F493773
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1413 | 698 | 1180 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300053142|Ga0500577_0000058|Ga0500577_0000058_24248_25108 |
| Length | 286 |
| Sequence | LHRKREKLLGCDQRERRRNARRADGFGTPMDRTDLPPTVPVGDVXXDAPRGFMARIRNYFLTGLIVAGPIAITFYLTWWFVTWVDALVRPLVPEAYRPEQYLPYGIPGSGLIVAFVALTLLGFLTANLIGRSLVDLGENLLGRMPVVRAIYRGLKQVFETLFSGNGSSFRRVGLVEFPSPGMWSIVLISQPPSVEIANSLPGEDEHISVFLPCAPNPTTGFFFYVPKSKIIDIDMSAEDAATLIMSAGVVQPGSDPQKKIAALAEMAQAARMANTAAPMQVPAKVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 26 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 27 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 28 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 29 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 30 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 31 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 32 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 33 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 34 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 35 | 2791355199 | |||
| 36 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 37 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 38 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 39 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 40 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 41 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 42 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 43 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 44 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 45 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 46 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 47 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 48 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 49 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 50 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 51 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 52 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 53 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 54 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 55 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 56 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 57 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 58 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 59 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 60 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 61 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 62 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 63 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 64 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 65 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 66 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 67 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 68 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 69 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 70 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 71 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 72 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 73 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 74 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 75 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 76 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 77 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 78 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 79 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 80 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 81 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 82 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 83 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 84 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 85 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 86 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 87 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 88 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 89 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 90 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 91 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 92 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 93 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 94 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 95 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 96 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 97 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 98 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 99 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 100 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 101 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 102 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 103 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 104 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 105 | 2904699407 | |||
| 106 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 107 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 108 | 2906610324 | |||
| 109 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 110 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 111 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 112 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 113 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 114 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 115 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 116 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 117 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 118 | 2922368715 | |||
| 119 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 120 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 121 | 2922425934 | |||
| 122 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 123 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 124 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 125 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 126 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 127 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 128 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 129 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 130 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 131 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 132 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 133 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 134 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 135 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 136 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 137 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 138 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 139 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 140 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 141 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 142 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 143 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 144 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 145 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 146 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 147 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 148 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 149 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 150 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 151 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 152 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 153 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 154 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 155 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 156 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 157 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 158 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 159 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 160 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 161 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 162 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 163 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 164 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 165 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 166 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 167 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 168 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 169 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 170 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 171 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 172 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 173 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 174 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 175 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 176 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 177 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 178 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 179 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 180 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 181 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 182 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 183 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 184 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 185 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 186 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 187 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 188 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 189 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 190 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 191 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 192 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 193 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 194 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 195 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 196 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 197 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 198 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 199 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 200 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 201 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 202 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 203 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 204 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 205 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 206 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 208 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 209 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 211 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 212 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 213 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 215 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 224 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 225 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 226 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 228 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 233 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 234 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 235 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 236 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 237 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 238 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 239 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 240 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 243 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 245 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 246 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 247 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 248 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 249 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 250 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 251 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 252 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 253 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 254 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 255 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 256 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 257 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 259 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 260 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 261 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 262 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 263 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 264 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 265 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 266 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 267 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 268 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 269 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 271 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 272 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 273 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 274 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 275 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 276 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 277 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 278 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 279 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 280 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 281 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 283 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 292 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 308 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 309 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 310 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 311 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 312 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 313 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 314 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 315 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 316 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 317 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 318 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 323 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 325 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 374 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 375 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 376 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 377 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 383 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 384 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 385 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 386 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 387 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 388 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 389 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 390 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 391 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 392 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 393 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 394 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 395 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 396 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 397 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 398 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 399 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 400 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 401 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 402 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 403 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 404 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 405 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 406 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 407 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 408 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 409 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 410 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 411 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 412 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 413 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 414 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 415 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 416 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 417 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 418 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 419 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 420 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 421 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 422 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 423 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 424 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 425 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 426 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 427 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 428 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 429 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 430 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 431 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 432 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 433 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 434 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 435 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 436 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 437 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 438 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 439 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 440 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 441 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 442 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 443 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 444 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 445 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 524 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 525 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 526 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 527 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 528 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 529 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 530 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 531 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 532 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 533 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 534 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 535 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 536 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 537 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 538 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 539 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 540 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 541 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 542 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 543 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 544 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 545 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 546 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 547 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 548 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 549 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 550 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 552 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 553 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 554 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 555 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 556 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 557 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 558 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 559 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 560 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 561 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 562 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 563 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 568 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 569 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 570 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 571 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 572 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 573 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 574 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 583 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 584 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 585 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 586 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 587 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 588 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 589 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 590 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 591 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 592 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 593 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 594 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 595 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 596 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 597 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 602 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 603 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 604 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 605 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 606 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 607 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 608 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 609 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 610 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 611 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 612 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 613 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 614 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 615 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 616 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 617 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 618 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 619 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 620 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 621 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 622 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 623 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 624 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 625 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 626 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 627 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 628 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 629 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 630 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 631 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 632 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 633 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 634 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 635 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 636 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 637 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 638 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 639 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 640 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 641 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 642 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 643 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 644 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 645 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 646 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 647 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 648 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 649 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 650 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 651 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 652 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 653 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 654 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 655 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 656 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 658 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 659 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 660 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 661 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 662 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 663 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 664 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 665 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 666 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 667 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 668 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 669 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 670 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 671 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 672 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 673 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 674 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 675 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 676 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 677 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 678 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 679 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 680 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 681 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 682 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 683 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 684 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 685 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 686 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 687 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 688 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 689 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 690 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 691 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 692 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 693 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 694 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 695 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 696 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 697 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 698 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.45 |
| Metatranscriptomes | 0.36 |
| Isolates | 16.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.81 |
| Nodule | 12.74 |
| Rhizoplane | 4.32 |
| Rhizosphere | 58.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10011169 | 3300001989 | Bacteria | 3318 |
| 2 | JGI24737J22298_10046391 | 3300001990 | Bacteria | 1326 |
| 3 | JGI24735J21928_10066513 | 3300002067 | Bacteria | 1034 |
| 4 | JGI25406J46586_10000004 | 3300003203 | Bacteria | 149772 |
| 5 | JGI25165J46597_1010878 | 3300003214 | Bacteria | 1315 |
| 6 | JGI25153J46596_10001121 | 3300003215 | Bacteria | 16242 |
| 7 | JGI25153J46596_10002750 | 3300003215 | Bacteria | 10011 |
| 8 | JGI25153J46596_10002825 | 3300003215 | Bacteria | 9869 |
| 9 | JGI25153J46596_10008914 | 3300003215 | Bacteria | 4733 |
| 10 | JGI25160J50197_1002027 | 3300003354 | Bacteria | 9658 |
| 11 | JGI25160J50197_1014597 | 3300003354 | Bacteria | 2621 |
| 12 | JGI25160J50197_1015874 | 3300003354 | Bacteria | 2452 |
| 13 | JGI25404J52841_10000996 | 3300003659 | Bacteria | 4650 |
| 14 | JGI25404J52841_10026278 | 3300003659 | Bacteria | 1253 |
| 15 | Ga0055542_1008165 | 3300003762 | Bacteria | 2065 |
| 16 | Ga0055524_1045785 | 3300003775 | Bacteria | 1048 |
| 17 | Ga0055531_10044317 | 3300003794 | Bacteria | 1248 |
| 18 | Ga0065165_1000394 | 3300005262 | Bacteria | 70991 |
| 19 | Ga0065165_1010648 | 3300005262 | Bacteria | 3942 |
| 20 | Ga0065165_1013090 | 3300005262 | Bacteria | 3322 |
| 21 | Ga0065165_1030460 | 3300005262 | Bacteria | 1716 |
| 22 | Ga0065165_1036596 | 3300005262 | Bacteria | 1496 |
| 23 | Ga0070658_10055088 | 3300005327 | Bacteria | 3230 |
| 24 | Ga0070658_10158173 | 3300005327 | Bacteria | 1900 |
| 25 | Ga0070676_10219328 | 3300005328 | Bacteria | 1255 |
| 26 | Ga0070683_100000652 | 3300005329 | Bacteria | 25052 |
| 27 | Ga0070683_100001741 | 3300005329 | Bacteria | 16946 |
| 28 | Ga0070683_100448812 | 3300005329 | Bacteria | 1230 |
| 29 | Ga0070690_100162646 | 3300005330 | Bacteria | 1531 |
| 30 | Ga0070670_100368031 | 3300005331 | Bacteria | 1265 |
| 31 | Ga0068869_100100381 | 3300005334 | Bacteria | 2188 |
| 32 | Ga0070680_100019780 | 3300005336 | Bacteria | 5339 |
| 33 | Ga0070680_100073065 | 3300005336 | Bacteria | 2820 |
| 34 | Ga0070680_100319565 | 3300005336 | Bacteria | 1318 |
| 35 | Ga0068868_100144046 | 3300005338 | Bacteria | 1958 |
| 36 | Ga0070660_100053501 | 3300005339 | Bacteria | 3114 |
| 37 | Ga0070660_100292611 | 3300005339 | Bacteria | 1334 |
| 38 | Ga0070660_100325791 | 3300005339 | Bacteria | 1262 |
| 39 | Ga0070660_100374332 | 3300005339 | Bacteria | 1175 |
| 40 | Ga0070691_10071209 | 3300005341 | Bacteria | 1688 |
| 41 | Ga0070661_100390503 | 3300005344 | Bacteria | 1099 |
| 42 | Ga0070661_100412282 | 3300005344 | Bacteria | 1070 |
| 43 | Ga0070668_100106427 | 3300005347 | Bacteria | 2228 |
| 44 | Ga0070668_100133855 | 3300005347 | Bacteria | 1992 |
| 45 | Ga0070671_100057432 | 3300005355 | Bacteria | 3238 |
| 46 | Ga0070671_100429508 | 3300005355 | Bacteria | 1132 |
| 47 | Ga0070674_100108900 | 3300005356 | Bacteria | 2031 |
| 48 | Ga0070674_100286605 | 3300005356 | Bacteria | 1308 |
| 49 | Ga0070673_100412447 | 3300005364 | Bacteria | 1209 |
| 50 | Ga0070673_100687102 | 3300005364 | Bacteria | 939 |
| 51 | Ga0070659_100267786 | 3300005366 | Bacteria | 1419 |
| 52 | Ga0070709_10000247 | 3300005434 | Bacteria | 34839 |
| 53 | Ga0070709_10001245 | 3300005434 | Bacteria | 13920 |
| 54 | Ga0070709_10013557 | 3300005434 | Bacteria | 4587 |
| 55 | Ga0070709_10013963 | 3300005434 | Bacteria | 4530 |
| 56 | Ga0070709_10573529 | 3300005434 | Bacteria | 866 |
| 57 | Ga0070714_100002813 | 3300005435 | Bacteria | 12843 |
| 58 | Ga0070714_100018248 | 3300005435 | Bacteria | 5695 |
| 59 | Ga0070714_100078278 | 3300005435 | Bacteria | 2873 |
| 60 | Ga0070714_100174819 | 3300005435 | Bacteria | 1951 |
| 61 | Ga0070714_100335359 | 3300005435 | Bacteria | 1417 |
| 62 | Ga0070713_100015159 | 3300005436 | Bacteria | 5748 |
| 63 | Ga0070713_100035160 | 3300005436 | Bacteria | 4031 |
| 64 | Ga0070713_100057996 | 3300005436 | Bacteria | 3227 |
| 65 | Ga0070713_100141130 | 3300005436 | Bacteria | 2134 |
| 66 | Ga0070713_100215823 | 3300005436 | Bacteria | 1739 |
| 67 | Ga0070713_100625935 | 3300005436 | Bacteria | 1024 |
| 68 | Ga0070710_10000979 | 3300005437 | Bacteria | 13573 |
| 69 | Ga0070710_10016239 | 3300005437 | Bacteria | 3785 |
| 70 | Ga0070710_10018757 | 3300005437 | Bacteria | 3565 |
| 71 | Ga0070710_10061787 | 3300005437 | Bacteria | 2134 |
| 72 | Ga0070701_10156475 | 3300005438 | Bacteria | 1317 |
| 73 | Ga0070711_100013370 | 3300005439 | Bacteria | 5155 |
| 74 | Ga0070711_100066238 | 3300005439 | Bacteria | 2529 |
| 75 | Ga0070711_100119442 | 3300005439 | Bacteria | 1947 |
| 76 | Ga0070711_100282960 | 3300005439 | Bacteria | 1313 |
| 77 | Ga0070694_100374031 | 3300005444 | Bacteria | 1109 |
| 78 | Ga0070708_100172862 | 3300005445 | Bacteria | 2018 |
| 79 | Ga0070663_100007669 | 3300005455 | Bacteria | 6585 |
| 80 | Ga0070663_100012373 | 3300005455 | Bacteria | 5396 |
| 81 | Ga0070663_100058807 | 3300005455 | Bacteria | 2761 |
| 82 | Ga0070663_100156959 | 3300005455 | Bacteria | 1749 |
| 83 | Ga0070663_100199845 | 3300005455 | Bacteria | 1559 |
| 84 | Ga0070663_100255846 | 3300005455 | Bacteria | 1387 |
| 85 | Ga0070678_100012438 | 3300005456 | Bacteria | 5290 |
| 86 | Ga0070678_100460397 | 3300005456 | Bacteria | 1115 |
| 87 | Ga0070662_100328034 | 3300005457 | Bacteria | 1250 |
| 88 | Ga0070681_10005973 | 3300005458 | Bacteria | 11794 |
| 89 | Ga0070681_10317721 | 3300005458 | Bacteria | 1467 |
| 90 | Ga0070681_10457618 | 3300005458 | Bacteria | 1188 |
| 91 | Ga0068867_100034125 | 3300005459 | Bacteria | 3687 |
| 92 | Ga0070685_10416625 | 3300005466 | Bacteria | 934 |
| 93 | Ga0070707_100269455 | 3300005468 | Bacteria | 1656 |
| 94 | Ga0070698_100190960 | 3300005471 | Bacteria | 1986 |
| 95 | Ga0070679_100059281 | 3300005530 | Bacteria | 3815 |
| 96 | Ga0070679_100124368 | 3300005530 | Bacteria | 2562 |
| 97 | Ga0070679_100254685 | 3300005530 | Bacteria | 1711 |
| 98 | Ga0070679_100319828 | 3300005530 | Bacteria | 1501 |
| 99 | Ga0070679_100395056 | 3300005530 | Bacteria | 1329 |
| 100 | Ga0070679_100432121 | 3300005530 | Bacteria | 1262 |
| 101 | Ga0070679_100606594 | 3300005530 | Bacteria | 1038 |
| 102 | Ga0070679_100662334 | 3300005530 | Bacteria | 986 |
| 103 | Ga0070684_100001124 | 3300005535 | Bacteria | 19191 |
| 104 | Ga0070684_100002282 | 3300005535 | Bacteria | 14130 |
| 105 | Ga0068853_100148198 | 3300005539 | Bacteria | 2111 |
| 106 | Ga0068853_100169905 | 3300005539 | Bacteria | 1972 |
| 107 | Ga0068853_100190357 | 3300005539 | Bacteria | 1864 |
| 108 | Ga0068853_100261663 | 3300005539 | Bacteria | 1591 |
| 109 | Ga0070693_100030193 | 3300005547 | Bacteria | 2962 |
| 110 | Ga0070693_100116009 | 3300005547 | Bacteria | 1654 |
| 111 | Ga0070693_100205784 | 3300005547 | Bacteria | 1281 |
| 112 | Ga0070665_100131331 | 3300005548 | Bacteria | 2506 |
| 113 | Ga0070665_100154903 | 3300005548 | Bacteria | 2293 |
| 114 | Ga0070665_100185286 | 3300005548 | Bacteria | 2082 |
| 115 | Ga0070665_100250822 | 3300005548 | Bacteria | 1771 |
| 116 | Ga0070665_100391937 | 3300005548 | Bacteria | 1397 |
| 117 | Ga0070665_100511034 | 3300005548 | Bacteria | 1213 |
| 118 | Ga0070665_100695863 | 3300005548 | Bacteria | 1029 |
| 119 | Ga0068855_100085961 | 3300005563 | Bacteria | 3638 |
| 120 | Ga0068855_100088315 | 3300005563 | Bacteria | 3581 |
| 121 | Ga0068855_100213638 | 3300005563 | Bacteria | 2166 |
| 122 | Ga0068855_100548497 | 3300005563 | Bacteria | 1252 |
| 123 | Ga0068855_100602110 | 3300005563 | Bacteria | 1185 |
| 124 | Ga0070664_100084318 | 3300005564 | Bacteria | 2743 |
| 125 | Ga0070664_100363863 | 3300005564 | Bacteria | 1318 |
| 126 | Ga0068857_100027761 | 3300005577 | Bacteria | 4992 |
| 127 | Ga0068857_100092655 | 3300005577 | Bacteria | 2705 |
| 128 | Ga0068857_100177335 | 3300005577 | Bacteria | 1939 |
| 129 | Ga0068854_100396225 | 3300005578 | Bacteria | 1141 |
| 130 | Ga0068856_100006007 | 3300005614 | Bacteria | 11948 |
| 131 | Ga0068856_100006164 | 3300005614 | Bacteria | 11765 |
| 132 | Ga0068856_100058656 | 3300005614 | Bacteria | 3802 |
| 133 | Ga0068856_100162321 | 3300005614 | Bacteria | 2245 |
| 134 | Ga0068856_100463638 | 3300005614 | Bacteria | 1288 |
| 135 | Ga0068856_100488290 | 3300005614 | Bacteria | 1252 |
| 136 | Ga0068852_100024877 | 3300005616 | Bacteria | 4844 |
| 137 | Ga0068852_100026594 | 3300005616 | Bacteria | 4706 |
| 138 | Ga0068852_100223513 | 3300005616 | Bacteria | 1792 |
| 139 | Ga0068852_100245240 | 3300005616 | Bacteria | 1714 |
| 140 | Ga0068852_100252297 | 3300005616 | Bacteria | 1691 |
| 141 | Ga0068852_100470325 | 3300005616 | Bacteria | 1247 |
| 142 | Ga0068852_100563289 | 3300005616 | Bacteria | 1141 |
| 143 | Ga0068864_100119863 | 3300005618 | Bacteria | 2351 |
| 144 | Ga0068864_100208257 | 3300005618 | Bacteria | 1799 |
| 145 | Ga0068861_100216164 | 3300005719 | Bacteria | 1617 |
| 146 | Ga0068861_100297022 | 3300005719 | Bacteria | 1397 |
| 147 | Ga0068863_100316017 | 3300005841 | Bacteria | 1517 |
| 148 | Ga0068858_100047111 | 3300005842 | Bacteria | 3997 |
| 149 | Ga0068858_100165501 | 3300005842 | Bacteria | 2083 |
| 150 | Ga0068860_100002150 | 3300005843 | Bacteria | 20778 |
| 151 | Ga0081455_10004224 | 3300005937 | Bacteria | 16189 |
| 152 | Ga0081455_10024799 | 3300005937 | Bacteria | 5545 |
| 153 | Ga0081455_10034743 | 3300005937 | Bacteria | 4513 |
| 154 | Ga0081455_10058007 | 3300005937 | Bacteria | 3279 |
| 155 | Ga0081455_10117367 | 3300005937 | Bacteria | 2103 |
| 156 | Ga0081455_10282495 | 3300005937 | Bacteria | 1199 |
| 157 | Ga0081538_10003572 | 3300005981 | Bacteria | 14631 |
| 158 | Ga0081538_10034900 | 3300005981 | Bacteria | 3315 |
| 159 | Ga0081538_10197342 | 3300005981 | Bacteria | 833 |
| 160 | Ga0081540_1000683 | 3300005983 | Bacteria | 31759 |
| 161 | Ga0081540_1006439 | 3300005983 | Bacteria | 8546 |
| 162 | Ga0081540_1009891 | 3300005983 | Bacteria | 6512 |
| 163 | Ga0081540_1011684 | 3300005983 | Bacteria | 5850 |
| 164 | Ga0081540_1013357 | 3300005983 | Bacteria | 5343 |
| 165 | Ga0081540_1019314 | 3300005983 | Bacteria | 4148 |
| 166 | Ga0081540_1024144 | 3300005983 | Bacteria | 3534 |
| 167 | Ga0081540_1031817 | 3300005983 | Bacteria | 2891 |
| 168 | Ga0081540_1117739 | 3300005983 | Bacteria | 1109 |
| 169 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 170 | Ga0081539_10000152 | 3300005985 | Bacteria | 160005 |
| 171 | Ga0081539_10020634 | 3300005985 | Bacteria | 4442 |
| 172 | Ga0081539_10089448 | 3300005985 | Bacteria | 1594 |
| 173 | Ga0070717_10001828 | 3300006028 | Bacteria | 14867 |
| 174 | Ga0070717_10024964 | 3300006028 | Bacteria | 4748 |
| 175 | Ga0070717_10047705 | 3300006028 | Bacteria | 3510 |
| 176 | Ga0070717_10228756 | 3300006028 | Bacteria | 1637 |
| 177 | Ga0070717_10291934 | 3300006028 | Bacteria | 1448 |
| 178 | Ga0070717_10339160 | 3300006028 | Bacteria | 1342 |
| 179 | Ga0075365_10005882 | 3300006038 | Bacteria | 6674 |
| 180 | Ga0075365_10021338 | 3300006038 | Bacteria | 4039 |
| 181 | Ga0075365_10055199 | 3300006038 | Bacteria | 2636 |
| 182 | Ga0075365_10204633 | 3300006038 | Bacteria | 1383 |
| 183 | Ga0075368_10039758 | 3300006042 | Bacteria | 1845 |
| 184 | Ga0075368_10045234 | 3300006042 | Bacteria | 1738 |
| 185 | Ga0075363_100031431 | 3300006048 | Bacteria | 2753 |
| 186 | Ga0075363_100052519 | 3300006048 | Bacteria | 2176 |
| 187 | Ga0075364_10035235 | 3300006051 | Bacteria | 3234 |
| 188 | Ga0075364_10049228 | 3300006051 | Bacteria | 2748 |
| 189 | Ga0075364_10163150 | 3300006051 | Bacteria | 1505 |
| 190 | Ga0070715_10028685 | 3300006163 | Bacteria | 2235 |
| 191 | Ga0070715_10029991 | 3300006163 | Bacteria | 2195 |
| 192 | Ga0070715_10106893 | 3300006163 | Bacteria | 1314 |
| 193 | Ga0070716_100003314 | 3300006173 | Bacteria | 7568 |
| 194 | Ga0070716_100441460 | 3300006173 | Bacteria | 946 |
| 195 | Ga0070712_100043218 | 3300006175 | Bacteria | 3102 |
| 196 | Ga0070712_100058182 | 3300006175 | Bacteria | 2719 |
| 197 | Ga0070712_100531675 | 3300006175 | Bacteria | 989 |
| 198 | Ga0075362_10095584 | 3300006177 | Bacteria | 1384 |
| 199 | Ga0075367_10055588 | 3300006178 | Bacteria | 2349 |
| 200 | Ga0075367_10061796 | 3300006178 | Bacteria | 2236 |
| 201 | Ga0075369_10060432 | 3300006186 | Bacteria | 1653 |
| 202 | Ga0075369_10070240 | 3300006186 | Bacteria | 1541 |
| 203 | Ga0075369_10075854 | 3300006186 | Bacteria | 1485 |
| 204 | Ga0075366_10037086 | 3300006195 | Bacteria | 2876 |
| 205 | Ga0075366_10138086 | 3300006195 | Bacteria | 1473 |
| 206 | Ga0075366_10405195 | 3300006195 | Bacteria | 839 |
| 207 | Ga0097621_100072481 | 3300006237 | Bacteria | 2849 |
| 208 | Ga0075370_10008424 | 3300006353 | Bacteria | 5306 |
| 209 | Ga0075370_10015344 | 3300006353 | Bacteria | 4100 |
| 210 | Ga0075370_10020659 | 3300006353 | Bacteria | 3602 |
| 211 | Ga0068871_100363378 | 3300006358 | Bacteria | 1282 |
| 212 | Ga0075428_100171201 | 3300006844 | Bacteria | 2353 |
| 213 | Ga0075428_100277708 | 3300006844 | Bacteria | 1802 |
| 214 | Ga0075430_100083282 | 3300006846 | Bacteria | 2680 |
| 215 | Ga0075431_100169347 | 3300006847 | Bacteria | 2245 |
| 216 | Ga0068865_100066760 | 3300006881 | Bacteria | 2539 |
| 217 | Ga0099825_1033686 | 3300006941 | Bacteria | 1966 |
| 218 | Ga0099824_1004774 | 3300006942 | Bacteria | 19390 |
| 219 | Ga0099822_1001842 | 3300006943 | Bacteria | 25496 |
| 220 | Ga0099795_10088120 | 3300007788 | Bacteria | 1199 |
| 221 | Ga0105240_10005091 | 3300009093 | Bacteria | 19694 |
| 222 | Ga0105240_10041630 | 3300009093 | Bacteria | 5861 |
| 223 | Ga0105240_10098304 | 3300009093 | Bacteria | 3565 |
| 224 | Ga0105240_10641619 | 3300009093 | Bacteria | 1165 |
| 225 | Ga0105245_10069555 | 3300009098 | Bacteria | 3192 |
| 226 | Ga0105245_10119829 | 3300009098 | Bacteria | 2457 |
| 227 | Ga0105247_10018856 | 3300009101 | Bacteria | 4142 |
| 228 | Ga0114129_10866194 | 3300009147 | Bacteria | 1147 |
| 229 | Ga0105243_10098298 | 3300009148 | Bacteria | 2424 |
| 230 | Ga0105241_10034947 | 3300009174 | Bacteria | 3779 |
| 231 | Ga0105241_10082432 | 3300009174 | Bacteria | 2521 |
| 232 | Ga0105241_10543789 | 3300009174 | Bacteria | 1042 |
| 233 | Ga0105241_10666452 | 3300009174 | Bacteria | 946 |
| 234 | Ga0105242_10269003 | 3300009176 | Bacteria | 1543 |
| 235 | Ga0105248_10227239 | 3300009177 | Bacteria | 2101 |
| 236 | Ga0105248_10356480 | 3300009177 | Bacteria | 1647 |
| 237 | Ga0105237_10003248 | 3300009545 | Bacteria | 19434 |
| 238 | Ga0105237_10214974 | 3300009545 | Bacteria | 1922 |
| 239 | Ga0105237_10238473 | 3300009545 | Bacteria | 1820 |
| 240 | Ga0105237_10314453 | 3300009545 | Bacteria | 1569 |
| 241 | Ga0105237_10369246 | 3300009545 | Bacteria | 1440 |
| 242 | Ga0105237_10370470 | 3300009545 | Bacteria | 1437 |
| 243 | Ga0105237_10571842 | 3300009545 | Bacteria | 1137 |
| 244 | Ga0105238_10016317 | 3300009551 | Bacteria | 7517 |
| 245 | Ga0105238_10036661 | 3300009551 | Bacteria | 4986 |
| 246 | Ga0105238_10230488 | 3300009551 | Bacteria | 1829 |
| 247 | Ga0105249_10369636 | 3300009553 | Bacteria | 1457 |
| 248 | Ga0099796_10015790 | 3300010159 | Bacteria | 2215 |
| 249 | Ga0105239_10057214 | 3300010375 | Bacteria | 4277 |
| 250 | Ga0105239_10323066 | 3300010375 | Bacteria | 1740 |
| 251 | Ga0105239_10335010 | 3300010375 | Bacteria | 1707 |
| 252 | Ga0105239_10359532 | 3300010375 | Bacteria | 1644 |
| 253 | Ga0105239_10374794 | 3300010375 | Bacteria | 1609 |
| 254 | Ga0105246_10082752 | 3300011119 | Bacteria | 2292 |
| 255 | Ga0105246_10375714 | 3300011119 | Bacteria | 1173 |
| 256 | Ga0157373_10066939 | 3300013100 | Bacteria | 2540 |
| 257 | Ga0157370_10102433 | 3300013104 | Bacteria | 2681 |
| 258 | Ga0157370_10388545 | 3300013104 | Bacteria | 1285 |
| 259 | Ga0157370_10430605 | 3300013104 | Bacteria | 1213 |
| 260 | Ga0157370_10633019 | 3300013104 | Bacteria | 978 |
| 261 | Ga0157369_10008681 | 3300013105 | Bacteria | 11650 |
| 262 | Ga0157369_10017985 | 3300013105 | Bacteria | 7931 |
| 263 | Ga0157369_10044826 | 3300013105 | Bacteria | 4812 |
| 264 | Ga0157374_10036354 | 3300013296 | Bacteria | 4510 |
| 265 | Ga0157374_10454849 | 3300013296 | Bacteria | 1282 |
| 266 | Ga0157378_10212703 | 3300013297 | Bacteria | 1834 |
| 267 | Ga0163162_10325077 | 3300013306 | Bacteria | 1670 |
| 268 | Ga0163162_10426113 | 3300013306 | Bacteria | 1459 |
| 269 | Ga0157372_10260539 | 3300013307 | Bacteria | 2014 |
| 270 | Ga0157372_10344185 | 3300013307 | Bacteria | 1737 |
| 271 | Ga0157372_10354872 | 3300013307 | Bacteria | 1708 |
| 272 | Ga0157372_10367736 | 3300013307 | Bacteria | 1676 |
| 273 | Ga0157372_10499081 | 3300013307 | Bacteria | 1419 |
| 274 | Ga0157375_10071721 | 3300013308 | Bacteria | 3478 |
| 275 | Ga0157375_10124674 | 3300013308 | Bacteria | 2689 |
| 276 | Ga0157375_10406530 | 3300013308 | Bacteria | 1528 |
| 277 | Ga0163163_10611968 | 3300014325 | Bacteria | 1153 |
| 278 | Ga0157380_10526034 | 3300014326 | Bacteria | 1155 |
| 279 | Ga0157379_10104499 | 3300014968 | Bacteria | 2542 |
| 280 | Ga0157379_10126237 | 3300014968 | Bacteria | 2302 |
| 281 | Ga0157379_11022356 | 3300014968 | Bacteria | 789 |
| 282 | Ga0157376_10011916 | 3300014969 | Bacteria | 6430 |
| 283 | Ga0157376_10410937 | 3300014969 | Bacteria | 1311 |
| 284 | Ga0157376_10724233 | 3300014969 | Bacteria | 1002 |
| 285 | Ga0163161_10399211 | 3300017792 | Bacteria | 1102 |
| 286 | Ga0197907_11314946 | 3300020069 | Bacteria | 1317 |
| 287 | Ga0214544_1000508 | 3300021320 | Bacteria | 71511 |
| 288 | Ga0214542_1000365 | 3300021321 | Bacteria | 78664 |
| 289 | Ga0214545_1000211 | 3300021324 | Bacteria | 78664 |
| 290 | Ga0214543_1001183 | 3300021327 | Bacteria | 49477 |
| 291 | Ga0213873_10011081 | 3300021358 | Bacteria | 1919 |
| 292 | Ga0213872_10069664 | 3300021361 | Bacteria | 1586 |
| 293 | Ga0213874_10015237 | 3300021377 | Bacteria | 2025 |
| 294 | Ga0213876_10000691 | 3300021384 | Bacteria | 23782 |
| 295 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 296 | Ga0224712_10034960 | 3300022467 | Bacteria | 1852 |
| 297 | Ga0209677_100698 | 3300025253 | Bacteria | 17141 |
| 298 | Ga0209677_103323 | 3300025253 | Bacteria | 5301 |
| 299 | Ga0209148_1000372 | 3300025254 | Bacteria | 54982 |
| 300 | Ga0209233_1002279 | 3300025261 | Bacteria | 7148 |
| 301 | Ga0209233_1004360 | 3300025261 | Bacteria | 4826 |
| 302 | Ga0209233_1008000 | 3300025261 | Bacteria | 3304 |
| 303 | Ga0209233_1008576 | 3300025261 | Bacteria | 3151 |
| 304 | Ga0209455_1004512 | 3300025272 | Bacteria | 4528 |
| 305 | Ga0209564_1005852 | 3300025295 | Bacteria | 6838 |
| 306 | Ga0209564_1008399 | 3300025295 | Bacteria | 5099 |
| 307 | Ga0209564_1019612 | 3300025295 | Bacteria | 2518 |
| 308 | Ga0209564_1035276 | 3300025295 | Bacteria | 1451 |
| 309 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 310 | Ga0209758_1001014 | 3300025297 | Bacteria | 37166 |
| 311 | Ga0209758_1001422 | 3300025297 | Bacteria | 28330 |
| 312 | Ga0209758_1002016 | 3300025297 | Bacteria | 21858 |
| 313 | Ga0209758_1004009 | 3300025297 | Bacteria | 12732 |
| 314 | Ga0209758_1012938 | 3300025297 | Bacteria | 4609 |
| 315 | Ga0209758_1018304 | 3300025297 | Bacteria | 3442 |
| 316 | Ga0209758_1037457 | 3300025297 | Bacteria | 1874 |
| 317 | Ga0209256_1001447 | 3300025299 | Bacteria | 24507 |
| 318 | Ga0209256_1025700 | 3300025299 | Bacteria | 1710 |
| 319 | Ga0207426_1000229 | 3300025302 | Bacteria | 128596 |
| 320 | Ga0207426_1001382 | 3300025302 | Bacteria | 20547 |
| 321 | Ga0207426_1006133 | 3300025302 | Bacteria | 5293 |
| 322 | Ga0207426_1041902 | 3300025302 | Bacteria | 1416 |
| 323 | Ga0209257_1001279 | 3300025304 | Bacteria | 30788 |
| 324 | Ga0207692_10001184 | 3300025898 | Bacteria | 9666 |
| 325 | Ga0207692_10008480 | 3300025898 | Bacteria | 4252 |
| 326 | Ga0207642_10207765 | 3300025899 | Bacteria | 1086 |
| 327 | Ga0207710_10016522 | 3300025900 | Bacteria | 3123 |
| 328 | Ga0207688_10121644 | 3300025901 | Bacteria | 1524 |
| 329 | Ga0207647_10003251 | 3300025904 | Bacteria | 12198 |
| 330 | Ga0207647_10007587 | 3300025904 | Bacteria | 7819 |
| 331 | Ga0207685_10042424 | 3300025905 | Bacteria | 1708 |
| 332 | Ga0207685_10049735 | 3300025905 | Bacteria | 1612 |
| 333 | Ga0207699_10004578 | 3300025906 | Bacteria | 6608 |
| 334 | Ga0207699_10026734 | 3300025906 | Bacteria | 3185 |
| 335 | Ga0207645_10422101 | 3300025907 | Bacteria | 899 |
| 336 | Ga0207643_10128219 | 3300025908 | Bacteria | 1507 |
| 337 | Ga0207705_10031591 | 3300025909 | Bacteria | 3781 |
| 338 | Ga0207705_10074220 | 3300025909 | Bacteria | 2469 |
| 339 | Ga0207654_10040486 | 3300025911 | Bacteria | 2626 |
| 340 | Ga0207654_10179272 | 3300025911 | Bacteria | 1381 |
| 341 | Ga0207654_10422380 | 3300025911 | Bacteria | 930 |
| 342 | Ga0207707_10000542 | 3300025912 | Bacteria | 38408 |
| 343 | Ga0207707_10044879 | 3300025912 | Bacteria | 3852 |
| 344 | Ga0207707_10055246 | 3300025912 | Bacteria | 3454 |
| 345 | Ga0207707_10069675 | 3300025912 | Bacteria | 3065 |
| 346 | Ga0207695_10000015 | 3300025913 | Bacteria | 803205 |
| 347 | Ga0207695_10016962 | 3300025913 | Bacteria | 8498 |
| 348 | Ga0207695_10250860 | 3300025913 | Bacteria | 1669 |
| 349 | Ga0207671_10001686 | 3300025914 | Bacteria | 25022 |
| 350 | Ga0207671_10045398 | 3300025914 | Bacteria | 3250 |
| 351 | Ga0207671_10049902 | 3300025914 | Bacteria | 3099 |
| 352 | Ga0207671_10144655 | 3300025914 | Bacteria | 1834 |
| 353 | Ga0207671_10199253 | 3300025914 | Bacteria | 1563 |
| 354 | Ga0207671_10230629 | 3300025914 | Bacteria | 1452 |
| 355 | Ga0207693_10019439 | 3300025915 | Bacteria | 5402 |
| 356 | Ga0207693_10020846 | 3300025915 | Bacteria | 5211 |
| 357 | Ga0207693_10025787 | 3300025915 | Bacteria | 4658 |
| 358 | Ga0207693_10216415 | 3300025915 | Bacteria | 1505 |
| 359 | Ga0207693_10366656 | 3300025915 | Bacteria | 1127 |
| 360 | Ga0207693_10372682 | 3300025915 | Bacteria | 1117 |
| 361 | Ga0207663_10000743 | 3300025916 | Bacteria | 14534 |
| 362 | Ga0207663_10022593 | 3300025916 | Bacteria | 3598 |
| 363 | Ga0207663_10054348 | 3300025916 | Bacteria | 2507 |
| 364 | Ga0207663_10082825 | 3300025916 | Bacteria | 2106 |
| 365 | Ga0207663_10370328 | 3300025916 | Bacteria | 1089 |
| 366 | Ga0207663_10383965 | 3300025916 | Bacteria | 1070 |
| 367 | Ga0207660_10154574 | 3300025917 | Bacteria | 1765 |
| 368 | Ga0207660_10409907 | 3300025917 | Bacteria | 1092 |
| 369 | Ga0207657_10006256 | 3300025919 | Bacteria | 12380 |
| 370 | Ga0207657_10161573 | 3300025919 | Bacteria | 1819 |
| 371 | Ga0207657_10194332 | 3300025919 | Bacteria | 1635 |
| 372 | Ga0207657_10342906 | 3300025919 | Bacteria | 1179 |
| 373 | Ga0207649_10107123 | 3300025920 | Bacteria | 1861 |
| 374 | Ga0207649_10215858 | 3300025920 | Bacteria | 1364 |
| 375 | Ga0207652_10004715 | 3300025921 | Bacteria | 11056 |
| 376 | Ga0207652_10027091 | 3300025921 | Bacteria | 4775 |
| 377 | Ga0207652_10200912 | 3300025921 | Bacteria | 1794 |
| 378 | Ga0207652_10257196 | 3300025921 | Bacteria | 1575 |
| 379 | Ga0207652_10323061 | 3300025921 | Bacteria | 1393 |
| 380 | Ga0207694_10156445 | 3300025924 | Bacteria | 1839 |
| 381 | Ga0207694_10190923 | 3300025924 | Bacteria | 1664 |
| 382 | Ga0207694_10281121 | 3300025924 | Bacteria | 1367 |
| 383 | Ga0207700_10021828 | 3300025928 | Bacteria | 4380 |
| 384 | Ga0207700_10042066 | 3300025928 | Bacteria | 3347 |
| 385 | Ga0207700_10052102 | 3300025928 | Bacteria | 3058 |
| 386 | Ga0207700_10054384 | 3300025928 | Bacteria | 3004 |
| 387 | Ga0207700_10117624 | 3300025928 | Bacteria | 2150 |
| 388 | Ga0207700_10132212 | 3300025928 | Bacteria | 2039 |
| 389 | Ga0207700_10506981 | 3300025928 | Bacteria | 1068 |
| 390 | Ga0207700_10508051 | 3300025928 | Bacteria | 1067 |
| 391 | Ga0207664_10017290 | 3300025929 | Bacteria | 5283 |
| 392 | Ga0207664_10030551 | 3300025929 | Bacteria | 4115 |
| 393 | Ga0207664_10034194 | 3300025929 | Bacteria | 3913 |
| 394 | Ga0207664_10058755 | 3300025929 | Bacteria | 3060 |
| 395 | Ga0207664_10190703 | 3300025929 | Bacteria | 1764 |
| 396 | Ga0207664_10419397 | 3300025929 | Bacteria | 1192 |
| 397 | Ga0207706_10127345 | 3300025933 | Bacteria | 2239 |
| 398 | Ga0207665_10002246 | 3300025939 | Bacteria | 13042 |
| 399 | Ga0207665_10050311 | 3300025939 | Bacteria | 2802 |
| 400 | Ga0207691_10234993 | 3300025940 | Bacteria | 1586 |
| 401 | Ga0207711_10025416 | 3300025941 | Bacteria | 4969 |
| 402 | Ga0207711_10078698 | 3300025941 | Bacteria | 2876 |
| 403 | Ga0207711_10778332 | 3300025941 | Bacteria | 891 |
| 404 | Ga0207689_10090689 | 3300025942 | Bacteria | 2511 |
| 405 | Ga0207689_10239339 | 3300025942 | Bacteria | 1500 |
| 406 | Ga0207661_10040524 | 3300025944 | Bacteria | 3661 |
| 407 | Ga0207661_10480208 | 3300025944 | Bacteria | 1134 |
| 408 | Ga0207679_10245126 | 3300025945 | Bacteria | 1520 |
| 409 | Ga0207667_10013962 | 3300025949 | Bacteria | 9174 |
| 410 | Ga0207667_10164839 | 3300025949 | Bacteria | 2278 |
| 411 | Ga0207667_10211168 | 3300025949 | Bacteria | 1989 |
| 412 | Ga0207667_10689967 | 3300025949 | Bacteria | 1024 |
| 413 | Ga0207712_10100821 | 3300025961 | Bacteria | 2146 |
| 414 | Ga0207668_10105748 | 3300025972 | Bacteria | 2101 |
| 415 | Ga0207668_10205216 | 3300025972 | Bacteria | 1572 |
| 416 | Ga0207640_10109328 | 3300025981 | Bacteria | 1956 |
| 417 | Ga0207640_10130436 | 3300025981 | Bacteria | 1816 |
| 418 | Ga0207640_10203984 | 3300025981 | Bacteria | 1501 |
| 419 | Ga0207658_10089179 | 3300025986 | Bacteria | 2387 |
| 420 | Ga0207703_10040144 | 3300026035 | Bacteria | 3744 |
| 421 | Ga0207703_10234020 | 3300026035 | Bacteria | 1648 |
| 422 | Ga0207639_10196994 | 3300026041 | Bacteria | 1725 |
| 423 | Ga0207678_10027583 | 3300026067 | Bacteria | 4955 |
| 424 | Ga0207678_10028548 | 3300026067 | Bacteria | 4870 |
| 425 | Ga0207678_10029406 | 3300026067 | Bacteria | 4795 |
| 426 | Ga0207678_10056344 | 3300026067 | Bacteria | 3383 |
| 427 | Ga0207678_10174693 | 3300026067 | Bacteria | 1834 |
| 428 | Ga0207708_10076715 | 3300026075 | Bacteria | 2564 |
| 429 | Ga0207708_10345253 | 3300026075 | Bacteria | 1220 |
| 430 | Ga0207702_10003081 | 3300026078 | Bacteria | 15478 |
| 431 | Ga0207702_10036786 | 3300026078 | Bacteria | 4095 |
| 432 | Ga0207702_10340520 | 3300026078 | Bacteria | 1433 |
| 433 | Ga0207641_10172250 | 3300026088 | Bacteria | 1977 |
| 434 | Ga0207641_10429054 | 3300026088 | Bacteria | 1274 |
| 435 | Ga0207648_10210859 | 3300026089 | Bacteria | 1724 |
| 436 | Ga0207674_10034941 | 3300026116 | Bacteria | 5250 |
| 437 | Ga0207674_10170778 | 3300026116 | Bacteria | 2128 |
| 438 | Ga0207674_10213186 | 3300026116 | Bacteria | 1880 |
| 439 | Ga0207675_100070518 | 3300026118 | Bacteria | 3266 |
| 440 | Ga0207683_10087032 | 3300026121 | Bacteria | 2778 |
| 441 | Ga0207683_10332279 | 3300026121 | Bacteria | 1393 |
| 442 | Ga0207698_10033737 | 3300026142 | Bacteria | 3723 |
| 443 | Ga0207698_10058032 | 3300026142 | Bacteria | 2997 |
| 444 | Ga0207698_10144517 | 3300026142 | Bacteria | 2055 |
| 445 | Ga0209389_1000041 | 3300027296 | Bacteria | 123983 |
| 446 | Ga0209389_1000177 | 3300027296 | Bacteria | 49952 |
| 447 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 448 | Ga0209589_1000072 | 3300027357 | Bacteria | 98789 |
| 449 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 450 | Ga0209489_100031 | 3300027361 | Bacteria | 184074 |
| 451 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 452 | Ga0209700_100010 | 3300027363 | Bacteria | 395269 |
| 453 | Ga0209179_1001806 | 3300027512 | Bacteria | 2731 |
| 454 | Ga0209179_1030993 | 3300027512 | Bacteria | 1095 |
| 455 | Ga0209588_1016853 | 3300027671 | Bacteria | 2260 |
| 456 | Ga0268266_10002176 | 3300028379 | Bacteria | 21461 |
| 457 | Ga0268266_10020579 | 3300028379 | Bacteria | 5621 |
| 458 | Ga0268266_10033715 | 3300028379 | Bacteria | 4352 |
| 459 | Ga0268266_10241882 | 3300028379 | Bacteria | 1666 |
| 460 | Ga0268266_10286276 | 3300028379 | Bacteria | 1533 |
| 461 | Ga0268265_10127289 | 3300028380 | Bacteria | 2110 |
| 462 | Ga0268264_10000162 | 3300028381 | Bacteria | 148472 |
| 463 | Ga0268264_10303835 | 3300028381 | Bacteria | 1503 |
| 464 | Ga0265323_10002662 | 3300028653 | Bacteria | 8063 |
| 465 | Ga0265336_10000852 | 3300028666 | Bacteria | 15879 |
| 466 | Ga0307517_10000419 | 3300028786 | Bacteria | 72682 |
| 467 | Ga0307517_10259351 | 3300028786 | Bacteria | 1011 |
| 468 | Ga0265338_10045157 | 3300028800 | Bacteria | 4055 |
| 469 | Ga0265340_10066870 | 3300031247 | Bacteria | 1709 |
| 470 | Ga0307513_10103307 | 3300031456 | Bacteria | 2867 |
| 471 | Ga0307513_10245603 | 3300031456 | Bacteria | 1591 |
| 472 | Ga0307509_10249461 | 3300031507 | Bacteria | 1560 |
| 473 | Ga0307508_10244124 | 3300031616 | Bacteria | 1393 |
| 474 | Ga0265314_10003550 | 3300031711 | Bacteria | 15057 |
| 475 | Ga0307516_10008049 | 3300031730 | Bacteria | 11984 |
| 476 | Ga0307516_10327093 | 3300031730 | Bacteria | 1203 |
| 477 | Ga0307410_10293668 | 3300031852 | Bacteria | 1280 |
| 478 | Ga0307410_10310420 | 3300031852 | Bacteria | 1248 |
| 479 | Ga0307406_10057670 | 3300031901 | Bacteria | 2492 |
| 480 | Ga0307409_100167133 | 3300031995 | Bacteria | 1932 |
| 481 | Ga0307409_100651119 | 3300031995 | Bacteria | 1047 |
| 482 | Ga0307411_10100612 | 3300032005 | Bacteria | 2043 |
| 483 | Ga0307507_10014311 | 3300033179 | Bacteria | 9481 |
| 484 | Ga0307510_10016740 | 3300033180 | Bacteria | 8651 |
| 485 | Ga0307510_10025604 | 3300033180 | Bacteria | 6800 |
| 486 | Ga0307510_10033199 | 3300033180 | Bacteria | 5800 |
| 487 | Ga0307510_10112169 | 3300033180 | Bacteria | 2465 |
| 488 | Ga0373926_0023829 | 3300035083 | Bacteria | 2128 |
| 489 | Ga0373928_0006084 | 3300035084 | Bacteria | 2315 |
| 490 | Ga0373934_0031937 | 3300035086 | Bacteria | 2064 |
| 491 | Ga0373923_0003846 | 3300035111 | Bacteria | 4887 |
| 492 | Ga0373936_0002352 | 3300035113 | Bacteria | 7077 |
| 493 | Ga0373936_0127476 | 3300035113 | Bacteria | 1091 |
| 494 | Ga0373939_0046801 | 3300035114 | Bacteria | 1326 |
| 495 | Ga0373941_0006333 | 3300035115 | Bacteria | 2846 |
| 496 | Ga0373945_0013610 | 3300035116 | Bacteria | 2718 |
| 497 | Ga0373953_0011610 | 3300035117 | Bacteria | 3097 |
| 498 | Ga0373953_0064738 | 3300035117 | Bacteria | 1500 |
| 499 | Ga0373954_0009272 | 3300035118 | Bacteria | 4330 |
| 500 | Ga0373954_0083438 | 3300035118 | Bacteria | 1529 |
| 501 | Ga0373956_0039768 | 3300035119 | Bacteria | 2085 |
| 502 | Ga0373956_0067322 | 3300035119 | Bacteria | 1630 |
| 503 | Ga0373946_0252510 | 3300035171 | Bacteria | 861 |
| 504 | Ga0373955_0043303 | 3300035172 | Bacteria | 2421 |
| 505 | Ga0373942_0096343 | 3300035207 | Bacteria | 899 |
| 506 | Ga0373924_0052083 | 3300035410 | Bacteria | 1698 |
| 507 | Ga0373931_0011783 | 3300035691 | Bacteria | 4227 |
| 508 | Ga0373931_0284787 | 3300035691 | Bacteria | 1016 |
| 509 | Ga0373935_0000164 | 3300035692 | Bacteria | 30791 |
| 510 | Ga0373935_0064822 | 3300035692 | Bacteria | 2343 |
| 511 | Ga0373935_0118799 | 3300035692 | Bacteria | 1763 |
| 512 | Ga0373935_0175039 | 3300035692 | Bacteria | 1470 |
| 513 | Ga0373935_0279372 | 3300035692 | Bacteria | 1175 |
| 514 | Ga0373935_0452322 | 3300035692 | Bacteria | 928 |
| 515 | Ga0373927_0000977 | 3300035695 | Bacteria | 21745 |
| 516 | Ga0373927_0031976 | 3300035695 | Bacteria | 3427 |
| 517 | Ga0373927_0063185 | 3300035695 | Bacteria | 2394 |
| 518 | Ga0373927_0173132 | 3300035695 | Bacteria | 1415 |
| 519 | Ga0373933_0000686 | 3300035724 | Bacteria | 20889 |
| 520 | Ga0373933_0031003 | 3300035724 | Bacteria | 3099 |
| 521 | Ga0373933_0066047 | 3300035724 | Bacteria | 2191 |
| 522 | Ga0373947_0003339 | 3300035725 | Bacteria | 9502 |
| 523 | Ga0373947_0006259 | 3300035725 | Bacteria | 6919 |
| 524 | Ga0373937_0018073 | 3300036401 | Bacteria | 6289 |
| 525 | Ga0373937_0125556 | 3300036401 | Bacteria | 2393 |
| 526 | Ga0310112_016313 | 3300036458 | Bacteria | 1055 |
| 527 | Ga0372808_014125 | 3300036459 | Bacteria | 1138 |
| 528 | Ga0310109_016196 | 3300036534 | Bacteria | 1010 |
| 529 | Ga0373925_0092678 | 3300037068 | Bacteria | 2311 |
| 530 | Ga0373925_0165182 | 3300037068 | Bacteria | 1745 |
| 531 | Ga0373925_0192286 | 3300037068 | Bacteria | 1619 |
| 532 | Ga0395899_0019671 | 3300037312 | Bacteria | 5126 |
| 533 | Ga0395899_0020079 | 3300037312 | Bacteria | 5069 |
| 534 | Ga0395900_0000917 | 3300037418 | Bacteria | 38740 |
| 535 | Ga0395898_0018861 | 3300037466 | Bacteria | 7029 |
| 536 | Ga0395898_0086189 | 3300037466 | Bacteria | 3027 |
| 537 | Ga0395898_0332905 | 3300037466 | Bacteria | 1448 |
| 538 | Ga0395898_0363657 | 3300037466 | Bacteria | 1380 |
| 539 | Ga0395905_0015528 | 3300037471 | Bacteria | 7237 |
| 540 | Ga0395905_0139633 | 3300037471 | Bacteria | 2280 |
| 541 | Ga0395905_0589380 | 3300037471 | Bacteria | 1013 |
| 542 | Ga0395905_0592593 | 3300037471 | Bacteria | 1010 |
| 543 | Ga0436364_0108567 | 3300037853 | Bacteria | 1708 |
| 544 | Ga0436364_0120722 | 3300037853 | Bacteria | 21173 |
| 545 | Ga0436364_0462513 | 3300037853 | Bacteria | 906 |
| 546 | Ga0436364_1124077 | 3300037853 | Bacteria | 4443 |
| 547 | Ga0436364_1513198 | 3300037853 | Bacteria | 3265 |
| 548 | Ga0395901_0010786 | 3300038443 | Bacteria | 9261 |
| 549 | Ga0395901_0151265 | 3300038443 | Bacteria | 2439 |
| 550 | Ga0395901_0199004 | 3300038443 | Bacteria | 2100 |
| 551 | Ga0395901_0267252 | 3300038443 | Bacteria | 1779 |
| 552 | Ga0436365_0169079 | 3300039437 | Bacteria | 2056 |
| 553 | Ga0436365_0847601 | 3300039437 | Bacteria | 4655 |
| 554 | Ga0436365_1698108 | 3300039437 | Bacteria | 3471 |
| 555 | Ga0436365_1855737 | 3300039437 | Bacteria | 2258 |
| 556 | Ga0436360_1064741 | 3300039438 | Bacteria | 952 |
| 557 | Ga0436361_0810566 | 3300039447 | Bacteria | 2642 |
| 558 | Ga0436363_0891931 | 3300039450 | Bacteria | 1055 |
| 559 | Ga0436363_1148126 | 3300039450 | Bacteria | 1911 |
| 560 | Ga0436363_1284550 | 3300039450 | Bacteria | 846 |
| 561 | Ga0436363_1567676 | 3300039450 | Bacteria | 6306 |
| 562 | Ga0436362_0209602 | 3300039453 | Bacteria | 2146 |
| 563 | Ga0436362_1238172 | 3300039453 | Bacteria | 1076 |
| 564 | Ga0439465_0065966 | 3300041413 | Bacteria | 1206 |
| 565 | Ga0466969_0153801 | 3300044656 | Bacteria | 1059 |
| 566 | Ga0466972_0000532 | 3300044658 | Bacteria | 18735 |
| 567 | Ga0466972_0113042 | 3300044658 | Bacteria | 1282 |
| 568 | Ga0466966_0000615 | 3300044684 | Bacteria | 22621 |
| 569 | Ga0466961_0000007 | 3300044693 | Bacteria | 146374 |
| 570 | Ga0466963_0081869 | 3300044694 | Bacteria | 2187 |
| 571 | Ga0466968_0298917 | 3300044735 | Bacteria | 774 |
| 572 | Ga0466970_0118892 | 3300044765 | Bacteria | 1447 |
| 573 | Ga0466957_0100383 | 3300044842 | Bacteria | 1824 |
| 574 | Ga0466960_0004498 | 3300044901 | Bacteria | 5459 |
| 575 | Ga0466960_0191535 | 3300044901 | Bacteria | 1113 |
| 576 | Ga0466967_0056365 | 3300045976 | Bacteria | 3464 |
| 577 | Ga0466967_0159550 | 3300045976 | Bacteria | 2115 |
| 578 | Ga0466967_0566753 | 3300045976 | Bacteria | 1119 |
| 579 | Ga0495617_004700 | 3300046452 | Bacteria | 4938 |
| 580 | Ga0495627_055398 | 3300046453 | Bacteria | 1184 |
| 581 | Ga0495592_0013585 | 3300046454 | Bacteria | 6195 |
| 582 | Ga0495592_0033422 | 3300046454 | Bacteria | 3879 |
| 583 | Ga0495592_0168698 | 3300046454 | Bacteria | 1500 |
| 584 | Ga0495603_0005902 | 3300046455 | Bacteria | 7319 |
| 585 | Ga0495603_0034275 | 3300046455 | Bacteria | 3052 |
| 586 | Ga0495603_0044412 | 3300046455 | Bacteria | 2652 |
| 587 | Ga0495603_0060537 | 3300046455 | Bacteria | 2237 |
| 588 | Ga0495603_0061209 | 3300046455 | Bacteria | 2223 |
| 589 | Ga0495603_0185812 | 3300046455 | Bacteria | 1202 |
| 590 | Ga0495603_0201246 | 3300046455 | Bacteria | 1151 |
| 591 | Ga0495629_0000087 | 3300046459 | Bacteria | 81337 |
| 592 | Ga0495629_0020296 | 3300046459 | Bacteria | 4744 |
| 593 | Ga0495629_0028710 | 3300046459 | Bacteria | 3949 |
| 594 | Ga0495629_0112904 | 3300046459 | Bacteria | 1894 |
| 595 | Ga0495629_0229070 | 3300046459 | Bacteria | 1281 |
| 596 | Ga0495629_0476057 | 3300046459 | Bacteria | 844 |
| 597 | Ga0495638_0025097 | 3300046460 | Bacteria | 3877 |
| 598 | Ga0495638_0048710 | 3300046460 | Bacteria | 2651 |
| 599 | Ga0495638_0181733 | 3300046460 | Bacteria | 1199 |
| 600 | Ga0495641_0056274 | 3300046461 | Bacteria | 1783 |
| 601 | Ga0495641_0209349 | 3300046461 | Bacteria | 874 |
| 602 | Ga0495651_0006121 | 3300046462 | Bacteria | 9188 |
| 603 | Ga0495651_0058185 | 3300046462 | Bacteria | 2966 |
| 604 | Ga0495651_0187273 | 3300046462 | Bacteria | 1459 |
| 605 | Ga0495651_0344547 | 3300046462 | Bacteria | 986 |
| 606 | Ga0495650_0050059 | 3300046471 | Bacteria | 1730 |
| 607 | Ga0495650_0113136 | 3300046471 | Bacteria | 1006 |
| 608 | Ga0495580_0155451 | 3300046472 | Bacteria | 1584 |
| 609 | Ga0495582_0000818 | 3300046473 | Bacteria | 17225 |
| 610 | Ga0495582_0017171 | 3300046473 | Bacteria | 3961 |
| 611 | Ga0495582_0023689 | 3300046473 | Bacteria | 3357 |
| 612 | Ga0495582_0167152 | 3300046473 | Bacteria | 1252 |
| 613 | Ga0495605_0046987 | 3300046474 | Bacteria | 2119 |
| 614 | Ga0495605_0103455 | 3300046474 | Bacteria | 1306 |
| 615 | Ga0495639_0000022 | 3300046475 | Bacteria | 72037 |
| 616 | Ga0495639_0021590 | 3300046475 | Bacteria | 2819 |
| 617 | Ga0495662_0000161 | 3300046476 | Bacteria | 26325 |
| 618 | Ga0495664_0008978 | 3300046477 | Bacteria | 5586 |
| 619 | Ga0495664_0010436 | 3300046477 | Bacteria | 5212 |
| 620 | Ga0495664_0025321 | 3300046477 | Bacteria | 3454 |
| 621 | Ga0495664_0300687 | 3300046477 | Bacteria | 969 |
| 622 | Ga0495585_0204695 | 3300046492 | Bacteria | 1003 |
| 623 | Ga0495594_0000275 | 3300046499 | Bacteria | 25366 |
| 624 | Ga0495607_0076704 | 3300046501 | Bacteria | 1848 |
| 625 | Ga0495607_0081498 | 3300046501 | Bacteria | 1777 |
| 626 | Ga0495583_0031803 | 3300046506 | Bacteria | 2554 |
| 627 | Ga0495583_0095735 | 3300046506 | Bacteria | 1273 |
| 628 | Ga0495606_0002311 | 3300046507 | Bacteria | 22456 |
| 629 | Ga0495608_0010519 | 3300046511 | Bacteria | 6456 |
| 630 | Ga0495608_0118648 | 3300046511 | Bacteria | 1697 |
| 631 | Ga0495616_0096958 | 3300046513 | Bacteria | 1388 |
| 632 | Ga0495618_0346680 | 3300046514 | Unclassified | 916 |
| 633 | Ga0495620_0043676 | 3300046515 | Bacteria | 1951 |
| 634 | Ga0495628_0001747 | 3300046516 | Bacteria | 19762 |
| 635 | Ga0495628_0017546 | 3300046516 | Bacteria | 5954 |
| 636 | Ga0495628_0032115 | 3300046516 | Bacteria | 4241 |
| 637 | Ga0495628_0155477 | 3300046516 | Bacteria | 1740 |
| 638 | Ga0495628_0335630 | 3300046516 | Bacteria | 1113 |
| 639 | Ga0495630_0003318 | 3300046517 | Bacteria | 11208 |
| 640 | Ga0495630_0069212 | 3300046517 | Bacteria | 2654 |
| 641 | Ga0495637_0151663 | 3300046520 | Bacteria | 874 |
| 642 | Ga0495643_0038350 | 3300046522 | Bacteria | 2624 |
| 643 | Ga0495644_0018106 | 3300046523 | Bacteria | 2690 |
| 644 | Ga0495648_0001225 | 3300046524 | Bacteria | 25650 |
| 645 | Ga0495648_0003338 | 3300046524 | Bacteria | 14157 |
| 646 | Ga0495648_0097817 | 3300046524 | Bacteria | 1627 |
| 647 | Ga0495663_0121971 | 3300046525 | Bacteria | 873 |
| 648 | Ga0495642_0140679 | 3300046528 | Bacteria | 1042 |
| 649 | Ga0495652_0032273 | 3300046529 | Bacteria | 4581 |
| 650 | Ga0495652_0090656 | 3300046529 | Bacteria | 2501 |
| 651 | Ga0495652_0471319 | 3300046529 | Bacteria | 875 |
| 652 | Ga0495654_0013914 | 3300046530 | Bacteria | 4294 |
| 653 | Ga0495665_0000105 | 3300046531 | Bacteria | 39366 |
| 654 | Ga0495665_0037812 | 3300046531 | Bacteria | 2575 |
| 655 | Ga0495640_0022475 | 3300046533 | Bacteria | 4608 |
| 656 | Ga0495640_0044182 | 3300046533 | Bacteria | 3099 |
| 657 | Ga0495640_0189730 | 3300046533 | Bacteria | 1307 |
| 658 | Ga0495586_0032919 | 3300046535 | Bacteria | 2781 |
| 659 | Ga0495587_0028494 | 3300046536 | Bacteria | 3396 |
| 660 | Ga0495587_0130240 | 3300046536 | Bacteria | 1438 |
| 661 | Ga0495587_0212808 | 3300046536 | Bacteria | 1091 |
| 662 | Ga0495645_0004709 | 3300046543 | Bacteria | 9318 |
| 663 | Ga0495645_0007422 | 3300046543 | Bacteria | 7629 |
| 664 | Ga0495645_0009152 | 3300046543 | Bacteria | 6921 |
| 665 | Ga0495645_0039319 | 3300046543 | Bacteria | 3450 |
| 666 | Ga0495622_0021392 | 3300046557 | Bacteria | 3011 |
| 667 | Ga0495622_0029620 | 3300046557 | Bacteria | 2558 |
| 668 | Ga0495622_0036742 | 3300046557 | Bacteria | 2283 |
| 669 | Ga0495622_0075623 | 3300046557 | Bacteria | 1552 |
| 670 | Ga0495622_0131755 | 3300046557 | Bacteria | 1138 |
| 671 | Ga0495622_0175124 | 3300046557 | Bacteria | 963 |
| 672 | Ga0495633_0041642 | 3300046558 | Bacteria | 2183 |
| 673 | Ga0495633_0086773 | 3300046558 | Bacteria | 1455 |
| 674 | Ga0495633_0139772 | 3300046558 | Bacteria | 1120 |
| 675 | Ga0495667_0008571 | 3300046559 | Bacteria | 6939 |
| 676 | Ga0495656_0039223 | 3300046615 | Bacteria | 1966 |
| 677 | Ga0495656_0042288 | 3300046615 | Bacteria | 1907 |
| 678 | Ga0495656_0069335 | 3300046615 | Bacteria | 1562 |
| 679 | Ga0495634_0032749 | 3300046642 | Bacteria | 3573 |
| 680 | Ga0495634_0070435 | 3300046642 | Bacteria | 2305 |
| 681 | Ga0495634_0139749 | 3300046642 | Bacteria | 1538 |
| 682 | Ga0495634_0279136 | 3300046642 | Bacteria | 1015 |
| 683 | Ga0495611_0081812 | 3300046648 | Bacteria | 1486 |
| 684 | Ga0495611_0201000 | 3300046648 | Bacteria | 929 |
| 685 | Ga0495635_0000359 | 3300046663 | Bacteria | 28977 |
| 686 | Ga0495635_0008606 | 3300046663 | Bacteria | 7124 |
| 687 | Ga0495635_0018462 | 3300046663 | Bacteria | 4867 |
| 688 | Ga0495635_0024280 | 3300046663 | Bacteria | 4226 |
| 689 | Ga0495635_0054715 | 3300046663 | Bacteria | 2748 |
| 690 | Ga0495659_0118649 | 3300046664 | Bacteria | 1039 |
| 691 | Ga0495588_0067236 | 3300046674 | Bacteria | 1860 |
| 692 | Ga0495588_0111581 | 3300046674 | Bacteria | 1440 |
| 693 | Ga0495657_0022842 | 3300046675 | Bacteria | 4475 |
| 694 | Ga0495657_0033017 | 3300046675 | Bacteria | 3607 |
| 695 | Ga0495599_0022485 | 3300046678 | Bacteria | 3937 |
| 696 | Ga0495599_0074439 | 3300046678 | Bacteria | 2120 |
| 697 | Ga0495599_0078082 | 3300046678 | Bacteria | 2067 |
| 698 | Ga0495623_0039468 | 3300046679 | Bacteria | 3017 |
| 699 | Ga0495646_0030813 | 3300046680 | Bacteria | 3347 |
| 700 | Ga0495647_0002828 | 3300046681 | Bacteria | 5511 |
| 701 | Ga0495647_0009627 | 3300046681 | Bacteria | 3279 |
| 702 | Ga0495647_0035007 | 3300046681 | Bacteria | 1884 |
| 703 | Ga0495658_0002969 | 3300046683 | Bacteria | 8503 |
| 704 | Ga0495658_0045638 | 3300046683 | Bacteria | 2460 |
| 705 | Ga0495658_0378929 | 3300046683 | Bacteria | 901 |
| 706 | Ga0495658_0468509 | 3300046683 | Bacteria | 805 |
| 707 | Ga0495669_0117580 | 3300046684 | Bacteria | 1245 |
| 708 | Ga0495613_0024571 | 3300046689 | Bacteria | 4489 |
| 709 | Ga0495613_0027201 | 3300046689 | Bacteria | 4256 |
| 710 | Ga0495613_0122217 | 3300046689 | Bacteria | 1869 |
| 711 | Ga0495624_0001105 | 3300046690 | Bacteria | 21345 |
| 712 | Ga0495624_0056555 | 3300046690 | Bacteria | 2468 |
| 713 | Ga0495624_0168393 | 3300046690 | Bacteria | 1337 |
| 714 | Ga0495624_0281662 | 3300046690 | Bacteria | 1004 |
| 715 | Ga0495624_0349439 | 3300046690 | Bacteria | 889 |
| 716 | Ga0495670_0005738 | 3300046691 | Bacteria | 6087 |
| 717 | Ga0495670_0206820 | 3300046691 | Bacteria | 1040 |
| 718 | Ga0495671_0269545 | 3300046692 | Bacteria | 821 |
| 719 | Ga0495649_0084615 | 3300046694 | Bacteria | 1693 |
| 720 | Ga0495600_0004522 | 3300046809 | Bacteria | 8332 |
| 721 | Ga0495600_0041130 | 3300046809 | Bacteria | 3012 |
| 722 | Ga0495600_0313018 | 3300046809 | Bacteria | 988 |
| 723 | Ga0495600_0384587 | 3300046809 | Bacteria | 875 |
| 724 | Ga0495581_0000889 | 3300047315 | Bacteria | 16000 |
| 725 | Ga0495581_0017695 | 3300047315 | Bacteria | 4141 |
| 726 | Ga0495604_0000837 | 3300047317 | Bacteria | 25702 |
| 727 | Ga0495604_0004042 | 3300047317 | Bacteria | 11657 |
| 728 | Ga0495604_0015252 | 3300047317 | Bacteria | 6134 |
| 729 | Ga0495604_0023476 | 3300047317 | Bacteria | 4920 |
| 730 | Ga0495604_0345809 | 3300047317 | Bacteria | 989 |
| 731 | Ga0495674_0010563 | 3300047319 | Bacteria | 8740 |
| 732 | Ga0495674_0016464 | 3300047319 | Bacteria | 6896 |
| 733 | Ga0495674_0057715 | 3300047319 | Bacteria | 3397 |
| 734 | Ga0495674_0081432 | 3300047319 | Bacteria | 2777 |
| 735 | Ga0495674_0122521 | 3300047319 | Bacteria | 2196 |
| 736 | Ga0495672_0019081 | 3300047320 | Bacteria | 4534 |
| 737 | Ga0495672_0048346 | 3300047320 | Bacteria | 2522 |
| 738 | Ga0495676_0033591 | 3300047321 | Bacteria | 4318 |
| 739 | Ga0495676_0060406 | 3300047321 | Bacteria | 2971 |
| 740 | Ga0495676_0343591 | 3300047321 | Bacteria | 999 |
| 741 | Ga0495680_0003829 | 3300047322 | Bacteria | 14610 |
| 742 | Ga0495680_0095290 | 3300047322 | Bacteria | 2225 |
| 743 | Ga0495683_0033407 | 3300047323 | Bacteria | 2618 |
| 744 | Ga0495683_0142501 | 3300047323 | Bacteria | 1122 |
| 745 | Ga0495687_031352 | 3300047443 | Bacteria | 2439 |
| 746 | Ga0495687_032692 | 3300047443 | Bacteria | 2371 |
| 747 | Ga0495675_0050477 | 3300047444 | Bacteria | 2644 |
| 748 | Ga0495675_0315405 | 3300047444 | Bacteria | 926 |
| 749 | Ga0495677_0090585 | 3300047445 | Bacteria | 1152 |
| 750 | Ga0495673_0024739 | 3300047469 | Bacteria | 2894 |
| 751 | Ga0495673_0053769 | 3300047469 | Bacteria | 1754 |
| 752 | Ga0495673_0075219 | 3300047469 | Bacteria | 1411 |
| 753 | Ga0495673_0089278 | 3300047469 | Bacteria | 1262 |
| 754 | Ga0495684_0011995 | 3300047471 | Bacteria | 6682 |
| 755 | Ga0495684_0079064 | 3300047471 | Bacteria | 2496 |
| 756 | Ga0495684_0345170 | 3300047471 | Bacteria | 1058 |
| 757 | Ga0495686_0060912 | 3300047472 | Bacteria | 2345 |
| 758 | Ga0495686_0106475 | 3300047472 | Bacteria | 1686 |
| 759 | Ga0495686_0164213 | 3300047472 | Bacteria | 1295 |
| 760 | Ga0495686_0363171 | 3300047472 | Bacteria | 784 |
| 761 | Ga0495593_0000213 | 3300047673 | Bacteria | 30598 |
| 762 | Ga0495593_0048739 | 3300047673 | Bacteria | 2251 |
| 763 | Ga0495593_0050152 | 3300047673 | Bacteria | 2212 |
| 764 | Ga0495593_0058879 | 3300047673 | Bacteria | 2014 |
| 765 | Ga0495602_0018479 | 3300048088 | Bacteria | 6960 |
| 766 | Ga0495602_0421335 | 3300048088 | Bacteria | 948 |
| 767 | Ga0495614_0044651 | 3300048089 | Bacteria | 1901 |
| 768 | Ga0495615_0060520 | 3300048090 | Bacteria | 998 |
| 769 | Ga0496100_0082160 | 3300048903 | Bacteria | 2178 |
| 770 | Ga0496100_0351202 | 3300048903 | Bacteria | 1114 |
| 771 | Ga0496100_0385911 | 3300048903 | Bacteria | 1064 |
| 772 | Ga0496101_0007272 | 3300048904 | Bacteria | 7166 |
| 773 | Ga0496101_0114579 | 3300048904 | Bacteria | 2033 |
| 774 | Ga0496101_0143517 | 3300048904 | Bacteria | 1822 |
| 775 | Ga0496102_0023382 | 3300048905 | Bacteria | 5488 |
| 776 | Ga0496102_0119831 | 3300048905 | Bacteria | 2457 |
| 777 | Ga0496102_0128475 | 3300048905 | Bacteria | 2370 |
| 778 | Ga0496103_0011197 | 3300048906 | Bacteria | 5312 |
| 779 | Ga0496103_0095313 | 3300048906 | Bacteria | 1880 |
| 780 | Ga0496104_0000090 | 3300048907 | Bacteria | 87877 |
| 781 | Ga0496104_0382235 | 3300048907 | Bacteria | 1321 |
| 782 | Ga0496104_0472605 | 3300048907 | Bacteria | 1165 |
| 783 | Ga0496105_0001807 | 3300048908 | Bacteria | 15303 |
| 784 | Ga0496105_0008671 | 3300048908 | Bacteria | 7908 |
| 785 | Ga0496105_0094063 | 3300048908 | Bacteria | 2475 |
| 786 | Ga0496105_0134697 | 3300048908 | Bacteria | 2035 |
| 787 | Ga0496105_0141805 | 3300048908 | Bacteria | 1978 |
| 788 | Ga0496106_0080266 | 3300048909 | Bacteria | 2505 |
| 789 | Ga0496106_0263772 | 3300048909 | Bacteria | 1379 |
| 790 | Ga0496107_0076355 | 3300048910 | Bacteria | 2440 |
| 791 | Ga0496107_0235158 | 3300048910 | Bacteria | 1363 |
| 792 | Ga0496107_0238285 | 3300048910 | Bacteria | 1354 |
| 793 | Ga0496107_0249609 | 3300048910 | Bacteria | 1320 |
| 794 | Ga0496108_0094194 | 3300048911 | Bacteria | 2549 |
| 795 | Ga0496108_0601391 | 3300048911 | Bacteria | 958 |
| 796 | Ga0496109_0035526 | 3300048912 | Bacteria | 4497 |
| 797 | Ga0496109_0424191 | 3300048912 | Bacteria | 1256 |
| 798 | Ga0496109_0532331 | 3300048912 | Bacteria | 1109 |
| 799 | Ga0496110_0038593 | 3300048913 | Bacteria | 4156 |
| 800 | Ga0496110_0062301 | 3300048913 | Bacteria | 3294 |
| 801 | Ga0496110_0683898 | 3300048913 | Bacteria | 927 |
| 802 | Ga0496111_0042237 | 3300048914 | Bacteria | 3273 |
| 803 | Ga0496111_0261468 | 3300048914 | Bacteria | 1284 |
| 804 | Ga0496111_0374064 | 3300048914 | Bacteria | 1054 |
| 805 | Ga0496111_0451870 | 3300048914 | Bacteria | 948 |
| 806 | Ga0496112_0169300 | 3300048915 | Bacteria | 2150 |
| 807 | Ga0496112_0201862 | 3300048915 | Bacteria | 1947 |
| 808 | Ga0496112_0798834 | 3300048915 | Bacteria | 868 |
| 809 | Ga0496113_0138153 | 3300048916 | Bacteria | 1916 |
| 810 | Ga0496113_0253750 | 3300048916 | Bacteria | 1404 |
| 811 | Ga0496113_0259287 | 3300048916 | Bacteria | 1389 |
| 812 | Ga0496113_0309062 | 3300048916 | Bacteria | 1266 |
| 813 | Ga0496114_0158685 | 3300048917 | Bacteria | 1965 |
| 814 | Ga0496114_0186087 | 3300048917 | Bacteria | 1815 |
| 815 | Ga0496114_0192471 | 3300048917 | Bacteria | 1785 |
| 816 | Ga0496114_0222306 | 3300048917 | Bacteria | 1658 |
| 817 | Ga0496114_0253237 | 3300048917 | Bacteria | 1549 |
| 818 | Ga0496114_0269663 | 3300048917 | Bacteria | 1500 |
| 819 | Ga0496114_0278699 | 3300048917 | Bacteria | 1474 |
| 820 | Ga0496115_0034395 | 3300048918 | Bacteria | 4005 |
| 821 | Ga0496115_0036742 | 3300048918 | Bacteria | 3879 |
| 822 | Ga0496115_0047926 | 3300048918 | Bacteria | 3418 |
| 823 | Ga0496115_0049795 | 3300048918 | Bacteria | 3354 |
| 824 | Ga0496115_0117944 | 3300048918 | Bacteria | 2183 |
| 825 | Ga0496115_0211341 | 3300048918 | Bacteria | 1602 |
| 826 | Ga0496115_0228759 | 3300048918 | Bacteria | 1534 |
| 827 | Ga0496115_0568665 | 3300048918 | Bacteria | 904 |
| 828 | Ga0496116_0001513 | 3300048919 | Bacteria | 25797 |
| 829 | Ga0496116_0044890 | 3300048919 | Bacteria | 2996 |
| 830 | Ga0496116_0220623 | 3300048919 | Bacteria | 972 |
| 831 | Ga0496117_0018780 | 3300048920 | Bacteria | 5711 |
| 832 | Ga0496117_0050320 | 3300048920 | Bacteria | 2955 |
| 833 | Ga0496117_0097052 | 3300048920 | Bacteria | 1878 |
| 834 | Ga0496117_0099583 | 3300048920 | Bacteria | 1843 |
| 835 | Ga0496117_0215115 | 3300048920 | Bacteria | 1074 |
| 836 | Ga0496118_0003772 | 3300048921 | Bacteria | 18723 |
| 837 | Ga0496118_0053399 | 3300048921 | Bacteria | 3072 |
| 838 | Ga0496118_0058993 | 3300048921 | Bacteria | 2862 |
| 839 | Ga0496118_0154757 | 3300048921 | Bacteria | 1428 |
| 840 | Ga0496118_0158428 | 3300048921 | Bacteria | 1404 |
| 841 | Ga0496119_0044789 | 3300048922 | Bacteria | 2781 |
| 842 | Ga0496119_0125185 | 3300048922 | Bacteria | 1407 |
| 843 | Ga0496119_0129507 | 3300048922 | Bacteria | 1377 |
| 844 | Ga0496119_0160573 | 3300048922 | Bacteria | 1195 |
| 845 | Ga0496120_0015096 | 3300048923 | Bacteria | 5111 |
| 846 | Ga0496120_0016845 | 3300048923 | Bacteria | 4759 |
| 847 | Ga0496120_0029408 | 3300048923 | Bacteria | 3355 |
| 848 | Ga0496120_0194959 | 3300048923 | Bacteria | 985 |
| 849 | Ga0496121_0000302 | 3300048924 | Bacteria | 102347 |
| 850 | Ga0496121_0001399 | 3300048924 | Bacteria | 40824 |
| 851 | Ga0496121_0001546 | 3300048924 | Bacteria | 38502 |
| 852 | Ga0496121_0014891 | 3300048924 | Bacteria | 8200 |
| 853 | Ga0496121_0027588 | 3300048924 | Bacteria | 5311 |
| 854 | Ga0496121_0040888 | 3300048924 | Bacteria | 4061 |
| 855 | Ga0496121_0082353 | 3300048924 | Bacteria | 2544 |
| 856 | Ga0496121_0092827 | 3300048924 | Bacteria | 2352 |
| 857 | Ga0496121_0098233 | 3300048924 | Bacteria | 2266 |
| 858 | Ga0496121_0167265 | 3300048924 | Bacteria | 1601 |
| 859 | Ga0496121_0188548 | 3300048924 | Bacteria | 1481 |
| 860 | Ga0496121_0221919 | 3300048924 | Bacteria | 1330 |
| 861 | Ga0496121_0245961 | 3300048924 | Bacteria | 1243 |
| 862 | Ga0496122_0017367 | 3300048925 | Bacteria | 6733 |
| 863 | Ga0496122_0105434 | 3300048925 | Bacteria | 1869 |
| 864 | Ga0496122_0122205 | 3300048925 | Bacteria | 1676 |
| 865 | Ga0496123_0024142 | 3300048926 | Bacteria | 4629 |
| 866 | Ga0496123_0031821 | 3300048926 | Bacteria | 3830 |
| 867 | Ga0496123_0171946 | 3300048926 | Bacteria | 1142 |
| 868 | Ga0496124_0005111 | 3300048927 | Bacteria | 14940 |
| 869 | Ga0496124_0102586 | 3300048927 | Bacteria | 2315 |
| 870 | Ga0496125_0000847 | 3300048928 | Bacteria | 49025 |
| 871 | Ga0496125_0001679 | 3300048928 | Bacteria | 30955 |
| 872 | Ga0496125_0007002 | 3300048928 | Bacteria | 12067 |
| 873 | Ga0496125_0012038 | 3300048928 | Bacteria | 8612 |
| 874 | Ga0496125_0067791 | 3300048928 | Bacteria | 2810 |
| 875 | Ga0496125_0232300 | 3300048928 | Bacteria | 1178 |
| 876 | Ga0496125_0249609 | 3300048928 | Bacteria | 1121 |
| 877 | Ga0496126_0004245 | 3300048929 | Bacteria | 17249 |
| 878 | Ga0496126_0006546 | 3300048929 | Bacteria | 12970 |
| 879 | Ga0496126_0006778 | 3300048929 | Bacteria | 12706 |
| 880 | Ga0496126_0039491 | 3300048929 | Bacteria | 4378 |
| 881 | Ga0496126_0041087 | 3300048929 | Bacteria | 4283 |
| 882 | Ga0496126_0081901 | 3300048929 | Bacteria | 2852 |
| 883 | Ga0496126_0142094 | 3300048929 | Bacteria | 2065 |
| 884 | Ga0496126_0148315 | 3300048929 | Bacteria | 2012 |
| 885 | Ga0496126_0168285 | 3300048929 | Bacteria | 1869 |
| 886 | Ga0496126_0171434 | 3300048929 | Bacteria | 1848 |
| 887 | Ga0496126_0180968 | 3300048929 | Bacteria | 1790 |
| 888 | Ga0496126_0199798 | 3300048929 | Bacteria | 1689 |
| 889 | Ga0496126_0227182 | 3300048929 | Bacteria | 1565 |
| 890 | Ga0496126_0344484 | 3300048929 | Bacteria | 1220 |
| 891 | Ga0496126_0411230 | 3300048929 | Bacteria | 1095 |
| 892 | Ga0496126_0532671 | 3300048929 | Bacteria | 934 |
| 893 | Ga0495682_0005454 | 3300049460 | Bacteria | 5285 |
| 894 | Ga0501031_0003006 | 3300049568 | Bacteria | 10795 |
| 895 | Ga0501031_0004506 | 3300049568 | Bacteria | 9037 |
| 896 | Ga0501031_0034955 | 3300049568 | Bacteria | 3278 |
| 897 | Ga0501031_0114201 | 3300049568 | Bacteria | 1764 |
| 898 | Ga0501032_0000316 | 3300049569 | Bacteria | 40481 |
| 899 | Ga0501032_0002923 | 3300049569 | Bacteria | 13280 |
| 900 | Ga0501032_0037038 | 3300049569 | Bacteria | 3327 |
| 901 | Ga0501032_0079106 | 3300049569 | Bacteria | 2189 |
| 902 | Ga0501032_0114965 | 3300049569 | Bacteria | 1779 |
| 903 | Ga0501032_0190779 | 3300049569 | Bacteria | 1339 |
| 904 | Ga0501032_0220773 | 3300049569 | Bacteria | 1233 |
| 905 | Ga0501033_0000025 | 3300049570 | Bacteria | 173634 |
| 906 | Ga0501033_0000155 | 3300049570 | Bacteria | 65906 |
| 907 | Ga0501033_0003921 | 3300049570 | Bacteria | 12072 |
| 908 | Ga0501033_0120706 | 3300049570 | Bacteria | 1902 |
| 909 | Ga0501034_0000177 | 3300049571 | Bacteria | 118966 |
| 910 | Ga0501034_0000852 | 3300049571 | Bacteria | 45151 |
| 911 | Ga0501034_0021638 | 3300049571 | Bacteria | 6550 |
| 912 | Ga0501034_0057729 | 3300049571 | Bacteria | 3901 |
| 913 | Ga0501034_0062059 | 3300049571 | Bacteria | 3752 |
| 914 | Ga0501034_0149442 | 3300049571 | Bacteria | 2312 |
| 915 | Ga0501034_0294457 | 3300049571 | Bacteria | 1560 |
| 916 | Ga0501034_0347707 | 3300049571 | Bacteria | 1411 |
| 917 | Ga0501034_0461010 | 3300049571 | Bacteria | 1187 |
| 918 | Ga0501036_0000167 | 3300049572 | Bacteria | 43218 |
| 919 | Ga0501036_0001075 | 3300049572 | Bacteria | 20707 |
| 920 | Ga0501036_0016597 | 3300049572 | Bacteria | 6149 |
| 921 | Ga0501036_0122137 | 3300049572 | Bacteria | 2199 |
| 922 | Ga0501036_0189749 | 3300049572 | Bacteria | 1729 |
| 923 | Ga0501036_0243932 | 3300049572 | Bacteria | 1506 |
| 924 | Ga0501037_0000034 | 3300049573 | Bacteria | 126321 |
| 925 | Ga0501037_0011935 | 3300049573 | Bacteria | 6399 |
| 926 | Ga0501037_0043333 | 3300049573 | Bacteria | 3307 |
| 927 | Ga0501037_0066838 | 3300049573 | Bacteria | 2618 |
| 928 | Ga0501037_0097923 | 3300049573 | Bacteria | 2119 |
| 929 | Ga0501037_0109198 | 3300049573 | Bacteria | 1993 |
| 930 | Ga0501037_0124516 | 3300049573 | Bacteria | 1851 |
| 931 | Ga0501037_0204089 | 3300049573 | Bacteria | 1396 |
| 932 | Ga0501038_0000029 | 3300049574 | Bacteria | 132861 |
| 933 | Ga0501038_0012457 | 3300049574 | Bacteria | 7772 |
| 934 | Ga0501038_0023339 | 3300049574 | Bacteria | 5531 |
| 935 | Ga0501038_0081654 | 3300049574 | Bacteria | 2723 |
| 936 | Ga0501038_0206044 | 3300049574 | Bacteria | 1576 |
| 937 | Ga0501038_0307885 | 3300049574 | Bacteria | 1242 |
| 938 | Ga0501038_0441727 | 3300049574 | Bacteria | 1001 |
| 939 | Ga0501038_0477700 | 3300049574 | Bacteria | 955 |
| 940 | Ga0501038_0551754 | 3300049574 | Bacteria | 876 |
| 941 | Ga0501039_0001343 | 3300049575 | Bacteria | 18000 |
| 942 | Ga0501039_0194319 | 3300049575 | Bacteria | 1595 |
| 943 | Ga0501039_0212404 | 3300049575 | Bacteria | 1521 |
| 944 | Ga0501039_0215801 | 3300049575 | Bacteria | 1508 |
| 945 | Ga0501039_0305089 | 3300049575 | Bacteria | 1252 |
| 946 | Ga0501040_0053418 | 3300049576 | Bacteria | 2767 |
| 947 | Ga0501040_0167562 | 3300049576 | Bacteria | 1555 |
| 948 | Ga0501041_0166795 | 3300049577 | Bacteria | 1377 |
| 949 | Ga0501042_0010208 | 3300049578 | Bacteria | 6284 |
| 950 | Ga0501043_0000067 | 3300049579 | Bacteria | 93232 |
| 951 | Ga0501043_0002466 | 3300049579 | Bacteria | 15653 |
| 952 | Ga0501043_0014023 | 3300049579 | Bacteria | 6272 |
| 953 | Ga0501043_0028876 | 3300049579 | Bacteria | 4353 |
| 954 | Ga0501043_0035118 | 3300049579 | Bacteria | 3943 |
| 955 | Ga0501043_0048514 | 3300049579 | Bacteria | 3338 |
| 956 | Ga0501043_0170391 | 3300049579 | Bacteria | 1698 |
| 957 | Ga0501046_0000479 | 3300049580 | Bacteria | 39962 |
| 958 | Ga0501046_0016944 | 3300049580 | Bacteria | 6096 |
| 959 | Ga0501046_0051707 | 3300049580 | Bacteria | 3241 |
| 960 | Ga0501046_0055075 | 3300049580 | Bacteria | 3127 |
| 961 | Ga0501046_0056324 | 3300049580 | Bacteria | 3087 |
| 962 | Ga0501046_0106609 | 3300049580 | Bacteria | 2144 |
| 963 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 964 | Ga0501047_0000061 | 3300049581 | Bacteria | 137341 |
| 965 | Ga0501047_0025620 | 3300049581 | Bacteria | 5670 |
| 966 | Ga0501047_0075853 | 3300049581 | Bacteria | 3235 |
| 967 | Ga0501047_0082984 | 3300049581 | Bacteria | 3080 |
| 968 | Ga0501047_0205856 | 3300049581 | Bacteria | 1827 |
| 969 | Ga0501047_0225034 | 3300049581 | Bacteria | 1731 |
| 970 | Ga0501047_0331033 | 3300049581 | Bacteria | 1361 |
| 971 | Ga0501048_0000009 | 3300049582 | Bacteria | 84404 |
| 972 | Ga0501048_0000592 | 3300049582 | Bacteria | 25706 |
| 973 | Ga0501048_0081398 | 3300049582 | Bacteria | 2284 |
| 974 | Ga0501048_0355630 | 3300049582 | Bacteria | 1045 |
| 975 | Ga0501067_0000132 | 3300049583 | Bacteria | 40720 |
| 976 | Ga0501067_0007483 | 3300049583 | Bacteria | 6066 |
| 977 | Ga0501068_0005703 | 3300049584 | Bacteria | 6822 |
| 978 | Ga0501068_0075828 | 3300049584 | Bacteria | 2057 |
| 979 | Ga0501068_0184432 | 3300049584 | Bacteria | 1320 |
| 980 | Ga0501069_0044802 | 3300049585 | Bacteria | 2449 |
| 981 | Ga0501069_0053916 | 3300049585 | Bacteria | 2239 |
| 982 | Ga0501069_0066124 | 3300049585 | Bacteria | 2022 |
| 983 | Ga0501069_0087548 | 3300049585 | Bacteria | 1760 |
| 984 | Ga0501070_0000563 | 3300049586 | Bacteria | 33758 |
| 985 | Ga0501070_0006160 | 3300049586 | Bacteria | 10226 |
| 986 | Ga0501070_0051183 | 3300049586 | Bacteria | 3429 |
| 987 | Ga0501070_0056293 | 3300049586 | Bacteria | 3260 |
| 988 | Ga0501070_0061133 | 3300049586 | Bacteria | 3121 |
| 989 | Ga0501070_0074060 | 3300049586 | Bacteria | 2818 |
| 990 | Ga0501070_0309036 | 3300049586 | Bacteria | 1287 |
| 991 | Ga0501070_0317015 | 3300049586 | Bacteria | 1269 |
| 992 | Ga0501071_0131744 | 3300049587 | Bacteria | 1858 |
| 993 | Ga0501072_0004340 | 3300049588 | Bacteria | 10765 |
| 994 | Ga0501072_0030306 | 3300049588 | Bacteria | 4230 |
| 995 | Ga0501073_0000365 | 3300049589 | Bacteria | 30467 |
| 996 | Ga0501073_0013455 | 3300049589 | Bacteria | 5950 |
| 997 | Ga0501074_0000087 | 3300049590 | Bacteria | 45234 |
| 998 | Ga0501074_0005873 | 3300049590 | Bacteria | 8852 |
| 999 | Ga0501074_0012930 | 3300049590 | Bacteria | 6068 |
| 1000 | Ga0501074_0033923 | 3300049590 | Bacteria | 3700 |
| 1001 | Ga0501074_0207947 | 3300049590 | Bacteria | 1394 |
| 1002 | Ga0501075_0134328 | 3300049591 | Bacteria | 1885 |
| 1003 | Ga0501076_0151083 | 3300049592 | Bacteria | 1889 |
| 1004 | Ga0501079_0031799 | 3300049741 | Bacteria | 4055 |
| 1005 | Ga0501079_0046540 | 3300049741 | Bacteria | 3347 |
| 1006 | Ga0501079_0206972 | 3300049741 | Bacteria | 1532 |
| 1007 | Ga0501080_0001547 | 3300049742 | Bacteria | 19438 |
| 1008 | Ga0501080_0024882 | 3300049742 | Bacteria | 5552 |
| 1009 | Ga0501080_0101908 | 3300049742 | Bacteria | 2663 |
| 1010 | Ga0501080_0340849 | 3300049742 | Bacteria | 1354 |
| 1011 | Ga0501080_0773938 | 3300049742 | Bacteria | 843 |
| 1012 | Ga0501081_0187130 | 3300049743 | Bacteria | 1499 |
| 1013 | Ga0501081_0255967 | 3300049743 | Bacteria | 1279 |
| 1014 | Ga0501083_0009601 | 3300049744 | Bacteria | 6836 |
| 1015 | Ga0501083_0014790 | 3300049744 | Bacteria | 5458 |
| 1016 | Ga0501035_0001202 | 3300049822 | Bacteria | 26996 |
| 1017 | Ga0501035_0022530 | 3300049822 | Bacteria | 5785 |
| 1018 | Ga0501035_0040465 | 3300049822 | Bacteria | 4212 |
| 1019 | Ga0501035_0057423 | 3300049822 | Bacteria | 3470 |
| 1020 | Ga0501035_0083442 | 3300049822 | Bacteria | 2819 |
| 1021 | Ga0501035_0086783 | 3300049822 | Bacteria | 2757 |
| 1022 | Ga0501035_0090700 | 3300049822 | Bacteria | 2690 |
| 1023 | Ga0501035_0095216 | 3300049822 | Bacteria | 2617 |
| 1024 | Ga0501035_0174631 | 3300049822 | Bacteria | 1854 |
| 1025 | Ga0501044_0000028 | 3300049823 | Bacteria | 179203 |
| 1026 | Ga0501044_0011508 | 3300049823 | Bacteria | 9584 |
| 1027 | Ga0501044_0018863 | 3300049823 | Bacteria | 7385 |
| 1028 | Ga0501044_0047106 | 3300049823 | Bacteria | 4460 |
| 1029 | Ga0501044_0084203 | 3300049823 | Bacteria | 3214 |
| 1030 | Ga0501044_0095558 | 3300049823 | Bacteria | 2994 |
| 1031 | Ga0501044_0117048 | 3300049823 | Bacteria | 2669 |
| 1032 | Ga0501044_0118316 | 3300049823 | Bacteria | 2653 |
| 1033 | Ga0501044_0343381 | 3300049823 | Bacteria | 1413 |
| 1034 | Ga0501044_0349449 | 3300049823 | Bacteria | 1398 |
| 1035 | Ga0501044_0568254 | 3300049823 | Bacteria | 1029 |
| 1036 | Ga0501045_0012975 | 3300049824 | Bacteria | 5872 |
| 1037 | Ga0501045_0251063 | 3300049824 | Bacteria | 1317 |
| 1038 | nmdc:mga03n38_151_c1 | 3300050490 | Bacteria | 15238 |
| 1039 | nmdc:mga03n38_77168_c1 | 3300050490 | Bacteria | 1556 |
| 1040 | nmdc:mga00v17_190273_c1 | 3300050491 | Bacteria | 1325 |
| 1041 | nmdc:mga00v17_250529_c1 | 3300050491 | Bacteria | 1148 |
| 1042 | nmdc:mga0yw44_145904_c1 | 3300050492 | Bacteria | 1541 |
| 1043 | nmdc:mga0yw44_232647_c1 | 3300050492 | Bacteria | 1223 |
| 1044 | nmdc:mga0yw44_250654_c1 | 3300050492 | Bacteria | 1178 |
| 1045 | nmdc:mga0yw44_42521_c1 | 3300050492 | Bacteria | 2710 |
| 1046 | nmdc:mga0yw44_8194_c1 | 3300050492 | Bacteria | 5191 |
| 1047 | nmdc:mga0k408_252587_c1 | 3300050493 | Bacteria | 1053 |
| 1048 | nmdc:mga0k408_49683_c1 | 3300050493 | Bacteria | 2428 |
| 1049 | nmdc:mga06z11_77970_c1 | 3300050494 | Bacteria | 1770 |
| 1050 | nmdc:mga04h51_12545_c1 | 3300050495 | Bacteria | 2381 |
| 1051 | nmdc:mga04h51_43071_c1 | 3300050495 | Bacteria | 1483 |
| 1052 | nmdc:mga07m45_82734_c1 | 3300050496 | Bacteria | 1833 |
| 1053 | nmdc:mga05p37_440457_c1 | 3300050507 | Bacteria | 1511 |
| 1054 | nmdc:mga09592_509751_c1 | 3300050508 | Bacteria | 1035 |
| 1055 | nmdc:mga0qj67_35476_c1 | 3300050509 | Bacteria | 3899 |
| 1056 | nmdc:mga06r32_150534_c1 | 3300050510 | Bacteria | 2305 |
| 1057 | nmdc:mga0n895_659362_c1 | 3300050512 | Bacteria | 1044 |
| 1058 | nmdc:mga0n895_6973_c1 | 3300050512 | Bacteria | 9647 |
| 1059 | nmdc:mga0n895_80495_c1 | 3300050512 | Bacteria | 3246 |
| 1060 | nmdc:mga0a205_136311_c1 | 3300050515 | Bacteria | 2355 |
| 1061 | nmdc:mga0a205_593874_c1 | 3300050515 | Bacteria | 960 |
| 1062 | nmdc:mga0sz30_32196_c1 | 3300050516 | Bacteria | 2174 |
| 1063 | nmdc:mga0sz30_4914_c1 | 3300050516 | Bacteria | 4870 |
| 1064 | nmdc:mga0sz30_88943_c1 | 3300050516 | Bacteria | 1342 |
| 1065 | Ga0495601_0004009 | 3300053077 | Bacteria | 8480 |
| 1066 | Ga0495601_0141984 | 3300053077 | Bacteria | 1567 |
| 1067 | Ga0495601_0159845 | 3300053077 | Bacteria | 1472 |
| 1068 | Ga0495601_0199574 | 3300053077 | Bacteria | 1307 |
| 1069 | Ga0495612_0004682 | 3300053078 | Bacteria | 5668 |
| 1070 | Ga0495612_0009850 | 3300053078 | Bacteria | 3869 |
| 1071 | Ga0495612_0031780 | 3300053078 | Bacteria | 2130 |
| 1072 | Ga0495595_0076635 | 3300053084 | Bacteria | 1587 |
| 1073 | Ga0495595_0149636 | 3300053084 | Bacteria | 1148 |
| 1074 | Ga0495619_0001464 | 3300053085 | Bacteria | 15552 |
| 1075 | Ga0495619_0051990 | 3300053085 | Bacteria | 2708 |
| 1076 | Ga0495619_0054085 | 3300053085 | Bacteria | 2656 |
| 1077 | Ga0495619_0185507 | 3300053085 | Bacteria | 1439 |
| 1078 | Ga0500578_0083432 | 3300053086 | Bacteria | 2031 |
| 1079 | Ga0500578_0097217 | 3300053086 | Bacteria | 1866 |
| 1080 | Ga0500578_0147009 | 3300053086 | Bacteria | 1470 |
| 1081 | Ga0500581_119900 | 3300053089 | Bacteria | 1271 |
| 1082 | Ga0500646_0004603 | 3300053090 | Bacteria | 3488 |
| 1083 | Ga0500646_0092678 | 3300053090 | Bacteria | 937 |
| 1084 | Ga0500647_0178127 | 3300053091 | Bacteria | 977 |
| 1085 | Ga0500583_0252757 | 3300053092 | Bacteria | 870 |
| 1086 | Ga0500651_0065429 | 3300053093 | Bacteria | 2265 |
| 1087 | Ga0500651_0079935 | 3300053093 | Bacteria | 2026 |
| 1088 | Ga0500651_0165586 | 3300053093 | Bacteria | 1320 |
| 1089 | Ga0500566_0000124 | 3300053094 | Bacteria | 40031 |
| 1090 | Ga0500566_0000667 | 3300053094 | Bacteria | 19213 |
| 1091 | Ga0500566_0001115 | 3300053094 | Bacteria | 15554 |
| 1092 | Ga0500566_0058112 | 3300053094 | Bacteria | 2196 |
| 1093 | Ga0500640_003612 | 3300053095 | Bacteria | 5452 |
| 1094 | Ga0500641_0004297 | 3300053096 | Bacteria | 5026 |
| 1095 | Ga0500641_0004927 | 3300053096 | Bacteria | 4731 |
| 1096 | Ga0500641_0073989 | 3300053096 | Bacteria | 1438 |
| 1097 | Ga0500641_0152540 | 3300053096 | Bacteria | 997 |
| 1098 | Ga0500648_131185 | 3300053097 | Bacteria | 1359 |
| 1099 | Ga0500650_0076908 | 3300053098 | Bacteria | 1559 |
| 1100 | Ga0500554_000874 | 3300053102 | Bacteria | 5896 |
| 1101 | Ga0500555_008678 | 3300053103 | Bacteria | 2899 |
| 1102 | Ga0500555_015843 | 3300053103 | Bacteria | 2174 |
| 1103 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 1104 | Ga0500557_000042 | 3300053105 | Bacteria | 64422 |
| 1105 | Ga0500562_015375 | 3300053108 | Bacteria | 1962 |
| 1106 | Ga0500562_052905 | 3300053108 | Bacteria | 1087 |
| 1107 | Ga0500562_092010 | 3300053108 | Bacteria | 823 |
| 1108 | Ga0500572_000207 | 3300053111 | Bacteria | 20845 |
| 1109 | Ga0500572_008732 | 3300053111 | Bacteria | 2377 |
| 1110 | Ga0500572_046339 | 3300053111 | Bacteria | 1280 |
| 1111 | Ga0500592_005237 | 3300053116 | Bacteria | 2062 |
| 1112 | Ga0500594_0031337 | 3300053118 | Bacteria | 1402 |
| 1113 | Ga0500595_000617 | 3300053119 | Bacteria | 21264 |
| 1114 | Ga0500595_002072 | 3300053119 | Bacteria | 10245 |
| 1115 | Ga0500595_011264 | 3300053119 | Bacteria | 3509 |
| 1116 | Ga0500595_028323 | 3300053119 | Bacteria | 1910 |
| 1117 | Ga0500607_038348 | 3300053121 | Bacteria | 2607 |
| 1118 | Ga0500607_048414 | 3300053121 | Bacteria | 2273 |
| 1119 | Ga0500608_004134 | 3300053122 | Bacteria | 5566 |
| 1120 | Ga0500608_047265 | 3300053122 | Bacteria | 2067 |
| 1121 | Ga0500614_002387 | 3300053123 | Bacteria | 4198 |
| 1122 | Ga0500617_162167 | 3300053124 | Bacteria | 870 |
| 1123 | Ga0500618_029100 | 3300053125 | Bacteria | 1305 |
| 1124 | Ga0500642_0000010 | 3300053130 | Bacteria | 272552 |
| 1125 | Ga0500642_0000112 | 3300053130 | Bacteria | 37891 |
| 1126 | Ga0500642_0040984 | 3300053130 | Bacteria | 2000 |
| 1127 | Ga0500652_000720 | 3300053131 | Bacteria | 11247 |
| 1128 | Ga0500658_0098706 | 3300053134 | Bacteria | 1272 |
| 1129 | Ga0500559_0000430 | 3300053136 | Bacteria | 29706 |
| 1130 | Ga0500559_0000658 | 3300053136 | Bacteria | 23226 |
| 1131 | Ga0500559_0001001 | 3300053136 | Bacteria | 17506 |
| 1132 | Ga0500559_0123207 | 3300053136 | Bacteria | 1206 |
| 1133 | Ga0500559_0128028 | 3300053136 | Bacteria | 1185 |
| 1134 | Ga0500564_058794 | 3300053138 | Bacteria | 1747 |
| 1135 | Ga0500573_0105885 | 3300053140 | Bacteria | 1578 |
| 1136 | Ga0500577_0000058 | 3300053142 | Bacteria | 25148 |
| 1137 | Ga0500586_019764 | 3300053145 | Bacteria | 2100 |
| 1138 | Ga0500588_0047387 | 3300053146 | Bacteria | 1325 |
| 1139 | Ga0500590_139487 | 3300053148 | Bacteria | 1110 |
| 1140 | Ga0500603_000069 | 3300053150 | Bacteria | 24202 |
| 1141 | Ga0500603_000345 | 3300053150 | Bacteria | 12107 |
| 1142 | Ga0500604_0016566 | 3300053151 | Bacteria | 2031 |
| 1143 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 1144 | Ga0500616_0039187 | 3300053153 | Bacteria | 2556 |
| 1145 | Ga0500619_011239 | 3300053154 | Bacteria | 2295 |
| 1146 | Ga0500622_0000972 | 3300053156 | Bacteria | 24262 |
| 1147 | Ga0500622_0011931 | 3300053156 | Bacteria | 4725 |
| 1148 | Ga0500633_0063467 | 3300053160 | Bacteria | 1304 |
| 1149 | Ga0500638_000353 | 3300053162 | Bacteria | 10587 |
| 1150 | Ga0500638_001860 | 3300053162 | Bacteria | 6985 |
| 1151 | Ga0500639_000057 | 3300053163 | Bacteria | 50484 |
| 1152 | Ga0500639_014190 | 3300053163 | Bacteria | 4190 |
| 1153 | Ga0500639_159142 | 3300053163 | Bacteria | 1030 |
| 1154 | Ga0500636_0000061 | 3300053177 | Bacteria | 52521 |
| 1155 | Ga0500636_0068146 | 3300053177 | Bacteria | 2066 |
| 1156 | Ga0500636_0081739 | 3300053177 | Bacteria | 1860 |
| 1157 | Ga0500636_0111476 | 3300053177 | Bacteria | 1545 |
| 1158 | Ga0500637_0000078 | 3300053178 | Bacteria | 34790 |
| 1159 | Ga0500637_0000494 | 3300053178 | Bacteria | 15279 |
| 1160 | Ga0500637_0061873 | 3300053178 | Bacteria | 2145 |
| 1161 | Ga0500637_0155603 | 3300053178 | Bacteria | 1319 |
| 1162 | Ga0500637_0255200 | 3300053178 | Bacteria | 976 |
| 1163 | Ga0500649_136169 | 3300053722 | Bacteria | 909 |
| 1164 | Ga0500570_140124 | 3300053724 | Bacteria | 892 |
| 1165 | Ga0500576_072629 | 3300053725 | Bacteria | 1474 |
| 1166 | Ga0500625_019916 | 3300053729 | Bacteria | 3156 |
| 1167 | Ga0500609_003186 | 3300053731 | Bacteria | 2319 |
| 1168 | Ga0500656_021761 | 3300053732 | Bacteria | 800 |
| 1169 | Ga0500596_000608 | 3300053735 | Bacteria | 6875 |
| 1170 | Ga0500596_004863 | 3300053735 | Bacteria | 2423 |
| 1171 | Ga0500596_019423 | 3300053735 | Bacteria | 1021 |
| 1172 | Ga0500601_000332 | 3300053737 | Bacteria | 8637 |
| 1173 | Ga0501084_0001341 | 3300054114 | Bacteria | 19442 |
| 1174 | Ga0501084_0217929 | 3300054114 | Bacteria | 1610 |
| 1175 | Ga0500661_000905 | 3300055283 | Bacteria | 5554 |
| 1176 | Ga0500661_018213 | 3300055283 | Bacteria | 1252 |
| 1177 | Ga0501082_0002555 | 3300060353 | Bacteria | 15940 |
| 1178 | Ga0501082_0202825 | 3300060353 | Bacteria | 1726 |
| 1179 | Ga0501082_0397004 | 3300060353 | Bacteria | 1203 |
| 1180 | Ga0466962_0152306 | 3300061719 | Bacteria | 1122 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0461010 | Ga0501034_0461010_468_1160 | 210 |
| 2 | 3300049742 | Ga0501080_0101908 | Ga0501080_0101908_29_721 | 210 |
| 3 | 3300049823 | Ga0501044_0343381 | Ga0501044_0343381_694_1386 | 210 |
| 4 | 3300053085 | Ga0495619_0054085 | Ga0495619_0054085_1810_2580 | 223 |
| 5 | 3300006175 | Ga0070712_100531675 | Ga0070712_1005316752 | 225 |
| 6 | 3300006844 | Ga0075428_100277708 | Ga0075428_1002777082 | 227 |
| 7 | 3300048918 | Ga0496115_0228759 | Ga0496115_0228759_600_1319 | 227 |
| 8 | 3300006028 | Ga0070717_10291934 | Ga0070717_102919342 | 228 |
| 9 | 3300037471 | Ga0395905_0592593 | Ga0395905_0592593_214_927 | 229 |
| 10 | 3300046455 | Ga0495603_0034275 | Ga0495603_0034275_2284_3000 | 230 |
| 11 | 3300046473 | Ga0495582_0017171 | Ga0495582_0017171_3166_3882 | 230 |
| 12 | 3300046557 | Ga0495622_0131755 | Ga0495622_0131755_359_1075 | 230 |
| 13 | 3300047320 | Ga0495672_0048346 | Ga0495672_0048346_998_1768 | 230 |
| 14 | 3300048929 | Ga0496126_0004245 | Ga0496126_0004245_3488_4204 | 230 |
| 15 | 3300049569 | Ga0501032_0190779 | Ga0501032_0190779_184_960 | 230 |
| 16 | 3300049572 | Ga0501036_0189749 | Ga0501036_0189749_397_1173 | 230 |
| 17 | 3300049573 | Ga0501037_0011935 | Ga0501037_0011935_5365_6141 | 230 |
| 18 | 3300049574 | Ga0501038_0012457 | Ga0501038_0012457_6561_7337 | 230 |
| 19 | 3300049580 | Ga0501046_0055075 | Ga0501046_0055075_980_1756 | 230 |
| 20 | 3300049581 | Ga0501047_0331033 | Ga0501047_0331033_85_861 | 230 |
| 21 | 3300049584 | Ga0501068_0184432 | Ga0501068_0184432_83_859 | 230 |
| 22 | 3300049822 | Ga0501035_0057423 | Ga0501035_0057423_494_1270 | 230 |
| 23 | iso_pu_bacteria | 2904699407 | 2904702814 | 230 |
| 24 | iso_pu_bacteria | 2922425934 | 2922429785 | 230 |
| 25 | 3300035692 | Ga0373935_0279372 | Ga0373935_0279372_105_896 | 231 |
| 26 | 3300041413 | Ga0439465_0065966 | Ga0439465_0065966_73_777 | 231 |
| 27 | 3300046459 | Ga0495629_0229070 | Ga0495629_0229070_414_1205 | 231 |
| 28 | 3300046642 | Ga0495634_0070435 | Ga0495634_0070435_1341_2132 | 231 |
| 29 | 3300047319 | Ga0495674_0122521 | Ga0495674_0122521_543_1334 | 231 |
| 30 | 3300048917 | Ga0496114_0186087 | Ga0496114_0186087_963_1757 | 231 |
| 31 | 3300048917 | Ga0496114_0278699 | Ga0496114_0278699_665_1456 | 231 |
| 32 | 3300005937 | Ga0081455_10034743 | Ga0081455_100347433 | 232 |
| 33 | 3300005985 | Ga0081539_10089448 | Ga0081539_100894482 | 232 |
| 34 | 3300006173 | Ga0070716_100441460 | Ga0070716_1004414602 | 232 |
| 35 | 3300028381 | Ga0268264_10303835 | Ga0268264_103038352 | 232 |
| 36 | 3300035115 | Ga0373941_0006333 | Ga0373941_0006333_1691_2467 | 232 |
| 37 | 3300037312 | Ga0395899_0020079 | Ga0395899_0020079_274_1047 | 232 |
| 38 | 3300038443 | Ga0395901_0010786 | Ga0395901_0010786_2023_2796 | 232 |
| 39 | 3300039453 | Ga0436362_1238172 | Ga0436362_1238172_239_976 | 232 |
| 40 | 3300046692 | Ga0495671_0269545 | Ga0495671_0269545_65_763 | 232 |
| 41 | 3300047444 | Ga0495675_0315405 | Ga0495675_0315405_57_755 | 232 |
| 42 | 3300048917 | Ga0496114_0192471 | Ga0496114_0192471_520_1293 | 232 |
| 43 | 3300049569 | Ga0501032_0079106 | Ga0501032_0079106_784_1557 | 232 |
| 44 | 3300049569 | Ga0501032_0220773 | Ga0501032_0220773_336_1112 | 232 |
| 45 | 3300049571 | Ga0501034_0021638 | Ga0501034_0021638_904_1677 | 232 |
| 46 | 3300049571 | Ga0501034_0347707 | Ga0501034_0347707_377_1153 | 232 |
| 47 | 3300049572 | Ga0501036_0016597 | Ga0501036_0016597_3212_3985 | 232 |
| 48 | 3300049573 | Ga0501037_0043333 | Ga0501037_0043333_1014_1790 | 232 |
| 49 | 3300049573 | Ga0501037_0204089 | Ga0501037_0204089_540_1313 | 232 |
| 50 | 3300049574 | Ga0501038_0477700 | Ga0501038_0477700_136_912 | 232 |
| 51 | 3300049580 | Ga0501046_0016944 | Ga0501046_0016944_2795_3568 | 232 |
| 52 | 3300049581 | Ga0501047_0075853 | Ga0501047_0075853_104_877 | 232 |
| 53 | 3300049581 | Ga0501047_0082984 | Ga0501047_0082984_2032_2805 | 232 |
| 54 | 3300049584 | Ga0501068_0075828 | Ga0501068_0075828_1254_2030 | 232 |
| 55 | 3300049585 | Ga0501069_0066124 | Ga0501069_0066124_1054_1830 | 232 |
| 56 | 3300049586 | Ga0501070_0056293 | Ga0501070_0056293_83_856 | 232 |
| 57 | 3300049586 | Ga0501070_0061133 | Ga0501070_0061133_1014_1790 | 232 |
| 58 | 3300049590 | Ga0501074_0012930 | Ga0501074_0012930_3627_4403 | 232 |
| 59 | 3300049741 | Ga0501079_0206972 | Ga0501079_0206972_221_997 | 232 |
| 60 | 3300049742 | Ga0501080_0024882 | Ga0501080_0024882_1355_2128 | 232 |
| 61 | 3300049822 | Ga0501035_0086783 | Ga0501035_0086783_27_800 | 232 |
| 62 | 3300049822 | Ga0501035_0090700 | Ga0501035_0090700_324_1100 | 232 |
| 63 | 3300049822 | Ga0501035_0095216 | Ga0501035_0095216_594_1367 | 232 |
| 64 | 3300050491 | nmdc:mga00v17_190273_c1 | nmdc:mga00v17_190273_c1_314_1024 | 232 |
| 65 | 3300050492 | nmdc:mga0yw44_232647_c1 | nmdc:mga0yw44_232647_c1_464_1207 | 232 |
| 66 | 3300050507 | nmdc:mga05p37_440457_c1 | nmdc:mga05p37_440457_c1_186_896 | 232 |
| 67 | 3300050508 | nmdc:mga09592_509751_c1 | nmdc:mga09592_509751_c1_306_1016 | 232 |
| 68 | 3300053091 | Ga0500647_0178127 | Ga0500647_0178127_234_932 | 232 |
| 69 | 3300053124 | Ga0500617_162167 | Ga0500617_162167_16_726 | 232 |
| 70 | 3300009147 | Ga0114129_10866194 | Ga0114129_108661942 | 233 |
| 71 | 3300009148 | Ga0105243_10098298 | Ga0105243_100982982 | 233 |
| 72 | 3300009177 | Ga0105248_10227239 | Ga0105248_102272392 | 233 |
| 73 | 3300013308 | Ga0157375_10071721 | Ga0157375_100717212 | 233 |
| 74 | 3300014326 | Ga0157380_10526034 | Ga0157380_105260342 | 233 |
| 75 | 3300035083 | Ga0373926_0023829 | Ga0373926_0023829_516_1223 | 233 |
| 76 | 3300035111 | Ga0373923_0003846 | Ga0373923_0003846_3286_3993 | 233 |
| 77 | 3300035113 | Ga0373936_0127476 | Ga0373936_0127476_247_954 | 233 |
| 78 | 3300035118 | Ga0373954_0083438 | Ga0373954_0083438_465_1172 | 233 |
| 79 | 3300035119 | Ga0373956_0067322 | Ga0373956_0067322_663_1370 | 233 |
| 80 | 3300035172 | Ga0373955_0043303 | Ga0373955_0043303_1342_2049 | 233 |
| 81 | 3300035695 | Ga0373927_0173132 | Ga0373927_0173132_70_777 | 233 |
| 82 | 3300035724 | Ga0373933_0066047 | Ga0373933_0066047_789_1496 | 233 |
| 83 | 3300035725 | Ga0373947_0006259 | Ga0373947_0006259_1541_2248 | 233 |
| 84 | 3300037068 | Ga0373925_0192286 | Ga0373925_0192286_845_1552 | 233 |
| 85 | 3300046459 | Ga0495629_0028710 | Ga0495629_0028710_3019_3726 | 233 |
| 86 | 3300046471 | Ga0495650_0113136 | Ga0495650_0113136_280_993 | 233 |
| 87 | 3300046473 | Ga0495582_0023689 | Ga0495582_0023689_2352_3059 | 233 |
| 88 | 3300046474 | Ga0495605_0046987 | Ga0495605_0046987_32_745 | 233 |
| 89 | 3300046475 | Ga0495639_0021590 | Ga0495639_0021590_1837_2544 | 233 |
| 90 | 3300046523 | Ga0495644_0018106 | Ga0495644_0018106_1408_2121 | 233 |
| 91 | 3300046529 | Ga0495652_0471319 | Ga0495652_0471319_62_769 | 233 |
| 92 | 3300046531 | Ga0495665_0037812 | Ga0495665_0037812_290_997 | 233 |
| 93 | 3300046533 | Ga0495640_0044182 | Ga0495640_0044182_17_724 | 233 |
| 94 | 3300046535 | Ga0495586_0032919 | Ga0495586_0032919_1225_1932 | 233 |
| 95 | 3300046558 | Ga0495633_0041642 | Ga0495633_0041642_899_1612 | 233 |
| 96 | 3300046615 | Ga0495656_0039223 | Ga0495656_0039223_81_794 | 233 |
| 97 | 3300046642 | Ga0495634_0032749 | Ga0495634_0032749_601_1308 | 233 |
| 98 | 3300046683 | Ga0495658_0045638 | Ga0495658_0045638_252_959 | 233 |
| 99 | 3300046689 | Ga0495613_0122217 | Ga0495613_0122217_651_1358 | 233 |
| 100 | 3300047471 | Ga0495684_0011995 | Ga0495684_0011995_3633_4340 | 233 |
| 101 | 3300048090 | Ga0495615_0060520 | Ga0495615_0060520_110_823 | 233 |
| 102 | 3300048905 | Ga0496102_0119831 | Ga0496102_0119831_29_742 | 233 |
| 103 | 3300048914 | Ga0496111_0451870 | Ga0496111_0451870_51_764 | 233 |
| 104 | 3300048917 | Ga0496114_0269663 | Ga0496114_0269663_248_955 | 233 |
| 105 | 3300048918 | Ga0496115_0568665 | Ga0496115_0568665_50_757 | 233 |
| 106 | 3300049572 | Ga0501036_0001075 | Ga0501036_0001075_17618_18391 | 233 |
| 107 | 3300049573 | Ga0501037_0066838 | Ga0501037_0066838_1654_2427 | 233 |
| 108 | 3300049579 | Ga0501043_0002466 | Ga0501043_0002466_11562_12335 | 233 |
| 109 | 3300049580 | Ga0501046_0051707 | Ga0501046_0051707_2250_3023 | 233 |
| 110 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_93142_93915 | 233 |
| 111 | 3300049582 | Ga0501048_0000592 | Ga0501048_0000592_797_1570 | 233 |
| 112 | 3300049586 | Ga0501070_0006160 | Ga0501070_0006160_7822_8595 | 233 |
| 113 | 3300049590 | Ga0501074_0033923 | Ga0501074_0033923_2338_3111 | 233 |
| 114 | 3300049744 | Ga0501083_0014790 | Ga0501083_0014790_4204_4977 | 233 |
| 115 | 3300049823 | Ga0501044_0011508 | Ga0501044_0011508_1603_2376 | 233 |
| 116 | 3300053108 | Ga0500562_052905 | Ga0500562_052905_14_715 | 233 |
| 117 | 3300053732 | Ga0500656_021761 | Ga0500656_021761_38_745 | 233 |
| 118 | 3300005455 | Ga0070663_100007669 | Ga0070663_1000076692 | 234 |
| 119 | 3300005616 | Ga0068852_100026594 | Ga0068852_1000265944 | 234 |
| 120 | 3300009098 | Ga0105245_10119829 | Ga0105245_101198292 | 234 |
| 121 | 3300011119 | Ga0105246_10082752 | Ga0105246_100827522 | 234 |
| 122 | 3300011119 | Ga0105246_10375714 | Ga0105246_103757142 | 234 |
| 123 | 3300013307 | Ga0157372_10260539 | Ga0157372_102605392 | 234 |
| 124 | 3300014325 | Ga0163163_10611968 | Ga0163163_106119682 | 234 |
| 125 | 3300014968 | Ga0157379_10126237 | Ga0157379_101262372 | 234 |
| 126 | 3300014968 | Ga0157379_11022356 | Ga0157379_110223561 | 234 |
| 127 | 3300014969 | Ga0157376_10011916 | Ga0157376_100119164 | 234 |
| 128 | 3300025917 | Ga0207660_10409907 | Ga0207660_104099071 | 234 |
| 129 | 3300025949 | Ga0207667_10164839 | Ga0207667_101648391 | 234 |
| 130 | 3300026067 | Ga0207678_10028548 | Ga0207678_100285484 | 234 |
| 131 | 3300026142 | Ga0207698_10058032 | Ga0207698_100580322 | 234 |
| 132 | 3300035692 | Ga0373935_0064822 | Ga0373935_0064822_1538_2257 | 234 |
| 133 | 3300037471 | Ga0395905_0015528 | Ga0395905_0015528_3185_3889 | 234 |
| 134 | 3300037853 | Ga0436364_0108567 | Ga0436364_0108567_19_735 | 234 |
| 135 | 3300037853 | Ga0436364_1513198 | Ga0436364_1513198_1434_2201 | 234 |
| 136 | 3300039450 | Ga0436363_1284550 | Ga0436363_1284550_87_803 | 234 |
| 137 | 3300046452 | Ga0495617_004700 | Ga0495617_004700_1022_1738 | 234 |
| 138 | 3300046453 | Ga0495627_055398 | Ga0495627_055398_384_1094 | 234 |
| 139 | 3300046455 | Ga0495603_0060537 | Ga0495603_0060537_768_1478 | 234 |
| 140 | 3300046455 | Ga0495603_0061209 | Ga0495603_0061209_74_793 | 234 |
| 141 | 3300046461 | Ga0495641_0209349 | Ga0495641_0209349_95_814 | 234 |
| 142 | 3300046474 | Ga0495605_0103455 | Ga0495605_0103455_51_767 | 234 |
| 143 | 3300046492 | Ga0495585_0204695 | Ga0495585_0204695_234_950 | 234 |
| 144 | 3300046513 | Ga0495616_0096958 | Ga0495616_0096958_301_1011 | 234 |
| 145 | 3300046525 | Ga0495663_0121971 | Ga0495663_0121971_130_840 | 234 |
| 146 | 3300046648 | Ga0495611_0201000 | Ga0495611_0201000_20_730 | 234 |
| 147 | 3300046674 | Ga0495588_0111581 | Ga0495588_0111581_337_1047 | 234 |
| 148 | 3300046681 | Ga0495647_0035007 | Ga0495647_0035007_601_1320 | 234 |
| 149 | 3300047320 | Ga0495672_0019081 | Ga0495672_0019081_1138_1842 | 234 |
| 150 | 3300047323 | Ga0495683_0033407 | Ga0495683_0033407_45_752 | 234 |
| 151 | 3300047443 | Ga0495687_032692 | Ga0495687_032692_31_738 | 234 |
| 152 | 3300047469 | Ga0495673_0075219 | Ga0495673_0075219_79_792 | 234 |
| 153 | 3300047472 | Ga0495686_0106475 | Ga0495686_0106475_588_1292 | 234 |
| 154 | 3300047472 | Ga0495686_0363171 | Ga0495686_0363171_52_768 | 234 |
| 155 | 3300048903 | Ga0496100_0351202 | Ga0496100_0351202_33_755 | 234 |
| 156 | 3300048904 | Ga0496101_0007272 | Ga0496101_0007272_5458_6162 | 234 |
| 157 | 3300048905 | Ga0496102_0023382 | Ga0496102_0023382_2595_3299 | 234 |
| 158 | 3300048907 | Ga0496104_0382235 | Ga0496104_0382235_207_911 | 234 |
| 159 | 3300048908 | Ga0496105_0134697 | Ga0496105_0134697_43_747 | 234 |
| 160 | 3300048910 | Ga0496107_0076355 | Ga0496107_0076355_1225_1947 | 234 |
| 161 | 3300048910 | Ga0496107_0235158 | Ga0496107_0235158_290_994 | 234 |
| 162 | 3300048917 | Ga0496114_0158685 | Ga0496114_0158685_1073_1777 | 234 |
| 163 | 3300048918 | Ga0496115_0049795 | Ga0496115_0049795_2086_2790 | 234 |
| 164 | 3300048924 | Ga0496121_0001546 | Ga0496121_0001546_6736_7440 | 234 |
| 165 | 3300048924 | Ga0496121_0167265 | Ga0496121_0167265_457_1176 | 234 |
| 166 | 3300048924 | Ga0496121_0188548 | Ga0496121_0188548_12_734 | 234 |
| 167 | 3300048924 | Ga0496121_0245961 | Ga0496121_0245961_59_775 | 234 |
| 168 | 3300049573 | Ga0501037_0097923 | Ga0501037_0097923_335_1039 | 234 |
| 169 | 3300049579 | Ga0501043_0028876 | Ga0501043_0028876_1596_2300 | 234 |
| 170 | 3300049581 | Ga0501047_0205856 | Ga0501047_0205856_1014_1718 | 234 |
| 171 | 3300049586 | Ga0501070_0051183 | Ga0501070_0051183_1875_2579 | 234 |
| 172 | 3300049742 | Ga0501080_0773938 | Ga0501080_0773938_22_726 | 234 |
| 173 | 3300049822 | Ga0501035_0083442 | Ga0501035_0083442_592_1296 | 234 |
| 174 | 3300049823 | Ga0501044_0084203 | Ga0501044_0084203_1713_2417 | 234 |
| 175 | 3300050515 | nmdc:mga0a205_593874_c1 | nmdc:mga0a205_593874_c1_129_845 | 234 |
| 176 | 3300053096 | Ga0500641_0152540 | Ga0500641_0152540_266_982 | 234 |
| 177 | 3300053108 | Ga0500562_092010 | Ga0500562_092010_62_775 | 234 |
| 178 | 3300053119 | Ga0500595_011264 | Ga0500595_011264_2326_3042 | 234 |
| 179 | 3300053119 | Ga0500595_028323 | Ga0500595_028323_689_1393 | 234 |
| 180 | 3300053134 | Ga0500658_0098706 | Ga0500658_0098706_321_1037 | 234 |
| 181 | 3300053148 | Ga0500590_139487 | Ga0500590_139487_292_1008 | 234 |
| 182 | 3300005548 | Ga0070665_100391937 | Ga0070665_1003919372 | 235 |
| 183 | 3300044735 | Ga0466968_0298917 | Ga0466968_0298917_38_757 | 235 |
| 184 | 3300048908 | Ga0496105_0141805 | Ga0496105_0141805_551_1345 | 235 |
| 185 | 3300048910 | Ga0496107_0238285 | Ga0496107_0238285_227_1021 | 235 |
| 186 | 3300048918 | Ga0496115_0047926 | Ga0496115_0047926_680_1474 | 235 |
| 187 | 3300049574 | Ga0501038_0206044 | Ga0501038_0206044_56_874 | 235 |
| 188 | 3300048904 | Ga0496101_0143517 | Ga0496101_0143517_926_1720 | 236 |
| 189 | 3300048907 | Ga0496104_0472605 | Ga0496104_0472605_183_977 | 236 |
| 190 | 3300049823 | Ga0501044_0117048 | Ga0501044_0117048_283_1056 | 236 |
| 191 | 3300005329 | Ga0070683_100000652 | Ga0070683_10000065215 | 237 |
| 192 | 3300005530 | Ga0070679_100606594 | Ga0070679_1006065941 | 237 |
| 193 | 3300005535 | Ga0070684_100001124 | Ga0070684_1000011242 | 237 |
| 194 | 3300006195 | Ga0075366_10405195 | Ga0075366_104051951 | 237 |
| 195 | 3300005437 | Ga0070710_10000979 | Ga0070710_1000097911 | 238 |
| 196 | 3300006846 | Ga0075430_100083282 | Ga0075430_1000832822 | 238 |
| 197 | 3300006847 | Ga0075431_100169347 | Ga0075431_1001693472 | 238 |
| 198 | 3300025920 | Ga0207649_10215858 | Ga0207649_102158581 | 238 |
| 199 | 3300025939 | Ga0207665_10050311 | Ga0207665_100503112 | 238 |
| 200 | 3300037466 | Ga0395898_0332905 | Ga0395898_0332905_225_995 | 238 |
| 201 | 3300037853 | Ga0436364_1124077 | Ga0436364_1124077_413_1207 | 238 |
| 202 | 3300039437 | Ga0436365_0847601 | Ga0436365_0847601_1140_1934 | 238 |
| 203 | 3300046459 | Ga0495629_0476057 | Ga0495629_0476057_29_796 | 238 |
| 204 | 3300049570 | Ga0501033_0120706 | Ga0501033_0120706_804_1574 | 238 |
| 205 | 3300049575 | Ga0501039_0212404 | Ga0501039_0212404_79_849 | 238 |
| 206 | 3300049576 | Ga0501040_0167562 | Ga0501040_0167562_643_1413 | 238 |
| 207 | 3300049581 | Ga0501047_0225034 | Ga0501047_0225034_621_1430 | 238 |
| 208 | 3300049591 | Ga0501075_0134328 | Ga0501075_0134328_613_1383 | 238 |
| 209 | 3300049743 | Ga0501081_0255967 | Ga0501081_0255967_234_1004 | 238 |
| 210 | 3300049823 | Ga0501044_0568254 | Ga0501044_0568254_17_787 | 238 |
| 211 | 3300050509 | nmdc:mga0qj67_35476_c1 | nmdc:mga0qj67_35476_c1_1028_1795 | 238 |
| 212 | 3300050510 | nmdc:mga06r32_150534_c1 | nmdc:mga06r32_150534_c1_268_1035 | 238 |
| 213 | 3300005434 | Ga0070709_10000247 | Ga0070709_1000024711 | 239 |
| 214 | 3300005435 | Ga0070714_100018248 | Ga0070714_1000182485 | 239 |
| 215 | 3300005436 | Ga0070713_100057996 | Ga0070713_1000579962 | 239 |
| 216 | 3300005439 | Ga0070711_100282960 | Ga0070711_1002829601 | 239 |
| 217 | 3300006038 | Ga0075365_10005882 | Ga0075365_100058823 | 239 |
| 218 | 3300006042 | Ga0075368_10039758 | Ga0075368_100397582 | 239 |
| 219 | 3300006048 | Ga0075363_100052519 | Ga0075363_1000525192 | 239 |
| 220 | 3300006051 | Ga0075364_10035235 | Ga0075364_100352352 | 239 |
| 221 | 3300006178 | Ga0075367_10061796 | Ga0075367_100617962 | 239 |
| 222 | 3300017792 | Ga0163161_10399211 | Ga0163161_103992112 | 239 |
| 223 | 3300025916 | Ga0207663_10054348 | Ga0207663_100543481 | 239 |
| 224 | 3300025928 | Ga0207700_10021828 | Ga0207700_100218283 | 239 |
| 225 | 3300025929 | Ga0207664_10034194 | Ga0207664_100341943 | 239 |
| 226 | 3300046615 | Ga0495656_0069335 | Ga0495656_0069335_335_1108 | 239 |
| 227 | 3300050490 | nmdc:mga03n38_77168_c1 | nmdc:mga03n38_77168_c1_221_997 | 239 |
| 228 | 3300050494 | nmdc:mga06z11_77970_c1 | nmdc:mga06z11_77970_c1_716_1471 | 239 |
| 229 | 3300050495 | nmdc:mga04h51_43071_c1 | nmdc:mga04h51_43071_c1_416_1171 | 239 |
| 230 | 3300005981 | Ga0081538_10034900 | Ga0081538_100349002 | 240 |
| 231 | 3300005981 | Ga0081538_10197342 | Ga0081538_101973421 | 240 |
| 232 | 3300025916 | Ga0207663_10370328 | Ga0207663_103703281 | 240 |
| 233 | 3300046462 | Ga0495651_0344547 | Ga0495651_0344547_132_905 | 240 |
| 234 | 3300046536 | Ga0495587_0212808 | Ga0495587_0212808_176_949 | 240 |
| 235 | 3300048912 | Ga0496109_0035526 | Ga0496109_0035526_96_869 | 240 |
| 236 | iso_pu_bacteria | 2841949485 | 2841950313 | 240 |
| 237 | 3300021377 | Ga0213874_10015237 | Ga0213874_100152372 | 241 |
| 238 | 3300031247 | Ga0265340_10066870 | Ga0265340_100668702 | 241 |
| 239 | 3300031456 | Ga0307513_10103307 | Ga0307513_101033072 | 241 |
| 240 | 3300031456 | Ga0307513_10245603 | Ga0307513_102456032 | 241 |
| 241 | 3300035207 | Ga0373942_0096343 | Ga0373942_0096343_82_858 | 241 |
| 242 | 3300039450 | Ga0436363_0891931 | Ga0436363_0891931_233_1015 | 241 |
| 243 | 3300039450 | Ga0436363_1567676 | Ga0436363_1567676_1312_2094 | 241 |
| 244 | 3300048918 | Ga0496115_0036742 | Ga0496115_0036742_3062_3841 | 241 |
| 245 | 3300048929 | Ga0496126_0180968 | Ga0496126_0180968_326_1105 | 241 |
| 246 | 3300049574 | Ga0501038_0551754 | Ga0501038_0551754_62_850 | 241 |
| 247 | 3300049822 | Ga0501035_0040465 | Ga0501035_0040465_1350_2138 | 241 |
| 248 | 3300005439 | Ga0070711_100066238 | Ga0070711_1000662382 | 242 |
| 249 | 3300009177 | Ga0105248_10356480 | Ga0105248_103564802 | 242 |
| 250 | 3300013308 | Ga0157375_10406530 | Ga0157375_104065302 | 242 |
| 251 | 3300025914 | Ga0207671_10144655 | Ga0207671_101446552 | 242 |
| 252 | 3300025915 | Ga0207693_10372682 | Ga0207693_103726822 | 242 |
| 253 | 3300025916 | Ga0207663_10082825 | Ga0207663_100828252 | 242 |
| 254 | 3300025941 | Ga0207711_10025416 | Ga0207711_100254163 | 242 |
| 255 | 3300028786 | Ga0307517_10000419 | Ga0307517_1000041943 | 242 |
| 256 | 3300035117 | Ga0373953_0064738 | Ga0373953_0064738_300_1061 | 242 |
| 257 | 3300035118 | Ga0373954_0009272 | Ga0373954_0009272_1211_1972 | 242 |
| 258 | 3300035119 | Ga0373956_0039768 | Ga0373956_0039768_956_1717 | 242 |
| 259 | 3300035691 | Ga0373931_0011783 | Ga0373931_0011783_3420_4193 | 242 |
| 260 | 3300035692 | Ga0373935_0175039 | Ga0373935_0175039_304_1065 | 242 |
| 261 | 3300035724 | Ga0373933_0031003 | Ga0373933_0031003_1993_2754 | 242 |
| 262 | 3300036401 | Ga0373937_0018073 | Ga0373937_0018073_3964_4725 | 242 |
| 263 | 3300037068 | Ga0373925_0165182 | Ga0373925_0165182_410_1171 | 242 |
| 264 | 3300046462 | Ga0495651_0187273 | Ga0495651_0187273_604_1365 | 242 |
| 265 | 3300046477 | Ga0495664_0300687 | Ga0495664_0300687_101_862 | 242 |
| 266 | 3300046514 | Ga0495618_0346680 | Ga0495618_0346680_118_879 | 242 |
| 267 | 3300046516 | Ga0495628_0001747 | Ga0495628_0001747_11111_11872 | 242 |
| 268 | 3300046529 | Ga0495652_0032273 | Ga0495652_0032273_1257_2018 | 242 |
| 269 | 3300046533 | Ga0495640_0189730 | Ga0495640_0189730_217_978 | 242 |
| 270 | 3300046536 | Ga0495587_0130240 | Ga0495587_0130240_461_1222 | 242 |
| 271 | 3300046543 | Ga0495645_0004709 | Ga0495645_0004709_5710_6471 | 242 |
| 272 | 3300046663 | Ga0495635_0018462 | Ga0495635_0018462_2846_3607 | 242 |
| 273 | 3300046809 | Ga0495600_0041130 | Ga0495600_0041130_110_871 | 242 |
| 274 | 3300047317 | Ga0495604_0004042 | Ga0495604_0004042_455_1216 | 242 |
| 275 | 3300047319 | Ga0495674_0057715 | Ga0495674_0057715_1199_1960 | 242 |
| 276 | 3300047322 | Ga0495680_0095290 | Ga0495680_0095290_1397_2158 | 242 |
| 277 | 3300048906 | Ga0496103_0011197 | Ga0496103_0011197_61_834 | 242 |
| 278 | 3300048907 | Ga0496104_0000090 | Ga0496104_0000090_52919_53680 | 242 |
| 279 | 3300048908 | Ga0496105_0001807 | Ga0496105_0001807_551_1312 | 242 |
| 280 | 3300048909 | Ga0496106_0080266 | Ga0496106_0080266_471_1244 | 242 |
| 281 | 3300048910 | Ga0496107_0249609 | Ga0496107_0249609_236_1009 | 242 |
| 282 | 3300048913 | Ga0496110_0038593 | Ga0496110_0038593_963_1736 | 242 |
| 283 | 3300048914 | Ga0496111_0042237 | Ga0496111_0042237_2384_3157 | 242 |
| 284 | 3300048916 | Ga0496113_0309062 | Ga0496113_0309062_291_1064 | 242 |
| 285 | 3300048918 | Ga0496115_0211341 | Ga0496115_0211341_324_1085 | 242 |
| 286 | 3300048929 | Ga0496126_0199798 | Ga0496126_0199798_124_861 | 242 |
| 287 | 3300053077 | Ga0495601_0004009 | Ga0495601_0004009_3132_3893 | 242 |
| 288 | 3300053078 | Ga0495612_0009850 | Ga0495612_0009850_851_1612 | 242 |
| 289 | 3300053084 | Ga0495595_0076635 | Ga0495595_0076635_525_1286 | 242 |
| 290 | 3300053085 | Ga0495619_0001464 | Ga0495619_0001464_4703_5464 | 242 |
| 291 | 3300005983 | Ga0081540_1024144 | Ga0081540_10241442 | 243 |
| 292 | 3300021388 | Ga0213875_10000007 | Ga0213875_10000007139 | 243 |
| 293 | 3300025295 | Ga0209564_1008399 | Ga0209564_10083994 | 243 |
| 294 | 3300027296 | Ga0209389_1000177 | Ga0209389_100017727 | 243 |
| 295 | 3300027357 | Ga0209589_1000072 | Ga0209589_100007286 | 243 |
| 296 | 3300027361 | Ga0209489_100031 | Ga0209489_10003126 | 243 |
| 297 | 3300044658 | Ga0466972_0113042 | Ga0466972_0113042_321_1091 | 243 |
| 298 | 3300044901 | Ga0466960_0004498 | Ga0466960_0004498_2790_3560 | 243 |
| 299 | 3300046472 | Ga0495580_0155451 | Ga0495580_0155451_620_1414 | 243 |
| 300 | 3300048909 | Ga0496106_0263772 | Ga0496106_0263772_421_1188 | 243 |
| 301 | 3300048919 | Ga0496116_0001513 | Ga0496116_0001513_13676_14443 | 243 |
| 302 | 3300048928 | Ga0496125_0012038 | Ga0496125_0012038_3210_3977 | 243 |
| 303 | 3300050516 | nmdc:mga0sz30_4914_c1 | nmdc:mga0sz30_4914_c1_1070_1837 | 243 |
| 304 | iso_pu_bacteria | 2643221651 | 2644288493 | 243 |
| 305 | 3300005437 | Ga0070710_10016239 | Ga0070710_100162392 | 244 |
| 306 | 3300005981 | Ga0081538_10003572 | Ga0081538_1000357213 | 244 |
| 307 | 3300006028 | Ga0070717_10228756 | Ga0070717_102287562 | 244 |
| 308 | 3300006163 | Ga0070715_10029991 | Ga0070715_100299912 | 244 |
| 309 | 3300009545 | Ga0105237_10370470 | Ga0105237_103704701 | 244 |
| 310 | 3300037853 | Ga0436364_0120722 | Ga0436364_0120722_992_1774 | 244 |
| 311 | 3300039450 | Ga0436363_1148126 | Ga0436363_1148126_257_1042 | 244 |
| 312 | 3300048920 | Ga0496117_0050320 | Ga0496117_0050320_1993_2763 | 244 |
| 313 | 3300048924 | Ga0496121_0040888 | Ga0496121_0040888_702_1475 | 244 |
| 314 | 3300048926 | Ga0496123_0031821 | Ga0496123_0031821_486_1250 | 244 |
| 315 | 3300048927 | Ga0496124_0102586 | Ga0496124_0102586_685_1449 | 244 |
| 316 | 3300050492 | nmdc:mga0yw44_8194_c1 | nmdc:mga0yw44_8194_c1_3306_4100 | 244 |
| 317 | 3300053093 | Ga0500651_0079935 | Ga0500651_0079935_559_1329 | 244 |
| 318 | 3300053094 | Ga0500566_0000667 | Ga0500566_0000667_15271_16044 | 244 |
| 319 | 3300005530 | Ga0070679_100432121 | Ga0070679_1004321212 | 245 |
| 320 | 3300005937 | Ga0081455_10004224 | Ga0081455_100042248 | 245 |
| 321 | 3300048926 | Ga0496123_0171946 | Ga0496123_0171946_153_938 | 245 |
| 322 | 3300049571 | Ga0501034_0000852 | Ga0501034_0000852_26123_26893 | 245 |
| 323 | 3300049575 | Ga0501039_0305089 | Ga0501039_0305089_178_951 | 245 |
| 324 | 3300049577 | Ga0501041_0166795 | Ga0501041_0166795_171_944 | 245 |
| 325 | 3300049582 | Ga0501048_0355630 | Ga0501048_0355630_264_1031 | 245 |
| 326 | 3300049743 | Ga0501081_0187130 | Ga0501081_0187130_549_1322 | 245 |
| 327 | 3300049824 | Ga0501045_0251063 | Ga0501045_0251063_313_1080 | 245 |
| 328 | 3300026075 | Ga0207708_10076715 | Ga0207708_100767152 | 246 |
| 329 | 3300047472 | Ga0495686_0060912 | Ga0495686_0060912_124_894 | 246 |
| 330 | 3300049568 | Ga0501031_0004506 | Ga0501031_0004506_5834_6607 | 246 |
| 331 | 3300049569 | Ga0501032_0037038 | Ga0501032_0037038_1380_2153 | 246 |
| 332 | 3300049570 | Ga0501033_0000155 | Ga0501033_0000155_51795_52568 | 246 |
| 333 | 3300049578 | Ga0501042_0010208 | Ga0501042_0010208_3234_4007 | 246 |
| 334 | 3300049579 | Ga0501043_0014023 | Ga0501043_0014023_3894_4667 | 246 |
| 335 | 3300049822 | Ga0501035_0022530 | Ga0501035_0022530_229_1002 | 246 |
| 336 | 3300061719 | Ga0466962_0152306 | Ga0466962_0152306_100_885 | 246 |
| 337 | iso_pu_bacteria | 2824600985 | 2824608689 | 246 |
| 338 | iso_pu_bacteria | 2824609381 | 2824613963 | 246 |
| 339 | iso_pu_bacteria | 2824653114 | 2824660004 | 246 |
| 340 | iso_pu_bacteria | 2888419890 | 2888424033 | 246 |
| 341 | iso_pu_bacteria | 2935648319 | 2935649641 | 246 |
| 342 | iso_pu_bacteria | 2935656913 | 2935658844 | 246 |
| 343 | iso_pu_bacteria | 2936011229 | 2936012877 | 246 |
| 344 | iso_pu_bacteria | 2936019824 | 2936021441 | 246 |
| 345 | iso_pu_bacteria | 2936028420 | 2936030170 | 246 |
| 346 | iso_pu_bacteria | 2936046547 | 2936047635 | 246 |
| 347 | iso_pu_bacteria | 2936055302 | 2936057207 | 246 |
| 348 | 3300005539 | Ga0068853_100148198 | Ga0068853_1001481982 | 247 |
| 349 | 3300005563 | Ga0068855_100213638 | Ga0068855_1002136382 | 247 |
| 350 | 3300005577 | Ga0068857_100177335 | Ga0068857_1001773352 | 247 |
| 351 | 3300009545 | Ga0105237_10314453 | Ga0105237_103144531 | 247 |
| 352 | 3300013296 | Ga0157374_10036354 | Ga0157374_100363542 | 247 |
| 353 | 3300013306 | Ga0163162_10426113 | Ga0163162_104261132 | 247 |
| 354 | 3300021358 | Ga0213873_10011081 | Ga0213873_100110812 | 247 |
| 355 | 3300021384 | Ga0213876_10000691 | Ga0213876_1000069119 | 247 |
| 356 | 3300025912 | Ga0207707_10069675 | Ga0207707_100696753 | 247 |
| 357 | 3300025924 | Ga0207694_10156445 | Ga0207694_101564452 | 247 |
| 358 | 3300025949 | Ga0207667_10689967 | Ga0207667_106899672 | 247 |
| 359 | 3300026116 | Ga0207674_10034941 | Ga0207674_100349414 | 247 |
| 360 | 3300028653 | Ga0265323_10002662 | Ga0265323_100026628 | 247 |
| 361 | 3300028666 | Ga0265336_10000852 | Ga0265336_1000085212 | 247 |
| 362 | 3300028800 | Ga0265338_10045157 | Ga0265338_100451575 | 247 |
| 363 | 3300039453 | Ga0436362_0209602 | Ga0436362_0209602_646_1434 | 247 |
| 364 | 3300048088 | Ga0495602_0421335 | Ga0495602_0421335_17_769 | 247 |
| 365 | 3300048911 | Ga0496108_0601391 | Ga0496108_0601391_99_872 | 247 |
| 366 | 3300048912 | Ga0496109_0424191 | Ga0496109_0424191_80_853 | 247 |
| 367 | 3300048914 | Ga0496111_0261468 | Ga0496111_0261468_332_1105 | 247 |
| 368 | 3300048915 | Ga0496112_0201862 | Ga0496112_0201862_105_878 | 247 |
| 369 | 3300048918 | Ga0496115_0034395 | Ga0496115_0034395_2108_2881 | 247 |
| 370 | 3300048918 | Ga0496115_0117944 | Ga0496115_0117944_174_947 | 247 |
| 371 | 3300050512 | nmdc:mga0n895_80495_c1 | nmdc:mga0n895_80495_c1_1369_2154 | 247 |
| 372 | iso_pu_bacteria | 2513237104 | 2513718112 | 247 |
| 373 | iso_pu_bacteria | 2824704595 | 2824712428 | 247 |
| 374 | iso_pu_bacteria | 2824753945 | 2824762334 | 247 |
| 375 | iso_pu_bacteria | 2824763712 | 2824772540 | 247 |
| 376 | iso_pu_bacteria | 2841957949 | 2841958253 | 247 |
| 377 | iso_pu_bacteria | 2904711408 | 2904717439 | 247 |
| 378 | 3300005336 | Ga0070680_100073065 | Ga0070680_1000730652 | 248 |
| 379 | 3300005339 | Ga0070660_100292611 | Ga0070660_1002926112 | 248 |
| 380 | 3300005355 | Ga0070671_100429508 | Ga0070671_1004295081 | 248 |
| 381 | 3300005356 | Ga0070674_100108900 | Ga0070674_1001089002 | 248 |
| 382 | 3300005366 | Ga0070659_100267786 | Ga0070659_1002677861 | 248 |
| 383 | 3300005455 | Ga0070663_100012373 | Ga0070663_1000123731 | 248 |
| 384 | 3300005455 | Ga0070663_100255846 | Ga0070663_1002558462 | 248 |
| 385 | 3300005548 | Ga0070665_100131331 | Ga0070665_1001313312 | 248 |
| 386 | 3300005548 | Ga0070665_100185286 | Ga0070665_1001852862 | 248 |
| 387 | 3300005563 | Ga0068855_100088315 | Ga0068855_1000883152 | 248 |
| 388 | 3300005564 | Ga0070664_100084318 | Ga0070664_1000843182 | 248 |
| 389 | 3300005578 | Ga0068854_100396225 | Ga0068854_1003962252 | 248 |
| 390 | 3300005614 | Ga0068856_100463638 | Ga0068856_1004636381 | 248 |
| 391 | 3300005616 | Ga0068852_100245240 | Ga0068852_1002452402 | 248 |
| 392 | 3300005618 | Ga0068864_100208257 | Ga0068864_1002082572 | 248 |
| 393 | 3300005841 | Ga0068863_100316017 | Ga0068863_1003160172 | 248 |
| 394 | 3300005842 | Ga0068858_100047111 | Ga0068858_1000471114 | 248 |
| 395 | 3300005843 | Ga0068860_100002150 | Ga0068860_1000021504 | 248 |
| 396 | 3300009174 | Ga0105241_10543789 | Ga0105241_105437892 | 248 |
| 397 | 3300010375 | Ga0105239_10359532 | Ga0105239_103595323 | 248 |
| 398 | 3300025297 | Ga0209758_1002016 | Ga0209758_100201622 | 248 |
| 399 | 3300025899 | Ga0207642_10207765 | Ga0207642_102077652 | 248 |
| 400 | 3300025911 | Ga0207654_10422380 | Ga0207654_104223801 | 248 |
| 401 | 3300025914 | Ga0207671_10045398 | Ga0207671_100453982 | 248 |
| 402 | 3300025919 | Ga0207657_10342906 | Ga0207657_103429061 | 248 |
| 403 | 3300025940 | Ga0207691_10234993 | Ga0207691_102349932 | 248 |
| 404 | 3300025945 | Ga0207679_10245126 | Ga0207679_102451262 | 248 |
| 405 | 3300026035 | Ga0207703_10040144 | Ga0207703_100401443 | 248 |
| 406 | 3300026067 | Ga0207678_10029406 | Ga0207678_100294062 | 248 |
| 407 | 3300026078 | Ga0207702_10340520 | Ga0207702_103405202 | 248 |
| 408 | 3300026088 | Ga0207641_10429054 | Ga0207641_104290542 | 248 |
| 409 | 3300026121 | Ga0207683_10332279 | Ga0207683_103322792 | 248 |
| 410 | 3300028379 | Ga0268266_10033715 | Ga0268266_100337154 | 248 |
| 411 | 3300028380 | Ga0268265_10127289 | Ga0268265_101272892 | 248 |
| 412 | 3300028381 | Ga0268264_10000162 | Ga0268264_1000016216 | 248 |
| 413 | 3300035114 | Ga0373939_0046801 | Ga0373939_0046801_108_890 | 248 |
| 414 | 3300036459 | Ga0372808_014125 | Ga0372808_014125_60_839 | 248 |
| 415 | 3300046459 | Ga0495629_0112904 | Ga0495629_0112904_246_1028 | 248 |
| 416 | 3300046648 | Ga0495611_0081812 | Ga0495611_0081812_179_937 | 248 |
| 417 | 3300046809 | Ga0495600_0384587 | Ga0495600_0384587_75_857 | 248 |
| 418 | 3300048913 | Ga0496110_0062301 | Ga0496110_0062301_571_1353 | 248 |
| 419 | 3300048917 | Ga0496114_0222306 | Ga0496114_0222306_487_1260 | 248 |
| 420 | 3300048920 | Ga0496117_0097052 | Ga0496117_0097052_67_846 | 248 |
| 421 | 3300048921 | Ga0496118_0003772 | Ga0496118_0003772_11754_12533 | 248 |
| 422 | 3300048924 | Ga0496121_0000302 | Ga0496121_0000302_18375_19154 | 248 |
| 423 | 3300048925 | Ga0496122_0017367 | Ga0496122_0017367_4948_5730 | 248 |
| 424 | 3300048927 | Ga0496124_0005111 | Ga0496124_0005111_11408_12187 | 248 |
| 425 | 3300048929 | Ga0496126_0006778 | Ga0496126_0006778_7495_8277 | 248 |
| 426 | 3300048929 | Ga0496126_0041087 | Ga0496126_0041087_1491_2270 | 248 |
| 427 | 3300048929 | Ga0496126_0532671 | Ga0496126_0532671_171_920 | 248 |
| 428 | 3300049580 | Ga0501046_0056324 | Ga0501046_0056324_1515_2282 | 248 |
| 429 | 3300049581 | Ga0501047_0025620 | Ga0501047_0025620_3167_3934 | 248 |
| 430 | 3300049586 | Ga0501070_0074060 | Ga0501070_0074060_391_1158 | 248 |
| 431 | 3300049590 | Ga0501074_0207947 | Ga0501074_0207947_433_1200 | 248 |
| 432 | 3300049742 | Ga0501080_0340849 | Ga0501080_0340849_215_982 | 248 |
| 433 | 3300049823 | Ga0501044_0047106 | Ga0501044_0047106_792_1559 | 248 |
| 434 | 3300053177 | Ga0500636_0111476 | Ga0500636_0111476_277_1083 | 248 |
| 435 | iso_pu_bacteria | 2507262055 | 2507509081 | 248 |
| 436 | iso_pu_bacteria | 2508501009 | 2508543163 | 248 |
| 437 | iso_pu_bacteria | 2508501042 | 2508691088 | 248 |
| 438 | iso_pu_bacteria | 2511231028 | 2511393306 | 248 |
| 439 | iso_pu_bacteria | 2513237092 | 2513624444 | 248 |
| 440 | iso_pu_bacteria | 2513237094 | 2513643640 | 248 |
| 441 | iso_pu_bacteria | 2513237095 | 2513650101 | 248 |
| 442 | iso_pu_bacteria | 2513237102 | 2513701954 | 248 |
| 443 | iso_pu_bacteria | 2513237139 | 2513872345 | 248 |
| 444 | iso_pu_bacteria | 2513237161 | 2514014071 | 248 |
| 445 | iso_pu_bacteria | 2515154112 | 2515626511 | 248 |
| 446 | iso_pu_bacteria | 2517093001 | 2517101701 | 248 |
| 447 | iso_pu_bacteria | 2524023205 | 2524436851 | 248 |
| 448 | iso_pu_bacteria | 2528768022 | 2528850138 | 248 |
| 449 | iso_pu_bacteria | 2617270735 | 2617351401 | 248 |
| 450 | iso_pu_bacteria | 2617270741 | 2617376203 | 248 |
| 451 | iso_pu_bacteria | 2744054633 | 2745080214 | 248 |
| 452 | iso_pu_bacteria | 2791355196 | 2793063793 | 248 |
| 453 | iso_pu_bacteria | 2802429603 | 2805918051 | 248 |
| 454 | iso_pu_bacteria | 2816332527 | 2818243158 | 248 |
| 455 | iso_pu_bacteria | 2824617872 | 2824625547 | 248 |
| 456 | iso_pu_bacteria | 2824626560 | 2824631408 | 248 |
| 457 | iso_pu_bacteria | 2824635225 | 2824643350 | 248 |
| 458 | iso_pu_bacteria | 2824644064 | 2824651614 | 248 |
| 459 | iso_pu_bacteria | 2824661429 | 2824669897 | 248 |
| 460 | iso_pu_bacteria | 2824671348 | 2824678001 | 248 |
| 461 | iso_pu_bacteria | 2824679649 | 2824686875 | 248 |
| 462 | iso_pu_bacteria | 2824687955 | 2824694407 | 248 |
| 463 | iso_pu_bacteria | 2824696289 | 2824703156 | 248 |
| 464 | iso_pu_bacteria | 2824714736 | 2824722235 | 248 |
| 465 | iso_pu_bacteria | 2824723954 | 2824731614 | 248 |
| 466 | iso_pu_bacteria | 2824732956 | 2824739967 | 248 |
| 467 | iso_pu_bacteria | 2824746037 | 2824753339 | 248 |
| 468 | iso_pu_bacteria | 2824773399 | 2824780048 | 248 |
| 469 | iso_pu_bacteria | 2838122688 | 2838126238 | 248 |
| 470 | iso_pu_bacteria | 2841941048 | 2841943673 | 248 |
| 471 | iso_pu_bacteria | 2841966195 | 2841966694 | 248 |
| 472 | iso_pu_bacteria | 2841974524 | 2841975451 | 248 |
| 473 | iso_pu_bacteria | 2841983080 | 2841988410 | 248 |
| 474 | iso_pu_bacteria | 2842038055 | 2842039503 | 248 |
| 475 | iso_pu_bacteria | 2842045827 | 2842047551 | 248 |
| 476 | iso_pu_bacteria | 2844315083 | 2844318625 | 248 |
| 477 | iso_pu_bacteria | 2847930680 | 2847935744 | 248 |
| 478 | iso_pu_bacteria | 2847939898 | 2847946127 | 248 |
| 479 | iso_pu_bacteria | 2849076700 | 2849079728 | 248 |
| 480 | iso_pu_bacteria | 2857509624 | 2857513850 | 248 |
| 481 | iso_pu_bacteria | 2874590934 | 2874597217 | 248 |
| 482 | iso_pu_bacteria | 2874612657 | 2874616228 | 248 |
| 483 | iso_pu_bacteria | 2874620515 | 2874620843 | 248 |
| 484 | iso_pu_bacteria | 2874628541 | 2874629686 | 248 |
| 485 | iso_pu_bacteria | 2874645413 | 2874649450 | 248 |
| 486 | iso_pu_bacteria | 2876761206 | 2876763854 | 248 |
| 487 | iso_pu_bacteria | 2876771140 | 2876777986 | 248 |
| 488 | iso_pu_bacteria | 2876818435 | 2876822993 | 248 |
| 489 | iso_pu_bacteria | 2879074833 | 2879078743 | 248 |
| 490 | iso_pu_bacteria | 2879083081 | 2879090706 | 248 |
| 491 | iso_pu_bacteria | 2879099564 | 2879108265 | 248 |
| 492 | iso_pu_bacteria | 2879127579 | 2879132779 | 248 |
| 493 | iso_pu_bacteria | 2879142872 | 2879143495 | 248 |
| 494 | iso_pu_bacteria | 2881364244 | 2881366938 | 248 |
| 495 | iso_pu_bacteria | 2881665667 | 2881666343 | 248 |
| 496 | iso_pu_bacteria | 2885366525 | 2885372081 | 248 |
| 497 | iso_pu_bacteria | 2885409591 | 2885412025 | 248 |
| 498 | iso_pu_bacteria | 2888378607 | 2888383605 | 248 |
| 499 | iso_pu_bacteria | 2888388044 | 2888394355 | 248 |
| 500 | iso_pu_bacteria | 2903727486 | 2903728740 | 248 |
| 501 | iso_pu_bacteria | 2904666416 | 2904666943 | 248 |
| 502 | iso_pu_bacteria | 2906602504 | 2906608556 | 248 |
| 503 | iso_pu_bacteria | 2906626472 | 2906634125 | 248 |
| 504 | iso_pu_bacteria | 2906643746 | 2906644792 | 248 |
| 505 | iso_pu_bacteria | 2908775508 | 2908779674 | 248 |
| 506 | iso_pu_bacteria | 2922368715 | 2922373831 | 248 |
| 507 | iso_pu_bacteria | 2922393267 | 2922395910 | 248 |
| 508 | iso_pu_bacteria | 2929615660 | 2929617536 | 248 |
| 509 | iso_pu_bacteria | 2929624759 | 2929627241 | 248 |
| 510 | iso_pu_bacteria | 2932784394 | 2932787414 | 248 |
| 511 | iso_pu_bacteria | 2932794094 | 2932798471 | 248 |
| 512 | iso_pu_bacteria | 2932801729 | 2932803228 | 248 |
| 513 | iso_pu_bacteria | 2932809354 | 2932815128 | 248 |
| 514 | iso_pu_bacteria | 2932818245 | 2932820674 | 248 |
| 515 | iso_pu_bacteria | 2932828146 | 2932831721 | 248 |
| 516 | iso_pu_bacteria | 2933577622 | 2933579492 | 248 |
| 517 | iso_pu_bacteria | 2935608549 | 2935612047 | 248 |
| 518 | iso_pu_bacteria | 2935616580 | 2935622225 | 248 |
| 519 | iso_pu_bacteria | 2935638405 | 2935642866 | 248 |
| 520 | iso_pu_bacteria | 2935665750 | 2935667967 | 248 |
| 521 | iso_pu_bacteria | 2935675223 | 2935678962 | 248 |
| 522 | iso_pu_bacteria | 2935684952 | 2935688712 | 248 |
| 523 | iso_pu_bacteria | 2935694250 | 2935696069 | 248 |
| 524 | iso_pu_bacteria | 2935703347 | 2935706835 | 248 |
| 525 | iso_pu_bacteria | 2935713505 | 2935715731 | 248 |
| 526 | iso_pu_bacteria | 2935722832 | 2935725705 | 248 |
| 527 | iso_pu_bacteria | 2935732158 | 2935738016 | 248 |
| 528 | iso_pu_bacteria | 2935741537 | 2935747391 | 248 |
| 529 | iso_pu_bacteria | 2935750917 | 2935754034 | 248 |
| 530 | iso_pu_bacteria | 2935760218 | 2935763039 | 248 |
| 531 | iso_pu_bacteria | 2935769743 | 2935772517 | 248 |
| 532 | iso_pu_bacteria | 2935777560 | 2935785296 | 248 |
| 533 | iso_pu_bacteria | 2935785616 | 2935791850 | 248 |
| 534 | iso_pu_bacteria | 2935793552 | 2935799490 | 248 |
| 535 | iso_pu_bacteria | 2935801545 | 2935808486 | 248 |
| 536 | iso_pu_bacteria | 2935810662 | 2935812818 | 248 |
| 537 | iso_pu_bacteria | 2935819856 | 2935821520 | 248 |
| 538 | iso_pu_bacteria | 2935827899 | 2935830469 | 248 |
| 539 | iso_pu_bacteria | 2935837841 | 2935840500 | 248 |
| 540 | iso_pu_bacteria | 2935847175 | 2935850211 | 248 |
| 541 | iso_pu_bacteria | 2935855204 | 2935860707 | 248 |
| 542 | iso_pu_bacteria | 2935864058 | 2935865259 | 248 |
| 543 | iso_pu_bacteria | 2935873716 | 2935877856 | 248 |
| 544 | iso_pu_bacteria | 2935883170 | 2935888003 | 248 |
| 545 | iso_pu_bacteria | 2935908558 | 2935914285 | 248 |
| 546 | iso_pu_bacteria | 2935916978 | 2935924661 | 248 |
| 547 | iso_pu_bacteria | 2935926038 | 2935931941 | 248 |
| 548 | iso_pu_bacteria | 2935934488 | 2935940539 | 248 |
| 549 | iso_pu_bacteria | 2935942939 | 2935948481 | 248 |
| 550 | iso_pu_bacteria | 2935951376 | 2935957048 | 248 |
| 551 | iso_pu_bacteria | 2935959822 | 2935960159 | 248 |
| 552 | iso_pu_bacteria | 2935967501 | 2935973646 | 248 |
| 553 | iso_pu_bacteria | 2935975950 | 2935977413 | 248 |
| 554 | iso_pu_bacteria | 2935984226 | 2935989906 | 248 |
| 555 | iso_pu_bacteria | 2935992306 | 2935996191 | 248 |
| 556 | iso_pu_bacteria | 2936002035 | 2936006325 | 248 |
| 557 | iso_pu_bacteria | 2936037263 | 2936041406 | 248 |
| 558 | iso_pu_bacteria | 2940556831 | 2940560590 | 248 |
| 559 | iso_pu_bacteria | 2941531003 | 2941534391 | 248 |
| 560 | iso_pu_bacteria | 2941538514 | 2941541369 | 248 |
| 561 | iso_pu_bacteria | 3005483717 | 3005489213 | 248 |
| 562 | iso_pu_bacteria | 3005506211 | 3005509924 | 248 |
| 563 | iso_pu_bacteria | 3005594810 | 3005598790 | 248 |
| 564 | iso_pu_bacteria | 3005710791 | 3005714412 | 248 |
| 565 | iso_pu_bacteria | 3005718088 | 3005721937 | 248 |
| 566 | iso_pu_bacteria | 8006926726 | 8006927322 | 248 |
| 567 | iso_pu_bacteria | 8016511872 | 8016513852 | 248 |
| 568 | iso_pu_bacteria | 8016522445 | 8016530113 | 248 |
| 569 | iso_pu_bacteria | 8016530956 | 8016535356 | 248 |
| 570 | iso_pu_bacteria | 8016539877 | 8016548561 | 248 |
| 571 | iso_pu_bacteria | 8016548790 | 8016553568 | 248 |
| 572 | iso_pu_bacteria | 8016557553 | 8016561951 | 248 |
| 573 | iso_pu_bacteria | 8016566248 | 8016573692 | 248 |
| 574 | iso_pu_bacteria | 8016575299 | 8016577818 | 248 |
| 575 | iso_pu_bacteria | 8016583857 | 8016592418 | 248 |
| 576 | iso_pu_bacteria | 8016595262 | 8016599777 | 248 |
| 577 | iso_pu_bacteria | 8016603502 | 8016611041 | 248 |
| 578 | iso_pu_bacteria | 8016613128 | 8016613928 | 248 |
| 579 | iso_pu_bacteria | 8016622563 | 8016627176 | 248 |
| 580 | iso_pu_bacteria | 8016630954 | 8016631496 | 248 |
| 581 | iso_pu_bacteria | 8017057580 | 8017062621 | 248 |
| 582 | iso_pu_bacteria | 8019538911 | 8019544381 | 248 |
| 583 | iso_pu_bacteria | 8019547302 | 8019554274 | 248 |
| 584 | iso_pu_bacteria | 8019576017 | 8019582024 | 248 |
| 585 | iso_pu_bacteria | 8019586578 | 8019589707 | 248 |
| 586 | iso_pu_bacteria | 8019597564 | 8019601568 | 248 |
| 587 | iso_pu_bacteria | 8019608314 | 8019616989 | 248 |
| 588 | iso_pu_bacteria | 8019619141 | 8019627611 | 248 |
| 589 | iso_pu_bacteria | 8019629233 | 8019634962 | 248 |
| 590 | iso_pu_bacteria | 8019648815 | 8019657853 | 248 |
| 591 | iso_pu_bacteria | 8019659431 | 8019662797 | 248 |
| 592 | iso_pu_bacteria | 8019668869 | 8019672406 | 248 |
| 593 | iso_pu_bacteria | 8019678201 | 8019683799 | 248 |
| 594 | iso_pu_bacteria | 8019687851 | 8019689515 | 248 |
| 595 | iso_pu_bacteria | 8055742211 | 8055746849 | 248 |
| 596 | iso_pu_bacteria | 8056967851 | 8056972995 | 248 |
| 597 | 3300031711 | Ga0265314_10003550 | Ga0265314_100035508 | 249 |
| 598 | 3300039437 | Ga0436365_0169079 | Ga0436365_0169079_1103_1882 | 249 |
| 599 | 3300046524 | Ga0495648_0003338 | Ga0495648_0003338_2193_2999 | 249 |
| 600 | 3300049574 | Ga0501038_0307885 | Ga0501038_0307885_369_1118 | 249 |
| 601 | 3300049823 | Ga0501044_0118316 | Ga0501044_0118316_598_1347 | 249 |
| 602 | 3300003203 | JGI25406J46586_10000004 | JGI25406J46586_10000004117 | 250 |
| 603 | 3300003659 | JGI25404J52841_10000996 | JGI25404J52841_100009963 | 250 |
| 604 | 3300005434 | Ga0070709_10013963 | Ga0070709_100139633 | 250 |
| 605 | 3300005435 | Ga0070714_100174819 | Ga0070714_1001748191 | 250 |
| 606 | 3300005436 | Ga0070713_100015159 | Ga0070713_1000151594 | 250 |
| 607 | 3300005436 | Ga0070713_100215823 | Ga0070713_1002158232 | 250 |
| 608 | 3300005548 | Ga0070665_100511034 | Ga0070665_1005110341 | 250 |
| 609 | 3300005985 | Ga0081539_10000080 | Ga0081539_1000008010 | 250 |
| 610 | 3300006028 | Ga0070717_10047705 | Ga0070717_100477052 | 250 |
| 611 | 3300006175 | Ga0070712_100058182 | Ga0070712_1000581823 | 250 |
| 612 | 3300025906 | Ga0207699_10026734 | Ga0207699_100267342 | 250 |
| 613 | 3300025915 | Ga0207693_10216415 | Ga0207693_102164151 | 250 |
| 614 | 3300025928 | Ga0207700_10052102 | Ga0207700_100521022 | 250 |
| 615 | 3300025928 | Ga0207700_10054384 | Ga0207700_100543841 | 250 |
| 616 | 3300025929 | Ga0207664_10058755 | Ga0207664_100587553 | 250 |
| 617 | 3300025929 | Ga0207664_10419397 | Ga0207664_104193972 | 250 |
| 618 | 3300037853 | Ga0436364_0462513 | Ga0436364_0462513_25_789 | 250 |
| 619 | 3300046462 | Ga0495651_0058185 | Ga0495651_0058185_2003_2776 | 250 |
| 620 | 3300053177 | Ga0500636_0081739 | Ga0500636_0081739_263_1069 | 250 |
| 621 | iso_pu_bacteria | 2791355197 | 2793068307 | 250 |
| 622 | iso_pu_bacteria | 3005474847 | 3005479873 | 250 |
| 623 | iso_pu_bacteria | 3005587118 | 3005589962 | 250 |
| 624 | 3300005327 | Ga0070658_10158173 | Ga0070658_101581731 | 251 |
| 625 | 3300005435 | Ga0070714_100078278 | Ga0070714_1000782782 | 251 |
| 626 | 3300005439 | Ga0070711_100119442 | Ga0070711_1001194422 | 251 |
| 627 | 3300005445 | Ga0070708_100172862 | Ga0070708_1001728622 | 251 |
| 628 | 3300005983 | Ga0081540_1011684 | Ga0081540_10116842 | 251 |
| 629 | 3300006038 | Ga0075365_10055199 | Ga0075365_100551992 | 251 |
| 630 | 3300006175 | Ga0070712_100043218 | Ga0070712_1000432182 | 251 |
| 631 | 3300025915 | Ga0207693_10020846 | Ga0207693_100208462 | 251 |
| 632 | 3300025916 | Ga0207663_10022593 | Ga0207663_100225931 | 251 |
| 633 | 3300025928 | Ga0207700_10508051 | Ga0207700_105080512 | 251 |
| 634 | 3300037471 | Ga0395905_0139633 | Ga0395905_0139633_997_1764 | 251 |
| 635 | 3300046558 | Ga0495633_0086773 | Ga0495633_0086773_18_803 | 251 |
| 636 | 3300046615 | Ga0495656_0042288 | Ga0495656_0042288_667_1452 | 251 |
| 637 | 3300046664 | Ga0495659_0118649 | Ga0495659_0118649_168_956 | 251 |
| 638 | 3300046691 | Ga0495670_0206820 | Ga0495670_0206820_28_816 | 251 |
| 639 | 3300047323 | Ga0495683_0142501 | Ga0495683_0142501_316_1107 | 251 |
| 640 | 3300048924 | Ga0496121_0001399 | Ga0496121_0001399_36406_37176 | 251 |
| 641 | 3300048929 | Ga0496126_0006546 | Ga0496126_0006546_4775_5539 | 251 |
| 642 | iso_pu_bacteria | 2513237096 | 2513654445 | 251 |
| 643 | iso_pu_bacteria | 2513237098 | 2513673092 | 251 |
| 644 | iso_pu_bacteria | 2513237137 | 2513859247 | 251 |
| 645 | iso_pu_bacteria | 2513237141 | 2513893461 | 251 |
| 646 | iso_pu_bacteria | 2513237145 | 2513915376 | 251 |
| 647 | iso_pu_bacteria | 2517572143 | 2517892680 | 251 |
| 648 | iso_pu_bacteria | 2524023210 | 2524464538 | 251 |
| 649 | iso_pu_bacteria | 2524023228 | 2524538152 | 251 |
| 650 | iso_pu_bacteria | 2602042107 | 2603859048 | 251 |
| 651 | iso_pu_bacteria | 2667528175 | 2671117403 | 251 |
| 652 | iso_pu_bacteria | 2728368998 | 2728748633 | 251 |
| 653 | iso_pu_bacteria | 2857524615 | 2857527850 | 251 |
| 654 | iso_pu_bacteria | 2876808645 | 2876809671 | 251 |
| 655 | iso_pu_bacteria | 2879110137 | 2879118260 | 251 |
| 656 | iso_pu_bacteria | 2885374607 | 2885378498 | 251 |
| 657 | iso_pu_bacteria | 2885383462 | 2885389303 | 251 |
| 658 | iso_pu_bacteria | 2893066018 | 2893066415 | 251 |
| 659 | iso_pu_bacteria | 2903748898 | 2903750575 | 251 |
| 660 | iso_pu_bacteria | 2903768456 | 2903777238 | 251 |
| 661 | iso_pu_bacteria | 2904690495 | 2904696040 | 251 |
| 662 | iso_pu_bacteria | 2906610324 | 2906618312 | 251 |
| 663 | iso_pu_bacteria | 2906635258 | 2906641488 | 251 |
| 664 | iso_pu_bacteria | 2906660503 | 2906664393 | 251 |
| 665 | iso_pu_bacteria | 2908739725 | 2908743043 | 251 |
| 666 | iso_pu_bacteria | 2908756301 | 2908760674 | 251 |
| 667 | iso_pu_bacteria | 2919073203 | 2919075249 | 251 |
| 668 | iso_pu_bacteria | 2935630451 | 2935633415 | 251 |
| 669 | iso_pu_bacteria | 2941507105 | 2941510306 | 251 |
| 670 | iso_pu_bacteria | 2941515067 | 2941517957 | 251 |
| 671 | iso_pu_bacteria | 2941523033 | 2941525973 | 251 |
| 672 | iso_pu_bacteria | 8006933436 | 8006941030 | 251 |
| 673 | iso_pu_bacteria | 8006964411 | 8006970792 | 251 |
| 674 | iso_pu_bacteria | 8006973647 | 8006980769 | 251 |
| 675 | iso_pu_bacteria | 8019555841 | 8019557107 | 251 |
| 676 | iso_pu_bacteria | 8019565922 | 8019568192 | 251 |
| 677 | iso_pu_bacteria | 8056681323 | 8056685412 | 251 |
| 678 | iso_pu_bacteria | 8056689827 | 8056689950 | 251 |
| 679 | 3300002067 | JGI24735J21928_10066513 | JGI24735J21928_100665131 | 252 |
| 680 | 3300003214 | JGI25165J46597_1010878 | JGI25165J46597_10108782 | 252 |
| 681 | 3300003215 | JGI25153J46596_10001121 | JGI25153J46596_1000112110 | 252 |
| 682 | 3300003215 | JGI25153J46596_10002750 | JGI25153J46596_100027502 | 252 |
| 683 | 3300003215 | JGI25153J46596_10002825 | JGI25153J46596_1000282512 | 252 |
| 684 | 3300003215 | JGI25153J46596_10008914 | JGI25153J46596_100089144 | 252 |
| 685 | 3300003354 | JGI25160J50197_1002027 | JGI25160J50197_10020277 | 252 |
| 686 | 3300003354 | JGI25160J50197_1014597 | JGI25160J50197_10145972 | 252 |
| 687 | 3300003354 | JGI25160J50197_1015874 | JGI25160J50197_10158742 | 252 |
| 688 | 3300003762 | Ga0055542_1008165 | Ga0055542_10081652 | 252 |
| 689 | 3300003775 | Ga0055524_1045785 | Ga0055524_10457851 | 252 |
| 690 | 3300003794 | Ga0055531_10044317 | Ga0055531_100443171 | 252 |
| 691 | 3300005262 | Ga0065165_1000394 | Ga0065165_10003942 | 252 |
| 692 | 3300005262 | Ga0065165_1010648 | Ga0065165_10106483 | 252 |
| 693 | 3300005262 | Ga0065165_1013090 | Ga0065165_10130904 | 252 |
| 694 | 3300005262 | Ga0065165_1030460 | Ga0065165_10304602 | 252 |
| 695 | 3300005262 | Ga0065165_1036596 | Ga0065165_10365962 | 252 |
| 696 | 3300005327 | Ga0070658_10055088 | Ga0070658_100550882 | 252 |
| 697 | 3300005331 | Ga0070670_100368031 | Ga0070670_1003680311 | 252 |
| 698 | 3300005339 | Ga0070660_100325791 | Ga0070660_1003257911 | 252 |
| 699 | 3300005347 | Ga0070668_100133855 | Ga0070668_1001338552 | 252 |
| 700 | 3300005355 | Ga0070671_100057432 | Ga0070671_1000574322 | 252 |
| 701 | 3300005434 | Ga0070709_10001245 | Ga0070709_100012455 | 252 |
| 702 | 3300005434 | Ga0070709_10013557 | Ga0070709_100135572 | 252 |
| 703 | 3300005435 | Ga0070714_100002813 | Ga0070714_1000028132 | 252 |
| 704 | 3300005435 | Ga0070714_100335359 | Ga0070714_1003353592 | 252 |
| 705 | 3300005436 | Ga0070713_100141130 | Ga0070713_1001411302 | 252 |
| 706 | 3300005437 | Ga0070710_10018757 | Ga0070710_100187572 | 252 |
| 707 | 3300005437 | Ga0070710_10061787 | Ga0070710_100617872 | 252 |
| 708 | 3300005439 | Ga0070711_100013370 | Ga0070711_1000133704 | 252 |
| 709 | 3300005455 | Ga0070663_100058807 | Ga0070663_1000588072 | 252 |
| 710 | 3300005455 | Ga0070663_100156959 | Ga0070663_1001569592 | 252 |
| 711 | 3300005457 | Ga0070662_100328034 | Ga0070662_1003280341 | 252 |
| 712 | 3300005548 | Ga0070665_100250822 | Ga0070665_1002508224 | 252 |
| 713 | 3300005563 | Ga0068855_100548497 | Ga0068855_1005484972 | 252 |
| 714 | 3300005614 | Ga0068856_100058656 | Ga0068856_1000586562 | 252 |
| 715 | 3300005616 | Ga0068852_100024877 | Ga0068852_1000248772 | 252 |
| 716 | 3300005616 | Ga0068852_100223513 | Ga0068852_1002235131 | 252 |
| 717 | 3300005616 | Ga0068852_100470325 | Ga0068852_1004703252 | 252 |
| 718 | 3300005616 | Ga0068852_100563289 | Ga0068852_1005632892 | 252 |
| 719 | 3300005842 | Ga0068858_100165501 | Ga0068858_1001655012 | 252 |
| 720 | 3300006028 | Ga0070717_10001828 | Ga0070717_100018286 | 252 |
| 721 | 3300006038 | Ga0075365_10021338 | Ga0075365_100213384 | 252 |
| 722 | 3300006048 | Ga0075363_100031431 | Ga0075363_1000314312 | 252 |
| 723 | 3300006051 | Ga0075364_10163150 | Ga0075364_101631502 | 252 |
| 724 | 3300006163 | Ga0070715_10028685 | Ga0070715_100286852 | 252 |
| 725 | 3300006173 | Ga0070716_100003314 | Ga0070716_1000033143 | 252 |
| 726 | 3300006186 | Ga0075369_10060432 | Ga0075369_100604322 | 252 |
| 727 | 3300006186 | Ga0075369_10070240 | Ga0075369_100702402 | 252 |
| 728 | 3300006186 | Ga0075369_10075854 | Ga0075369_100758542 | 252 |
| 729 | 3300006195 | Ga0075366_10037086 | Ga0075366_100370863 | 252 |
| 730 | 3300006195 | Ga0075366_10138086 | Ga0075366_101380862 | 252 |
| 731 | 3300006353 | Ga0075370_10020659 | Ga0075370_100206593 | 252 |
| 732 | 3300006941 | Ga0099825_1033686 | Ga0099825_10336862 | 252 |
| 733 | 3300009093 | Ga0105240_10005091 | Ga0105240_100050914 | 252 |
| 734 | 3300009174 | Ga0105241_10034947 | Ga0105241_100349472 | 252 |
| 735 | 3300009174 | Ga0105241_10666452 | Ga0105241_106664521 | 252 |
| 736 | 3300009176 | Ga0105242_10269003 | Ga0105242_102690032 | 252 |
| 737 | 3300009545 | Ga0105237_10003248 | Ga0105237_1000324810 | 252 |
| 738 | 3300009545 | Ga0105237_10571842 | Ga0105237_105718421 | 252 |
| 739 | 3300010375 | Ga0105239_10057214 | Ga0105239_100572142 | 252 |
| 740 | 3300010375 | Ga0105239_10374794 | Ga0105239_103747942 | 252 |
| 741 | 3300013296 | Ga0157374_10454849 | Ga0157374_104548492 | 252 |
| 742 | 3300013306 | Ga0163162_10325077 | Ga0163162_103250772 | 252 |
| 743 | 3300013308 | Ga0157375_10124674 | Ga0157375_101246743 | 252 |
| 744 | 3300014968 | Ga0157379_10104499 | Ga0157379_101044992 | 252 |
| 745 | 3300021320 | Ga0214544_1000508 | Ga0214544_100050813 | 252 |
| 746 | 3300021321 | Ga0214542_1000365 | Ga0214542_100036513 | 252 |
| 747 | 3300021324 | Ga0214545_1000211 | Ga0214545_100021163 | 252 |
| 748 | 3300021327 | Ga0214543_1001183 | Ga0214543_100118333 | 252 |
| 749 | 3300025253 | Ga0209677_103323 | Ga0209677_1033234 | 252 |
| 750 | 3300025254 | Ga0209148_1000372 | Ga0209148_100037232 | 252 |
| 751 | 3300025261 | Ga0209233_1004360 | Ga0209233_10043601 | 252 |
| 752 | 3300025261 | Ga0209233_1008576 | Ga0209233_10085762 | 252 |
| 753 | 3300025272 | Ga0209455_1004512 | Ga0209455_10045122 | 252 |
| 754 | 3300025295 | Ga0209564_1019612 | Ga0209564_10196121 | 252 |
| 755 | 3300025295 | Ga0209564_1035276 | Ga0209564_10352761 | 252 |
| 756 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021274 | 252 |
| 757 | 3300025297 | Ga0209758_1001014 | Ga0209758_100101428 | 252 |
| 758 | 3300025297 | Ga0209758_1001422 | Ga0209758_10014228 | 252 |
| 759 | 3300025297 | Ga0209758_1004009 | Ga0209758_10040093 | 252 |
| 760 | 3300025297 | Ga0209758_1037457 | Ga0209758_10374571 | 252 |
| 761 | 3300025299 | Ga0209256_1001447 | Ga0209256_100144717 | 252 |
| 762 | 3300025299 | Ga0209256_1025700 | Ga0209256_10257002 | 252 |
| 763 | 3300025302 | Ga0207426_1000229 | Ga0207426_100022969 | 252 |
| 764 | 3300025302 | Ga0207426_1001382 | Ga0207426_10013829 | 252 |
| 765 | 3300025302 | Ga0207426_1006133 | Ga0207426_10061333 | 252 |
| 766 | 3300025302 | Ga0207426_1041902 | Ga0207426_10419022 | 252 |
| 767 | 3300025304 | Ga0209257_1001279 | Ga0209257_10012798 | 252 |
| 768 | 3300025898 | Ga0207692_10001184 | Ga0207692_100011842 | 252 |
| 769 | 3300025898 | Ga0207692_10008480 | Ga0207692_100084805 | 252 |
| 770 | 3300025904 | Ga0207647_10007587 | Ga0207647_100075877 | 252 |
| 771 | 3300025905 | Ga0207685_10049735 | Ga0207685_100497352 | 252 |
| 772 | 3300025906 | Ga0207699_10004578 | Ga0207699_100045783 | 252 |
| 773 | 3300025909 | Ga0207705_10031591 | Ga0207705_100315912 | 252 |
| 774 | 3300025911 | Ga0207654_10040486 | Ga0207654_100404862 | 252 |
| 775 | 3300025913 | Ga0207695_10000015 | Ga0207695_10000015532 | 252 |
| 776 | 3300025914 | Ga0207671_10001686 | Ga0207671_1000168611 | 252 |
| 777 | 3300025914 | Ga0207671_10049902 | Ga0207671_100499023 | 252 |
| 778 | 3300025915 | Ga0207693_10019439 | Ga0207693_100194394 | 252 |
| 779 | 3300025915 | Ga0207693_10025787 | Ga0207693_100257872 | 252 |
| 780 | 3300025916 | Ga0207663_10000743 | Ga0207663_1000074310 | 252 |
| 781 | 3300025920 | Ga0207649_10107123 | Ga0207649_101071232 | 252 |
| 782 | 3300025921 | Ga0207652_10004715 | Ga0207652_100047152 | 252 |
| 783 | 3300025928 | Ga0207700_10042066 | Ga0207700_100420662 | 252 |
| 784 | 3300025928 | Ga0207700_10132212 | Ga0207700_101322122 | 252 |
| 785 | 3300025929 | Ga0207664_10017290 | Ga0207664_100172903 | 252 |
| 786 | 3300025939 | Ga0207665_10002246 | Ga0207665_1000224610 | 252 |
| 787 | 3300025941 | Ga0207711_10078698 | Ga0207711_100786982 | 252 |
| 788 | 3300025972 | Ga0207668_10105748 | Ga0207668_101057482 | 252 |
| 789 | 3300025981 | Ga0207640_10109328 | Ga0207640_101093282 | 252 |
| 790 | 3300025981 | Ga0207640_10203984 | Ga0207640_102039841 | 252 |
| 791 | 3300025986 | Ga0207658_10089179 | Ga0207658_100891792 | 252 |
| 792 | 3300026067 | Ga0207678_10027583 | Ga0207678_100275836 | 252 |
| 793 | 3300026088 | Ga0207641_10172250 | Ga0207641_101722502 | 252 |
| 794 | 3300026089 | Ga0207648_10210859 | Ga0207648_102108592 | 252 |
| 795 | 3300026116 | Ga0207674_10213186 | Ga0207674_102131862 | 252 |
| 796 | 3300026121 | Ga0207683_10087032 | Ga0207683_100870324 | 252 |
| 797 | 3300026142 | Ga0207698_10033737 | Ga0207698_100337372 | 252 |
| 798 | 3300027296 | Ga0209389_1000041 | Ga0209389_100004111 | 252 |
| 799 | 3300027363 | Ga0209700_100010 | Ga0209700_100010308 | 252 |
| 800 | 3300028379 | Ga0268266_10241882 | Ga0268266_102418824 | 252 |
| 801 | 3300031507 | Ga0307509_10249461 | Ga0307509_102494612 | 252 |
| 802 | 3300033180 | Ga0307510_10016740 | Ga0307510_100167403 | 252 |
| 803 | 3300033180 | Ga0307510_10033199 | Ga0307510_100331994 | 252 |
| 804 | 3300033180 | Ga0307510_10112169 | Ga0307510_101121692 | 252 |
| 805 | 3300037471 | Ga0395905_0589380 | Ga0395905_0589380_112_882 | 252 |
| 806 | 3300044658 | Ga0466972_0000532 | Ga0466972_0000532_14690_15460 | 252 |
| 807 | 3300044684 | Ga0466966_0000615 | Ga0466966_0000615_7710_8480 | 252 |
| 808 | 3300044693 | Ga0466961_0000007 | Ga0466961_0000007_60379_61149 | 252 |
| 809 | 3300044694 | Ga0466963_0081869 | Ga0466963_0081869_636_1406 | 252 |
| 810 | 3300044765 | Ga0466970_0118892 | Ga0466970_0118892_374_1144 | 252 |
| 811 | 3300044901 | Ga0466960_0191535 | Ga0466960_0191535_164_934 | 252 |
| 812 | 3300045976 | Ga0466967_0056365 | Ga0466967_0056365_1227_1997 | 252 |
| 813 | 3300046454 | Ga0495592_0033422 | Ga0495592_0033422_214_984 | 252 |
| 814 | 3300046459 | Ga0495629_0020296 | Ga0495629_0020296_3923_4693 | 252 |
| 815 | 3300046460 | Ga0495638_0048710 | Ga0495638_0048710_1588_2358 | 252 |
| 816 | 3300046462 | Ga0495651_0006121 | Ga0495651_0006121_2522_3292 | 252 |
| 817 | 3300046471 | Ga0495650_0050059 | Ga0495650_0050059_610_1380 | 252 |
| 818 | 3300046473 | Ga0495582_0167152 | Ga0495582_0167152_402_1172 | 252 |
| 819 | 3300046477 | Ga0495664_0025321 | Ga0495664_0025321_458_1228 | 252 |
| 820 | 3300046501 | Ga0495607_0076704 | Ga0495607_0076704_1042_1818 | 252 |
| 821 | 3300046506 | Ga0495583_0031803 | Ga0495583_0031803_40_810 | 252 |
| 822 | 3300046511 | Ga0495608_0118648 | Ga0495608_0118648_239_1009 | 252 |
| 823 | 3300046516 | Ga0495628_0017546 | Ga0495628_0017546_3723_4493 | 252 |
| 824 | 3300046522 | Ga0495643_0038350 | Ga0495643_0038350_1054_1824 | 252 |
| 825 | 3300046524 | Ga0495648_0097817 | Ga0495648_0097817_574_1344 | 252 |
| 826 | 3300046528 | Ga0495642_0140679 | Ga0495642_0140679_173_943 | 252 |
| 827 | 3300046529 | Ga0495652_0090656 | Ga0495652_0090656_573_1343 | 252 |
| 828 | 3300046536 | Ga0495587_0028494 | Ga0495587_0028494_333_1103 | 252 |
| 829 | 3300046543 | Ga0495645_0009152 | Ga0495645_0009152_5110_5880 | 252 |
| 830 | 3300046557 | Ga0495622_0036742 | Ga0495622_0036742_397_1167 | 252 |
| 831 | 3300046557 | Ga0495622_0175124 | Ga0495622_0175124_130_900 | 252 |
| 832 | 3300046559 | Ga0495667_0008571 | Ga0495667_0008571_3778_4548 | 252 |
| 833 | 3300046663 | Ga0495635_0054715 | Ga0495635_0054715_376_1146 | 252 |
| 834 | 3300046674 | Ga0495588_0067236 | Ga0495588_0067236_781_1551 | 252 |
| 835 | 3300046675 | Ga0495657_0022842 | Ga0495657_0022842_617_1387 | 252 |
| 836 | 3300046675 | Ga0495657_0033017 | Ga0495657_0033017_307_1077 | 252 |
| 837 | 3300046678 | Ga0495599_0074439 | Ga0495599_0074439_521_1291 | 252 |
| 838 | 3300046679 | Ga0495623_0039468 | Ga0495623_0039468_291_1061 | 252 |
| 839 | 3300046680 | Ga0495646_0030813 | Ga0495646_0030813_1596_2366 | 252 |
| 840 | 3300046683 | Ga0495658_0378929 | Ga0495658_0378929_53_823 | 252 |
| 841 | 3300046689 | Ga0495613_0027201 | Ga0495613_0027201_1119_1889 | 252 |
| 842 | 3300046690 | Ga0495624_0056555 | Ga0495624_0056555_410_1180 | 252 |
| 843 | 3300046694 | Ga0495649_0084615 | Ga0495649_0084615_540_1310 | 252 |
| 844 | 3300046809 | Ga0495600_0004522 | Ga0495600_0004522_3188_3958 | 252 |
| 845 | 3300046809 | Ga0495600_0313018 | Ga0495600_0313018_185_955 | 252 |
| 846 | 3300047317 | Ga0495604_0000837 | Ga0495604_0000837_1376_2146 | 252 |
| 847 | 3300047317 | Ga0495604_0023476 | Ga0495604_0023476_3022_3792 | 252 |
| 848 | 3300047319 | Ga0495674_0081432 | Ga0495674_0081432_624_1394 | 252 |
| 849 | 3300047321 | Ga0495676_0033591 | Ga0495676_0033591_3276_4046 | 252 |
| 850 | 3300047322 | Ga0495680_0003829 | Ga0495680_0003829_4883_5653 | 252 |
| 851 | 3300047443 | Ga0495687_031352 | Ga0495687_031352_1150_1920 | 252 |
| 852 | 3300047444 | Ga0495675_0050477 | Ga0495675_0050477_1470_2240 | 252 |
| 853 | 3300047469 | Ga0495673_0053769 | Ga0495673_0053769_382_1152 | 252 |
| 854 | 3300047469 | Ga0495673_0089278 | Ga0495673_0089278_101_871 | 252 |
| 855 | 3300047673 | Ga0495593_0048739 | Ga0495593_0048739_930_1700 | 252 |
| 856 | 3300048088 | Ga0495602_0018479 | Ga0495602_0018479_1384_2154 | 252 |
| 857 | 3300048903 | Ga0496100_0385911 | Ga0496100_0385911_90_860 | 252 |
| 858 | 3300048904 | Ga0496101_0114579 | Ga0496101_0114579_448_1218 | 252 |
| 859 | 3300048905 | Ga0496102_0128475 | Ga0496102_0128475_764_1534 | 252 |
| 860 | 3300048906 | Ga0496103_0095313 | Ga0496103_0095313_20_790 | 252 |
| 861 | 3300048908 | Ga0496105_0008671 | Ga0496105_0008671_1392_2162 | 252 |
| 862 | 3300048908 | Ga0496105_0094063 | Ga0496105_0094063_198_968 | 252 |
| 863 | 3300048911 | Ga0496108_0094194 | Ga0496108_0094194_939_1709 | 252 |
| 864 | 3300048914 | Ga0496111_0374064 | Ga0496111_0374064_66_836 | 252 |
| 865 | 3300048915 | Ga0496112_0169300 | Ga0496112_0169300_974_1744 | 252 |
| 866 | 3300048916 | Ga0496113_0138153 | Ga0496113_0138153_147_917 | 252 |
| 867 | 3300048916 | Ga0496113_0253750 | Ga0496113_0253750_348_1118 | 252 |
| 868 | 3300048917 | Ga0496114_0253237 | Ga0496114_0253237_472_1242 | 252 |
| 869 | 3300048919 | Ga0496116_0044890 | Ga0496116_0044890_1615_2385 | 252 |
| 870 | 3300048920 | Ga0496117_0215115 | Ga0496117_0215115_228_998 | 252 |
| 871 | 3300048922 | Ga0496119_0125185 | Ga0496119_0125185_390_1160 | 252 |
| 872 | 3300048922 | Ga0496119_0129507 | Ga0496119_0129507_328_1098 | 252 |
| 873 | 3300048922 | Ga0496119_0160573 | Ga0496119_0160573_376_1146 | 252 |
| 874 | 3300048923 | Ga0496120_0016845 | Ga0496120_0016845_1603_2373 | 252 |
| 875 | 3300048923 | Ga0496120_0194959 | Ga0496120_0194959_171_947 | 252 |
| 876 | 3300048924 | Ga0496121_0027588 | Ga0496121_0027588_1914_2684 | 252 |
| 877 | 3300048925 | Ga0496122_0122205 | Ga0496122_0122205_707_1477 | 252 |
| 878 | 3300048928 | Ga0496125_0067791 | Ga0496125_0067791_1845_2615 | 252 |
| 879 | 3300048928 | Ga0496125_0232300 | Ga0496125_0232300_176_946 | 252 |
| 880 | 3300048929 | Ga0496126_0148315 | Ga0496126_0148315_1229_1999 | 252 |
| 881 | 3300049460 | Ga0495682_0005454 | Ga0495682_0005454_915_1685 | 252 |
| 882 | 3300050492 | nmdc:mga0yw44_42521_c1 | nmdc:mga0yw44_42521_c1_1315_2085 | 252 |
| 883 | 3300050493 | nmdc:mga0k408_49683_c1 | nmdc:mga0k408_49683_c1_1425_2195 | 252 |
| 884 | 3300050495 | nmdc:mga04h51_12545_c1 | nmdc:mga04h51_12545_c1_49_819 | 252 |
| 885 | 3300050496 | nmdc:mga07m45_82734_c1 | nmdc:mga07m45_82734_c1_479_1255 | 252 |
| 886 | 3300050512 | nmdc:mga0n895_6973_c1 | nmdc:mga0n895_6973_c1_6864_7637 | 252 |
| 887 | 3300050515 | nmdc:mga0a205_136311_c1 | nmdc:mga0a205_136311_c1_83_856 | 252 |
| 888 | 3300050516 | nmdc:mga0sz30_32196_c1 | nmdc:mga0sz30_32196_c1_1225_2001 | 252 |
| 889 | 3300050516 | nmdc:mga0sz30_88943_c1 | nmdc:mga0sz30_88943_c1_69_842 | 252 |
| 890 | 3300053084 | Ga0495595_0149636 | Ga0495595_0149636_348_1118 | 252 |
| 891 | 3300053085 | Ga0495619_0051990 | Ga0495619_0051990_1806_2576 | 252 |
| 892 | 3300053086 | Ga0500578_0083432 | Ga0500578_0083432_527_1297 | 252 |
| 893 | 3300053086 | Ga0500578_0147009 | Ga0500578_0147009_186_956 | 252 |
| 894 | 3300053090 | Ga0500646_0092678 | Ga0500646_0092678_100_870 | 252 |
| 895 | 3300053096 | Ga0500641_0073989 | Ga0500641_0073989_521_1291 | 252 |
| 896 | 3300053103 | Ga0500555_008678 | Ga0500555_008678_811_1581 | 252 |
| 897 | 3300053105 | Ga0500557_000042 | Ga0500557_000042_61541_62311 | 252 |
| 898 | 3300053108 | Ga0500562_015375 | Ga0500562_015375_833_1603 | 252 |
| 899 | 3300053111 | Ga0500572_008732 | Ga0500572_008732_30_800 | 252 |
| 900 | 3300053116 | Ga0500592_005237 | Ga0500592_005237_125_895 | 252 |
| 901 | 3300053121 | Ga0500607_038348 | Ga0500607_038348_379_1149 | 252 |
| 902 | 3300053130 | Ga0500642_0000112 | Ga0500642_0000112_28761_29531 | 252 |
| 903 | 3300053130 | Ga0500642_0040984 | Ga0500642_0040984_258_1028 | 252 |
| 904 | 3300053136 | Ga0500559_0123207 | Ga0500559_0123207_380_1150 | 252 |
| 905 | 3300053138 | Ga0500564_058794 | Ga0500564_058794_668_1438 | 252 |
| 906 | 3300053146 | Ga0500588_0047387 | Ga0500588_0047387_194_964 | 252 |
| 907 | 3300053153 | Ga0500616_0039187 | Ga0500616_0039187_481_1251 | 252 |
| 908 | 3300053154 | Ga0500619_011239 | Ga0500619_011239_161_931 | 252 |
| 909 | 3300053156 | Ga0500622_0011931 | Ga0500622_0011931_3895_4665 | 252 |
| 910 | 3300053177 | Ga0500636_0000061 | Ga0500636_0000061_29252_30022 | 252 |
| 911 | 3300053178 | Ga0500637_0155603 | Ga0500637_0155603_219_989 | 252 |
| 912 | 3300053722 | Ga0500649_136169 | Ga0500649_136169_58_828 | 252 |
| 913 | 3300053729 | Ga0500625_019916 | Ga0500625_019916_2120_2890 | 252 |
| 914 | 3300053731 | Ga0500609_003186 | Ga0500609_003186_29_799 | 252 |
| 915 | 3300053737 | Ga0500601_000332 | Ga0500601_000332_4281_5051 | 252 |
| 916 | 3300055283 | Ga0500661_018213 | Ga0500661_018213_161_931 | 252 |
| 917 | iso_pu_bacteria | 2513237101 | 2513692103 | 252 |
| 918 | iso_pu_bacteria | 2721755755 | 2723845524 | 252 |
| 919 | iso_pu_bacteria | 2791355199 | 2793082649 | 252 |
| 920 | iso_pu_bacteria | 2874604998 | 2874607583 | 252 |
| 921 | iso_pu_bacteria | 2889033259 | 2889040302 | 252 |
| 922 | iso_pu_bacteria | 2922361189 | 2922368200 | 252 |
| 923 | iso_pu_bacteria | 2922386360 | 2922388325 | 252 |
| 924 | iso_pu_bacteria | 8006984368 | 8006985645 | 252 |
| 925 | iso_pu_bacteria | 8006994254 | 8007000194 | 252 |
| 926 | iso_pu_bacteria | 8056673599 | 8056674261 | 252 |
| 927 | 3300005334 | Ga0068869_100100381 | Ga0068869_1001003812 | 253 |
| 928 | 3300005364 | Ga0070673_100687102 | Ga0070673_1006871021 | 253 |
| 929 | 3300005456 | Ga0070678_100460397 | Ga0070678_1004603971 | 253 |
| 930 | 3300006028 | Ga0070717_10339160 | Ga0070717_103391602 | 253 |
| 931 | 3300006051 | Ga0075364_10049228 | Ga0075364_100492283 | 253 |
| 932 | 3300006178 | Ga0075367_10055588 | Ga0075367_100555882 | 253 |
| 933 | 3300013297 | Ga0157378_10212703 | Ga0157378_102127031 | 253 |
| 934 | 3300025261 | Ga0209233_1008000 | Ga0209233_10080002 | 253 |
| 935 | 3300025295 | Ga0209564_1005852 | Ga0209564_10058523 | 253 |
| 936 | 3300025942 | Ga0207689_10239339 | Ga0207689_102393392 | 253 |
| 937 | 3300026067 | Ga0207678_10174693 | Ga0207678_101746932 | 253 |
| 938 | 3300031852 | Ga0307410_10293668 | Ga0307410_102936681 | 253 |
| 939 | 3300031901 | Ga0307406_10057670 | Ga0307406_100576702 | 253 |
| 940 | 3300031995 | Ga0307409_100651119 | Ga0307409_1006511191 | 253 |
| 941 | 3300037418 | Ga0395900_0000917 | Ga0395900_0000917_24933_25712 | 253 |
| 942 | 3300037466 | Ga0395898_0018861 | Ga0395898_0018861_6221_7000 | 253 |
| 943 | 3300038443 | Ga0395901_0199004 | Ga0395901_0199004_1133_1912 | 253 |
| 944 | 3300039437 | Ga0436365_1698108 | Ga0436365_1698108_568_1344 | 253 |
| 945 | 3300039438 | Ga0436360_1064741 | Ga0436360_1064741_44_817 | 253 |
| 946 | 3300044656 | Ga0466969_0153801 | Ga0466969_0153801_131_904 | 253 |
| 947 | 3300044842 | Ga0466957_0100383 | Ga0466957_0100383_704_1492 | 253 |
| 948 | 3300047469 | Ga0495673_0024739 | Ga0495673_0024739_486_1262 | 253 |
| 949 | 3300048913 | Ga0496110_0683898 | Ga0496110_0683898_64_861 | 253 |
| 950 | 3300048923 | Ga0496120_0029408 | Ga0496120_0029408_2069_2833 | 253 |
| 951 | 3300050491 | nmdc:mga00v17_250529_c1 | nmdc:mga00v17_250529_c1_144_908 | 253 |
| 952 | 3300053096 | Ga0500641_0004927 | Ga0500641_0004927_3818_4597 | 253 |
| 953 | 3300005434 | Ga0070709_10573529 | Ga0070709_105735291 | 254 |
| 954 | 3300005436 | Ga0070713_100035160 | Ga0070713_1000351602 | 254 |
| 955 | 3300005444 | Ga0070694_100374031 | Ga0070694_1003740311 | 254 |
| 956 | 3300005468 | Ga0070707_100269455 | Ga0070707_1002694552 | 254 |
| 957 | 3300005471 | Ga0070698_100190960 | Ga0070698_1001909602 | 254 |
| 958 | 3300005530 | Ga0070679_100254685 | Ga0070679_1002546852 | 254 |
| 959 | 3300005539 | Ga0068853_100190357 | Ga0068853_1001903572 | 254 |
| 960 | 3300005547 | Ga0070693_100030193 | Ga0070693_1000301932 | 254 |
| 961 | 3300005614 | Ga0068856_100162321 | Ga0068856_1001623212 | 254 |
| 962 | 3300009093 | Ga0105240_10041630 | Ga0105240_100416302 | 254 |
| 963 | 3300013104 | Ga0157370_10102433 | Ga0157370_101024332 | 254 |
| 964 | 3300013104 | Ga0157370_10388545 | Ga0157370_103885452 | 254 |
| 965 | 3300013105 | Ga0157369_10017985 | Ga0157369_100179852 | 254 |
| 966 | 3300013105 | Ga0157369_10044826 | Ga0157369_100448262 | 254 |
| 967 | 3300020069 | Ga0197907_11314946 | Ga0197907_113149462 | 254 |
| 968 | 3300022467 | Ga0224712_10034960 | Ga0224712_100349602 | 254 |
| 969 | 3300025912 | Ga0207707_10055246 | Ga0207707_100552462 | 254 |
| 970 | 3300025913 | Ga0207695_10016962 | Ga0207695_100169624 | 254 |
| 971 | 3300025921 | Ga0207652_10200912 | Ga0207652_102009122 | 254 |
| 972 | 3300025928 | Ga0207700_10117624 | Ga0207700_101176242 | 254 |
| 973 | 3300025929 | Ga0207664_10030551 | Ga0207664_100305513 | 254 |
| 974 | 3300025929 | Ga0207664_10190703 | Ga0207664_101907032 | 254 |
| 975 | 3300026075 | Ga0207708_10345253 | Ga0207708_103452532 | 254 |
| 976 | 3300026078 | Ga0207702_10036786 | Ga0207702_100367863 | 254 |
| 977 | 3300031730 | Ga0307516_10327093 | Ga0307516_103270932 | 254 |
| 978 | 3300038443 | Ga0395901_0151265 | Ga0395901_0151265_1310_2080 | 254 |
| 979 | 3300039447 | Ga0436361_0810566 | Ga0436361_0810566_744_1523 | 254 |
| 980 | 3300048922 | Ga0496119_0044789 | Ga0496119_0044789_1373_2185 | 254 |
| 981 | 3300049568 | Ga0501031_0034955 | Ga0501031_0034955_352_1122 | 254 |
| 982 | 3300049569 | Ga0501032_0002923 | Ga0501032_0002923_5069_5839 | 254 |
| 983 | 3300049570 | Ga0501033_0003921 | Ga0501033_0003921_6241_7011 | 254 |
| 984 | 3300049571 | Ga0501034_0057729 | Ga0501034_0057729_372_1142 | 254 |
| 985 | 3300049571 | Ga0501034_0062059 | Ga0501034_0062059_653_1423 | 254 |
| 986 | 3300049571 | Ga0501034_0294457 | Ga0501034_0294457_470_1240 | 254 |
| 987 | 3300049572 | Ga0501036_0122137 | Ga0501036_0122137_1114_1884 | 254 |
| 988 | 3300049573 | Ga0501037_0124516 | Ga0501037_0124516_551_1321 | 254 |
| 989 | 3300049574 | Ga0501038_0023339 | Ga0501038_0023339_4322_5092 | 254 |
| 990 | 3300049574 | Ga0501038_0441727 | Ga0501038_0441727_30_800 | 254 |
| 991 | 3300049575 | Ga0501039_0215801 | Ga0501039_0215801_559_1329 | 254 |
| 992 | 3300049576 | Ga0501040_0053418 | Ga0501040_0053418_266_1036 | 254 |
| 993 | 3300049579 | Ga0501043_0035118 | Ga0501043_0035118_628_1398 | 254 |
| 994 | 3300049579 | Ga0501043_0048514 | Ga0501043_0048514_862_1632 | 254 |
| 995 | 3300049582 | Ga0501048_0081398 | Ga0501048_0081398_1114_1884 | 254 |
| 996 | 3300049583 | Ga0501067_0007483 | Ga0501067_0007483_1553_2323 | 254 |
| 997 | 3300049585 | Ga0501069_0053916 | Ga0501069_0053916_250_1020 | 254 |
| 998 | 3300049586 | Ga0501070_0309036 | Ga0501070_0309036_215_985 | 254 |
| 999 | 3300049586 | Ga0501070_0317015 | Ga0501070_0317015_125_895 | 254 |
| 1000 | 3300049587 | Ga0501071_0131744 | Ga0501071_0131744_32_802 | 254 |
| 1001 | 3300049588 | Ga0501072_0004340 | Ga0501072_0004340_2677_3447 | 254 |
| 1002 | 3300049589 | Ga0501073_0013455 | Ga0501073_0013455_4195_4965 | 254 |
| 1003 | 3300049590 | Ga0501074_0005873 | Ga0501074_0005873_4301_5071 | 254 |
| 1004 | 3300049741 | Ga0501079_0046540 | Ga0501079_0046540_823_1593 | 254 |
| 1005 | 3300049822 | Ga0501035_0174631 | Ga0501035_0174631_897_1667 | 254 |
| 1006 | 3300049823 | Ga0501044_0018863 | Ga0501044_0018863_4076_4846 | 254 |
| 1007 | 3300049823 | Ga0501044_0095558 | Ga0501044_0095558_1793_2563 | 254 |
| 1008 | 3300049824 | Ga0501045_0012975 | Ga0501045_0012975_4439_5209 | 254 |
| 1009 | 3300054114 | Ga0501084_0217929 | Ga0501084_0217929_258_1028 | 254 |
| 1010 | 3300060353 | Ga0501082_0397004 | Ga0501082_0397004_360_1130 | 254 |
| 1011 | 3300005339 | Ga0070660_100374332 | Ga0070660_1003743322 | 255 |
| 1012 | 3300005563 | Ga0068855_100602110 | Ga0068855_1006021102 | 255 |
| 1013 | 3300005983 | Ga0081540_1000683 | Ga0081540_10006834 | 255 |
| 1014 | 3300005983 | Ga0081540_1019314 | Ga0081540_10193142 | 255 |
| 1015 | 3300005983 | Ga0081540_1031817 | Ga0081540_10318172 | 255 |
| 1016 | 3300006028 | Ga0070717_10024964 | Ga0070717_100249643 | 255 |
| 1017 | 3300006038 | Ga0075365_10204633 | Ga0075365_102046332 | 255 |
| 1018 | 3300006177 | Ga0075362_10095584 | Ga0075362_100955842 | 255 |
| 1019 | 3300006353 | Ga0075370_10015344 | Ga0075370_100153441 | 255 |
| 1020 | 3300006942 | Ga0099824_1004774 | Ga0099824_100477413 | 255 |
| 1021 | 3300006943 | Ga0099822_1001842 | Ga0099822_10018427 | 255 |
| 1022 | 3300007788 | Ga0099795_10088120 | Ga0099795_100881202 | 255 |
| 1023 | 3300013104 | Ga0157370_10430605 | Ga0157370_104306052 | 255 |
| 1024 | 3300013307 | Ga0157372_10354872 | Ga0157372_103548722 | 255 |
| 1025 | 3300014969 | Ga0157376_10410937 | Ga0157376_104109372 | 255 |
| 1026 | 3300021361 | Ga0213872_10069664 | Ga0213872_100696642 | 255 |
| 1027 | 3300025900 | Ga0207710_10016522 | Ga0207710_100165222 | 255 |
| 1028 | 3300025919 | Ga0207657_10194332 | Ga0207657_101943322 | 255 |
| 1029 | 3300025972 | Ga0207668_10205216 | Ga0207668_102052162 | 255 |
| 1030 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003245 | 255 |
| 1031 | 3300027361 | Ga0209489_100003 | Ga0209489_100003296 | 255 |
| 1032 | 3300027363 | Ga0209700_100003 | Ga0209700_100003296 | 255 |
| 1033 | 3300027512 | Ga0209179_1001806 | Ga0209179_10018062 | 255 |
| 1034 | 3300031730 | Ga0307516_10008049 | Ga0307516_100080494 | 255 |
| 1035 | 3300031852 | Ga0307410_10310420 | Ga0307410_103104202 | 255 |
| 1036 | 3300033179 | Ga0307507_10014311 | Ga0307507_100143113 | 255 |
| 1037 | 3300035171 | Ga0373946_0252510 | Ga0373946_0252510_59_841 | 255 |
| 1038 | 3300035410 | Ga0373924_0052083 | Ga0373924_0052083_770_1552 | 255 |
| 1039 | 3300035692 | Ga0373935_0118799 | Ga0373935_0118799_203_985 | 255 |
| 1040 | 3300035695 | Ga0373927_0031976 | Ga0373927_0031976_477_1256 | 255 |
| 1041 | 3300035695 | Ga0373927_0063185 | Ga0373927_0063185_1194_1976 | 255 |
| 1042 | 3300036401 | Ga0373937_0125556 | Ga0373937_0125556_1186_1968 | 255 |
| 1043 | 3300037466 | Ga0395898_0363657 | Ga0395898_0363657_156_932 | 255 |
| 1044 | 3300046455 | Ga0495603_0201246 | Ga0495603_0201246_23_805 | 255 |
| 1045 | 3300046460 | Ga0495638_0025097 | Ga0495638_0025097_63_833 | 255 |
| 1046 | 3300046460 | Ga0495638_0181733 | Ga0495638_0181733_367_1137 | 255 |
| 1047 | 3300046477 | Ga0495664_0008978 | Ga0495664_0008978_3503_4285 | 255 |
| 1048 | 3300046501 | Ga0495607_0081498 | Ga0495607_0081498_524_1294 | 255 |
| 1049 | 3300046506 | Ga0495583_0095735 | Ga0495583_0095735_184_954 | 255 |
| 1050 | 3300046515 | Ga0495620_0043676 | Ga0495620_0043676_517_1287 | 255 |
| 1051 | 3300046516 | Ga0495628_0335630 | Ga0495628_0335630_215_997 | 255 |
| 1052 | 3300046517 | Ga0495630_0069212 | Ga0495630_0069212_1192_1974 | 255 |
| 1053 | 3300046520 | Ga0495637_0151663 | Ga0495637_0151663_62_832 | 255 |
| 1054 | 3300046530 | Ga0495654_0013914 | Ga0495654_0013914_3367_4137 | 255 |
| 1055 | 3300046557 | Ga0495622_0021392 | Ga0495622_0021392_396_1175 | 255 |
| 1056 | 3300046557 | Ga0495622_0075623 | Ga0495622_0075623_602_1390 | 255 |
| 1057 | 3300046558 | Ga0495633_0139772 | Ga0495633_0139772_227_994 | 255 |
| 1058 | 3300046663 | Ga0495635_0024280 | Ga0495635_0024280_3328_4110 | 255 |
| 1059 | 3300046681 | Ga0495647_0009627 | Ga0495647_0009627_1574_2356 | 255 |
| 1060 | 3300046684 | Ga0495669_0117580 | Ga0495669_0117580_193_960 | 255 |
| 1061 | 3300046690 | Ga0495624_0281662 | Ga0495624_0281662_26_793 | 255 |
| 1062 | 3300046690 | Ga0495624_0349439 | Ga0495624_0349439_55_837 | 255 |
| 1063 | 3300046691 | Ga0495670_0005738 | Ga0495670_0005738_4885_5655 | 255 |
| 1064 | 3300047315 | Ga0495581_0017695 | Ga0495581_0017695_1774_2556 | 255 |
| 1065 | 3300047317 | Ga0495604_0345809 | Ga0495604_0345809_101_916 | 255 |
| 1066 | 3300047319 | Ga0495674_0016464 | Ga0495674_0016464_3674_4456 | 255 |
| 1067 | 3300047472 | Ga0495686_0164213 | Ga0495686_0164213_34_804 | 255 |
| 1068 | 3300047673 | Ga0495593_0050152 | Ga0495593_0050152_1268_2050 | 255 |
| 1069 | 3300048920 | Ga0496117_0099583 | Ga0496117_0099583_215_985 | 255 |
| 1070 | 3300048921 | Ga0496118_0058993 | Ga0496118_0058993_818_1588 | 255 |
| 1071 | 3300048921 | Ga0496118_0154757 | Ga0496118_0154757_171_941 | 255 |
| 1072 | 3300048923 | Ga0496120_0015096 | Ga0496120_0015096_793_1569 | 255 |
| 1073 | 3300048924 | Ga0496121_0221919 | Ga0496121_0221919_146_916 | 255 |
| 1074 | 3300048925 | Ga0496122_0105434 | Ga0496122_0105434_394_1164 | 255 |
| 1075 | 3300048926 | Ga0496123_0024142 | Ga0496123_0024142_3844_4614 | 255 |
| 1076 | 3300048928 | Ga0496125_0007002 | Ga0496125_0007002_10410_11180 | 255 |
| 1077 | 3300048929 | Ga0496126_0171434 | Ga0496126_0171434_684_1454 | 255 |
| 1078 | 3300048929 | Ga0496126_0227182 | Ga0496126_0227182_408_1187 | 255 |
| 1079 | 3300049568 | Ga0501031_0003006 | Ga0501031_0003006_246_1022 | 255 |
| 1080 | 3300049569 | Ga0501032_0000316 | Ga0501032_0000316_37172_37948 | 255 |
| 1081 | 3300049570 | Ga0501033_0000025 | Ga0501033_0000025_93821_94597 | 255 |
| 1082 | 3300049571 | Ga0501034_0000177 | Ga0501034_0000177_3484_4260 | 255 |
| 1083 | 3300049572 | Ga0501036_0000167 | Ga0501036_0000167_4861_5637 | 255 |
| 1084 | 3300049573 | Ga0501037_0000034 | Ga0501037_0000034_121615_122391 | 255 |
| 1085 | 3300049574 | Ga0501038_0000029 | Ga0501038_0000029_20360_21136 | 255 |
| 1086 | 3300049575 | Ga0501039_0001343 | Ga0501039_0001343_15119_15895 | 255 |
| 1087 | 3300049579 | Ga0501043_0000067 | Ga0501043_0000067_56104_56880 | 255 |
| 1088 | 3300049580 | Ga0501046_0000479 | Ga0501046_0000479_11895_12671 | 255 |
| 1089 | 3300049581 | Ga0501047_0000061 | Ga0501047_0000061_68056_68832 | 255 |
| 1090 | 3300049582 | Ga0501048_0000009 | Ga0501048_0000009_76478_77254 | 255 |
| 1091 | 3300049583 | Ga0501067_0000132 | Ga0501067_0000132_16000_16776 | 255 |
| 1092 | 3300049584 | Ga0501068_0005703 | Ga0501068_0005703_5562_6338 | 255 |
| 1093 | 3300049585 | Ga0501069_0044802 | Ga0501069_0044802_219_995 | 255 |
| 1094 | 3300049586 | Ga0501070_0000563 | Ga0501070_0000563_21747_22523 | 255 |
| 1095 | 3300049588 | Ga0501072_0030306 | Ga0501072_0030306_381_1157 | 255 |
| 1096 | 3300049589 | Ga0501073_0000365 | Ga0501073_0000365_10218_10994 | 255 |
| 1097 | 3300049590 | Ga0501074_0000087 | Ga0501074_0000087_13474_14250 | 255 |
| 1098 | 3300049592 | Ga0501076_0151083 | Ga0501076_0151083_41_817 | 255 |
| 1099 | 3300049741 | Ga0501079_0031799 | Ga0501079_0031799_2117_2893 | 255 |
| 1100 | 3300049742 | Ga0501080_0001547 | Ga0501080_0001547_11331_12107 | 255 |
| 1101 | 3300049744 | Ga0501083_0009601 | Ga0501083_0009601_307_1083 | 255 |
| 1102 | 3300049822 | Ga0501035_0001202 | Ga0501035_0001202_4213_4989 | 255 |
| 1103 | 3300049823 | Ga0501044_0000028 | Ga0501044_0000028_96297_97073 | 255 |
| 1104 | 3300050492 | nmdc:mga0yw44_145904_c1 | nmdc:mga0yw44_145904_c1_548_1318 | 255 |
| 1105 | 3300053077 | Ga0495601_0159845 | Ga0495601_0159845_190_972 | 255 |
| 1106 | 3300053078 | Ga0495612_0031780 | Ga0495612_0031780_695_1477 | 255 |
| 1107 | 3300053086 | Ga0500578_0097217 | Ga0500578_0097217_705_1475 | 255 |
| 1108 | 3300053089 | Ga0500581_119900 | Ga0500581_119900_405_1175 | 255 |
| 1109 | 3300053090 | Ga0500646_0004603 | Ga0500646_0004603_395_1165 | 255 |
| 1110 | 3300053093 | Ga0500651_0065429 | Ga0500651_0065429_696_1514 | 255 |
| 1111 | 3300053093 | Ga0500651_0165586 | Ga0500651_0165586_489_1259 | 255 |
| 1112 | 3300053094 | Ga0500566_0001115 | Ga0500566_0001115_4072_4839 | 255 |
| 1113 | 3300053094 | Ga0500566_0058112 | Ga0500566_0058112_1134_1937 | 255 |
| 1114 | 3300053096 | Ga0500641_0004297 | Ga0500641_0004297_1142_1921 | 255 |
| 1115 | 3300053097 | Ga0500648_131185 | Ga0500648_131185_566_1345 | 255 |
| 1116 | 3300053098 | Ga0500650_0076908 | Ga0500650_0076908_647_1417 | 255 |
| 1117 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_752334_753104 | 255 |
| 1118 | 3300053118 | Ga0500594_0031337 | Ga0500594_0031337_233_1051 | 255 |
| 1119 | 3300053119 | Ga0500595_000617 | Ga0500595_000617_3249_4064 | 255 |
| 1120 | 3300053119 | Ga0500595_002072 | Ga0500595_002072_4725_5492 | 255 |
| 1121 | 3300053121 | Ga0500607_048414 | Ga0500607_048414_1370_2140 | 255 |
| 1122 | 3300053122 | Ga0500608_047265 | Ga0500608_047265_949_1752 | 255 |
| 1123 | 3300053130 | Ga0500642_0000010 | Ga0500642_0000010_70560_71330 | 255 |
| 1124 | 3300053131 | Ga0500652_000720 | Ga0500652_000720_415_1185 | 255 |
| 1125 | 3300053136 | Ga0500559_0000430 | Ga0500559_0000430_308_1111 | 255 |
| 1126 | 3300053136 | Ga0500559_0128028 | Ga0500559_0128028_82_849 | 255 |
| 1127 | 3300053140 | Ga0500573_0105885 | Ga0500573_0105885_86_865 | 255 |
| 1128 | 3300053145 | Ga0500586_019764 | Ga0500586_019764_980_1750 | 255 |
| 1129 | 3300053151 | Ga0500604_0016566 | Ga0500604_0016566_494_1264 | 255 |
| 1130 | 3300053153 | Ga0500616_0000069 | Ga0500616_0000069_233038_233808 | 255 |
| 1131 | 3300053156 | Ga0500622_0000972 | Ga0500622_0000972_16199_16969 | 255 |
| 1132 | 3300053160 | Ga0500633_0063467 | Ga0500633_0063467_386_1156 | 255 |
| 1133 | 3300053162 | Ga0500638_001860 | Ga0500638_001860_4399_5166 | 255 |
| 1134 | 3300053163 | Ga0500639_159142 | Ga0500639_159142_204_983 | 255 |
| 1135 | 3300053177 | Ga0500636_0068146 | Ga0500636_0068146_367_1155 | 255 |
| 1136 | 3300053178 | Ga0500637_0000078 | Ga0500637_0000078_11477_12244 | 255 |
| 1137 | 3300053178 | Ga0500637_0255200 | Ga0500637_0255200_143_931 | 255 |
| 1138 | 3300053724 | Ga0500570_140124 | Ga0500570_140124_68_838 | 255 |
| 1139 | 3300053735 | Ga0500596_004863 | Ga0500596_004863_849_1628 | 255 |
| 1140 | 3300054114 | Ga0501084_0001341 | Ga0501084_0001341_2730_3506 | 255 |
| 1141 | 3300055283 | Ga0500661_000905 | Ga0500661_000905_617_1384 | 255 |
| 1142 | 3300060353 | Ga0501082_0002555 | Ga0501082_0002555_8539_9315 | 255 |
| 1143 | 3300003659 | JGI25404J52841_10026278 | JGI25404J52841_100262781 | 256 |
| 1144 | 3300005328 | Ga0070676_10219328 | Ga0070676_102193282 | 256 |
| 1145 | 3300005329 | Ga0070683_100001741 | Ga0070683_1000017414 | 256 |
| 1146 | 3300005330 | Ga0070690_100162646 | Ga0070690_1001626461 | 256 |
| 1147 | 3300005336 | Ga0070680_100019780 | Ga0070680_1000197802 | 256 |
| 1148 | 3300005341 | Ga0070691_10071209 | Ga0070691_100712092 | 256 |
| 1149 | 3300005344 | Ga0070661_100390503 | Ga0070661_1003905032 | 256 |
| 1150 | 3300005347 | Ga0070668_100106427 | Ga0070668_1001064272 | 256 |
| 1151 | 3300005438 | Ga0070701_10156475 | Ga0070701_101564751 | 256 |
| 1152 | 3300005456 | Ga0070678_100012438 | Ga0070678_1000124384 | 256 |
| 1153 | 3300005458 | Ga0070681_10005973 | Ga0070681_100059734 | 256 |
| 1154 | 3300005458 | Ga0070681_10457618 | Ga0070681_104576181 | 256 |
| 1155 | 3300005459 | Ga0068867_100034125 | Ga0068867_1000341252 | 256 |
| 1156 | 3300005466 | Ga0070685_10416625 | Ga0070685_104166251 | 256 |
| 1157 | 3300005530 | Ga0070679_100124368 | Ga0070679_1001243682 | 256 |
| 1158 | 3300005530 | Ga0070679_100662334 | Ga0070679_1006623341 | 256 |
| 1159 | 3300005535 | Ga0070684_100002282 | Ga0070684_10000228212 | 256 |
| 1160 | 3300005547 | Ga0070693_100116009 | Ga0070693_1001160093 | 256 |
| 1161 | 3300005547 | Ga0070693_100205784 | Ga0070693_1002057841 | 256 |
| 1162 | 3300005548 | Ga0070665_100154903 | Ga0070665_1001549032 | 256 |
| 1163 | 3300005548 | Ga0070665_100695863 | Ga0070665_1006958631 | 256 |
| 1164 | 3300005564 | Ga0070664_100363863 | Ga0070664_1003638632 | 256 |
| 1165 | 3300005577 | Ga0068857_100092655 | Ga0068857_1000926552 | 256 |
| 1166 | 3300005719 | Ga0068861_100216164 | Ga0068861_1002161642 | 256 |
| 1167 | 3300005937 | Ga0081455_10024799 | Ga0081455_100247992 | 256 |
| 1168 | 3300005937 | Ga0081455_10058007 | Ga0081455_100580072 | 256 |
| 1169 | 3300005983 | Ga0081540_1013357 | Ga0081540_10133575 | 256 |
| 1170 | 3300005983 | Ga0081540_1117739 | Ga0081540_11177391 | 256 |
| 1171 | 3300005985 | Ga0081539_10020634 | Ga0081539_100206343 | 256 |
| 1172 | 3300006237 | Ga0097621_100072481 | Ga0097621_1000724812 | 256 |
| 1173 | 3300006353 | Ga0075370_10008424 | Ga0075370_100084241 | 256 |
| 1174 | 3300006844 | Ga0075428_100171201 | Ga0075428_1001712012 | 256 |
| 1175 | 3300006881 | Ga0068865_100066760 | Ga0068865_1000667602 | 256 |
| 1176 | 3300009174 | Ga0105241_10082432 | Ga0105241_100824322 | 256 |
| 1177 | 3300009545 | Ga0105237_10214974 | Ga0105237_102149742 | 256 |
| 1178 | 3300009545 | Ga0105237_10238473 | Ga0105237_102384732 | 256 |
| 1179 | 3300009551 | Ga0105238_10036661 | Ga0105238_100366615 | 256 |
| 1180 | 3300009553 | Ga0105249_10369636 | Ga0105249_103696362 | 256 |
| 1181 | 3300010159 | Ga0099796_10015790 | Ga0099796_100157902 | 256 |
| 1182 | 3300010375 | Ga0105239_10323066 | Ga0105239_103230663 | 256 |
| 1183 | 3300013105 | Ga0157369_10008681 | Ga0157369_100086816 | 256 |
| 1184 | 3300013307 | Ga0157372_10367736 | Ga0157372_103677362 | 256 |
| 1185 | 3300013307 | Ga0157372_10499081 | Ga0157372_104990811 | 256 |
| 1186 | 3300025261 | Ga0209233_1002279 | Ga0209233_10022798 | 256 |
| 1187 | 3300025297 | Ga0209758_1012938 | Ga0209758_10129382 | 256 |
| 1188 | 3300025297 | Ga0209758_1018304 | Ga0209758_10183042 | 256 |
| 1189 | 3300025901 | Ga0207688_10121644 | Ga0207688_101216441 | 256 |
| 1190 | 3300025907 | Ga0207645_10422101 | Ga0207645_104221011 | 256 |
| 1191 | 3300025908 | Ga0207643_10128219 | Ga0207643_101282191 | 256 |
| 1192 | 3300025911 | Ga0207654_10179272 | Ga0207654_101792721 | 256 |
| 1193 | 3300025912 | Ga0207707_10000542 | Ga0207707_1000054222 | 256 |
| 1194 | 3300025912 | Ga0207707_10044879 | Ga0207707_100448793 | 256 |
| 1195 | 3300025914 | Ga0207671_10199253 | Ga0207671_101992532 | 256 |
| 1196 | 3300025914 | Ga0207671_10230629 | Ga0207671_102306292 | 256 |
| 1197 | 3300025921 | Ga0207652_10027091 | Ga0207652_100270912 | 256 |
| 1198 | 3300025921 | Ga0207652_10257196 | Ga0207652_102571962 | 256 |
| 1199 | 3300025924 | Ga0207694_10190923 | Ga0207694_101909232 | 256 |
| 1200 | 3300025924 | Ga0207694_10281121 | Ga0207694_102811212 | 256 |
| 1201 | 3300025933 | Ga0207706_10127345 | Ga0207706_101273452 | 256 |
| 1202 | 3300025944 | Ga0207661_10040524 | Ga0207661_100405243 | 256 |
| 1203 | 3300025949 | Ga0207667_10211168 | Ga0207667_102111682 | 256 |
| 1204 | 3300025961 | Ga0207712_10100821 | Ga0207712_101008212 | 256 |
| 1205 | 3300026041 | Ga0207639_10196994 | Ga0207639_101969942 | 256 |
| 1206 | 3300026067 | Ga0207678_10056344 | Ga0207678_100563441 | 256 |
| 1207 | 3300026116 | Ga0207674_10170778 | Ga0207674_101707781 | 256 |
| 1208 | 3300026118 | Ga0207675_100070518 | Ga0207675_1000705181 | 256 |
| 1209 | 3300028379 | Ga0268266_10002176 | Ga0268266_1000217616 | 256 |
| 1210 | 3300028379 | Ga0268266_10020579 | Ga0268266_100205797 | 256 |
| 1211 | 3300028786 | Ga0307517_10259351 | Ga0307517_102593511 | 256 |
| 1212 | 3300035113 | Ga0373936_0002352 | Ga0373936_0002352_370_1158 | 256 |
| 1213 | 3300037312 | Ga0395899_0019671 | Ga0395899_0019671_3439_4218 | 256 |
| 1214 | 3300037466 | Ga0395898_0086189 | Ga0395898_0086189_590_1369 | 256 |
| 1215 | 3300038443 | Ga0395901_0267252 | Ga0395901_0267252_812_1591 | 256 |
| 1216 | 3300045976 | Ga0466967_0566753 | Ga0466967_0566753_204_989 | 256 |
| 1217 | 3300046543 | Ga0495645_0039319 | Ga0495645_0039319_1650_2435 | 256 |
| 1218 | 3300047445 | Ga0495677_0090585 | Ga0495677_0090585_187_972 | 256 |
| 1219 | 3300048912 | Ga0496109_0532331 | Ga0496109_0532331_46_828 | 256 |
| 1220 | 3300048916 | Ga0496113_0259287 | Ga0496113_0259287_532_1317 | 256 |
| 1221 | 3300048920 | Ga0496117_0018780 | Ga0496117_0018780_400_1218 | 256 |
| 1222 | 3300048921 | Ga0496118_0158428 | Ga0496118_0158428_67_885 | 256 |
| 1223 | 3300048924 | Ga0496121_0014891 | Ga0496121_0014891_3562_4380 | 256 |
| 1224 | 3300048924 | Ga0496121_0092827 | Ga0496121_0092827_824_1609 | 256 |
| 1225 | 3300048928 | Ga0496125_0000847 | Ga0496125_0000847_9787_10560 | 256 |
| 1226 | 3300048928 | Ga0496125_0001679 | Ga0496125_0001679_9651_10424 | 256 |
| 1227 | 3300048929 | Ga0496126_0039491 | Ga0496126_0039491_1262_2035 | 256 |
| 1228 | 3300048929 | Ga0496126_0081901 | Ga0496126_0081901_1151_1960 | 256 |
| 1229 | 3300048929 | Ga0496126_0142094 | Ga0496126_0142094_226_999 | 256 |
| 1230 | 3300048929 | Ga0496126_0411230 | Ga0496126_0411230_232_1005 | 256 |
| 1231 | 3300049568 | Ga0501031_0114201 | Ga0501031_0114201_683_1453 | 256 |
| 1232 | 3300049569 | Ga0501032_0114965 | Ga0501032_0114965_634_1404 | 256 |
| 1233 | 3300049571 | Ga0501034_0149442 | Ga0501034_0149442_1362_2132 | 256 |
| 1234 | 3300049572 | Ga0501036_0243932 | Ga0501036_0243932_614_1384 | 256 |
| 1235 | 3300049573 | Ga0501037_0109198 | Ga0501037_0109198_229_999 | 256 |
| 1236 | 3300049574 | Ga0501038_0081654 | Ga0501038_0081654_1229_1999 | 256 |
| 1237 | 3300049575 | Ga0501039_0194319 | Ga0501039_0194319_656_1426 | 256 |
| 1238 | 3300049579 | Ga0501043_0170391 | Ga0501043_0170391_839_1609 | 256 |
| 1239 | 3300049580 | Ga0501046_0106609 | Ga0501046_0106609_357_1127 | 256 |
| 1240 | 3300049585 | Ga0501069_0087548 | Ga0501069_0087548_61_831 | 256 |
| 1241 | 3300049823 | Ga0501044_0349449 | Ga0501044_0349449_400_1170 | 256 |
| 1242 | 3300050490 | nmdc:mga03n38_151_c1 | nmdc:mga03n38_151_c1_8094_8876 | 256 |
| 1243 | 3300050492 | nmdc:mga0yw44_250654_c1 | nmdc:mga0yw44_250654_c1_241_1023 | 256 |
| 1244 | 3300053077 | Ga0495601_0199574 | Ga0495601_0199574_49_834 | 256 |
| 1245 | 3300053078 | Ga0495612_0004682 | Ga0495612_0004682_1570_2355 | 256 |
| 1246 | 3300053092 | Ga0500583_0252757 | Ga0500583_0252757_21_839 | 256 |
| 1247 | 3300053094 | Ga0500566_0000124 | Ga0500566_0000124_35974_36762 | 256 |
| 1248 | 3300053095 | Ga0500640_003612 | Ga0500640_003612_4199_4987 | 256 |
| 1249 | 3300053111 | Ga0500572_000207 | Ga0500572_000207_16797_17585 | 256 |
| 1250 | 3300053111 | Ga0500572_046339 | Ga0500572_046339_53_847 | 256 |
| 1251 | 3300053122 | Ga0500608_004134 | Ga0500608_004134_2198_2986 | 256 |
| 1252 | 3300053123 | Ga0500614_002387 | Ga0500614_002387_878_1666 | 256 |
| 1253 | 3300053125 | Ga0500618_029100 | Ga0500618_029100_222_995 | 256 |
| 1254 | 3300053136 | Ga0500559_0000658 | Ga0500559_0000658_21653_22441 | 256 |
| 1255 | 3300053136 | Ga0500559_0001001 | Ga0500559_0001001_9352_10146 | 256 |
| 1256 | 3300053142 | Ga0500577_0000058 | Ga0500577_0000058_24248_25108 | 256 |
| 1257 | 3300053150 | Ga0500603_000069 | Ga0500603_000069_2850_3638 | 256 |
| 1258 | 3300053162 | Ga0500638_000353 | Ga0500638_000353_1337_2125 | 256 |
| 1259 | 3300053163 | Ga0500639_000057 | Ga0500639_000057_11782_12570 | 256 |
| 1260 | 3300053163 | Ga0500639_014190 | Ga0500639_014190_901_1695 | 256 |
| 1261 | 3300053178 | Ga0500637_0061873 | Ga0500637_0061873_781_1572 | 256 |
| 1262 | 3300053725 | Ga0500576_072629 | Ga0500576_072629_463_1257 | 256 |
| 1263 | 3300053735 | Ga0500596_000608 | Ga0500596_000608_2843_3631 | 256 |
| 1264 | 3300053735 | Ga0500596_019423 | Ga0500596_019423_143_937 | 256 |
| 1265 | 3300060353 | Ga0501082_0202825 | Ga0501082_0202825_444_1232 | 256 |
| 1266 | 3300001989 | JGI24739J22299_10011169 | JGI24739J22299_100111691 | 257 |
| 1267 | 3300001990 | JGI24737J22298_10046391 | JGI24737J22298_100463911 | 257 |
| 1268 | 3300005329 | Ga0070683_100448812 | Ga0070683_1004488121 | 257 |
| 1269 | 3300005336 | Ga0070680_100319565 | Ga0070680_1003195651 | 257 |
| 1270 | 3300005338 | Ga0068868_100144046 | Ga0068868_1001440461 | 257 |
| 1271 | 3300005339 | Ga0070660_100053501 | Ga0070660_1000535013 | 257 |
| 1272 | 3300005344 | Ga0070661_100412282 | Ga0070661_1004122821 | 257 |
| 1273 | 3300005356 | Ga0070674_100286605 | Ga0070674_1002866051 | 257 |
| 1274 | 3300005364 | Ga0070673_100412447 | Ga0070673_1004124472 | 257 |
| 1275 | 3300005436 | Ga0070713_100625935 | Ga0070713_1006259351 | 257 |
| 1276 | 3300005455 | Ga0070663_100199845 | Ga0070663_1001998452 | 257 |
| 1277 | 3300005458 | Ga0070681_10317721 | Ga0070681_103177212 | 257 |
| 1278 | 3300005530 | Ga0070679_100059281 | Ga0070679_1000592811 | 257 |
| 1279 | 3300005530 | Ga0070679_100319828 | Ga0070679_1003198282 | 257 |
| 1280 | 3300005530 | Ga0070679_100395056 | Ga0070679_1003950562 | 257 |
| 1281 | 3300005539 | Ga0068853_100169905 | Ga0068853_1001699052 | 257 |
| 1282 | 3300005539 | Ga0068853_100261663 | Ga0068853_1002616632 | 257 |
| 1283 | 3300005563 | Ga0068855_100085961 | Ga0068855_1000859613 | 257 |
| 1284 | 3300005577 | Ga0068857_100027761 | Ga0068857_1000277612 | 257 |
| 1285 | 3300005614 | Ga0068856_100006007 | Ga0068856_1000060072 | 257 |
| 1286 | 3300005614 | Ga0068856_100006164 | Ga0068856_1000061645 | 257 |
| 1287 | 3300005614 | Ga0068856_100488290 | Ga0068856_1004882902 | 257 |
| 1288 | 3300005616 | Ga0068852_100252297 | Ga0068852_1002522973 | 257 |
| 1289 | 3300005618 | Ga0068864_100119863 | Ga0068864_1001198632 | 257 |
| 1290 | 3300005719 | Ga0068861_100297022 | Ga0068861_1002970222 | 257 |
| 1291 | 3300005937 | Ga0081455_10117367 | Ga0081455_101173673 | 257 |
| 1292 | 3300005937 | Ga0081455_10282495 | Ga0081455_102824952 | 257 |
| 1293 | 3300005983 | Ga0081540_1006439 | Ga0081540_10064392 | 257 |
| 1294 | 3300005983 | Ga0081540_1009891 | Ga0081540_10098913 | 257 |
| 1295 | 3300005985 | Ga0081539_10000152 | Ga0081539_1000015226 | 257 |
| 1296 | 3300006042 | Ga0075368_10045234 | Ga0075368_100452342 | 257 |
| 1297 | 3300006163 | Ga0070715_10106893 | Ga0070715_101068931 | 257 |
| 1298 | 3300006358 | Ga0068871_100363378 | Ga0068871_1003633781 | 257 |
| 1299 | 3300009093 | Ga0105240_10098304 | Ga0105240_100983042 | 257 |
| 1300 | 3300009093 | Ga0105240_10641619 | Ga0105240_106416191 | 257 |
| 1301 | 3300009098 | Ga0105245_10069555 | Ga0105245_100695553 | 257 |
| 1302 | 3300009101 | Ga0105247_10018856 | Ga0105247_100188563 | 257 |
| 1303 | 3300009545 | Ga0105237_10369246 | Ga0105237_103692463 | 257 |
| 1304 | 3300009551 | Ga0105238_10016317 | Ga0105238_100163178 | 257 |
| 1305 | 3300009551 | Ga0105238_10230488 | Ga0105238_102304882 | 257 |
| 1306 | 3300010375 | Ga0105239_10335010 | Ga0105239_103350102 | 257 |
| 1307 | 3300013100 | Ga0157373_10066939 | Ga0157373_100669392 | 257 |
| 1308 | 3300013104 | Ga0157370_10633019 | Ga0157370_106330191 | 257 |
| 1309 | 3300013307 | Ga0157372_10344185 | Ga0157372_103441852 | 257 |
| 1310 | 3300014969 | Ga0157376_10724233 | Ga0157376_107242331 | 257 |
| 1311 | 3300025253 | Ga0209677_100698 | Ga0209677_1006986 | 257 |
| 1312 | 3300025904 | Ga0207647_10003251 | Ga0207647_100032517 | 257 |
| 1313 | 3300025905 | Ga0207685_10042424 | Ga0207685_100424241 | 257 |
| 1314 | 3300025909 | Ga0207705_10074220 | Ga0207705_100742202 | 257 |
| 1315 | 3300025913 | Ga0207695_10250860 | Ga0207695_102508602 | 257 |
| 1316 | 3300025915 | Ga0207693_10366656 | Ga0207693_103666561 | 257 |
| 1317 | 3300025916 | Ga0207663_10383965 | Ga0207663_103839652 | 257 |
| 1318 | 3300025917 | Ga0207660_10154574 | Ga0207660_101545743 | 257 |
| 1319 | 3300025919 | Ga0207657_10006256 | Ga0207657_100062562 | 257 |
| 1320 | 3300025919 | Ga0207657_10161573 | Ga0207657_101615732 | 257 |
| 1321 | 3300025921 | Ga0207652_10323061 | Ga0207652_103230611 | 257 |
| 1322 | 3300025928 | Ga0207700_10506981 | Ga0207700_105069811 | 257 |
| 1323 | 3300025941 | Ga0207711_10778332 | Ga0207711_107783321 | 257 |
| 1324 | 3300025942 | Ga0207689_10090689 | Ga0207689_100906892 | 257 |
| 1325 | 3300025944 | Ga0207661_10480208 | Ga0207661_104802081 | 257 |
| 1326 | 3300025949 | Ga0207667_10013962 | Ga0207667_100139622 | 257 |
| 1327 | 3300025981 | Ga0207640_10130436 | Ga0207640_101304362 | 257 |
| 1328 | 3300026035 | Ga0207703_10234020 | Ga0207703_102340202 | 257 |
| 1329 | 3300026078 | Ga0207702_10003081 | Ga0207702_100030816 | 257 |
| 1330 | 3300026142 | Ga0207698_10144517 | Ga0207698_101445172 | 257 |
| 1331 | 3300027512 | Ga0209179_1030993 | Ga0209179_10309931 | 257 |
| 1332 | 3300027671 | Ga0209588_1016853 | Ga0209588_10168532 | 257 |
| 1333 | 3300028379 | Ga0268266_10286276 | Ga0268266_102862761 | 257 |
| 1334 | 3300031616 | Ga0307508_10244124 | Ga0307508_102441242 | 257 |
| 1335 | 3300031995 | Ga0307409_100167133 | Ga0307409_1001671332 | 257 |
| 1336 | 3300032005 | Ga0307411_10100612 | Ga0307411_101006122 | 257 |
| 1337 | 3300033180 | Ga0307510_10025604 | Ga0307510_100256042 | 257 |
| 1338 | 3300035084 | Ga0373928_0006084 | Ga0373928_0006084_1493_2266 | 257 |
| 1339 | 3300035086 | Ga0373934_0031937 | Ga0373934_0031937_115_888 | 257 |
| 1340 | 3300035116 | Ga0373945_0013610 | Ga0373945_0013610_280_1053 | 257 |
| 1341 | 3300035117 | Ga0373953_0011610 | Ga0373953_0011610_1980_2753 | 257 |
| 1342 | 3300035691 | Ga0373931_0284787 | Ga0373931_0284787_233_1006 | 257 |
| 1343 | 3300035692 | Ga0373935_0000164 | Ga0373935_0000164_26701_27474 | 257 |
| 1344 | 3300035692 | Ga0373935_0452322 | Ga0373935_0452322_73_849 | 257 |
| 1345 | 3300035695 | Ga0373927_0000977 | Ga0373927_0000977_8815_9588 | 257 |
| 1346 | 3300035724 | Ga0373933_0000686 | Ga0373933_0000686_5765_6544 | 257 |
| 1347 | 3300035725 | Ga0373947_0003339 | Ga0373947_0003339_1499_2272 | 257 |
| 1348 | 3300036458 | Ga0310112_016313 | Ga0310112_016313_140_922 | 257 |
| 1349 | 3300036534 | Ga0310109_016196 | Ga0310109_016196_66_848 | 257 |
| 1350 | 3300037068 | Ga0373925_0092678 | Ga0373925_0092678_192_965 | 257 |
| 1351 | 3300039437 | Ga0436365_1855737 | Ga0436365_1855737_1328_2125 | 257 |
| 1352 | 3300045976 | Ga0466967_0159550 | Ga0466967_0159550_981_1769 | 257 |
| 1353 | 3300046454 | Ga0495592_0013585 | Ga0495592_0013585_3900_4673 | 257 |
| 1354 | 3300046454 | Ga0495592_0168698 | Ga0495592_0168698_401_1174 | 257 |
| 1355 | 3300046455 | Ga0495603_0005902 | Ga0495603_0005902_6477_7250 | 257 |
| 1356 | 3300046455 | Ga0495603_0044412 | Ga0495603_0044412_429_1202 | 257 |
| 1357 | 3300046455 | Ga0495603_0185812 | Ga0495603_0185812_18_791 | 257 |
| 1358 | 3300046459 | Ga0495629_0000087 | Ga0495629_0000087_13682_14455 | 257 |
| 1359 | 3300046461 | Ga0495641_0056274 | Ga0495641_0056274_689_1462 | 257 |
| 1360 | 3300046473 | Ga0495582_0000818 | Ga0495582_0000818_4486_5259 | 257 |
| 1361 | 3300046475 | Ga0495639_0000022 | Ga0495639_0000022_52218_52991 | 257 |
| 1362 | 3300046476 | Ga0495662_0000161 | Ga0495662_0000161_8847_9620 | 257 |
| 1363 | 3300046477 | Ga0495664_0010436 | Ga0495664_0010436_4360_5133 | 257 |
| 1364 | 3300046499 | Ga0495594_0000275 | Ga0495594_0000275_12644_13417 | 257 |
| 1365 | 3300046507 | Ga0495606_0002311 | Ga0495606_0002311_12826_13602 | 257 |
| 1366 | 3300046511 | Ga0495608_0010519 | Ga0495608_0010519_4898_5671 | 257 |
| 1367 | 3300046516 | Ga0495628_0032115 | Ga0495628_0032115_3308_4081 | 257 |
| 1368 | 3300046516 | Ga0495628_0155477 | Ga0495628_0155477_221_994 | 257 |
| 1369 | 3300046517 | Ga0495630_0003318 | Ga0495630_0003318_6148_6921 | 257 |
| 1370 | 3300046524 | Ga0495648_0001225 | Ga0495648_0001225_4797_5570 | 257 |
| 1371 | 3300046531 | Ga0495665_0000105 | Ga0495665_0000105_27248_28021 | 257 |
| 1372 | 3300046533 | Ga0495640_0022475 | Ga0495640_0022475_2990_3763 | 257 |
| 1373 | 3300046543 | Ga0495645_0007422 | Ga0495645_0007422_4655_5428 | 257 |
| 1374 | 3300046557 | Ga0495622_0029620 | Ga0495622_0029620_639_1412 | 257 |
| 1375 | 3300046642 | Ga0495634_0139749 | Ga0495634_0139749_583_1356 | 257 |
| 1376 | 3300046642 | Ga0495634_0279136 | Ga0495634_0279136_113_886 | 257 |
| 1377 | 3300046663 | Ga0495635_0000359 | Ga0495635_0000359_8998_9771 | 257 |
| 1378 | 3300046663 | Ga0495635_0008606 | Ga0495635_0008606_6125_6898 | 257 |
| 1379 | 3300046678 | Ga0495599_0022485 | Ga0495599_0022485_1715_2488 | 257 |
| 1380 | 3300046678 | Ga0495599_0078082 | Ga0495599_0078082_122_895 | 257 |
| 1381 | 3300046681 | Ga0495647_0002828 | Ga0495647_0002828_3219_3992 | 257 |
| 1382 | 3300046683 | Ga0495658_0002969 | Ga0495658_0002969_7564_8337 | 257 |
| 1383 | 3300046683 | Ga0495658_0468509 | Ga0495658_0468509_13_786 | 257 |
| 1384 | 3300046689 | Ga0495613_0024571 | Ga0495613_0024571_3231_4004 | 257 |
| 1385 | 3300046690 | Ga0495624_0001105 | Ga0495624_0001105_10574_11347 | 257 |
| 1386 | 3300046690 | Ga0495624_0168393 | Ga0495624_0168393_528_1301 | 257 |
| 1387 | 3300047315 | Ga0495581_0000889 | Ga0495581_0000889_11893_12666 | 257 |
| 1388 | 3300047317 | Ga0495604_0015252 | Ga0495604_0015252_1015_1788 | 257 |
| 1389 | 3300047319 | Ga0495674_0010563 | Ga0495674_0010563_3487_4260 | 257 |
| 1390 | 3300047321 | Ga0495676_0060406 | Ga0495676_0060406_421_1194 | 257 |
| 1391 | 3300047321 | Ga0495676_0343591 | Ga0495676_0343591_215_988 | 257 |
| 1392 | 3300047471 | Ga0495684_0079064 | Ga0495684_0079064_1695_2468 | 257 |
| 1393 | 3300047471 | Ga0495684_0345170 | Ga0495684_0345170_39_812 | 257 |
| 1394 | 3300047673 | Ga0495593_0000213 | Ga0495593_0000213_7152_7925 | 257 |
| 1395 | 3300047673 | Ga0495593_0058879 | Ga0495593_0058879_25_798 | 257 |
| 1396 | 3300048089 | Ga0495614_0044651 | Ga0495614_0044651_639_1412 | 257 |
| 1397 | 3300048903 | Ga0496100_0082160 | Ga0496100_0082160_1328_2101 | 257 |
| 1398 | 3300048915 | Ga0496112_0798834 | Ga0496112_0798834_10_798 | 257 |
| 1399 | 3300048919 | Ga0496116_0220623 | Ga0496116_0220623_62_868 | 257 |
| 1400 | 3300048921 | Ga0496118_0053399 | Ga0496118_0053399_120_917 | 257 |
| 1401 | 3300048924 | Ga0496121_0082353 | Ga0496121_0082353_1274_2080 | 257 |
| 1402 | 3300048924 | Ga0496121_0098233 | Ga0496121_0098233_520_1317 | 257 |
| 1403 | 3300048928 | Ga0496125_0249609 | Ga0496125_0249609_109_897 | 257 |
| 1404 | 3300048929 | Ga0496126_0168285 | Ga0496126_0168285_141_947 | 257 |
| 1405 | 3300048929 | Ga0496126_0344484 | Ga0496126_0344484_210_983 | 257 |
| 1406 | 3300050493 | nmdc:mga0k408_252587_c1 | nmdc:mga0k408_252587_c1_226_1014 | 257 |
| 1407 | 3300050512 | nmdc:mga0n895_659362_c1 | nmdc:mga0n895_659362_c1_37_825 | 257 |
| 1408 | 3300053077 | Ga0495601_0141984 | Ga0495601_0141984_747_1520 | 257 |
| 1409 | 3300053085 | Ga0495619_0185507 | Ga0495619_0185507_23_796 | 257 |
| 1410 | 3300053102 | Ga0500554_000874 | Ga0500554_000874_4676_5449 | 257 |
| 1411 | 3300053103 | Ga0500555_015843 | Ga0500555_015843_904_1689 | 257 |
| 1412 | 3300053150 | Ga0500603_000345 | Ga0500603_000345_6292_7065 | 257 |
| 1413 | 3300053178 | Ga0500637_0000494 | Ga0500637_0000494_6013_6786 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar