Ga0075363_100031431 Ga0075363_1000314312 252
723 3300006051 Ga0075364_10163150 Ga0075364_101631502 252
724 3300006163 Ga0070715_10028685 Ga0070715_100286852 252
725 3300006173 Ga0070716_100003314 Ga0070716_1000033143 252
726 3300006186 Ga0075369_10060432 Ga0075369_100604322 252
727 3300006186 Ga0075369_10070240 Ga0075369_100702402 252
728 3300006186 Ga0075369_10075854 Ga0075369_100758542 252
729 3300006195 Ga0075366_10037086 Ga0075366_100370863 252
730 3300006195 Ga0075366_10138086 Ga0075366_101380862 252
731 3300006353 Ga0075370_10020659 Ga0075370_100206593 252
732 3300006941 Ga0099825_1033686 Ga0099825_10336862 252
733 3300009093 Ga0105240_10005091 Ga0105240_100050914 252
734 3300009174 Ga0105241_10034947 Ga0105241_100349472 252
735 3300009174 Ga0105241_10666452 Ga0105241_106664521 252
736 3300009176 Ga0105242_10269003 Ga0105242_102690032 252
737 3300009545 Ga0105237_10003248 Ga0105237_1000324810 252
738 3300009545 Ga0105237_10571842 Ga0105237_105718421 252
739 3300010375 Ga0105239_10057214 Ga0105239_100572142 252
740 3300010375 Ga0105239_10374794 Ga0105239_103747942 252
741 3300013296 Ga0157374_10454849 Ga0157374_104548492 252
742 3300013306 Ga0163162_10325077 Ga0163162_103250772 252
743 3300013308 Ga0157375_10124674 Ga0157375_101246743 252
744 3300014968 Ga0157379_10104499 Ga0157379_101044992 252
745 3300021320 Ga0214544_1000508 Ga0214544_100050813 252
746 3300021321 Ga0214542_1000365 Ga0214542_100036513 252
747 3300021324 Ga0214545_1000211 Ga0214545_100021163 252
748 3300021327 Ga0214543_1001183 Ga0214543_100118333 252
749 3300025253 Ga0209677_103323 Ga0209677_1033234 252
750 3300025254 Ga0209148_1000372 Ga0209148_100037232 252
751 3300025261 Ga0209233_1004360 Ga0209233_10043601 252
752 3300025261 Ga0209233_1008576 Ga0209233_10085762 252
753 3300025272 Ga0209455_1004512 Ga0209455_10045122 252
754 3300025295 Ga0209564_1019612 Ga0209564_10196121 252
755 3300025295 Ga0209564_1035276 Ga0209564_10352761 252
756 3300025297 Ga0209758_1000021 Ga0209758_1000021274 252
757 3300025297 Ga0209758_1001014 Ga0209758_100101428 252
758 3300025297 Ga0209758_1001422 Ga0209758_10014228 252
759 3300025297 Ga0209758_1004009 Ga0209758_10040093 252
760 3300025297 Ga0209758_1037457 Ga0209758_10374571 252
761 3300025299 Ga0209256_1001447 Ga0209256_100144717 252
762 3300025299 Ga0209256_1025700 Ga0209256_10257002 252
763 3300025302 Ga0207426_1000229 Ga0207426_100022969 252
764 3300025302 Ga0207426_1001382 Ga0207426_10013829 252
765 3300025302 Ga0207426_1006133 Ga0207426_10061333 252
766 3300025302 Ga0207426_1041902 Ga0207426_10419022 252
767 3300025304 Ga0209257_1001279 Ga0209257_10012798 252
768 3300025898 Ga0207692_10001184 Ga0207692_100011842 252
769 3300025898 Ga0207692_10008480 Ga0207692_100084805 252
770 3300025904 Ga0207647_10007587 Ga0207647_100075877 252
771 3300025905 Ga0207685_10049735 Ga0207685_100497352 252
772 3300025906 Ga0207699_10004578 Ga0207699_100045783 252
773 3300025909 Ga0207705_10031591 Ga0207705_100315912 252
774 3300025911 Ga0207654_10040486 Ga0207654_100404862 252
775 3300025913 Ga0207695_10000015 Ga0207695_10000015532 252
776 3300025914 Ga0207671_10001686 Ga0207671_1000168611 252
777 3300025914 Ga0207671_10049902 Ga0207671_100499023 252
778 3300025915 Ga0207693_10019439 Ga0207693_100194394 252
779 3300025915 Ga0207693_10025787 Ga0207693_100257872 252
780 3300025916 Ga0207663_10000743 Ga0207663_1000074310 252
781 3300025920 Ga0207649_10107123 Ga0207649_101071232 252
782 3300025921 Ga0207652_10004715 Ga0207652_100047152 252
783 3300025928 Ga0207700_10042066 Ga0207700_100420662 252
784 3300025928 Ga0207700_10132212 Ga0207700_101322122 252
785 3300025929 Ga0207664_10017290 Ga0207664_100172903 252
786 3300025939 Ga0207665_10002246 Ga0207665_1000224610 252
787 3300025941 Ga0207711_10078698 Ga0207711_100786982 252
788 3300025972 Ga0207668_10105748 Ga0207668_101057482 252
789 3300025981 Ga0207640_10109328 Ga0207640_101093282 252
790 3300025981 Ga0207640_10203984 Ga0207640_102039841 252
791 3300025986 Ga0207658_10089179 Ga0207658_100891792 252
792 3300026067 Ga0207678_10027583 Ga0207678_100275836 252
793 3300026088 Ga0207641_10172250 Ga0207641_101722502 252
794 3300026089 Ga0207648_10210859 Ga0207648_102108592 252
795 3300026116 Ga0207674_10213186 Ga0207674_102131862 252
796 3300026121 Ga0207683_10087032 Ga0207683_100870324 252
797 3300026142 Ga0207698_10033737 Ga0207698_100337372 252
798 3300027296 Ga0209389_1000041 Ga0209389_100004111 252
799 3300027363 Ga0209700_100010 Ga0209700_100010308 252
800 3300028379 Ga0268266_10241882 Ga0268266_102418824 252
801 3300031507 Ga0307509_10249461 Ga0307509_102494612 252
802 3300033180 Ga0307510_10016740 Ga0307510_100167403 252
803 3300033180 Ga0307510_10033199 Ga0307510_100331994 252
804 3300033180 Ga0307510_10112169 Ga0307510_101121692 252
805 3300037471 Ga0395905_0589380 Ga0395905_0589380_112_882 252
806 3300044658 Ga0466972_0000532 Ga0466972_0000532_14690_15460 252
807 3300044684 Ga0466966_0000615 Ga0466966_0000615_7710_8480 252
808 3300044693 Ga0466961_0000007 Ga0466961_0000007_60379_61149 252
809 3300044694 Ga0466963_0081869 Ga0466963_0081869_636_1406 252
810 3300044765 Ga0466970_0118892 Ga0466970_0118892_374_1144 252
811 3300044901 Ga0466960_0191535 Ga0466960_0191535_164_934 252
812 3300045976 Ga0466967_0056365 Ga0466967_0056365_1227_1997 252
813 3300046454 Ga0495592_0033422 Ga0495592_0033422_214_984 252
814 3300046459 Ga0495629_0020296 Ga0495629_0020296_3923_4693 252
815 3300046460 Ga0495638_0048710 Ga0495638_0048710_1588_2358 252
816 3300046462 Ga0495651_0006121 Ga0495651_0006121_2522_3292 252
817 3300046471 Ga0495650_0050059 Ga0495650_0050059_610_1380 252
818 3300046473 Ga0495582_0167152 Ga0495582_0167152_402_1172 252
819 3300046477 Ga0495664_0025321 Ga0495664_0025321_458_1228 252
820 3300046501 Ga0495607_0076704 Ga0495607_0076704_1042_1818 252
821 3300046506 Ga0495583_0031803 Ga0495583_0031803_40_810 252
822 3300046511 Ga0495608_0118648 Ga0495608_0118648_239_1009 252
823 3300046516 Ga0495628_0017546 Ga0495628_0017546_3723_4493 252
824 3300046522 Ga0495643_0038350 Ga0495643_0038350_1054_1824 252
825 3300046524 Ga0495648_0097817 Ga0495648_0097817_574_1344 252
826 3300046528 Ga0495642_0140679 Ga0495642_0140679_173_943 252
827 3300046529 Ga0495652_0090656 Ga0495652_0090656_573_1343 252
828 3300046536 Ga0495587_0028494 Ga0495587_0028494_333_1103 252
829 3300046543 Ga0495645_0009152 Ga0495645_0009152_5110_5880 252
830 3300046557 Ga0495622_0036742 Ga0495622_0036742_397_1167 252
831 3300046557 Ga0495622_0175124 Ga0495622_0175124_130_900 252
832 3300046559 Ga0495667_0008571 Ga0495667_0008571_3778_4548 252
833 3300046663 Ga0495635_0054715 Ga0495635_0054715_376_1146 252
834 3300046674 Ga0495588_0067236 Ga0495588_0067236_781_1551 252
835 3300046675 Ga0495657_0022842 Ga0495657_0022842_617_1387 252
836 3300046675 Ga0495657_0033017 Ga0495657_0033017_307_1077 252
837 3300046678 Ga0495599_0074439 Ga0495599_0074439_521_1291 252
838 3300046679 Ga0495623_0039468 Ga0495623_0039468_291_1061 252
839 3300046680 Ga0495646_0030813 Ga0495646_0030813_1596_2366 252
840 3300046683 Ga0495658_0378929 Ga0495658_0378929_53_823 252
841 3300046689 Ga0495613_0027201 Ga0495613_0027201_1119_1889 252
842 3300046690 Ga0495624_0056555 Ga0495624_0056555_410_1180 252
843 3300046694 Ga0495649_0084615 Ga0495649_0084615_540_1310 252
844 3300046809 Ga0495600_0004522 Ga0495600_0004522_3188_3958 252
845 3300046809 Ga0495600_0313018 Ga0495600_0313018_185_955 252
846 3300047317 Ga0495604_0000837 Ga0495604_0000837_1376_2146 252
847 3300047317 Ga0495604_0023476 Ga0495604_0023476_3022_3792 252
848 3300047319 Ga0495674_0081432 Ga0495674_0081432_624_1394 252
849 3300047321 Ga0495676_0033591 Ga0495676_0033591_3276_4046 252
850 3300047322 Ga0495680_0003829 Ga0495680_0003829_4883_5653 252
851 3300047443 Ga0495687_031352 Ga0495687_031352_1150_1920 252
852 3300047444 Ga0495675_0050477 Ga0495675_0050477_1470_2240 252
853 3300047469 Ga0495673_0053769 Ga0495673_0053769_382_1152 252
854 3300047469 Ga0495673_0089278 Ga0495673_0089278_101_871 252
855 3300047673 Ga0495593_0048739 Ga0495593_0048739_930_1700 252
856 3300048088 Ga0495602_0018479 Ga0495602_0018479_1384_2154 252
857 3300048903 Ga0496100_0385911 Ga0496100_0385911_90_860 252
858 3300048904 Ga0496101_0114579 Ga0496101_0114579_448_1218 252
859 3300048905 Ga0496102_0128475 Ga0496102_0128475_764_1534 252
860 3300048906 Ga0496103_0095313 Ga0496103_0095313_20_790 252
861 3300048908 Ga0496105_0008671 Ga0496105_0008671_1392_2162 252
862 3300048908 Ga0496105_0094063 Ga0496105_0094063_198_968 252
863 3300048911 Ga0496108_0094194 Ga0496108_0094194_939_1709 252
864 3300048914 Ga0496111_0374064 Ga0496111_0374064_66_836 252
865 3300048915 Ga0496112_0169300 Ga0496112_0169300_974_1744 252
866 3300048916 Ga0496113_0138153 Ga0496113_0138153_147_917 252
867 3300048916 Ga0496113_0253750 Ga0496113_0253750_348_1118 252
868 3300048917 Ga0496114_0253237 Ga0496114_0253237_472_1242 252
869 3300048919 Ga0496116_0044890 Ga0496116_0044890_1615_2385 252
870 3300048920 Ga0496117_0215115 Ga0496117_0215115_228_998 252
871 3300048922 Ga0496119_0125185 Ga0496119_0125185_390_1160 252
872 3300048922 Ga0496119_0129507 Ga0496119_0129507_328_1098 252
873 3300048922 Ga0496119_0160573 Ga0496119_0160573_376_1146 252
874 3300048923 Ga0496120_0016845 Ga0496120_0016845_1603_2373 252
875 3300048923 Ga0496120_0194959 Ga0496120_0194959_171_947 252
876 3300048924 Ga0496121_0027588 Ga0496121_0027588_1914_2684 252
877 3300048925 Ga0496122_0122205 Ga0496122_0122205_707_1477 252
878 3300048928 Ga0496125_0067791 Ga0496125_0067791_1845_2615 252
879 3300048928 Ga0496125_0232300 Ga0496125_0232300_176_946 252
880 3300048929 Ga0496126_0148315 Ga0496126_0148315_1229_1999 252
881 3300049460 Ga0495682_0005454 Ga0495682_0005454_915_1685 252
882 3300050492 nmdc:mga0yw44_42521_c1 nmdc:mga0yw44_42521_c1_1315_2085 252
883 3300050493 nmdc:mga0k408_49683_c1 nmdc:mga0k408_49683_c1_1425_2195 252
884 3300050495 nmdc:mga04h51_12545_c1 nmdc:mga04h51_12545_c1_49_819 252
885 3300050496 nmdc:mga07m45_82734_c1 nmdc:mga07m45_82734_c1_479_1255 252
886 3300050512 nmdc:mga0n895_6973_c1 nmdc:mga0n895_6973_c1_6864_7637 252
887 3300050515 nmdc:mga0a205_136311_c1 nmdc:mga0a205_136311_c1_83_856 252
888 3300050516 nmdc:mga0sz30_32196_c1 nmdc:mga0sz30_32196_c1_1225_2001 252
889 3300050516 nmdc:mga0sz30_88943_c1 nmdc:mga0sz30_88943_c1_69_842 252
890 3300053084 Ga0495595_0149636 Ga0495595_0149636_348_1118 252
891 3300053085 Ga0495619_0051990 Ga0495619_0051990_1806_2576 252
892 3300053086 Ga0500578_0083432 Ga0500578_0083432_527_1297 252
893 3300053086 Ga0500578_0147009 Ga0500578_0147009_186_956 252
894 3300053090 Ga0500646_0092678 Ga0500646_0092678_100_870 252
895 3300053096 Ga0500641_0073989 Ga0500641_0073989_521_1291 252
896 3300053103 Ga0500555_008678 Ga0500555_008678_811_1581 252
897 3300053105 Ga0500557_000042 Ga0500557_000042_61541_62311 252
898 3300053108 Ga0500562_015375 Ga0500562_015375_833_1603 252
899 3300053111 Ga0500572_008732 Ga0500572_008732_30_800 252
900 3300053116 Ga0500592_005237 Ga0500592_005237_125_895 252
901 3300053121 Ga0500607_038348 Ga0500607_038348_379_1149 252
902 3300053130 Ga0500642_0000112 Ga0500642_0000112_28761_29531 252
903 3300053130 Ga0500642_0040984 Ga0500642_0040984_258_1028 252
904 3300053136 Ga0500559_0123207 Ga0500559_0123207_380_1150 252
905 3300053138 Ga0500564_058794 Ga0500564_058794_668_1438 252
906 3300053146 Ga0500588_0047387 Ga0500588_0047387_194_964 252
907 3300053153 Ga0500616_0039187 Ga0500616_0039187_481_1251 252
908 3300053154 Ga0500619_011239 Ga0500619_011239_161_931 252
909 3300053156 Ga0500622_0011931 Ga0500622_0011931_3895_4665 252
910 3300053177 Ga0500636_0000061 Ga0500636_0000061_29252_30022 252
911 3300053178 Ga0500637_0155603 Ga0500637_0155603_219_989 252
912 3300053722 Ga0500649_136169 Ga0500649_136169_58_828 252
913 3300053729 Ga0500625_019916 Ga0500625_019916_2120_2890 252
914 3300053731 Ga0500609_003186 Ga0500609_003186_29_799 252
915 3300053737 Ga0500601_000332 Ga0500601_000332_4281_5051 252
916 3300055283 Ga0500661_018213 Ga0500661_018213_161_931 252
917 iso_pu_bacteria 2513237101 2513692103 252
918 iso_pu_bacteria 2721755755 2723845524 252
919 iso_pu_bacteria 2791355199 2793082649 252
920 iso_pu_bacteria 2874604998 2874607583 252
921 iso_pu_bacteria 2889033259 2889040302 252
922 iso_pu_bacteria 2922361189 2922368200 252
923 iso_pu_bacteria 2922386360 2922388325 252
924 iso_pu_bacteria 8006984368 8006985645 252
925 iso_pu_bacteria 8006994254 8007000194 252
926 iso_pu_bacteria 8056673599 8056674261 252
927 3300005334 Ga0068869_100100381 Ga0068869_1001003812 253
928 3300005364 Ga0070673_100687102 Ga0070673_1006871021 253
929 3300005456 Ga0070678_100460397 Ga0070678_1004603971 253
930 3300006028 Ga0070717_10339160 Ga0070717_103391602 253
931 3300006051 Ga0075364_10049228 Ga0075364_100492283 253
932 3300006178 Ga0075367_10055588 Ga0075367_100555882 253
933 3300013297 Ga0157378_10212703 Ga0157378_102127031 253
934 3300025261 Ga0209233_1008000 Ga0209233_10080002 253
935 3300025295 Ga0209564_1005852 Ga0209564_10058523 253
936 3300025942 Ga0207689_10239339 Ga0207689_102393392 253
937 3300026067 Ga0207678_10174693 Ga0207678_101746932 253
938 3300031852 Ga0307410_10293668 Ga0307410_102936681 253
939 3300031901 Ga0307406_10057670 Ga0307406_100576702 253
940 3300031995 Ga0307409_100651119 Ga0307409_1006511191 253
941 3300037418 Ga0395900_0000917 Ga0395900_0000917_24933_25712 253
942 3300037466 Ga0395898_0018861 Ga0395898_0018861_6221_7000 253
943 3300038443 Ga0395901_0199004 Ga0395901_0199004_1133_1912 253
944 3300039437 Ga0436365_1698108 Ga0436365_1698108_568_1344 253
945 3300039438 Ga0436360_1064741 Ga0436360_1064741_44_817 253
946 3300044656 Ga0466969_0153801 Ga0466969_0153801_131_904 253
947 3300044842 Ga0466957_0100383 Ga0466957_0100383_704_1492 253
948 3300047469 Ga0495673_0024739 Ga0495673_0024739_486_1262 253
949 3300048913 Ga0496110_0683898 Ga0496110_0683898_64_861 253
950 3300048923 Ga0496120_0029408 Ga0496120_0029408_2069_2833 253
951 3300050491 nmdc:mga00v17_250529_c1 nmdc:mga00v17_250529_c1_144_908 253
952 3300053096 Ga0500641_0004927 Ga0500641_0004927_3818_4597 253
953 3300005434 Ga0070709_10573529 Ga0070709_105735291 254
954 3300005436 Ga0070713_100035160 Ga0070713_1000351602 254
955 3300005444 Ga0070694_100374031 Ga0070694_1003740311 254
956 3300005468 Ga0070707_100269455 Ga0070707_1002694552 254
957 3300005471 Ga0070698_100190960 Ga0070698_1001909602 254
958 3300005530 Ga0070679_100254685 Ga0070679_1002546852 254
959 3300005539 Ga0068853_100190357 Ga0068853_1001903572 254
960 3300005547 Ga0070693_100030193 Ga0070693_1000301932 254
961 3300005614 Ga0068856_100162321 Ga0068856_1001623212 254
962 3300009093 Ga0105240_10041630 Ga0105240_100416302 254
963 3300013104 Ga0157370_10102433 Ga0157370_101024332 254
964 3300013104 Ga0157370_10388545 Ga0157370_103885452 254
965 3300013105 Ga0157369_10017985 Ga0157369_100179852 254
966 3300013105 Ga0157369_10044826 Ga0157369_100448262 254
967 3300020069 Ga0197907_11314946 Ga0197907_113149462 254
968 3300022467 Ga0224712_10034960 Ga0224712_100349602 254
969 3300025912 Ga0207707_10055246 Ga0207707_100552462 254
970 3300025913 Ga0207695_10016962 Ga0207695_100169624 254
971 3300025921 Ga0207652_10200912 Ga0207652_102009122 254
972 3300025928 Ga0207700_10117624 Ga0207700_101176242 254
973 3300025929 Ga0207664_10030551 Ga0207664_100305513 254
974 3300025929 Ga0207664_10190703 Ga0207664_101907032 254
975 3300026075 Ga0207708_10345253 Ga0207708_103452532 254
976 3300026078 Ga0207702_10036786 Ga0207702_100367863 254
977 3300031730 Ga0307516_10327093 Ga0307516_103270932 254
978 3300038443 Ga0395901_0151265 Ga0395901_0151265_1310_2080 254
979 3300039447 Ga0436361_0810566 Ga0436361_0810566_744_1523 254
980 3300048922 Ga0496119_0044789 Ga0496119_0044789_1373_2185 254
981 3300049568 Ga0501031_0034955 Ga0501031_0034955_352_1122 254
982 3300049569 Ga0501032_0002923 Ga0501032_0002923_5069_5839 254
983 3300049570 Ga0501033_0003921 Ga0501033_0003921_6241_7011 254
984 3300049571 Ga0501034_0057729 Ga0501034_0057729_372_1142 254
985 3300049571 Ga0501034_0062059 Ga0501034_0062059_653_1423 254
986 3300049571 Ga0501034_0294457 Ga0501034_0294457_470_1240 254
987 3300049572 Ga0501036_0122137 Ga0501036_0122137_1114_1884 254
988 3300049573 Ga0501037_0124516 Ga0501037_0124516_551_1321 254
989 3300049574 Ga0501038_0023339 Ga0501038_0023339_4322_5092 254
990 3300049574 Ga0501038_0441727 Ga0501038_0441727_30_800 254
991 3300049575 Ga0501039_0215801 Ga0501039_0215801_559_1329 254
992 3300049576 Ga0501040_0053418 Ga0501040_0053418_266_1036 254
993 3300049579 Ga0501043_0035118 Ga0501043_0035118_628_1398 254
994 3300049579 Ga0501043_0048514 Ga0501043_0048514_862_1632 254
995 3300049582 Ga0501048_0081398 Ga0501048_0081398_1114_1884 254
996 3300049583 Ga0501067_0007483 Ga0501067_0007483_1553_2323 254
997 3300049585 Ga0501069_0053916 Ga0501069_0053916_250_1020 254
998 3300049586 Ga0501070_0309036 Ga0501070_0309036_215_985 254
999 3300049586 Ga0501070_0317015 Ga0501070_0317015_125_895 254
1000 3300049587 Ga0501071_0131744 Ga0501071_0131744_32_802 254
1001 3300049588 Ga0501072_0004340 Ga0501072_0004340_2677_3447 254
1002 3300049589 Ga0501073_0013455 Ga0501073_0013455_4195_4965 254
1003 3300049590 Ga0501074_0005873 Ga0501074_0005873_4301_5071 254
1004 3300049741 Ga0501079_0046540 Ga0501079_0046540_823_1593 254
1005 3300049822 Ga0501035_0174631 Ga0501035_0174631_897_1667 254
1006 3300049823 Ga0501044_0018863 Ga0501044_0018863_4076_4846 254
1007 3300049823 Ga0501044_0095558 Ga0501044_0095558_1793_2563 254
1008 3300049824 Ga0501045_0012975 Ga0501045_0012975_4439_5209 254
1009 3300054114 Ga0501084_0217929 Ga0501084_0217929_258_1028 254
1010 3300060353 Ga0501082_0397004 Ga0501082_0397004_360_1130 254
1011 3300005339 Ga0070660_100374332 Ga0070660_1003743322 255
1012 3300005563 Ga0068855_100602110 Ga0068855_1006021102 255
1013 3300005983 Ga0081540_1000683 Ga0081540_10006834 255
1014 3300005983 Ga0081540_1019314 Ga0081540_10193142 255
1015 3300005983 Ga0081540_1031817 Ga0081540_10318172 255
1016 3300006028 Ga0070717_10024964 Ga0070717_100249643 255
1017 3300006038 Ga0075365_10204633 Ga0075365_102046332 255
1018 3300006177 Ga0075362_10095584 Ga0075362_100955842 255
1019 3300006353 Ga0075370_10015344 Ga0075370_100153441 255
1020 3300006942 Ga0099824_1004774 Ga0099824_100477413 255
1021 3300006943 Ga0099822_1001842 Ga0099822_10018427 255
1022 3300007788 Ga0099795_10088120 Ga0099795_100881202 255
1023 3300013104 Ga0157370_10430605 Ga0157370_104306052 255
1024 3300013307 Ga0157372_10354872 Ga0157372_103548722 255
1025 3300014969 Ga0157376_10410937 Ga0157376_104109372 255
1026 3300021361 Ga0213872_10069664 Ga0213872_100696642 255
1027 3300025900 Ga0207710_10016522 Ga0207710_100165222 255
1028 3300025919 Ga0207657_10194332 Ga0207657_101943322 255
1029 3300025972 Ga0207668_10205216 Ga0207668_102052162 255
1030 3300027357 Ga0209589_1000003 Ga0209589_1000003245 255
1031 3300027361 Ga0209489_100003 Ga0209489_100003296 255
1032 3300027363 Ga0209700_100003 Ga0209700_100003296 255
1033 3300027512 Ga0209179_1001806 Ga0209179_10018062 255
1034 3300031730 Ga0307516_10008049 Ga0307516_100080494 255
1035 3300031852 Ga0307410_10310420 Ga0307410_103104202 255
1036 3300033179 Ga0307507_10014311 Ga0307507_100143113 255
1037 3300035171 Ga0373946_0252510 Ga0373946_0252510_59_841 255
1038 3300035410 Ga0373924_0052083 Ga0373924_0052083_770_1552 255
1039 3300035692 Ga0373935_0118799 Ga0373935_0118799_203_985 255
1040 3300035695 Ga0373927_0031976 Ga0373927_0031976_477_1256 255
1041 3300035695 Ga0373927_0063185 Ga0373927_0063185_1194_1976 255
1042 3300036401 Ga0373937_0125556 Ga0373937_0125556_1186_1968 255
1043 3300037466 Ga0395898_0363657 Ga0395898_0363657_156_932 255
1044 3300046455 Ga0495603_0201246 Ga0495603_0201246_23_805 255
1045 3300046460 Ga0495638_0025097 Ga0495638_0025097_63_833 255
1046 3300046460 Ga0495638_0181733 Ga0495638_0181733_367_1137 255
1047 3300046477 Ga0495664_0008978 Ga0495664_0008978_3503_4285 255
1048 3300046501 Ga0495607_0081498 Ga0495607_0081498_524_1294 255
1049 3300046506 Ga0495583_0095735 Ga0495583_0095735_184_954 255
1050 3300046515 Ga0495620_0043676 Ga0495620_0043676_517_1287 255
1051 3300046516 Ga0495628_0335630 Ga0495628_0335630_215_997 255
1052 3300046517 Ga0495630_0069212 Ga0495630_0069212_1192_1974 255
1053 3300046520 Ga0495637_0151663 Ga0495637_0151663_62_832 255
1054 3300046530 Ga0495654_0013914 Ga0495654_0013914_3367_4137 255
1055 3300046557 Ga0495622_0021392 Ga0495622_0021392_396_1175 255
1056 3300046557 Ga0495622_0075623 Ga0495622_0075623_602_1390 255
1057 3300046558 Ga0495633_0139772 Ga0495633_0139772_227_994 255
1058 3300046663 Ga0495635_0024280 Ga0495635_0024280_3328_4110 255
1059 3300046681 Ga0495647_0009627 Ga0495647_0009627_1574_2356 255
1060 3300046684 Ga0495669_0117580 Ga0495669_0117580_193_960 255
1061 3300046690 Ga0495624_0281662 Ga0495624_0281662_26_793 255
1062 3300046690 Ga0495624_0349439 Ga0495624_0349439_55_837 255
1063 3300046691 Ga0495670_0005738 Ga0495670_0005738_4885_5655 255
1064 3300047315 Ga0495581_0017695 Ga0495581_0017695_1774_2556 255
1065 3300047317 Ga0495604_0345809 Ga0495604_0345809_101_916 255
1066 3300047319 Ga0495674_0016464 Ga0495674_0016464_3674_4456 255
1067 3300047472 Ga0495686_0164213 Ga0495686_0164213_34_804 255
1068 3300047673 Ga0495593_0050152 Ga0495593_0050152_1268_2050 255
1069 3300048920 Ga0496117_0099583 Ga0496117_0099583_215_985 255
1070 3300048921 Ga0496118_0058993 Ga0496118_0058993_818_1588 255
1071 3300048921 Ga0496118_0154757 Ga0496118_0154757_171_941 255
1072 3300048923 Ga0496120_0015096 Ga0496120_0015096_793_1569 255
1073 3300048924 Ga0496121_0221919 Ga0496121_0221919_146_916 255
1074 3300048925 Ga0496122_0105434 Ga0496122_0105434_394_1164 255
1075 3300048926 Ga0496123_0024142 Ga0496123_0024142_3844_4614 255
1076 3300048928 Ga0496125_0007002 Ga0496125_0007002_10410_11180 255
1077 3300048929 Ga0496126_0171434 Ga0496126_0171434_684_1454 255
1078 3300048929 Ga0496126_0227182 Ga0496126_0227182_408_1187 255
1079 3300049568 Ga0501031_0003006 Ga0501031_0003006_246_1022 255
1080 3300049569 Ga0501032_0000316 Ga0501032_0000316_37172_37948 255
1081 3300049570 Ga0501033_0000025 Ga0501033_0000025_93821_94597 255
1082 3300049571 Ga0501034_0000177 Ga0501034_0000177_3484_4260 255
1083 3300049572 Ga0501036_0000167 Ga0501036_0000167_4861_5637 255
1084 3300049573 Ga0501037_0000034 Ga0501037_0000034_121615_122391 255
1085 3300049574 Ga0501038_0000029 Ga0501038_0000029_20360_21136 255
1086 3300049575 Ga0501039_0001343 Ga0501039_0001343_15119_15895 255
1087 3300049579 Ga0501043_0000067 Ga0501043_0000067_56104_56880 255
1088 3300049580 Ga0501046_0000479 Ga0501046_0000479_11895_12671 255
1089 3300049581 Ga0501047_0000061 Ga0501047_0000061_68056_68832 255
1090 3300049582 Ga0501048_0000009 Ga0501048_0000009_76478_77254 255
1091 3300049583 Ga0501067_0000132 Ga0501067_0000132_16000_16776 255
1092 3300049584 Ga0501068_0005703 Ga0501068_0005703_5562_6338 255
1093 3300049585 Ga0501069_0044802 Ga0501069_0044802_219_995 255
1094 3300049586 Ga0501070_0000563 Ga0501070_0000563_21747_22523 255
1095 3300049588 Ga0501072_0030306 Ga0501072_0030306_381_1157 255
1096 3300049589 Ga0501073_0000365 Ga0501073_0000365_10218_10994 255
1097 3300049590 Ga0501074_0000087 Ga0501074_0000087_13474_14250 255
1098 3300049592 Ga0501076_0151083 Ga0501076_0151083_41_817 255
1099 3300049741 Ga0501079_0031799 Ga0501079_0031799_2117_2893 255
1100 3300049742 Ga0501080_0001547 Ga0501080_0001547_11331_12107 255
1101 3300049744 Ga0501083_0009601 Ga0501083_0009601_307_1083 255
1102 3300049822 Ga0501035_0001202 Ga0501035_0001202_4213_4989 255
1103 3300049823 Ga0501044_0000028 Ga0501044_0000028_96297_97073 255
1104 3300050492 nmdc:mga0yw44_145904_c1 nmdc:mga0yw44_145904_c1_548_1318 255
1105 3300053077 Ga0495601_0159845 Ga0495601_0159845_190_972 255
1106 3300053078 Ga0495612_0031780 Ga0495612_0031780_695_1477 255
1107 3300053086 Ga0500578_0097217 Ga0500578_0097217_705_1475 255
1108 3300053089 Ga0500581_119900 Ga0500581_119900_405_1175 255
1109 3300053090 Ga0500646_0004603 Ga0500646_0004603_395_1165 255
1110 3300053093 Ga0500651_0065429 Ga0500651_0065429_696_1514 255
1111 3300053093 Ga0500651_0165586 Ga0500651_0165586_489_1259 255
1112 3300053094 Ga0500566_0001115 Ga0500566_0001115_4072_4839 255
1113 3300053094 Ga0500566_0058112 Ga0500566_0058112_1134_1937 255
1114 3300053096 Ga0500641_0004297 Ga0500641_0004297_1142_1921 255
1115 3300053097 Ga0500648_131185 Ga0500648_131185_566_1345 255
1116 3300053098 Ga0500650_0076908 Ga0500650_0076908_647_1417 255
1117 3300053104 Ga0500556_0000002 Ga0500556_0000002_752334_753104 255
1118 3300053118 Ga0500594_0031337 Ga0500594_0031337_233_1051 255
1119 3300053119 Ga0500595_000617 Ga0500595_000617_3249_4064 255
1120 3300053119 Ga0500595_002072 Ga0500595_002072_4725_5492 255
1121 3300053121 Ga0500607_048414 Ga0500607_048414_1370_2140 255
1122 3300053122 Ga0500608_047265 Ga0500608_047265_949_1752 255
1123 3300053130 Ga0500642_0000010 Ga0500642_0000010_70560_71330 255
1124 3300053131 Ga0500652_000720 Ga0500652_000720_415_1185 255
1125 3300053136 Ga0500559_0000430 Ga0500559_0000430_308_1111 255
1126 3300053136 Ga0500559_0128028 Ga0500559_0128028_82_849 255
1127 3300053140 Ga0500573_0105885 Ga0500573_0105885_86_865 255
1128 3300053145 Ga0500586_019764 Ga0500586_019764_980_1750 255
1129 3300053151 Ga0500604_0016566 Ga0500604_0016566_494_1264 255
1130 3300053153 Ga0500616_0000069 Ga0500616_0000069_233038_233808 255
1131 3300053156 Ga0500622_0000972 Ga0500622_0000972_16199_16969 255
1132 3300053160 Ga0500633_0063467 Ga0500633_0063467_386_1156 255
1133 3300053162 Ga0500638_001860 Ga0500638_001860_4399_5166 255
1134 3300053163 Ga0500639_159142 Ga0500639_159142_204_983 255
1135 3300053177 Ga0500636_0068146 Ga0500636_0068146_367_1155 255
1136 3300053178 Ga0500637_0000078 Ga0500637_0000078_11477_12244 255
1137 3300053178 Ga0500637_0255200 Ga0500637_0255200_143_931 255
1138 3300053724 Ga0500570_140124 Ga0500570_140124_68_838 255
1139 3300053735 Ga0500596_004863 Ga0500596_004863_849_1628 255
1140 3300054114 Ga0501084_0001341 Ga0501084_0001341_2730_3506 255
1141 3300055283 Ga0500661_000905 Ga0500661_000905_617_1384 255
1142 3300060353 Ga0501082_0002555 Ga0501082_0002555_8539_9315 255
1143 3300003659 JGI25404J52841_10026278 JGI25404J52841_100262781 256
1144 3300005328 Ga0070676_10219328 Ga0070676_102193282 256
1145 3300005329 Ga0070683_100001741 Ga0070683_1000017414 256
1146 3300005330 Ga0070690_100162646 Ga0070690_1001626461 256
1147 3300005336 Ga0070680_100019780 Ga0070680_1000197802 256
1148 3300005341 Ga0070691_10071209 Ga0070691_100712092 256
1149 3300005344 Ga0070661_100390503 Ga0070661_1003905032 256
1150 3300005347 Ga0070668_100106427 Ga0070668_1001064272 256
1151 3300005438 Ga0070701_10156475 Ga0070701_101564751 256
1152 3300005456 Ga0070678_100012438 Ga0070678_1000124384 256
1153 3300005458 Ga0070681_10005973 Ga0070681_100059734 256
1154 3300005458 Ga0070681_10457618 Ga0070681_104576181 256
1155 3300005459 Ga0068867_100034125 Ga0068867_1000341252 256
1156 3300005466 Ga0070685_10416625 Ga0070685_104166251 256
1157 3300005530 Ga0070679_100124368 Ga0070679_1001243682 256
1158 3300005530 Ga0070679_100662334 Ga0070679_1006623341 256
1159 3300005535 Ga0070684_100002282 Ga0070684_10000228212 256
1160 3300005547 Ga0070693_100116009 Ga0070693_1001160093 256
1161 3300005547 Ga0070693_100205784 Ga0070693_1002057841 256
1162 3300005548 Ga0070665_100154903 Ga0070665_1001549032 256
1163 3300005548 Ga0070665_100695863 Ga0070665_1006958631 256
1164 3300005564 Ga0070664_100363863 Ga0070664_1003638632 256
1165 3300005577 Ga0068857_100092655 Ga0068857_1000926552 256
1166 3300005719 Ga0068861_100216164 Ga0068861_1002161642 256
1167 3300005937 Ga0081455_10024799 Ga0081455_100247992 256
1168 3300005937 Ga0081455_10058007 Ga0081455_100580072 256
1169 3300005983 Ga0081540_1013357 Ga0081540_10133575 256
1170 3300005983 Ga0081540_1117739 Ga0081540_11177391 256
1171 3300005985 Ga0081539_10020634 Ga0081539_100206343 256
1172 3300006237 Ga0097621_100072481 Ga0097621_1000724812 256
1173 3300006353 Ga0075370_10008424 Ga0075370_100084241 256
1174 3300006844 Ga0075428_100171201 Ga0075428_1001712012 256
1175 3300006881 Ga0068865_100066760 Ga0068865_1000667602 256
1176 3300009174 Ga0105241_10082432 Ga0105241_100824322 256
1177 3300009545 Ga0105237_10214974 Ga0105237_102149742 256
1178 3300009545 Ga0105237_10238473 Ga0105237_102384732 256
1179 3300009551 Ga0105238_10036661 Ga0105238_100366615 256
1180 3300009553 Ga0105249_10369636 Ga0105249_103696362 256
1181 3300010159 Ga0099796_10015790 Ga0099796_100157902 256
1182 3300010375 Ga0105239_10323066 Ga0105239_103230663 256
1183 3300013105 Ga0157369_10008681 Ga0157369_100086816 256
1184 3300013307 Ga0157372_10367736 Ga0157372_103677362 256
1185 3300013307 Ga0157372_10499081 Ga0157372_104990811 256
1186 3300025261 Ga0209233_1002279 Ga0209233_10022798 256
1187 3300025297 Ga0209758_1012938 Ga0209758_10129382 256
1188 3300025297 Ga0209758_1018304 Ga0209758_10183042 256
1189 3300025901 Ga0207688_10121644 Ga0207688_101216441 256
1190 3300025907 Ga0207645_10422101 Ga0207645_104221011 256
1191 3300025908 Ga0207643_10128219 Ga0207643_101282191 256
1192 3300025911 Ga0207654_10179272 Ga0207654_101792721 256
1193 3300025912 Ga0207707_10000542 Ga0207707_1000054222 256
1194 3300025912 Ga0207707_10044879 Ga0207707_100448793 256
1195 3300025914 Ga0207671_10199253 Ga0207671_101992532 256
1196 3300025914 Ga0207671_10230629 Ga0207671_102306292 256
1197 3300025921 Ga0207652_10027091 Ga0207652_100270912 256
1198 3300025921 Ga0207652_10257196 Ga0207652_102571962 256
1199 3300025924 Ga0207694_10190923 Ga0207694_101909232 256
1200 3300025924 Ga0207694_10281121 Ga0207694_102811212 256
1201 3300025933 Ga0207706_10127345 Ga0207706_101273452 256
1202 3300025944 Ga0207661_10040524 Ga0207661_100405243 256
1203 3300025949 Ga0207667_10211168 Ga0207667_102111682 256
1204 3300025961 Ga0207712_10100821 Ga0207712_101008212 256
1205 3300026041 Ga0207639_10196994 Ga0207639_101969942 256
1206 3300026067 Ga0207678_10056344 Ga0207678_100563441 256
1207 3300026116 Ga0207674_10170778 Ga0207674_101707781 256
1208 3300026118 Ga0207675_100070518 Ga0207675_1000705181 256
1209 3300028379 Ga0268266_10002176 Ga0268266_1000217616 256
1210 3300028379 Ga0268266_10020579 Ga0268266_100205797 256
1211 3300028786 Ga0307517_10259351 Ga0307517_102593511 256
1212 3300035113 Ga0373936_0002352 Ga0373936_0002352_370_1158 256
1213 3300037312 Ga0395899_0019671 Ga0395899_0019671_3439_4218 256
1214 3300037466 Ga0395898_0086189 Ga0395898_0086189_590_1369 256
1215 3300038443 Ga0395901_0267252 Ga0395901_0267252_812_1591 256
1216 3300045976 Ga0466967_0566753 Ga0466967_0566753_204_989 256
1217 3300046543 Ga0495645_0039319 Ga0495645_0039319_1650_2435 256
1218 3300047445 Ga0495677_0090585 Ga0495677_0090585_187_972 256
1219 3300048912 Ga0496109_0532331 Ga0496109_0532331_46_828 256
1220 3300048916 Ga0496113_0259287 Ga0496113_0259287_532_1317 256
1221 3300048920 Ga0496117_0018780 Ga0496117_0018780_400_1218 256
1222 3300048921 Ga0496118_0158428 Ga0496118_0158428_67_885 256
1223 3300048924 Ga0496121_0014891 Ga0496121_0014891_3562_4380 256
1224 3300048924 Ga0496121_0092827 Ga0496121_0092827_824_1609 256
1225 3300048928 Ga0496125_0000847 Ga0496125_0000847_9787_10560 256
1226 3300048928 Ga0496125_0001679 Ga0496125_0001679_9651_10424 256
1227 3300048929 Ga0496126_0039491 Ga0496126_0039491_1262_2035 256
1228 3300048929 Ga0496126_0081901 Ga0496126_0081901_1151_1960 256
1229 3300048929 Ga0496126_0142094 Ga0496126_0142094_226_999 256
1230 3300048929 Ga0496126_0411230 Ga0496126_0411230_232_1005 256
1231 3300049568 Ga0501031_0114201 Ga0501031_0114201_683_1453 256
1232 3300049569 Ga0501032_0114965 Ga0501032_0114965_634_1404 256
1233 3300049571 Ga0501034_0149442 Ga0501034_0149442_1362_2132 256
1234 3300049572 Ga0501036_0243932 Ga0501036_0243932_614_1384 256
1235 3300049573 Ga0501037_0109198 Ga0501037_0109198_229_999 256
1236 3300049574 Ga0501038_0081654 Ga0501038_0081654_1229_1999 256
1237 3300049575 Ga0501039_0194319 Ga0501039_0194319_656_1426 256
1238 3300049579 Ga0501043_0170391 Ga0501043_0170391_839_1609 256
1239 3300049580 Ga0501046_0106609 Ga0501046_0106609_357_1127 256
1240 3300049585 Ga0501069_0087548 Ga0501069_0087548_61_831 256
1241 3300049823 Ga0501044_0349449 Ga0501044_0349449_400_1170 256
1242 3300050490 nmdc:mga03n38_151_c1 nmdc:mga03n38_151_c1_8094_8876 256
1243 3300050492 nmdc:mga0yw44_250654_c1 nmdc:mga0yw44_250654_c1_241_1023 256
1244 3300053077 Ga0495601_0199574 Ga0495601_0199574_49_834 256
1245 3300053078 Ga0495612_0004682 Ga0495612_0004682_1570_2355 256
1246 3300053092 Ga0500583_0252757 Ga0500583_0252757_21_839 256
1247 3300053094 Ga0500566_0000124 Ga0500566_0000124_35974_36762 256
1248 3300053095 Ga0500640_003612 Ga0500640_003612_4199_4987 256
1249 3300053111 Ga0500572_000207 Ga0500572_000207_16797_17585 256
1250 3300053111 Ga0500572_046339 Ga0500572_046339_53_847 256
1251 3300053122 Ga0500608_004134 Ga0500608_004134_2198_2986 256
1252 3300053123 Ga0500614_002387 Ga0500614_002387_878_1666 256
1253 3300053125 Ga0500618_029100 Ga0500618_029100_222_995 256
1254 3300053136 Ga0500559_0000658 Ga0500559_0000658_21653_22441 256
1255 3300053136 Ga0500559_0001001 Ga0500559_0001001_9352_10146 256
1256 3300053142 Ga0500577_0000058 Ga0500577_0000058_24248_25108 256
1257 3300053150 Ga0500603_000069 Ga0500603_000069_2850_3638 256
1258 3300053162 Ga0500638_000353 Ga0500638_000353_1337_2125 256
1259 3300053163 Ga0500639_000057 Ga0500639_000057_11782_12570 256
1260 3300053163 Ga0500639_014190 Ga0500639_014190_901_1695 256
1261 3300053178 Ga0500637_0061873 Ga0500637_0061873_781_1572 256
1262 3300053725 Ga0500576_072629 Ga0500576_072629_463_1257 256
1263 3300053735 Ga0500596_000608 Ga0500596_000608_2843_3631 256
1264 3300053735 Ga0500596_019423 Ga0500596_019423_143_937 256
1265 3300060353 Ga0501082_0202825 Ga0501082_0202825_444_1232 256
1266 3300001989 JGI24739J22299_10011169 JGI24739J22299_100111691 257
1267 3300001990 JGI24737J22298_10046391 JGI24737J22298_100463911 257
1268 3300005329 Ga0070683_100448812 Ga0070683_1004488121 257
1269 3300005336 Ga0070680_100319565 Ga0070680_1003195651 257
1270 3300005338 Ga0068868_100144046 Ga0068868_1001440461 257
1271 3300005339 Ga0070660_100053501 Ga0070660_1000535013 257
1272 3300005344 Ga0070661_100412282 Ga0070661_1004122821 257
1273 3300005356 Ga0070674_100286605 Ga0070674_1002866051 257
1274 3300005364 Ga0070673_100412447 Ga0070673_1004124472 257
1275 3300005436 Ga0070713_100625935 Ga0070713_1006259351 257
1276 3300005455 Ga0070663_100199845 Ga0070663_1001998452 257
1277 3300005458 Ga0070681_10317721 Ga0070681_103177212 257
1278 3300005530 Ga0070679_100059281 Ga0070679_1000592811 257
1279 3300005530 Ga0070679_100319828 Ga0070679_1003198282 257
1280 3300005530 Ga0070679_100395056 Ga0070679_1003950562 257
1281 3300005539 Ga0068853_100169905 Ga0068853_1001699052 257
1282 3300005539 Ga0068853_100261663 Ga0068853_1002616632 257
1283 3300005563 Ga0068855_100085961 Ga0068855_1000859613 257
1284 3300005577 Ga0068857_100027761 Ga0068857_1000277612 257
1285 3300005614 Ga0068856_100006007 Ga0068856_1000060072 257
1286 3300005614 Ga0068856_100006164 Ga0068856_1000061645 257
1287 3300005614 Ga0068856_100488290 Ga0068856_1004882902 257
1288 3300005616 Ga0068852_100252297 Ga0068852_1002522973 257
1289 3300005618 Ga0068864_100119863 Ga0068864_1001198632 257
1290 3300005719 Ga0068861_100297022 Ga0068861_1002970222 257
1291 3300005937 Ga0081455_10117367 Ga0081455_101173673 257
1292 3300005937 Ga0081455_10282495 Ga0081455_102824952 257
1293 3300005983 Ga0081540_1006439 Ga0081540_10064392 257
1294 3300005983 Ga0081540_1009891 Ga0081540_10098913 257
1295 3300005985 Ga0081539_10000152 Ga0081539_1000015226 257
1296 3300006042 Ga0075368_10045234 Ga0075368_100452342 257
1297 3300006163 Ga0070715_10106893 Ga0070715_101068931 257
1298 3300006358 Ga0068871_100363378 Ga0068871_1003633781 257
1299 3300009093 Ga0105240_10098304 Ga0105240_100983042 257
1300 3300009093 Ga0105240_10641619 Ga0105240_106416191 257
1301 3300009098 Ga0105245_10069555 Ga0105245_100695553 257
1302 3300009101 Ga0105247_10018856 Ga0105247_100188563 257
1303 3300009545 Ga0105237_10369246 Ga0105237_103692463 257
1304 3300009551 Ga0105238_10016317 Ga0105238_100163178 257
1305 3300009551 Ga0105238_10230488 Ga0105238_102304882 257
1306 3300010375 Ga0105239_10335010 Ga0105239_103350102 257
1307 3300013100 Ga0157373_10066939 Ga0157373_100669392 257
1308 3300013104 Ga0157370_10633019 Ga0157370_106330191 257
1309 3300013307 Ga0157372_10344185 Ga0157372_103441852 257
1310 3300014969 Ga0157376_10724233 Ga0157376_107242331 257
1311 3300025253 Ga0209677_100698 Ga0209677_1006986 257
1312 3300025904 Ga0207647_10003251 Ga0207647_100032517 257
1313 3300025905 Ga0207685_10042424 Ga0207685_100424241 257
1314 3300025909 Ga0207705_10074220 Ga0207705_100742202 257
1315 3300025913 Ga0207695_10250860 Ga0207695_102508602 257
1316 3300025915 Ga0207693_10366656 Ga0207693_103666561 257
1317 3300025916 Ga0207663_10383965 Ga0207663_103839652 257
1318 3300025917 Ga0207660_10154574 Ga0207660_101545743 257
1319 3300025919 Ga0207657_10006256 Ga0207657_100062562 257
1320 3300025919 Ga0207657_10161573 Ga0207657_101615732 257
1321 3300025921 Ga0207652_10323061 Ga0207652_103230611 257
1322 3300025928 Ga0207700_10506981 Ga0207700_105069811 257
1323 3300025941 Ga0207711_10778332 Ga0207711_107783321 257
1324 3300025942 Ga0207689_10090689 Ga0207689_100906892 257
1325 3300025944 Ga0207661_10480208 Ga0207661_104802081 257
1326 3300025949 Ga0207667_10013962 Ga0207667_100139622 257
1327 3300025981 Ga0207640_10130436 Ga0207640_101304362 257
1328 3300026035 Ga0207703_10234020 Ga0207703_102340202 257
1329 3300026078 Ga0207702_10003081 Ga0207702_100030816 257
1330 3300026142 Ga0207698_10144517 Ga0207698_101445172 257
1331 3300027512 Ga0209179_1030993 Ga0209179_10309931 257
1332 3300027671 Ga0209588_1016853 Ga0209588_10168532 257
1333 3300028379 Ga0268266_10286276 Ga0268266_102862761 257
1334 3300031616 Ga0307508_10244124 Ga0307508_102441242 257
1335 3300031995 Ga0307409_100167133 Ga0307409_1001671332 257
1336 3300032005 Ga0307411_10100612 Ga0307411_101006122 257
1337 3300033180 Ga0307510_10025604 Ga0307510_100256042 257
1338 3300035084 Ga0373928_0006084 Ga0373928_0006084_1493_2266 257
1339 3300035086 Ga0373934_0031937 Ga0373934_0031937_115_888 257
1340 3300035116 Ga0373945_0013610 Ga0373945_0013610_280_1053 257
1341 3300035117 Ga0373953_0011610 Ga0373953_0011610_1980_2753 257
1342 3300035691 Ga0373931_0284787 Ga0373931_0284787_233_1006 257
1343 3300035692 Ga0373935_0000164 Ga0373935_0000164_26701_27474 257
1344 3300035692 Ga0373935_0452322 Ga0373935_0452322_73_849 257
1345 3300035695 Ga0373927_0000977 Ga0373927_0000977_8815_9588 257
1346 3300035724 Ga0373933_0000686 Ga0373933_0000686_5765_6544 257
1347 3300035725 Ga0373947_0003339 Ga0373947_0003339_1499_2272 257
1348 3300036458 Ga0310112_016313 Ga0310112_016313_140_922 257
1349 3300036534 Ga0310109_016196 Ga0310109_016196_66_848 257
1350 3300037068 Ga0373925_0092678 Ga0373925_0092678_192_965 257
1351 3300039437 Ga0436365_1855737 Ga0436365_1855737_1328_2125 257
1352 3300045976 Ga0466967_0159550 Ga0466967_0159550_981_1769 257
1353 3300046454 Ga0495592_0013585 Ga0495592_0013585_3900_4673 257
1354 3300046454 Ga0495592_0168698 Ga0495592_0168698_401_1174 257
1355 3300046455 Ga0495603_0005902 Ga0495603_0005902_6477_7250 257
1356 3300046455 Ga0495603_0044412 Ga0495603_0044412_429_1202 257
1357 3300046455 Ga0495603_0185812 Ga0495603_0185812_18_791 257
1358 3300046459 Ga0495629_0000087 Ga0495629_0000087_13682_14455 257
1359 3300046461 Ga0495641_0056274 Ga0495641_0056274_689_1462 257
1360 3300046473 Ga0495582_0000818 Ga0495582_0000818_4486_5259 257
1361 3300046475 Ga0495639_0000022 Ga0495639_0000022_52218_52991 257
1362 3300046476 Ga0495662_0000161 Ga0495662_0000161_8847_9620 257
1363 3300046477 Ga0495664_0010436 Ga0495664_0010436_4360_5133 257
1364 3300046499 Ga0495594_0000275 Ga0495594_0000275_12644_13417 257
1365 3300046507 Ga0495606_0002311 Ga0495606_0002311_12826_13602 257
1366 3300046511 Ga0495608_0010519 Ga0495608_0010519_4898_5671 257
1367 3300046516 Ga0495628_0032115 Ga0495628_0032115_3308_4081 257
1368 3300046516 Ga0495628_0155477 Ga0495628_0155477_221_994 257
1369 3300046517 Ga0495630_0003318 Ga0495630_0003318_6148_6921 257
1370 3300046524 Ga0495648_0001225 Ga0495648_0001225_4797_5570 257
1371 3300046531 Ga0495665_0000105 Ga0495665_0000105_27248_28021 257
1372 3300046533 Ga0495640_0022475 Ga0495640_0022475_2990_3763 257
1373 3300046543 Ga0495645_0007422 Ga0495645_0007422_4655_5428 257
1374 3300046557 Ga0495622_0029620 Ga0495622_0029620_639_1412 257
1375 3300046642 Ga0495634_0139749 Ga0495634_0139749_583_1356 257
1376 3300046642 Ga0495634_0279136 Ga0495634_0279136_113_886 257
1377 3300046663 Ga0495635_0000359 Ga0495635_0000359_8998_9771 257
1378 3300046663 Ga0495635_0008606 Ga0495635_0008606_6125_6898 257
1379 3300046678 Ga0495599_0022485 Ga0495599_0022485_1715_2488 257
1380 3300046678 Ga0495599_0078082 Ga0495599_0078082_122_895 257
1381 3300046681 Ga0495647_0002828 Ga0495647_0002828_3219_3992 257
1382 3300046683 Ga0495658_0002969 Ga0495658_0002969_7564_8337 257
1383 3300046683 Ga0495658_0468509 Ga0495658_0468509_13_786 257
1384 3300046689 Ga0495613_0024571 Ga0495613_0024571_3231_4004 257
1385 3300046690 Ga0495624_0001105 Ga0495624_0001105_10574_11347 257
1386 3300046690 Ga0495624_0168393 Ga0495624_0168393_528_1301 257
1387 3300047315 Ga0495581_0000889 Ga0495581_0000889_11893_12666 257
1388 3300047317 Ga0495604_0015252 Ga0495604_0015252_1015_1788 257
1389 3300047319 Ga0495674_0010563 Ga0495674_0010563_3487_4260 257
1390 3300047321 Ga0495676_0060406 Ga0495676_0060406_421_1194 257
1391 3300047321 Ga0495676_0343591 Ga0495676_0343591_215_988 257
1392 3300047471 Ga0495684_0079064 Ga0495684_0079064_1695_2468 257
1393 3300047471 Ga0495684_0345170 Ga0495684_0345170_39_812 257
1394 3300047673 Ga0495593_0000213 Ga0495593_0000213_7152_7925 257
1395 3300047673 Ga0495593_0058879 Ga0495593_0058879_25_798 257
1396 3300048089 Ga0495614_0044651 Ga0495614_0044651_639_1412 257
1397 3300048903 Ga0496100_0082160 Ga0496100_0082160_1328_2101 257
1398 3300048915 Ga0496112_0798834 Ga0496112_0798834_10_798 257
1399 3300048919 Ga0496116_0220623 Ga0496116_0220623_62_868 257
1400 3300048921 Ga0496118_0053399 Ga0496118_0053399_120_917 257
1401 3300048924 Ga0496121_0082353 Ga0496121_0082353_1274_2080 257
1402 3300048924 Ga0496121_0098233 Ga0496121_0098233_520_1317 257
1403 3300048928 Ga0496125_0249609 Ga0496125_0249609_109_897 257
1404 3300048929 Ga0496126_0168285 Ga0496126_0168285_141_947 257
1405 3300048929 Ga0496126_0344484 Ga0496126_0344484_210_983 257
1406 3300050493 nmdc:mga0k408_252587_c1 nmdc:mga0k408_252587_c1_226_1014 257
1407 3300050512 nmdc:mga0n895_659362_c1 nmdc:mga0n895_659362_c1_37_825 257
1408 3300053077 Ga0495601_0141984 Ga0495601_0141984_747_1520 257
1409 3300053085 Ga0495619_0185507 Ga0495619_0185507_23_796 257
1410 3300053102 Ga0500554_000874 Ga0500554_000874_4676_5449 257
1411 3300053103 Ga0500555_015843 Ga0500555_015843_904_1689 257
1412 3300053150 Ga0500603_000345 Ga0500603_000345_6292_7065 257
1413 3300053178 Ga0500637_0000494 Ga0500637_0000494_6013_6786 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04367

DUF502

Protein of unknown function (DUF502)

112

219

0.98

Feature Viewer

pLDDT pTM Quality
73.04 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map