F493787

General Info

Members Datasets Scaffolds Average Seq Length
1416 488 1357 388

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100036780|Ga0070680_1000367804
Length 446
Sequence MAAAHLSRLRECYRNCIDVINLRSIVALFLIIETAWLFASLILVCYDDSFEVTAVAETKVREAVIIDAVRTPLGRRDGMLKEWHPVDLLAHTLGGLVQRNKLDSRLVEDVIGGCVMQVGEQSVNVTRNAVLAAGFPESVPATTVDRQCGSSQQAIHFAAQGVMAGSYDVVIACGVESMTRVPMGSAAASGPGKPFGPAMMRRYNNAHFNQGISAEMMAERWKLDRASLXXYSLESHRRAGRATEQGWFCREILPTPVQAESSAKMISRDEGIRPDTTLEKMATLKTVFKPDGVITAANSSQITDGAAAVLIMERGKAESLGFRPMARFVSFALAGEDPVLMLSAPIPATRRVLERAQLKLEEIDRIEINEAFASVVLAWQKETGADMARVNVNGGAIALGHPLGASGARLMATLVHEMERSGSRYGLQTMCEGGGMANATIIERLA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
5 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
6 2626541554 Frankia sp. AvcI.1 Isolate Nodule
7 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
8 2643221576 Nocardioides sp. Root614 Isolate Unclassified
9 2643221580 Devosia sp. Root635 Isolate Unclassified
10 2643221590 Nocardioides sp. Root682 Isolate Unclassified
11 2643221604 Nocardioides sp. Root190 Isolate Unclassified
12 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
13 2643221615 Nocardioides sp. Root224 Isolate Unclassified
14 2643221617 Nocardioides sp. Root79 Isolate Unclassified
15 2643221620 Nocardioides sp. Root240 Isolate Unclassified
16 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
17 2643221670 Streptomyces sp. Root431 Isolate Unclassified
18 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
19 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
20 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
21 2671180195 Frankia sp. CcI49 Isolate Nodule
22 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
23 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
24 2738541305 Nocardioides sp. CF167 Isolate Unclassified
25 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
26 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
27 2773857922 Frankia sp. CcI49 Isolate Nodule
28 2773857933 Frankia sp. BMG5.30 Isolate Nodule
29 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
30 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
31 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
32 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
33 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
34 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
35 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
36 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
37 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
38 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
39 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
40 2862574272 Streptomyces sp. AcE210 Isolate Nodule
41 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
42 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
43 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
44 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
45 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
46 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
47 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
48 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
49 2919395869 Microbacterium resistens 2980 Isolate Unclassified
50 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
51 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
52 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
53 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
54 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
55 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
56 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
59 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
75 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
80 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
81 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
84 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
85 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
86 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
89 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
90 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
97 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
98 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
99 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
100 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
101 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
102 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
103 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
104 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
105 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
106 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
107 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
115 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
116 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
125 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
127 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
128 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
129 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
136 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
137 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
139 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
140 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
141 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
142 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
143 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
144 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
145 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
146 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
147 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
148 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
149 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
150 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
152 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
168 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
169 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
170 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
171 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
172 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
173 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
179 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
180 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
181 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
182 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
246 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
251 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
252 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
253 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
254 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
255 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
256 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
257 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
259 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
262 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
263 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
267 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
268 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
271 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
274 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
275 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
276 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
277 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
278 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
279 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
280 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
281 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
282 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
289 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
296 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
297 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
298 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
299 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
300 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
301 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
302 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
303 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
304 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
307 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
308 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
309 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
310 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
311 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
312 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
313 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
314 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
315 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
316 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
317 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
318 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
319 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
320 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
321 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
322 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
323 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
327 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
336 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
340 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
341 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
344 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
345 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
346 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
347 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
348 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
352 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
353 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
354 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
358 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
359 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
364 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
365 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
366 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
367 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
368 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
371 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
372 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
373 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
374 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
375 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
376 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
377 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
378 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
379 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
380 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
381 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
382 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
383 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
384 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
385 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
386 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
387 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
388 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
389 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
390 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
391 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
394 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
395 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
396 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
397 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
398 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
399 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
400 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
401 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
402 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
403 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
404 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
405 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
406 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
407 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
408 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
409 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
410 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
413 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
433 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
434 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
435 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
436 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
437 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
438 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
439 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
440 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
441 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
442 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
443 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
444 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
445 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
446 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
450 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
451 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
452 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
453 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
454 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
455 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
456 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
457 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
460 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
461 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
462 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
463 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
464 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
465 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
466 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
467 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
468 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
469 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
470 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
471 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
472 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
473 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
474 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
475 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
476 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
477 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
478 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
479 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
485 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
486 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
487 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
488 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.48
Metatranscriptomes 0.35
Isolates 4.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.14
Nodule 0.64
Rhizoplane 5.58
Rhizosphere 78.18
Stem 0
Stem Tuber 0
Unclassified 9.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_234738 2162886007 Bacteria 74037
2 JGI24752J21851_1000016 3300001976 Bacteria 19236
3 JGI25406J46586_10001652 3300003203 Bacteria 10526
4 JGI25406J46586_10042249 3300003203 Bacteria 1598
5 JGI25407J50210_10001942 3300003373 Bacteria 4800
6 JGI25407J50210_10008386 3300003373 Bacteria 2605
7 JGI25407J50210_10017589 3300003373 Bacteria 1856
8 Ga0006562J51391_1026012 3300003578 Bacteria 17450
9 Ga0006562J51391_1026013 3300003578 Bacteria 9070
10 Ga0055527_1000003 3300003760 Bacteria 705001
11 Ga0055542_1000066 3300003762 Bacteria 154802
12 Ga0055529_1000006 3300003763 Bacteria 416978
13 Ga0055536_1000120 3300003781 Bacteria 68066
14 Ga0055536_1002455 3300003781 Bacteria 10404
15 Ga0055536_1003250 3300003781 Bacteria 8806
16 Ga0055530_10004423 3300003791 Bacteria 7232
17 Ga0055531_10001056 3300003794 Bacteria 21694
18 Ga0065704_10000463 3300005289 Bacteria 20938
19 Ga0065704_10070166 3300005289 Bacteria 176609
20 Ga0070676_10050975 3300005328 Bacteria 2429
21 Ga0070683_100046776 3300005329 Bacteria 3998
22 Ga0070670_100063134 3300005331 Bacteria 3179
23 Ga0068869_100112712 3300005334 Bacteria 2071
24 Ga0070666_10017054 3300005335 Bacteria 4652
25 Ga0070666_10017345 3300005335 Bacteria 4615
26 Ga0070666_10087702 3300005335 Bacteria 2133
27 Ga0070680_100036780 3300005336 Bacteria 3955
28 Ga0070680_100061972 3300005336 Bacteria 3062
29 Ga0068868_100015846 3300005338 Bacteria 5585
30 Ga0068868_100057974 3300005338 Bacteria 3060
31 Ga0070660_100200036 3300005339 Bacteria 1620
32 Ga0070691_10037150 3300005341 Bacteria 2297
33 Ga0070692_10018697 3300005345 Bacteria 3336
34 Ga0070668_100001679 3300005347 Bacteria 16043
35 Ga0070668_100018380 3300005347 Bacteria 5248
36 Ga0070668_100052643 3300005347 Bacteria 3138
37 Ga0070668_100078046 3300005347 Bacteria 2589
38 Ga0070668_100131986 3300005347 Bacteria 2005
39 Ga0070669_100000199 3300005353 Bacteria 52239
40 Ga0070669_100001309 3300005353 Bacteria 17967
41 Ga0070675_100294787 3300005354 Bacteria 1428
42 Ga0070671_100001302 3300005355 Bacteria 18731
43 Ga0070671_100003136 3300005355 Bacteria 12877
44 Ga0070671_100020311 3300005355 Bacteria 5416
45 Ga0070671_100236961 3300005355 Bacteria 1549
46 Ga0070674_100106223 3300005356 Bacteria 2054
47 Ga0070688_100069407 3300005365 Bacteria 2250
48 Ga0070667_100036976 3300005367 Bacteria 4093
49 Ga0070667_100037134 3300005367 Bacteria 4084
50 Ga0070667_100138603 3300005367 Bacteria 2128
51 Ga0070709_10000415 3300005434 Bacteria 25969
52 Ga0070709_10036118 3300005434 Bacteria 3008
53 Ga0070709_10059647 3300005434 Bacteria 2423
54 Ga0070714_100013426 3300005435 Bacteria 6564
55 Ga0070714_100016670 3300005435 Bacteria 5938
56 Ga0070714_100023393 3300005435 Bacteria 5075
57 Ga0070714_100084032 3300005435 Bacteria 2777
58 Ga0070714_100085394 3300005435 Bacteria 2756
59 Ga0070714_100160512 3300005435 Bacteria 2033
60 Ga0070714_100294540 3300005435 Bacteria 1511
61 Ga0070714_100299429 3300005435 Bacteria 1499
62 Ga0070714_100313261 3300005435 Bacteria 1466
63 Ga0070713_100001671 3300005436 Bacteria 14261
64 Ga0070713_100003202 3300005436 Bacteria 10776
65 Ga0070713_100004967 3300005436 Bacteria 9030
66 Ga0070713_100030858 3300005436 Bacteria 4262
67 Ga0070713_100036605 3300005436 Bacteria 3961
68 Ga0070713_100074784 3300005436 Bacteria 2871
69 Ga0070713_100083535 3300005436 Bacteria 2730
70 Ga0070713_100084413 3300005436 Bacteria 2717
71 Ga0070713_100107375 3300005436 Bacteria 2428
72 Ga0070713_100153057 3300005436 Bacteria 2053
73 Ga0070713_100205191 3300005436 Bacteria 1782
74 Ga0070710_10008731 3300005437 Bacteria 4942
75 Ga0070710_10050450 3300005437 Bacteria 2333
76 Ga0070711_100006415 3300005439 Bacteria 7094
77 Ga0070711_100006917 3300005439 Bacteria 6877
78 Ga0070711_100011664 3300005439 Bacteria 5462
79 Ga0070711_100022978 3300005439 Bacteria 4049
80 Ga0070705_100027206 3300005440 Bacteria 3121
81 Ga0070705_100110883 3300005440 Bacteria 1753
82 Ga0070694_100027435 3300005444 Bacteria 3698
83 Ga0070708_100000349 3300005445 Bacteria 34913
84 Ga0070708_100000533 3300005445 Bacteria 28660
85 Ga0070708_100000666 3300005445 Bacteria 26039
86 Ga0070708_100000690 3300005445 Bacteria 25675
87 Ga0070708_100001311 3300005445 Bacteria 19055
88 Ga0070708_100002162 3300005445 Bacteria 15182
89 Ga0070708_100002598 3300005445 Bacteria 13966
90 Ga0070708_100005982 3300005445 Bacteria 9671
91 Ga0070708_100010514 3300005445 Bacteria 7502
92 Ga0070708_100013121 3300005445 Bacteria 6779
93 Ga0070708_100014032 3300005445 Bacteria 6582
94 Ga0070708_100022101 3300005445 Bacteria 5392
95 Ga0070708_100024160 3300005445 Bacteria 5177
96 Ga0070708_100043431 3300005445 Bacteria 3950
97 Ga0070708_100044355 3300005445 Bacteria 3910
98 Ga0070708_100077002 3300005445 Bacteria 3013
99 Ga0070708_100087507 3300005445 Bacteria 2831
100 Ga0070708_100098963 3300005445 Bacteria 2667
101 Ga0070708_100110460 3300005445 Bacteria 2526
102 Ga0070708_100130369 3300005445 Bacteria 2326
103 Ga0070708_100251797 3300005445 Bacteria 1659
104 Ga0070708_100326978 3300005445 Bacteria 1444
105 Ga0070663_100230046 3300005455 Bacteria 1459
106 Ga0070678_100159455 3300005456 Bacteria 1826
107 Ga0070662_100014694 3300005457 Bacteria 5233
108 Ga0070662_100030835 3300005457 Bacteria 3756
109 Ga0070681_10035708 3300005458 Bacteria 4992
110 Ga0070681_10056306 3300005458 Bacteria 3914
111 Ga0070681_10063857 3300005458 Bacteria 3655
112 Ga0070681_10067382 3300005458 Bacteria 3548
113 Ga0070681_10072624 3300005458 Bacteria 3403
114 Ga0068867_100118258 3300005459 Bacteria 2044
115 Ga0070706_100000135 3300005467 Bacteria 92156
116 Ga0070706_100000468 3300005467 Bacteria 47895
117 Ga0070706_100001386 3300005467 Bacteria 25687
118 Ga0070706_100003646 3300005467 Bacteria 15071
119 Ga0070706_100006569 3300005467 Bacteria 10972
120 Ga0070706_100010529 3300005467 Bacteria 8584
121 Ga0070706_100058229 3300005467 Bacteria 3566
122 Ga0070706_100147947 3300005467 Bacteria 2193
123 Ga0070706_100240939 3300005467 Bacteria 1689
124 Ga0070707_100001184 3300005468 Bacteria 25664
125 Ga0070707_100002591 3300005468 Bacteria 17175
126 Ga0070707_100005919 3300005468 Bacteria 11411
127 Ga0070707_100022895 3300005468 Bacteria 5907
128 Ga0070707_100061260 3300005468 Bacteria 3608
129 Ga0070707_100072303 3300005468 Bacteria 3324
130 Ga0070707_100089632 3300005468 Bacteria 2976
131 Ga0070707_100133679 3300005468 Bacteria 2413
132 Ga0070707_100149077 3300005468 Bacteria 2277
133 Ga0070707_100214531 3300005468 Bacteria 1875
134 Ga0070698_100001196 3300005471 Bacteria 28804
135 Ga0070698_100022951 3300005471 Bacteria 6524
136 Ga0070698_100032401 3300005471 Bacteria 5414
137 Ga0070698_100033429 3300005471 Bacteria 5327
138 Ga0070698_100048615 3300005471 Bacteria 4334
139 Ga0070698_100053945 3300005471 Bacteria 4083
140 Ga0070698_100090061 3300005471 Bacteria 3051
141 Ga0070698_100132234 3300005471 Bacteria 2450
142 Ga0070698_100149232 3300005471 Bacteria 2286
143 Ga0070699_100001383 3300005518 Bacteria 22291
144 Ga0070699_100006603 3300005518 Bacteria 10085
145 Ga0070699_100013622 3300005518 Bacteria 7001
146 Ga0070699_100133860 3300005518 Bacteria 2186
147 Ga0070699_100237630 3300005518 Bacteria 1625
148 Ga0070699_100248637 3300005518 Bacteria 1588
149 Ga0070699_100361392 3300005518 Bacteria 1309
150 Ga0070679_100024392 3300005530 Bacteria 5925
151 Ga0070679_100073779 3300005530 Bacteria 3403
152 Ga0070684_100065731 3300005535 Bacteria 3184
153 Ga0070684_100187761 3300005535 Bacteria 1880
154 Ga0070697_100000009 3300005536 Bacteria 181121
155 Ga0070697_100016676 3300005536 Bacteria 5778
156 Ga0070697_100031234 3300005536 Bacteria 4283
157 Ga0070697_100075680 3300005536 Bacteria 2768
158 Ga0070697_100190997 3300005536 Bacteria 1738
159 Ga0070697_100202062 3300005536 Bacteria 1689
160 Ga0070697_100215866 3300005536 Bacteria 1634
161 Ga0070697_100234357 3300005536 Bacteria 1566
162 Ga0068853_100057914 3300005539 Bacteria 3344
163 Ga0068853_100188779 3300005539 Bacteria 1871
164 Ga0070672_100125493 3300005543 Bacteria 2105
165 Ga0070672_100304138 3300005543 Bacteria 1352
166 Ga0070695_100065244 3300005545 Bacteria 2370
167 Ga0070696_100042987 3300005546 Bacteria 3125
168 Ga0070693_100018180 3300005547 Bacteria 3667
169 Ga0070665_100000163 3300005548 Bacteria 121320
170 Ga0070665_100001693 3300005548 Bacteria 25360
171 Ga0070665_100056477 3300005548 Bacteria 3936
172 Ga0070665_100072091 3300005548 Bacteria 3462
173 Ga0070704_100000858 3300005549 Bacteria 15201
174 Ga0070704_100006236 3300005549 Bacteria 7014
175 Ga0070704_100030090 3300005549 Bacteria 3634
176 Ga0068855_100063559 3300005563 Bacteria 4307
177 Ga0068855_100111522 3300005563 Bacteria 3140
178 Ga0068855_100205411 3300005563 Bacteria 2216
179 Ga0068855_100288539 3300005563 Bacteria 1820
180 Ga0068854_100005717 3300005578 Bacteria 7860
181 Ga0068856_100033050 3300005614 Bacteria 5065
182 Ga0068856_100066302 3300005614 Bacteria 3568
183 Ga0068856_100148439 3300005614 Bacteria 2352
184 Ga0068856_100290463 3300005614 Bacteria 1652
185 Ga0070702_100014359 3300005615 Bacteria 4017
186 Ga0068864_100161695 3300005618 Bacteria 2036
187 Ga0068864_100185407 3300005618 Bacteria 1904
188 Ga0068866_10012232 3300005718 Bacteria 3738
189 Ga0068866_10012771 3300005718 Bacteria 3666
190 Ga0068861_100006004 3300005719 Bacteria 8255
191 Ga0068861_100017995 3300005719 Bacteria 5026
192 Ga0068861_100057942 3300005719 Bacteria 2960
193 Ga0068851_10002905 3300005834 Bacteria 7569
194 Ga0068870_10057281 3300005840 Bacteria 2083
195 Ga0068863_100005713 3300005841 Bacteria 12212
196 Ga0068863_100036931 3300005841 Bacteria 4651
197 Ga0068858_100000071 3300005842 Bacteria 105192
198 Ga0068858_100016152 3300005842 Bacteria 7013
199 Ga0068858_100185205 3300005842 Bacteria 1967
200 Ga0068860_100001767 3300005843 Bacteria 23066
201 Ga0068860_100120828 3300005843 Bacteria 2508
202 Ga0068862_100000254 3300005844 Bacteria 59824
203 Ga0068862_100011608 3300005844 Bacteria 7268
204 Ga0068862_100020840 3300005844 Bacteria 5475
205 Ga0081455_10001381 3300005937 Bacteria 30015
206 Ga0081455_10032862 3300005937 Bacteria 4669
207 Ga0081455_10058023 3300005937 Bacteria 3278
208 Ga0081455_10149670 3300005937 Bacteria 1801
209 Ga0081538_10000174 3300005981 Bacteria 69374
210 Ga0081538_10000273 3300005981 Bacteria 59166
211 Ga0081538_10000644 3300005981 Bacteria 38607
212 Ga0081538_10001092 3300005981 Bacteria 28732
213 Ga0081538_10002697 3300005981 Bacteria 17076
214 Ga0081538_10005256 3300005981 Bacteria 11693
215 Ga0081538_10007825 3300005981 Bacteria 9168
216 Ga0081538_10029706 3300005981 Bacteria 3728
217 Ga0081540_1045757 3300005983 Bacteria 2217
218 Ga0081539_10000257 3300005985 Bacteria 122507
219 Ga0081539_10000515 3300005985 Bacteria 80495
220 Ga0081539_10001117 3300005985 Bacteria 48683
221 Ga0081539_10012766 3300005985 Bacteria 6419
222 Ga0081539_10080679 3300005985 Bacteria 1711
223 Ga0070717_10000453 3300006028 Bacteria 25968
224 Ga0070717_10003196 3300006028 Bacteria 11704
225 Ga0070717_10004815 3300006028 Bacteria 9816
226 Ga0070717_10020785 3300006028 Bacteria 5167
227 Ga0070717_10021370 3300006028 Bacteria 5099
228 Ga0070717_10023206 3300006028 Bacteria 4913
229 Ga0070717_10059942 3300006028 Bacteria 3150
230 Ga0070717_10059974 3300006028 Bacteria 3149
231 Ga0070717_10233749 3300006028 Bacteria 1619
232 Ga0070717_10315613 3300006028 Bacteria 1392
233 Ga0075365_10000969 3300006038 Bacteria 12210
234 Ga0075365_10006322 3300006038 Bacteria 6505
235 Ga0075365_10018126 3300006038 Bacteria 4322
236 Ga0075365_10064373 3300006038 Bacteria 2456
237 Ga0075365_10088182 3300006038 Bacteria 2110
238 Ga0075365_10111027 3300006038 Bacteria 1884
239 Ga0075365_10176986 3300006038 Bacteria 1490
240 Ga0075368_10003879 3300006042 Bacteria 5032
241 Ga0075368_10011082 3300006042 Bacteria 3275
242 Ga0075368_10017362 3300006042 Bacteria 2693
243 Ga0075363_100000514 3300006048 Bacteria 12426
244 Ga0075363_100001165 3300006048 Bacteria 9649
245 Ga0075363_100079046 3300006048 Bacteria 1796
246 Ga0075364_10002900 3300006051 Bacteria 9670
247 Ga0075364_10004132 3300006051 Bacteria 8330
248 Ga0075364_10009982 3300006051 Bacteria 5717
249 Ga0075364_10029926 3300006051 Bacteria 3494
250 Ga0075364_10066542 3300006051 Bacteria 2367
251 Ga0070715_10000618 3300006163 Bacteria 9385
252 Ga0070715_10011430 3300006163 Bacteria 3198
253 Ga0070715_10011734 3300006163 Bacteria 3164
254 Ga0070716_100010802 3300006173 Bacteria 4590
255 Ga0070716_100053469 3300006173 Bacteria 2303
256 Ga0070712_100002095 3300006175 Bacteria 12257
257 Ga0075367_10000707 3300006178 Bacteria 12885
258 Ga0075367_10009026 3300006178 Bacteria 5193
259 Ga0075367_10011633 3300006178 Bacteria 4666
260 Ga0075367_10072633 3300006178 Bacteria 2072
261 Ga0075369_10007018 3300006186 Bacteria 4279
262 Ga0097621_100016928 3300006237 Bacteria 5526
263 Ga0068871_100010527 3300006358 Bacteria 6756
264 Ga0075428_100000070 3300006844 Bacteria 82370
265 Ga0075430_100003589 3300006846 Bacteria 13003
266 Ga0075430_100130981 3300006846 Bacteria 2090
267 Ga0075430_100238670 3300006846 Bacteria 1506
268 Ga0075431_100002904 3300006847 Bacteria 16579
269 Ga0075431_100039886 3300006847 Bacteria 4838
270 Ga0075433_10079860 3300006852 Bacteria 2883
271 Ga0075433_10226758 3300006852 Bacteria 1659
272 Ga0075434_100031972 3300006871 Bacteria 5188
273 Ga0075434_100143393 3300006871 Bacteria 2409
274 Ga0075434_100201022 3300006871 Bacteria 2013
275 Ga0075429_100000389 3300006880 Bacteria 32222
276 Ga0075429_100033137 3300006880 Bacteria 4488
277 Ga0068865_100038199 3300006881 Bacteria 3248
278 Ga0075435_100005151 3300007076 Bacteria 9087
279 Ga0075435_100041182 3300007076 Bacteria 3692
280 Ga0075435_100042206 3300007076 Bacteria 3649
281 Ga0075435_100081727 3300007076 Bacteria 2654
282 Ga0075435_100215259 3300007076 Bacteria 1630
283 Ga0099794_10008996 3300007265 Bacteria 4169
284 Ga0099794_10014117 3300007265 Bacteria 3493
285 Ga0105251_10001177 3300009011 Bacteria 22695
286 Ga0105251_10012618 3300009011 Bacteria 4775
287 Ga0105240_10015604 3300009093 Bacteria 10321
288 Ga0105240_10035668 3300009093 Bacteria 6408
289 Ga0105240_10132149 3300009093 Bacteria 2993
290 Ga0105240_10356924 3300009093 Bacteria 1657
291 Ga0105240_10465368 3300009093 Bacteria 1412
292 Ga0111539_10008219 3300009094 Bacteria 13281
293 Ga0111539_10118457 3300009094 Bacteria 3104
294 Ga0111539_10163403 3300009094 Bacteria 2604
295 Ga0105245_10001993 3300009098 Bacteria 18544
296 Ga0105245_10013559 3300009098 Bacteria 7100
297 Ga0105245_10045220 3300009098 Bacteria 3931
298 Ga0105245_10085193 3300009098 Bacteria 2896
299 Ga0105245_10419579 3300009098 Bacteria 1341
300 Ga0105247_10000098 3300009101 Bacteria 94446
301 Ga0105247_10092368 3300009101 Bacteria 1922
302 Ga0114129_10035947 3300009147 Bacteria 6996
303 Ga0114129_10121412 3300009147 Bacteria 3595
304 Ga0114129_10193253 3300009147 Bacteria 2762
305 Ga0114129_10358109 3300009147 Bacteria 1931
306 Ga0114129_10360900 3300009147 Bacteria 1922
307 Ga0114129_10362527 3300009147 Bacteria 1917
308 Ga0105243_10000837 3300009148 Bacteria 29254
309 Ga0105243_10001220 3300009148 Bacteria 23146
310 Ga0105243_10050562 3300009148 Bacteria 3284
311 Ga0105243_10229896 3300009148 Bacteria 1645
312 Ga0105241_10040303 3300009174 Bacteria 3526
313 Ga0105241_10242565 3300009174 Bacteria 1524
314 Ga0105242_10003317 3300009176 Bacteria 12520
315 Ga0105248_10001028 3300009177 Bacteria 30880
316 Ga0105248_10007376 3300009177 Bacteria 12073
317 Ga0105248_10009163 3300009177 Bacteria 10886
318 Ga0105248_10035549 3300009177 Bacteria 5574
319 Ga0105248_10038628 3300009177 Bacteria 5343
320 Ga0105248_10103710 3300009177 Bacteria 3206
321 Ga0105248_10140684 3300009177 Bacteria 2722
322 Ga0105237_10050231 3300009545 Bacteria 4190
323 Ga0105237_10283529 3300009545 Bacteria 1659
324 Ga0105238_10031880 3300009551 Bacteria 5363
325 Ga0105249_10003362 3300009553 Bacteria 13843
326 Ga0105028_102375 3300009993 Bacteria 1976
327 Ga0105239_10009458 3300010375 Bacteria 10983
328 Ga0105239_10043946 3300010375 Bacteria 4900
329 Ga0105239_10049347 3300010375 Bacteria 4616
330 Ga0105246_10019387 3300011119 Bacteria 4345
331 Ga0157371_10176806 3300013102 Bacteria 1526
332 Ga0157370_10069263 3300013104 Bacteria 3332
333 Ga0157369_10045142 3300013105 Bacteria 4794
334 Ga0157369_10066535 3300013105 Bacteria 3876
335 Ga0157369_10135495 3300013105 Bacteria 2607
336 Ga0157374_10024852 3300013296 Bacteria 5373
337 Ga0157374_10119235 3300013296 Bacteria 2545
338 Ga0157374_10426328 3300013296 Bacteria 1326
339 Ga0157378_10006762 3300013297 Bacteria 10020
340 Ga0163162_10166944 3300013306 Bacteria 2325
341 Ga0157372_10233349 3300013307 Bacteria 2133
342 Ga0157375_10242880 3300013308 Bacteria 1960
343 Ga0163163_10036377 3300014325 Bacteria 4782
344 Ga0163163_10050489 3300014325 Bacteria 4096
345 Ga0157380_10000641 3300014326 Bacteria 21588
346 Ga0157380_10187239 3300014326 Bacteria 1824
347 Ga0157379_10000015 3300014968 Bacteria 104289
348 Ga0157379_10003142 3300014968 Bacteria 13972
349 Ga0157379_10012452 3300014968 Bacteria 7428
350 Ga0157379_10012814 3300014968 Bacteria 7332
351 Ga0157379_10030912 3300014968 Bacteria 4769
352 Ga0157376_10100812 3300014969 Bacteria 2522
353 Ga0157376_10104047 3300014969 Bacteria 2487
354 Ga0157376_10362631 3300014969 Bacteria 1390
355 Ga0163161_10001576 3300017792 Bacteria 16816
356 Ga0163161_10002689 3300017792 Bacteria 12638
357 Ga0206354_10723939 3300020081 Bacteria 1302
358 Ga0213874_10001931 3300021377 Bacteria 4364
359 Ga0213876_10001603 3300021384 Bacteria 13888
360 Ga0213876_10013319 3300021384 Bacteria 4371
361 Ga0213876_10020134 3300021384 Bacteria 3525
362 Ga0213876_10129089 3300021384 Bacteria 1343
363 Ga0224712_10053583 3300022467 Bacteria 1580
364 Ga0224572_1001046 3300024225 Bacteria 3855
365 Ga0224572_1003464 3300024225 Bacteria 2663
366 Ga0209672_100003 3300025228 Bacteria 1560476
367 Ga0209147_100287 3300025229 Bacteria 42863
368 Ga0209148_1000004 3300025254 Bacteria 1844481
369 Ga0209455_1000046 3300025272 Bacteria 382681
370 Ga0209676_1000043 3300025292 Bacteria 418680
371 Ga0209676_1000081 3300025292 Bacteria 285297
372 Ga0209676_1001430 3300025292 Bacteria 22561
373 Ga0209050_1001461 3300025298 Bacteria 25284
374 Ga0209050_1001802 3300025298 Bacteria 20966
375 Ga0209050_1031396 3300025298 Bacteria 1656
376 Ga0209051_1002052 3300025303 Bacteria 15280
377 Ga0209257_1000134 3300025304 Bacteria 207628
378 Ga0209257_1004322 3300025304 Bacteria 11148
379 Ga0207713_1000436 3300025735 Bacteria 43987
380 Ga0207710_10000065 3300025900 Bacteria 154842
381 Ga0207710_10000115 3300025900 Bacteria 99626
382 Ga0207710_10000210 3300025900 Bacteria 53899
383 Ga0207710_10027973 3300025900 Bacteria 2445
384 Ga0207688_10000775 3300025901 Bacteria 15896
385 Ga0207680_10049043 3300025903 Bacteria 2511
386 Ga0207680_10144248 3300025903 Bacteria 1581
387 Ga0207680_10163068 3300025903 Bacteria 1496
388 Ga0207685_10003364 3300025905 Bacteria 3879
389 Ga0207699_10000059 3300025906 Bacteria 94698
390 Ga0207699_10018644 3300025906 Bacteria 3682
391 Ga0207699_10180315 3300025906 Bacteria 1419
392 Ga0207645_10001237 3300025907 Bacteria 21011
393 Ga0207643_10063592 3300025908 Bacteria 2110
394 Ga0207684_10000003 3300025910 Bacteria 766933
395 Ga0207684_10000046 3300025910 Bacteria 251569
396 Ga0207684_10000165 3300025910 Bacteria 111682
397 Ga0207684_10000936 3300025910 Bacteria 32980
398 Ga0207684_10001807 3300025910 Bacteria 22392
399 Ga0207684_10003142 3300025910 Bacteria 16265
400 Ga0207684_10003336 3300025910 Bacteria 15755
401 Ga0207684_10008463 3300025910 Bacteria 9155
402 Ga0207684_10010250 3300025910 Bacteria 8249
403 Ga0207684_10013997 3300025910 Bacteria 6930
404 Ga0207684_10074978 3300025910 Bacteria 2875
405 Ga0207684_10102360 3300025910 Bacteria 2449
406 Ga0207684_10171628 3300025910 Bacteria 1869
407 Ga0207684_10280775 3300025910 Bacteria 1436
408 Ga0207684_10310332 3300025910 Bacteria 1360
409 Ga0207654_10037418 3300025911 Bacteria 2716
410 Ga0207654_10101179 3300025911 Bacteria 1776
411 Ga0207707_10016514 3300025912 Bacteria 6437
412 Ga0207707_10166585 3300025912 Bacteria 1926
413 Ga0207693_10000510 3300025915 Bacteria 35052
414 Ga0207693_10013690 3300025915 Bacteria 6535
415 Ga0207693_10014563 3300025915 Bacteria 6320
416 Ga0207663_10021870 3300025916 Bacteria 3648
417 Ga0207663_10128975 3300025916 Bacteria 1744
418 Ga0207660_10001617 3300025917 Bacteria 15117
419 Ga0207660_10120009 3300025917 Bacteria 1990
420 Ga0207660_10195385 3300025917 Bacteria 1578
421 Ga0207662_10041671 3300025918 Bacteria 2704
422 Ga0207657_10029316 3300025919 Bacteria 5011
423 Ga0207652_10011392 3300025921 Bacteria 7167
424 Ga0207652_10037287 3300025921 Bacteria 4115
425 Ga0207652_10051314 3300025921 Bacteria 3537
426 Ga0207646_10000079 3300025922 Bacteria 129281
427 Ga0207646_10001830 3300025922 Bacteria 25684
428 Ga0207646_10001851 3300025922 Bacteria 25523
429 Ga0207646_10002086 3300025922 Bacteria 23974
430 Ga0207646_10006689 3300025922 Bacteria 11881
431 Ga0207646_10007282 3300025922 Bacteria 11274
432 Ga0207646_10011708 3300025922 Bacteria 8482
433 Ga0207646_10021898 3300025922 Bacteria 5897
434 Ga0207646_10027719 3300025922 Bacteria 5163
435 Ga0207646_10046359 3300025922 Bacteria 3899
436 Ga0207646_10052652 3300025922 Bacteria 3643
437 Ga0207646_10056126 3300025922 Bacteria 3521
438 Ga0207646_10075914 3300025922 Bacteria 3003
439 Ga0207646_10089073 3300025922 Bacteria 2762
440 Ga0207646_10138431 3300025922 Bacteria 2192
441 Ga0207646_10143856 3300025922 Bacteria 2148
442 Ga0207681_10001702 3300025923 Bacteria 14143
443 Ga0207681_10001754 3300025923 Bacteria 13928
444 Ga0207681_10103268 3300025923 Bacteria 2060
445 Ga0207694_10024082 3300025924 Bacteria 4623
446 Ga0207694_10099575 3300025924 Bacteria 2302
447 Ga0207694_10231959 3300025924 Bacteria 1507
448 Ga0207650_10039654 3300025925 Bacteria 3442
449 Ga0207650_10249165 3300025925 Bacteria 1438
450 Ga0207659_10251203 3300025926 Bacteria 1435
451 Ga0207687_10006821 3300025927 Bacteria 7522
452 Ga0207687_10095658 3300025927 Bacteria 2175
453 Ga0207700_10001583 3300025928 Bacteria 12923
454 Ga0207700_10008954 3300025928 Bacteria 6231
455 Ga0207700_10082518 3300025928 Bacteria 2514
456 Ga0207700_10092464 3300025928 Bacteria 2391
457 Ga0207700_10102464 3300025928 Bacteria 2286
458 Ga0207664_10052865 3300025929 Bacteria 3214
459 Ga0207664_10055572 3300025929 Bacteria 3142
460 Ga0207664_10068716 3300025929 Bacteria 2847
461 Ga0207664_10137394 3300025929 Bacteria 2064
462 Ga0207644_10005491 3300025931 Bacteria 8256
463 Ga0207644_10016838 3300025931 Bacteria 4924
464 Ga0207644_10022539 3300025931 Bacteria 4304
465 Ga0207690_10068110 3300025932 Bacteria 2444
466 Ga0207706_10002030 3300025933 Bacteria 19845
467 Ga0207706_10008905 3300025933 Bacteria 9238
468 Ga0207706_10020512 3300025933 Bacteria 5940
469 Ga0207686_10000728 3300025934 Bacteria 20416
470 Ga0207709_10000029 3300025935 Bacteria 333327
471 Ga0207709_10003047 3300025935 Bacteria 10152
472 Ga0207709_10024077 3300025935 Bacteria 3473
473 Ga0207704_10038565 3300025938 Bacteria 2772
474 Ga0207704_10104236 3300025938 Bacteria 1899
475 Ga0207665_10001502 3300025939 Bacteria 15679
476 Ga0207665_10001555 3300025939 Bacteria 15458
477 Ga0207665_10005098 3300025939 Bacteria 8769
478 Ga0207691_10001275 3300025940 Bacteria 25192
479 Ga0207691_10020316 3300025940 Bacteria 6279
480 Ga0207691_10101701 3300025940 Bacteria 2564
481 Ga0207691_10170400 3300025940 Bacteria 1906
482 Ga0207711_10000385 3300025941 Bacteria 46717
483 Ga0207711_10001851 3300025941 Bacteria 19297
484 Ga0207711_10005140 3300025941 Bacteria 11092
485 Ga0207711_10049586 3300025941 Bacteria 3594
486 Ga0207711_10150222 3300025941 Bacteria 2101
487 Ga0207661_10015243 3300025944 Bacteria 5651
488 Ga0207667_10026130 3300025949 Bacteria 6383
489 Ga0207667_10130530 3300025949 Bacteria 2588
490 Ga0207667_10452242 3300025949 Bacteria 1305
491 Ga0207651_10106329 3300025960 Bacteria 2095
492 Ga0207712_10001928 3300025961 Bacteria 13642
493 Ga0207712_10041248 3300025961 Bacteria 3171
494 Ga0207712_10044475 3300025961 Bacteria 3069
495 Ga0207712_10128197 3300025961 Bacteria 1929
496 Ga0207668_10001606 3300025972 Bacteria 13190
497 Ga0207668_10003751 3300025972 Bacteria 8946
498 Ga0207668_10012138 3300025972 Bacteria 5265
499 Ga0207668_10060220 3300025972 Bacteria 2664
500 Ga0207640_10231665 3300025981 Bacteria 1421
501 Ga0207658_10011684 3300025986 Bacteria 5978
502 Ga0207677_10036659 3300026023 Bacteria 3199
503 Ga0207703_10000021 3300026035 Bacteria 247414
504 Ga0207703_10000094 3300026035 Bacteria 104297
505 Ga0207703_10128595 3300026035 Bacteria 2184
506 Ga0207639_10027426 3300026041 Bacteria 4150
507 Ga0207639_10110355 3300026041 Bacteria 2240
508 Ga0207678_10043812 3300026067 Bacteria 3872
509 Ga0207702_10046622 3300026078 Bacteria 3649
510 Ga0207702_10067266 3300026078 Bacteria 3074
511 Ga0207702_10236090 3300026078 Bacteria 1711
512 Ga0207702_10267283 3300026078 Bacteria 1612
513 Ga0207641_10005772 3300026088 Bacteria 10509
514 Ga0207641_10029494 3300026088 Bacteria 4537
515 Ga0207648_10006902 3300026089 Bacteria 11248
516 Ga0207648_10035426 3300026089 Bacteria 4397
517 Ga0207648_10073321 3300026089 Bacteria 2984
518 Ga0207648_10209177 3300026089 Bacteria 1731
519 Ga0207676_10081198 3300026095 Bacteria 2634
520 Ga0207675_100003148 3300026118 Bacteria 16183
521 Ga0207675_100007183 3300026118 Bacteria 10523
522 Ga0207675_100023017 3300026118 Bacteria 5795
523 Ga0207683_10000798 3300026121 Bacteria 28764
524 Ga0207683_10035867 3300026121 Bacteria 4314
525 Ga0207683_10146554 3300026121 Bacteria 2129
526 Ga0207698_10047547 3300026142 Bacteria 3251
527 Ga0209983_1000778 3300027665 Bacteria 6936
528 Ga0209971_1001080 3300027682 Bacteria 6932
529 Ga0209998_10000369 3300027717 Bacteria 13058
530 Ga0209813_10000868 3300027866 Bacteria 6808
531 Ga0209813_10007776 3300027866 Bacteria 2682
532 Ga0209974_10000695 3300027876 Bacteria 11471
533 Ga0268266_10000205 3300028379 Bacteria 103915
534 Ga0268266_10001878 3300028379 Bacteria 23728
535 Ga0268266_10237346 3300028379 Bacteria 1681
536 Ga0268265_10000273 3300028380 Bacteria 58609
537 Ga0268265_10018226 3300028380 Bacteria 4862
538 Ga0268265_10428184 3300028380 Bacteria 1230
539 Ga0268264_10039797 3300028381 Bacteria 3884
540 Ga0268264_10099798 3300028381 Bacteria 2520
541 Ga0265336_10016311 3300028666 Bacteria 2430
542 Ga0307517_10013216 3300028786 Bacteria 11240
543 Ga0307517_10153658 3300028786 Bacteria 1570
544 Ga0307515_10001941 3300028794 Bacteria 45822
545 Ga0307515_10037594 3300028794 Bacteria 7779
546 Ga0265338_10009613 3300028800 Bacteria 11488
547 Ga0265338_10014711 3300028800 Bacteria 8671
548 Ga0265338_10017067 3300028800 Bacteria 7848
549 Ga0307511_10000323 3300030521 Bacteria 50893
550 Ga0307511_10082344 3300030521 Bacteria 2251
551 Ga0307512_10006934 3300030522 Bacteria 11325
552 Ga0316181_1293728 3300030744 Bacteria 1475
553 Ga0265760_10025587 3300031090 Bacteria 1724
554 Ga0265327_10000406 3300031251 Bacteria 79464
555 Ga0265327_10000980 3300031251 Bacteria 40691
556 Ga0265327_10001468 3300031251 Bacteria 29534
557 Ga0265327_10001997 3300031251 Bacteria 23054
558 Ga0265327_10022524 3300031251 Bacteria 3761
559 Ga0265327_10110645 3300031251 Bacteria 1313
560 Ga0307509_10007688 3300031507 Bacteria 13996
561 Ga0307509_10034641 3300031507 Bacteria 5545
562 Ga0307509_10039411 3300031507 Bacteria 5148
563 Ga0307408_100190975 3300031548 Bacteria 1650
564 Ga0307408_100193896 3300031548 Bacteria 1639
565 Ga0316579_10035162 3300031691 Bacteria 2308
566 Ga0316579_10060319 3300031691 Bacteria 1784
567 Ga0316579_10066654 3300031691 Bacteria 1700
568 Ga0316576_10009839 3300031727 Bacteria 6190
569 Ga0316576_10012197 3300031727 Bacteria 5669
570 Ga0316576_10051408 3300031727 Bacteria 2999
571 Ga0316576_10059141 3300031727 Bacteria 2805
572 Ga0316576_10079768 3300031727 Bacteria 2426
573 Ga0316576_10108842 3300031727 Bacteria 2076
574 Ga0316578_10002239 3300031728 Bacteria 8378
575 Ga0316578_10002290 3300031728 Bacteria 8316
576 Ga0307516_10000051 3300031730 Bacteria 129126
577 Ga0307405_10000504 3300031731 Bacteria 14716
578 Ga0307405_10026476 3300031731 Bacteria 3345
579 Ga0307405_10051925 3300031731 Bacteria 2547
580 Ga0307405_10161572 3300031731 Bacteria 1587
581 Ga0316577_10006615 3300031733 Bacteria 6136
582 Ga0307413_10013493 3300031824 Bacteria 4111
583 Ga0307413_10014202 3300031824 Bacteria 4035
584 Ga0307413_10089921 3300031824 Bacteria 1996
585 Ga0307413_10107743 3300031824 Bacteria 1858
586 Ga0307413_10165453 3300031824 Bacteria 1559
587 Ga0307518_10001877 3300031838 Bacteria 15543
588 Ga0307518_10024558 3300031838 Bacteria 4344
589 Ga0307410_10015336 3300031852 Bacteria 4542
590 Ga0307410_10036662 3300031852 Bacteria 3195
591 Ga0307410_10069765 3300031852 Bacteria 2432
592 Ga0307406_10019480 3300031901 Bacteria 3982
593 Ga0307406_10022797 3300031901 Bacteria 3717
594 Ga0307406_10039626 3300031901 Bacteria 2924
595 Ga0307407_10003243 3300031903 Bacteria 6618
596 Ga0307407_10004134 3300031903 Bacteria 6112
597 Ga0307407_10027225 3300031903 Bacteria 3038
598 Ga0307412_10177560 3300031911 Bacteria 1598
599 Ga0307409_100000609 3300031995 Bacteria 15621
600 Ga0307409_100007938 3300031995 Bacteria 6394
601 Ga0307409_100052153 3300031995 Bacteria 3134
602 Ga0307416_100001552 3300032002 Bacteria 12574
603 Ga0307416_100002852 3300032002 Bacteria 10057
604 Ga0307416_100005870 3300032002 Bacteria 7617
605 Ga0307416_100015762 3300032002 Bacteria 5230
606 Ga0307416_100026128 3300032002 Bacteria 4296
607 Ga0307416_100026813 3300032002 Bacteria 4253
608 Ga0307416_100027301 3300032002 Bacteria 4225
609 Ga0307416_100039266 3300032002 Bacteria 3663
610 Ga0307416_100080280 3300032002 Bacteria 2753
611 Ga0307416_100103120 3300032002 Bacteria 2489
612 Ga0307414_10012270 3300032004 Bacteria 5060
613 Ga0307414_10016565 3300032004 Bacteria 4484
614 Ga0307414_10112297 3300032004 Bacteria 2077
615 Ga0307414_10266013 3300032004 Bacteria 1433
616 Ga0307411_10001307 3300032005 Bacteria 10015
617 Ga0307411_10046872 3300032005 Bacteria 2790
618 Ga0307411_10332161 3300032005 Bacteria 1232
619 Ga0307415_100003403 3300032126 Bacteria 8095
620 Ga0307415_100012829 3300032126 Bacteria 4863
621 Ga0307415_100043611 3300032126 Bacteria 2993
622 Ga0307415_100077521 3300032126 Bacteria 2360
623 Ga0307415_100143353 3300032126 Bacteria 1828
624 Ga0307415_100223668 3300032126 Bacteria 1511
625 Ga0316585_10022950 3300032137 Bacteria 1922
626 Ga0316580_10004372 3300032139 Bacteria 4094
627 Ga0316580_10024035 3300032139 Bacteria 1883
628 Ga0307507_10006561 3300033179 Bacteria 17741
629 Ga0307507_10036876 3300033179 Bacteria 4988
630 Ga0307507_10042562 3300033179 Bacteria 4522
631 Ga0307510_10023432 3300033180 Bacteria 7156
632 Ga0373932_0015720 3300035112 Bacteria 1922
633 Ga0373936_0020341 3300035113 Bacteria 2578
634 Ga0373954_0008179 3300035118 Bacteria 4585
635 Ga0373954_0009972 3300035118 Bacteria 4185
636 Ga0373954_0020809 3300035118 Bacteria 2969
637 Ga0373954_0132874 3300035118 Bacteria 1212
638 Ga0373956_0000372 3300035119 Bacteria 18325
639 Ga0373956_0006401 3300035119 Bacteria 4716
640 Ga0373956_0023828 3300035119 Bacteria 2631
641 Ga0373960_0001783 3300035121 Bacteria 4827
642 Ga0373955_0002810 3300035172 Bacteria 7649
643 Ga0373955_0030976 3300035172 Bacteria 2799
644 Ga0316574_0001663 3300035398 Bacteria 10713
645 Ga0316574_0002355 3300035398 Bacteria 9455
646 Ga0316574_0010197 3300035398 Bacteria 5297
647 Ga0316574_0054549 3300035398 Bacteria 2496
648 Ga0316574_0069183 3300035398 Bacteria 2227
649 Ga0316574_0128294 3300035398 Bacteria 1631
650 Ga0316574_0137360 3300035398 Bacteria 1574
651 Ga0373924_0016578 3300035410 Bacteria 2814
652 Ga0373924_0021062 3300035410 Bacteria 2540
653 Ga0373935_0001339 3300035692 Bacteria 13634
654 Ga0373935_0059741 3300035692 Bacteria 2438
655 Ga0373935_0079239 3300035692 Bacteria 2132
656 Ga0373927_0000245 3300035695 Bacteria 42703
657 Ga0373927_0002053 3300035695 Bacteria 14853
658 Ga0373927_0040910 3300035695 Bacteria 3006
659 Ga0373927_0105699 3300035695 Bacteria 1833
660 Ga0373927_0107143 3300035695 Bacteria 1820
661 Ga0373933_0074120 3300035724 Bacteria 2075
662 Ga0373933_0237832 3300035724 Bacteria 1171
663 Ga0373947_0006797 3300035725 Bacteria 6632
664 Ga0373947_0100517 3300035725 Bacteria 1817
665 Ga0373947_0104014 3300035725 Bacteria 1787
666 Ga0373937_0001374 3300036401 Bacteria 20334
667 Ga0373937_0007793 3300036401 Bacteria 9285
668 Ga0373937_0047722 3300036401 Bacteria 3919
669 Ga0373937_0094334 3300036401 Bacteria 2775
670 Ga0373937_0286366 3300036401 Bacteria 1556
671 Ga0373937_0357658 3300036401 Bacteria 1383
672 Ga0373937_0362576 3300036401 Bacteria 1373
673 Ga0316582_0011567 3300036647 Bacteria 4886
674 Ga0316582_0054247 3300036647 Bacteria 2551
675 Ga0316582_0195333 3300036647 Bacteria 1379
676 Ga0316584_0002180 3300036712 Bacteria 12268
677 Ga0316584_0027566 3300036712 Bacteria 4182
678 Ga0316584_0113503 3300036712 Bacteria 2027
679 Ga0316584_0117736 3300036712 Bacteria 1987
680 Ga0373925_0001738 3300037068 Bacteria 18280
681 Ga0373925_0014597 3300037068 Bacteria 5675
682 Ga0373925_0023215 3300037068 Bacteria 4526
683 Ga0373925_0061423 3300037068 Bacteria 2823
684 Ga0373925_0078863 3300037068 Bacteria 2501
685 Ga0373925_0098705 3300037068 Bacteria 2242
686 Ga0395899_0005670 3300037312 Bacteria 9695
687 Ga0395899_0039193 3300037312 Bacteria 3548
688 Ga0395899_0060476 3300037312 Bacteria 2791
689 Ga0395899_0131297 3300037312 Bacteria 1788
690 Ga0395900_0005157 3300037418 Bacteria 13723
691 Ga0395900_0022515 3300037418 Bacteria 6446
692 Ga0395900_0026195 3300037418 Bacteria 5971
693 Ga0395900_0043160 3300037418 Bacteria 4647
694 Ga0395900_0065597 3300037418 Bacteria 3730
695 Ga0395900_0189589 3300037418 Bacteria 2086
696 Ga0395898_0001347 3300037466 Bacteria 35447
697 Ga0395898_0308232 3300037466 Bacteria 1510
698 Ga0436364_0071314 3300037853 Bacteria 11222
699 Ga0436364_0227828 3300037853 Bacteria 3430
700 Ga0436364_0836106 3300037853 Bacteria 2940
701 Ga0395901_0003177 3300038443 Bacteria 16531
702 Ga0395901_0016207 3300038443 Bacteria 7591
703 Ga0395901_0017089 3300038443 Bacteria 7396
704 Ga0395901_0067093 3300038443 Bacteria 3736
705 Ga0395901_0091515 3300038443 Bacteria 3184
706 Ga0395901_0159201 3300038443 Bacteria 2371
707 Ga0395901_0203578 3300038443 Bacteria 2074
708 Ga0395901_0236028 3300038443 Bacteria 1908
709 Ga0395901_0367075 3300038443 Bacteria 1483
710 Ga0400485_06590 3300038735 Bacteria 2122
711 Ga0400483_019236 3300039062 Bacteria 20281
712 Ga0400483_062449 3300039062 Bacteria 34296
713 Ga0400483_064439 3300039062 Bacteria 4249
714 Ga0400483_113982 3300039062 Bacteria 2163
715 Ga0400483_155225 3300039062 Bacteria 28956
716 Ga0400483_223199 3300039062 Bacteria 4740
717 Ga0400483_231711 3300039062 Bacteria 1357
718 Ga0400483_284406 3300039062 Bacteria 4789
719 Ga0436365_0300094 3300039437 Bacteria 4788
720 Ga0436365_0555887 3300039437 Bacteria 4983
721 Ga0436365_1184635 3300039437 Bacteria 10697
722 Ga0436365_1263598 3300039437 Bacteria 19546
723 Ga0436365_1521394 3300039437 Bacteria 14815
724 Ga0436365_1764143 3300039437 Bacteria 2281
725 Ga0436365_1830951 3300039437 Bacteria 10544
726 Ga0436363_1641403 3300039450 Bacteria 2780
727 Ga0436363_1707329 3300039450 Bacteria 5173
728 Ga0436362_0747267 3300039453 Bacteria 4028
729 Ga0439466_0038315 3300041411 Bacteria 1610
730 Ga0451793_1230644 3300041452 Bacteria 3440
731 Ga0451833_0883155 3300041491 Bacteria 9667
732 Ga0451837_0273179 3300041494 Bacteria 6838
733 Ga0439450_000293 3300042008 Bacteria 6204
734 Ga0439454_001128 3300042011 Bacteria 2455
735 Ga0439455_0004175 3300042012 Bacteria 2841
736 Ga0439456_009050 3300042013 Bacteria 2058
737 Ga0439463_000426 3300042016 Bacteria 11745
738 Ga0450905_001621 3300042142 Bacteria 2873
739 Ga0439434_0001600 3300042435 Bacteria 6533
740 Ga0439434_0003242 3300042435 Bacteria 4776
741 Ga0439434_0018890 3300042435 Bacteria 2066
742 Ga0439434_0036091 3300042435 Bacteria 1511
743 Ga0439444_0012243 3300042437 Bacteria 1403
744 Ga0439464_0012368 3300042439 Bacteria 2273
745 Ga0439460_0042584 3300042461 Bacteria 1338
746 Ga0466972_0002652 3300044658 Bacteria 8856
747 Ga0466972_0015963 3300044658 Bacteria 3755
748 Ga0466972_0018954 3300044658 Bacteria 3439
749 Ga0466965_0000829 3300044683 Bacteria 11695
750 Ga0466965_0020704 3300044683 Bacteria 3165
751 Ga0466961_0040179 3300044693 Bacteria 2999
752 Ga0466963_0041537 3300044694 Bacteria 3017
753 Ga0466971_0011349 3300044719 Bacteria 3902
754 Ga0466968_0002914 3300044735 Bacteria 6321
755 Ga0466968_0043368 3300044735 Bacteria 1904
756 Ga0466957_0000531 3300044842 Bacteria 19195
757 Ga0466957_0012606 3300044842 Bacteria 4894
758 Ga0466957_0036488 3300044842 Bacteria 2955
759 Ga0466960_0006439 3300044901 Bacteria 4710
760 Ga0466960_0008614 3300044901 Bacteria 4181
761 Ga0466960_0024394 3300044901 Bacteria 2728
762 Ga0466959_0035382 3300045049 Bacteria 3694
763 Ga0466959_0098951 3300045049 Bacteria 2089
764 Ga0466958_0003983 3300045836 Bacteria 7741
765 Ga0466958_0037845 3300045836 Bacteria 2892
766 Ga0466967_0043369 3300045976 Bacteria 3894
767 Ga0466967_0089138 3300045976 Bacteria 2801
768 Ga0466967_0109036 3300045976 Bacteria 2541
769 Ga0495592_0016002 3300046454 Bacteria 5691
770 Ga0495629_0008205 3300046459 Bacteria 7680
771 Ga0495629_0008634 3300046459 Bacteria 7503
772 Ga0495629_0042053 3300046459 Bacteria 3212
773 Ga0495629_0065786 3300046459 Bacteria 2530
774 Ga0495638_0035146 3300046460 Bacteria 3195
775 Ga0495641_0025392 3300046461 Bacteria 2909
776 Ga0495641_0066257 3300046461 Bacteria 1625
777 Ga0495651_0010451 3300046462 Bacteria 7131
778 Ga0495651_0103448 3300046462 Bacteria 2116
779 Ga0495651_0147001 3300046462 Bacteria 1703
780 Ga0495651_0162603 3300046462 Bacteria 1598
781 Ga0495651_0212309 3300046462 Bacteria 1346
782 Ga0495651_0271416 3300046462 Bacteria 1150
783 Ga0495653_0030857 3300046463 Bacteria 4265
784 Ga0495653_0048847 3300046463 Bacteria 3263
785 Ga0495653_0055153 3300046463 Bacteria 3034
786 Ga0495580_0000466 3300046472 Bacteria 33634
787 Ga0495580_0008231 3300046472 Bacteria 8297
788 Ga0495580_0035436 3300046472 Bacteria 3588
789 Ga0495580_0058842 3300046472 Bacteria 2702
790 Ga0495582_0000090 3300046473 Bacteria 46995
791 Ga0495582_0127010 3300046473 Bacteria 1439
792 Ga0495582_0132547 3300046473 Bacteria 1408
793 Ga0495605_0122391 3300046474 Bacteria 1178
794 Ga0495639_0010081 3300046475 Bacteria 4061
795 Ga0495662_0002198 3300046476 Bacteria 9815
796 Ga0495664_0008145 3300046477 Bacteria 5836
797 Ga0495664_0106108 3300046477 Bacteria 1694
798 Ga0495664_0107941 3300046477 Bacteria 1679
799 Ga0495584_0032323 3300046491 Bacteria 2648
800 Ga0495594_0001554 3300046499 Bacteria 11925
801 Ga0495594_0018322 3300046499 Bacteria 3706
802 Ga0495594_0052211 3300046499 Bacteria 2251
803 Ga0495608_0004452 3300046511 Bacteria 10028
804 Ga0495608_0058055 3300046511 Bacteria 2552
805 Ga0495608_0089988 3300046511 Bacteria 1986
806 Ga0495618_0056451 3300046514 Bacteria 2486
807 Ga0495628_0037171 3300046516 Bacteria 3905
808 Ga0495628_0085939 3300046516 Bacteria 2440
809 Ga0495630_0016110 3300046517 Bacteria 5462
810 Ga0495630_0067018 3300046517 Bacteria 2698
811 Ga0495630_0077856 3300046517 Bacteria 2500
812 Ga0495644_0013471 3300046523 Bacteria 3136
813 Ga0495644_0060094 3300046523 Bacteria 1429
814 Ga0495663_0009481 3300046525 Bacteria 2701
815 Ga0495642_0007939 3300046528 Bacteria 4063
816 Ga0495652_0004136 3300046529 Bacteria 13997
817 Ga0495665_0011841 3300046531 Bacteria 4723
818 Ga0495665_0046990 3300046531 Bacteria 2290
819 Ga0495586_0013777 3300046535 Bacteria 4290
820 Ga0495587_0002869 3300046536 Bacteria 11535
821 Ga0495587_0012129 3300046536 Bacteria 5441
822 Ga0495587_0027163 3300046536 Bacteria 3486
823 Ga0495597_0071514 3300046542 Bacteria 1493
824 Ga0495645_0150856 3300046543 Bacteria 1615
825 Ga0495667_0007993 3300046559 Bacteria 7174
826 Ga0495667_0093642 3300046559 Bacteria 1945
827 Ga0495668_0000061 3300046616 Bacteria 192499
828 Ga0495668_0015163 3300046616 Bacteria 4505
829 Ga0495634_0006466 3300046642 Bacteria 8905
830 Ga0495634_0021313 3300046642 Bacteria 4583
831 Ga0495635_0120953 3300046663 Bacteria 1786
832 Ga0495661_0034811 3300046665 Bacteria 3166
833 Ga0495657_0012077 3300046675 Bacteria 6425
834 Ga0495657_0022922 3300046675 Bacteria 4469
835 Ga0495657_0038755 3300046675 Bacteria 3277
836 Ga0495657_0077507 3300046675 Bacteria 2156
837 Ga0495599_0117725 3300046678 Bacteria 1652
838 Ga0495623_0032584 3300046679 Bacteria 3349
839 Ga0495646_0001733 3300046680 Bacteria 13084
840 Ga0495658_0000460 3300046683 Bacteria 22574
841 Ga0495658_0023206 3300046683 Bacteria 3291
842 Ga0495658_0048171 3300046683 Bacteria 2402
843 Ga0495658_0092145 3300046683 Bacteria 1796
844 Ga0495613_0000300 3300046689 Bacteria 44523
845 Ga0495613_0000766 3300046689 Bacteria 25103
846 Ga0495613_0001705 3300046689 Bacteria 16726
847 Ga0495613_0091424 3300046689 Bacteria 2204
848 Ga0495613_0113885 3300046689 Bacteria 1947
849 Ga0495624_0115254 3300046690 Bacteria 1652
850 Ga0495670_0008752 3300046691 Bacteria 4980
851 Ga0495671_0011122 3300046692 Bacteria 4967
852 Ga0495671_0018314 3300046692 Bacteria 3719
853 Ga0495589_0036618 3300046794 Bacteria 2459
854 Ga0495600_0002700 3300046809 Bacteria 10257
855 Ga0495600_0049762 3300046809 Bacteria 2734
856 Ga0495581_0001688 3300047315 Bacteria 12304
857 Ga0495581_0006491 3300047315 Bacteria 6784
858 Ga0495581_0152536 3300047315 Bacteria 1350
859 Ga0495604_0001598 3300047317 Bacteria 18660
860 Ga0495604_0074840 3300047317 Bacteria 2551
861 Ga0495604_0149658 3300047317 Bacteria 1660
862 Ga0495672_0002312 3300047320 Bacteria 17683
863 Ga0495672_0003473 3300047320 Bacteria 13473
864 Ga0495672_0010268 3300047320 Bacteria 6689
865 Ga0495672_0065032 3300047320 Bacteria 2086
866 Ga0495676_0012384 3300047321 Bacteria 7684
867 Ga0495676_0172163 3300047321 Bacteria 1523
868 Ga0495680_0002690 3300047322 Bacteria 17942
869 Ga0495680_0022189 3300047322 Bacteria 5297
870 Ga0495680_0136627 3300047322 Bacteria 1797
871 Ga0495680_0221076 3300047322 Bacteria 1352
872 Ga0495680_0240434 3300047322 Bacteria 1286
873 Ga0495687_002224 3300047443 Bacteria 16026
874 Ga0495675_0004188 3300047444 Bacteria 8730
875 Ga0495685_000894 3300047447 Bacteria 9105
876 Ga0495673_0002925 3300047469 Bacteria 11556
877 Ga0495681_0004568 3300047470 Bacteria 9429
878 Ga0495681_0027408 3300047470 Bacteria 2946
879 Ga0495684_0054667 3300047471 Bacteria 3045
880 Ga0495684_0067820 3300047471 Bacteria 2713
881 Ga0495593_0013517 3300047673 Bacteria 4654
882 Ga0495593_0095353 3300047673 Bacteria 1530
883 Ga0495602_0008914 3300048088 Bacteria 10461
884 Ga0495602_0040015 3300048088 Bacteria 4308
885 Ga0495602_0059991 3300048088 Bacteria 3318
886 Ga0495602_0119001 3300048088 Bacteria 2129
887 Ga0495614_0013108 3300048089 Bacteria 3636
888 Ga0496100_0003115 3300048903 Bacteria 8583
889 Ga0496100_0008120 3300048903 Bacteria 5841
890 Ga0496101_0070340 3300048904 Bacteria 2562
891 Ga0496102_0000178 3300048905 Bacteria 86174
892 Ga0496102_0000217 3300048905 Bacteria 75968
893 Ga0496102_0043107 3300048905 Bacteria 4090
894 Ga0496102_0073613 3300048905 Bacteria 3139
895 Ga0496102_0140306 3300048905 Bacteria 2266
896 Ga0496102_0190665 3300048905 Bacteria 1931
897 Ga0496102_0296567 3300048905 Bacteria 1524
898 Ga0496103_0000119 3300048906 Bacteria 86194
899 Ga0496103_0000255 3300048906 Bacteria 51189
900 Ga0496104_0009768 3300048907 Bacteria 8557
901 Ga0496104_0032050 3300048907 Bacteria 4891
902 Ga0496104_0051195 3300048907 Bacteria 3897
903 Ga0496104_0052029 3300048907 Bacteria 3867
904 Ga0496104_0122002 3300048907 Bacteria 2502
905 Ga0496104_0159334 3300048907 Bacteria 2165
906 Ga0496104_0255258 3300048907 Bacteria 1666
907 Ga0496105_0000193 3300048908 Bacteria 40676
908 Ga0496105_0011672 3300048908 Bacteria 6951
909 Ga0496105_0016616 3300048908 Bacteria 5877
910 Ga0496105_0036874 3300048908 Bacteria 4028
911 Ga0496105_0142424 3300048908 Bacteria 1973
912 Ga0496105_0152102 3300048908 Bacteria 1902
913 Ga0496105_0156280 3300048908 Bacteria 1873
914 Ga0496105_0165956 3300048908 Bacteria 1812
915 Ga0496105_0260257 3300048908 Bacteria 1403
916 Ga0496106_0057908 3300048909 Bacteria 2931
917 Ga0496106_0073680 3300048909 Bacteria 2612
918 Ga0496107_0008926 3300048910 Bacteria 6947
919 Ga0496107_0185456 3300048910 Bacteria 1545
920 Ga0496108_0000349 3300048911 Bacteria 39032
921 Ga0496108_0011709 3300048911 Bacteria 7136
922 Ga0496108_0026750 3300048911 Bacteria 4761
923 Ga0496108_0039578 3300048911 Bacteria 3929
924 Ga0496108_0059914 3300048911 Bacteria 3202
925 Ga0496108_0063692 3300048911 Bacteria 3105
926 Ga0496108_0102380 3300048911 Bacteria 2444
927 Ga0496108_0145893 3300048911 Bacteria 2040
928 Ga0496108_0168568 3300048911 Bacteria 1894
929 Ga0496108_0177972 3300048911 Bacteria 1842
930 Ga0496109_0008376 3300048912 Bacteria 8788
931 Ga0496109_0048160 3300048912 Bacteria 3878
932 Ga0496109_0106168 3300048912 Bacteria 2608
933 Ga0496109_0110523 3300048912 Bacteria 2555
934 Ga0496109_0163962 3300048912 Bacteria 2083
935 Ga0496109_0242085 3300048912 Bacteria 1698
936 Ga0496110_0005735 3300048913 Bacteria 9754
937 Ga0496110_0031193 3300048913 Bacteria 4598
938 Ga0496110_0043162 3300048913 Bacteria 3937
939 Ga0496110_0058462 3300048913 Bacteria 3396
940 Ga0496110_0072552 3300048913 Bacteria 3055
941 Ga0496110_0075313 3300048913 Bacteria 2999
942 Ga0496110_0102224 3300048913 Bacteria 2570
943 Ga0496110_0107291 3300048913 Bacteria 2507
944 Ga0496110_0149965 3300048913 Bacteria 2111
945 Ga0496110_0153141 3300048913 Bacteria 2088
946 Ga0496110_0272086 3300048913 Bacteria 1542
947 Ga0496111_0000546 3300048914 Bacteria 19480
948 Ga0496111_0001142 3300048914 Bacteria 14731
949 Ga0496111_0008808 3300048914 Bacteria 6702
950 Ga0496111_0048717 3300048914 Bacteria 3053
951 Ga0496111_0178899 3300048914 Bacteria 1576
952 Ga0496112_0000329 3300048915 Bacteria 30667
953 Ga0496112_0018256 3300048915 Bacteria 6604
954 Ga0496112_0023802 3300048915 Bacteria 5858
955 Ga0496112_0030365 3300048915 Bacteria 5229
956 Ga0496112_0040047 3300048915 Bacteria 4580
957 Ga0496112_0078138 3300048915 Bacteria 3273
958 Ga0496113_0041403 3300048916 Bacteria 3400
959 Ga0496114_0002414 3300048917 Bacteria 14245
960 Ga0496114_0013956 3300048917 Bacteria 6440
961 Ga0496114_0207978 3300048917 Bacteria 1716
962 Ga0496115_0000253 3300048918 Bacteria 47511
963 Ga0496115_0017554 3300048918 Bacteria 5474
964 Ga0496115_0111808 3300048918 Bacteria 2244
965 Ga0496116_0000265 3300048919 Bacteria 91618
966 Ga0496116_0000335 3300048919 Bacteria 75484
967 Ga0496116_0009914 3300048919 Bacteria 8055
968 Ga0496116_0010615 3300048919 Bacteria 7703
969 Ga0496117_0000318 3300048920 Bacteria 84351
970 Ga0496117_0000389 3300048920 Bacteria 75476
971 Ga0496117_0006208 3300048920 Bacteria 12186
972 Ga0496117_0040483 3300048920 Bacteria 3426
973 Ga0496118_0000155 3300048921 Bacteria 121944
974 Ga0496118_0000186 3300048921 Bacteria 108940
975 Ga0496118_0000372 3300048921 Bacteria 75474
976 Ga0496118_0039621 3300048921 Bacteria 3756
977 Ga0496118_0103066 3300048921 Bacteria 1921
978 Ga0496119_0000067 3300048922 Bacteria 162404
979 Ga0496119_0000336 3300048922 Bacteria 65760
980 Ga0496119_0000389 3300048922 Bacteria 60683
981 Ga0496119_0000618 3300048922 Bacteria 47971
982 Ga0496119_0005200 3300048922 Bacteria 12574
983 Ga0496119_0006999 3300048922 Bacteria 10275
984 Ga0496119_0046626 3300048922 Bacteria 2704
985 Ga0496119_0057358 3300048922 Bacteria 2353
986 Ga0496120_0000475 3300048923 Bacteria 62978
987 Ga0496120_0001000 3300048923 Bacteria 38203
988 Ga0496120_0012026 3300048923 Bacteria 5913
989 Ga0496120_0022832 3300048923 Bacteria 3931
990 Ga0496121_0001102 3300048924 Bacteria 47573
991 Ga0496121_0001167 3300048924 Bacteria 46089
992 Ga0496121_0012047 3300048924 Bacteria 9499
993 Ga0496121_0019766 3300048924 Bacteria 6714
994 Ga0496121_0030700 3300048924 Bacteria 4930
995 Ga0496121_0173615 3300048924 Bacteria 1563
996 Ga0496122_0017665 3300048925 Bacteria 6651
997 Ga0496123_0013912 3300048926 Bacteria 6703
998 Ga0496124_0000324 3300048927 Bacteria 88327
999 Ga0496124_0007589 3300048927 Eukaryota 11502
1000 Ga0496124_0010188 3300048927 Bacteria 9559
1001 Ga0496124_0011982 3300048927 Bacteria 8622
1002 Ga0496124_0015055 3300048927 Bacteria 7438
1003 Ga0496124_0020083 3300048927 Bacteria 6186
1004 Ga0496124_0020940 3300048927 Bacteria 6033
1005 Ga0496124_0091490 3300048927 Bacteria 2479
1006 Ga0496124_0252879 3300048927 Bacteria 1302
1007 Ga0496125_0000444 3300048928 Bacteria 75459
1008 Ga0496125_0007511 3300048928 Bacteria 11586
1009 Ga0496125_0015325 3300048928 Bacteria 7419
1010 Ga0496125_0033548 3300048928 Bacteria 4540
1011 Ga0496126_0000502 3300048929 Bacteria 76806
1012 Ga0496126_0001180 3300048929 Bacteria 42930
1013 Ga0496126_0003207 3300048929 Bacteria 20981
1014 Ga0496126_0017622 3300048929 Bacteria 7115
1015 Ga0496126_0060725 3300048929 Bacteria 3399
1016 Ga0496126_0079526 3300048929 Bacteria 2902
1017 Ga0496126_0118852 3300048929 Bacteria 2294
1018 Ga0501031_0002717 3300049568 Bacteria 11260
1019 Ga0501031_0006690 3300049568 Bacteria 7518
1020 Ga0501031_0025249 3300049568 Bacteria 3876
1021 Ga0501031_0108323 3300049568 Bacteria 1814
1022 Ga0501032_0001861 3300049569 Bacteria 16689
1023 Ga0501032_0005181 3300049569 Bacteria 9714
1024 Ga0501032_0012019 3300049569 Bacteria 6198
1025 Ga0501032_0022357 3300049569 Bacteria 4384
1026 Ga0501033_0000295 3300049570 Bacteria 47954
1027 Ga0501033_0001353 3300049570 Bacteria 21844
1028 Ga0501033_0002936 3300049570 Bacteria 14255
1029 Ga0501033_0003694 3300049570 Bacteria 12445
1030 Ga0501033_0020505 3300049570 Bacteria 4994
1031 Ga0501033_0044076 3300049570 Bacteria 3321
1032 Ga0501033_0114065 3300049570 Bacteria 1965
1033 Ga0501033_0124397 3300049570 Bacteria 1870
1034 Ga0501033_0225810 3300049570 Bacteria 1332
1035 Ga0501034_0002426 3300049571 Bacteria 22542
1036 Ga0501034_0005350 3300049571 Bacteria 14056
1037 Ga0501034_0019421 3300049571 Bacteria 6951
1038 Ga0501034_0027637 3300049571 Bacteria 5769
1039 Ga0501034_0031081 3300049571 Bacteria 5427
1040 Ga0501034_0033730 3300049571 Bacteria 5190
1041 Ga0501034_0119093 3300049571 Bacteria 2627
1042 Ga0501034_0291744 3300049571 Bacteria 1569
1043 Ga0501036_0000410 3300049572 Bacteria 30271
1044 Ga0501036_0000993 3300049572 Bacteria 21421
1045 Ga0501036_0045934 3300049572 Bacteria 3699
1046 Ga0501036_0085912 3300049572 Bacteria 2659
1047 Ga0501036_0107700 3300049572 Bacteria 2356
1048 Ga0501036_0112099 3300049572 Bacteria 2305
1049 Ga0501036_0321566 3300049572 Bacteria 1293
1050 Ga0501036_0342460 3300049572 Bacteria 1249
1051 Ga0501037_0001405 3300049573 Bacteria 17651
1052 Ga0501037_0006264 3300049573 Bacteria 8698
1053 Ga0501037_0008952 3300049573 Bacteria 7335
1054 Ga0501037_0011155 3300049573 Bacteria 6613
1055 Ga0501037_0023151 3300049573 Bacteria 4594
1056 Ga0501037_0041894 3300049573 Bacteria 3366
1057 Ga0501037_0123885 3300049573 Bacteria 1857
1058 Ga0501037_0155405 3300049573 Bacteria 1633
1059 Ga0501038_0002491 3300049574 Bacteria 17140
1060 Ga0501038_0007001 3300049574 Bacteria 10415
1061 Ga0501038_0008025 3300049574 Bacteria 9724
1062 Ga0501038_0010873 3300049574 Bacteria 8313
1063 Ga0501038_0018014 3300049574 Bacteria 6379
1064 Ga0501038_0043562 3300049574 Bacteria 3902
1065 Ga0501038_0044754 3300049574 Bacteria 3844
1066 Ga0501038_0108141 3300049574 Bacteria 2306
1067 Ga0501038_0139617 3300049574 Bacteria 1983
1068 Ga0501038_0202689 3300049574 Bacteria 1591
1069 Ga0501039_0000222 3300049575 Bacteria 41722
1070 Ga0501039_0004014 3300049575 Bacteria 11062
1071 Ga0501039_0010937 3300049575 Bacteria 6915
1072 Ga0501039_0020815 3300049575 Bacteria 5028
1073 Ga0501039_0033579 3300049575 Bacteria 3957
1074 Ga0501039_0139390 3300049575 Bacteria 1905
1075 Ga0501040_0000424 3300049576 Bacteria 25065
1076 Ga0501040_0017237 3300049576 Bacteria 4793
1077 Ga0501040_0020798 3300049576 Bacteria 4375
1078 Ga0501040_0027207 3300049576 Bacteria 3849
1079 Ga0501040_0032827 3300049576 Bacteria 3513
1080 Ga0501040_0047096 3300049576 Bacteria 2944
1081 Ga0501040_0048205 3300049576 Bacteria 2911
1082 Ga0501040_0104794 3300049576 Bacteria 1975
1083 Ga0501040_0188766 3300049576 Bacteria 1462
1084 Ga0501041_0000442 3300049577 Bacteria 21008
1085 Ga0501041_0000572 3300049577 Bacteria 19173
1086 Ga0501041_0000689 3300049577 Bacteria 17926
1087 Ga0501041_0001386 3300049577 Bacteria 13420
1088 Ga0501041_0007625 3300049577 Bacteria 6357
1089 Ga0501041_0014442 3300049577 Bacteria 4689
1090 Ga0501041_0076509 3300049577 Bacteria 2059
1091 Ga0501042_0000173 3300049578 Bacteria 29754
1092 Ga0501042_0000523 3300049578 Bacteria 19988
1093 Ga0501042_0004267 3300049578 Bacteria 9103
1094 Ga0501042_0013485 3300049578 Bacteria 5564
1095 Ga0501042_0014719 3300049578 Bacteria 5340
1096 Ga0501042_0018574 3300049578 Bacteria 4815
1097 Ga0501042_0065026 3300049578 Bacteria 2607
1098 Ga0501042_0132715 3300049578 Bacteria 1795
1099 Ga0501042_0170818 3300049578 Bacteria 1569
1100 Ga0501043_0006030 3300049579 Bacteria 9737
1101 Ga0501043_0040856 3300049579 Bacteria 3645
1102 Ga0501043_0045035 3300049579 Bacteria 3470
1103 Ga0501043_0082032 3300049579 Bacteria 2534
1104 Ga0501043_0086350 3300049579 Bacteria 2466
1105 Ga0501046_0002551 3300049580 Bacteria 17036
1106 Ga0501046_0016496 3300049580 Bacteria 6184
1107 Ga0501046_0020810 3300049580 Bacteria 5418
1108 Ga0501046_0030030 3300049580 Bacteria 4415
1109 Ga0501046_0034798 3300049580 Bacteria 4063
1110 Ga0501046_0250897 3300049580 Bacteria 1302
1111 Ga0501047_0000176 3300049581 Bacteria 78742
1112 Ga0501047_0000220 3300049581 Bacteria 68612
1113 Ga0501047_0011821 3300049581 Bacteria 8257
1114 Ga0501047_0019464 3300049581 Bacteria 6512
1115 Ga0501047_0021474 3300049581 Bacteria 6199
1116 Ga0501047_0159615 3300049581 Bacteria 2127
1117 Ga0501047_0166175 3300049581 Bacteria 2077
1118 Ga0501047_0271129 3300049581 Bacteria 1543
1119 Ga0501048_0000155 3300049582 Bacteria 42224
1120 Ga0501048_0000590 3300049582 Bacteria 25751
1121 Ga0501048_0010061 3300049582 Bacteria 7076
1122 Ga0501048_0078021 3300049582 Bacteria 2337
1123 Ga0501048_0090817 3300049582 Bacteria 2154
1124 Ga0501048_0154759 3300049582 Bacteria 1622
1125 Ga0501048_0221888 3300049582 Bacteria 1341
1126 Ga0501048_0224368 3300049582 Bacteria 1333
1127 Ga0501067_0043880 3300049583 Bacteria 2484
1128 Ga0501067_0209384 3300049583 Bacteria 1086
1129 Ga0501068_0001141 3300049584 Bacteria 14054
1130 Ga0501068_0026225 3300049584 Bacteria 3433
1131 Ga0501068_0037323 3300049584 Bacteria 2909
1132 Ga0501068_0046580 3300049584 Bacteria 2615
1133 Ga0501068_0052658 3300049584 Bacteria 2463
1134 Ga0501068_0087654 3300049584 Bacteria 1917
1135 Ga0501068_0192911 3300049584 Bacteria 1291
1136 Ga0501069_0000034 3300049585 Bacteria 92080
1137 Ga0501069_0001445 3300049585 Bacteria 11667
1138 Ga0501069_0042271 3300049585 Bacteria 2521
1139 Ga0501069_0072254 3300049585 Bacteria 1934
1140 Ga0501069_0087503 3300049585 Bacteria 1760
1141 Ga0501070_0000013 3300049586 Bacteria 180554
1142 Ga0501070_0000325 3300049586 Bacteria 43267
1143 Ga0501070_0007683 3300049586 Bacteria 9148
1144 Ga0501070_0014305 3300049586 Bacteria 6678
1145 Ga0501070_0020441 3300049586 Bacteria 5554
1146 Ga0501070_0095040 3300049586 Bacteria 2466
1147 Ga0501070_0143874 3300049586 Bacteria 1969
1148 Ga0501071_0003071 3300049587 Bacteria 10342
1149 Ga0501071_0005640 3300049587 Bacteria 8068
1150 Ga0501071_0011464 3300049587 Bacteria 5973
1151 Ga0501071_0015085 3300049587 Bacteria 5297
1152 Ga0501071_0017061 3300049587 Bacteria 5001
1153 Ga0501071_0019850 3300049587 Bacteria 4667
1154 Ga0501071_0038360 3300049587 Bacteria 3424
1155 Ga0501071_0064951 3300049587 Bacteria 2649
1156 Ga0501071_0082398 3300049587 Bacteria 2356
1157 Ga0501071_0184270 3300049587 Bacteria 1565
1158 Ga0501071_0218701 3300049587 Bacteria 1433
1159 Ga0501071_0231745 3300049587 Bacteria 1391
1160 Ga0501071_0238996 3300049587 Bacteria 1369
1161 Ga0501071_0270097 3300049587 Bacteria 1286
1162 Ga0501072_0001732 3300049588 Bacteria 16269
1163 Ga0501072_0005079 3300049588 Bacteria 10018
1164 Ga0501072_0006190 3300049588 Bacteria 9113
1165 Ga0501072_0010907 3300049588 Bacteria 6932
1166 Ga0501072_0024326 3300049588 Bacteria 4711
1167 Ga0501072_0024373 3300049588 Bacteria 4705
1168 Ga0501072_0037680 3300049588 Bacteria 3793
1169 Ga0501072_0040870 3300049588 Bacteria 3642
1170 Ga0501072_0250527 3300049588 Bacteria 1410
1171 Ga0501073_0008544 3300049589 Bacteria 7592
1172 Ga0501073_0231671 3300049589 Bacteria 1276
1173 Ga0501074_0000371 3300049590 Bacteria 26460
1174 Ga0501074_0001214 3300049590 Bacteria 16965
1175 Ga0501074_0003411 3300049590 Bacteria 11252
1176 Ga0501074_0003776 3300049590 Bacteria 10765
1177 Ga0501074_0014472 3300049590 Bacteria 5739
1178 Ga0501074_0017274 3300049590 Bacteria 5234
1179 Ga0501074_0022859 3300049590 Bacteria 4547
1180 Ga0501074_0039218 3300049590 Bacteria 3430
1181 Ga0501074_0055310 3300049590 Bacteria 2861
1182 Ga0501074_0080181 3300049590 Bacteria 2342
1183 Ga0501074_0145305 3300049590 Bacteria 1696
1184 Ga0501075_0001630 3300049591 Bacteria 14731
1185 Ga0501075_0002120 3300049591 Bacteria 13124
1186 Ga0501075_0007555 3300049591 Bacteria 7543
1187 Ga0501075_0008918 3300049591 Bacteria 6999
1188 Ga0501075_0011928 3300049591 Bacteria 6164
1189 Ga0501075_0025603 3300049591 Bacteria 4335
1190 Ga0501075_0034503 3300049591 Bacteria 3768
1191 Ga0501075_0037028 3300049591 Bacteria 3643
1192 Ga0501075_0064441 3300049591 Bacteria 2764
1193 Ga0501075_0075066 3300049591 Bacteria 2556
1194 Ga0501075_0104157 3300049591 Bacteria 2156
1195 Ga0501075_0207655 3300049591 Bacteria 1494
1196 Ga0501076_0000457 3300049592 Bacteria 25863
1197 Ga0501076_0004757 3300049592 Bacteria 9694
1198 Ga0501076_0008144 3300049592 Bacteria 7668
1199 Ga0501076_0028807 3300049592 Bacteria 4316
1200 Ga0501076_0071128 3300049592 Bacteria 2782
1201 Ga0501076_0083379 3300049592 Bacteria 2567
1202 Ga0501076_0154512 3300049592 Bacteria 1867
1203 Ga0501077_0000353 3300049593 Bacteria 27157
1204 Ga0501077_0007087 3300049593 Bacteria 6913
1205 Ga0501077_0009984 3300049593 Bacteria 5908
1206 Ga0501077_0014723 3300049593 Bacteria 4914
1207 Ga0501077_0047184 3300049593 Bacteria 2737
1208 Ga0501077_0059864 3300049593 Bacteria 2417
1209 Ga0501079_0000271 3300049741 Bacteria 31924
1210 Ga0501079_0001277 3300049741 Bacteria 17674
1211 Ga0501079_0011345 3300049741 Bacteria 6798
1212 Ga0501079_0012200 3300049741 Bacteria 6561
1213 Ga0501079_0033302 3300049741 Bacteria 3964
1214 Ga0501079_0040888 3300049741 Bacteria 3578
1215 Ga0501079_0193513 3300049741 Bacteria 1587
1216 Ga0501079_0329027 3300049741 Bacteria 1197
1217 Ga0501080_0000096 3300049742 Bacteria 59454
1218 Ga0501080_0001144 3300049742 Bacteria 21856
1219 Ga0501080_0002735 3300049742 Bacteria 15471
1220 Ga0501080_0016256 3300049742 Bacteria 6871
1221 Ga0501080_0026902 3300049742 Bacteria 5349
1222 Ga0501080_0058489 3300049742 Bacteria 3588
1223 Ga0501080_0063661 3300049742 Bacteria 3432
1224 Ga0501080_0078684 3300049742 Bacteria 3066
1225 Ga0501080_0482428 3300049742 Bacteria 1109
1226 Ga0501081_0000803 3300049743 Bacteria 18535
1227 Ga0501081_0008090 3300049743 Bacteria 6824
1228 Ga0501081_0009917 3300049743 Bacteria 6203
1229 Ga0501081_0033137 3300049743 Bacteria 3508
1230 Ga0501081_0045276 3300049743 Bacteria 3021
1231 Ga0501081_0056043 3300049743 Bacteria 2723
1232 Ga0501081_0102134 3300049743 Bacteria 2028
1233 Ga0501083_0034963 3300049744 Bacteria 3434
1234 Ga0501035_0000815 3300049822 Bacteria 33266
1235 Ga0501035_0004822 3300049822 Bacteria 12787
1236 Ga0501035_0103241 3300049822 Bacteria 2501
1237 Ga0501035_0131797 3300049822 Bacteria 2178
1238 Ga0501035_0261165 3300049822 Bacteria 1468
1239 Ga0501035_0285377 3300049822 Bacteria 1394
1240 Ga0501044_0000201 3300049823 Bacteria 75685
1241 Ga0501044_0002240 3300049823 Bacteria 22130
1242 Ga0501044_0003728 3300049823 Bacteria 17117
1243 Ga0501044_0007577 3300049823 Bacteria 11933
1244 Ga0501044_0009471 3300049823 Bacteria 10604
1245 Ga0501044_0179932 3300049823 Bacteria 2082
1246 Ga0501044_0284787 3300049823 Bacteria 1585
1247 Ga0501044_0374226 3300049823 Bacteria 1340
1248 Ga0501045_0000037 3300049824 Bacteria 56362
1249 Ga0501045_0008488 3300049824 Bacteria 7160
1250 Ga0501045_0008822 3300049824 Bacteria 7044
1251 Ga0501045_0022040 3300049824 Bacteria 4558
1252 Ga0501045_0023862 3300049824 Bacteria 4390
1253 Ga0501045_0053180 3300049824 Bacteria 2959
1254 Ga0501045_0058262 3300049824 Bacteria 2828
1255 Ga0501045_0084632 3300049824 Bacteria 2340
1256 Ga0501045_0094614 3300049824 Bacteria 2210
1257 Ga0501045_0097108 3300049824 Bacteria 2180
1258 nmdc:mga03n38_86177_c1 3300050490 Bacteria 1486
1259 nmdc:mga00v17_13817_c1 3300050491 Bacteria 4490
1260 nmdc:mga00v17_21975_c1 3300050491 Bacteria 3677
1261 nmdc:mga00v17_27775_c1 3300050491 Bacteria 3307
1262 nmdc:mga00v17_32382_c1 3300050491 Bacteria 3089
1263 nmdc:mga00v17_49060_c1 3300050491 Bacteria 2560
1264 nmdc:mga00v17_7574_c1 3300050491 Bacteria 5799
1265 nmdc:mga0yw44_115229_c1 3300050492 Bacteria 1726
1266 nmdc:mga0yw44_1153_c1 3300050492 Bacteria 10243
1267 nmdc:mga0yw44_14602_c1 3300050492 Bacteria 4176
1268 nmdc:mga0yw44_28061_c1 3300050492 Bacteria 3234
1269 nmdc:mga0yw44_4854_c1 3300050492 Bacteria 6249
1270 nmdc:mga0yw44_50043_c1 3300050492 Bacteria 2525
1271 nmdc:mga0yw44_53050_c1 3300050492 Bacteria 2460
1272 nmdc:mga0yw44_60352_c1 3300050492 Bacteria 2323
1273 nmdc:mga0yw44_664_c1 3300050492 Bacteria 12540
1274 nmdc:mga06z11_155649_c1 3300050494 Bacteria 1303
1275 nmdc:mga06z11_35845_c1 3300050494 Bacteria 2445
1276 nmdc:mga06z11_54832_c1 3300050494 Bacteria 2056
1277 nmdc:mga04h51_56923_c1 3300050495 Bacteria 1329
1278 nmdc:mga07m45_16563_c1 3300050496 Bacteria 3946
1279 nmdc:mga05p37_11750_c2 3300050507 Bacteria 9523
1280 nmdc:mga05p37_173136_c1 3300050507 Bacteria 2631
1281 nmdc:mga05p37_369670_c1 3300050507 Bacteria 1683
1282 nmdc:mga09592_150916_c1 3300050508 Bacteria 2005
1283 nmdc:mga09592_3187_c1 3300050508 Bacteria 13303
1284 nmdc:mga09592_374008_c1 3300050508 Bacteria 1232
1285 nmdc:mga0qj67_137216_c1 3300050509 Bacteria 1982
1286 nmdc:mga0qj67_47840_c1 3300050509 Bacteria 3379
1287 nmdc:mga06r32_41766_c1 3300050510 Bacteria 4358
1288 nmdc:mga06r32_4733_c1 3300050510 Bacteria 12238
1289 nmdc:mga08y16_13622_c1 3300050511 Bacteria 8559
1290 nmdc:mga08y16_49690_c1 3300050511 Bacteria 4389
1291 nmdc:mga08y16_72784_c1 3300050511 Bacteria 3581
1292 nmdc:mga0n895_167361_c1 3300050512 Bacteria 2230
1293 nmdc:mga0n895_18738_c1 3300050512 Bacteria 6414
1294 nmdc:mga0rr50_107853_c1 3300050513 Bacteria 2199
1295 nmdc:mga0rr50_17965_c1 3300050513 Bacteria 4738
1296 nmdc:mga0rr50_265733_c1 3300050513 Bacteria 1428
1297 nmdc:mga0rr50_4135_c1 3300050513 Bacteria 8484
1298 nmdc:mga0a205_10249_c1 3300050515 Bacteria 8611
1299 nmdc:mga0a205_27932_c1 3300050515 Bacteria 5391
1300 nmdc:mga0sz30_7582_c1 3300050516 Bacteria 4074
1301 nmdc:mga0sz30_80134_c1 3300050516 Bacteria 1412
1302 Ga0495601_0052164 3300053077 Bacteria 2582
1303 Ga0495601_0058473 3300053077 Bacteria 2443
1304 Ga0495595_0020057 3300053084 Bacteria 2906
1305 Ga0495595_0049493 3300053084 Bacteria 1944
1306 Ga0495619_0014472 3300053085 Bacteria 4984
1307 Ga0495619_0144756 3300053085 Bacteria 1638
1308 Ga0500583_0011434 3300053092 Bacteria 3345
1309 Ga0500566_0000576 3300053094 Bacteria 20648
1310 Ga0500553_060231 3300053101 Bacteria 1785
1311 Ga0500560_002330 3300053107 Bacteria 3601
1312 Ga0500593_002084 3300053117 Bacteria 7257
1313 Ga0500608_000250 3300053122 Bacteria 21026
1314 Ga0500618_004042 3300053125 Bacteria 4822
1315 Ga0500568_0000013 3300053139 Bacteria 224760
1316 Ga0500568_0000068 3300053139 Bacteria 103847
1317 Ga0500568_0000141 3300053139 Bacteria 64491
1318 Ga0500568_0002823 3300053139 Bacteria 10032
1319 Ga0500573_0000027 3300053140 Bacteria 143529
1320 Ga0500577_0007500 3300053142 Bacteria 3062
1321 Ga0500616_0000693 3300053153 Bacteria 39405
1322 Ga0500616_0003044 3300053153 Bacteria 13193
1323 Ga0500616_0003638 3300053153 Bacteria 11589
1324 Ga0500616_0031003 3300053153 Bacteria 2932
1325 Ga0500622_0035839 3300053156 Bacteria 2595
1326 Ga0501084_0002270 3300054114 Bacteria 15442
1327 Ga0501084_0004389 3300054114 Bacteria 11498
1328 Ga0501084_0005146 3300054114 Bacteria 10703
1329 Ga0501084_0078251 3300054114 Bacteria 2772
1330 Ga0501084_0126208 3300054114 Bacteria 2153
1331 Ga0501084_0183834 3300054114 Bacteria 1764
1332 Ga0501084_0332986 3300054114 Bacteria 1282
1333 Ga0590075_007396 3300059424 Bacteria 2609
1334 Ga0501082_0000435 3300060353 Bacteria 37081
1335 Ga0501082_0001152 3300060353 Bacteria 23289
1336 Ga0501082_0007878 3300060353 Bacteria 9195
1337 Ga0501082_0017210 3300060353 Bacteria 6228
1338 Ga0501082_0026644 3300060353 Bacteria 4983
1339 Ga0501082_0032315 3300060353 Bacteria 4513
1340 Ga0501082_0048148 3300060353 Bacteria 3674
1341 Ga0501082_0051024 3300060353 Bacteria 3566
1342 Ga0501082_0059789 3300060353 Bacteria 3284
1343 Ga0501082_0066710 3300060353 Bacteria 3099
1344 Ga0501082_0074479 3300060353 Bacteria 2924
1345 Ga0501082_0114431 3300060353 Bacteria 2336
1346 Ga0466962_0085069 3300061719 Bacteria 1514
1347 Ga0530510_0000096 3300061734 Bacteria 47876
1348 Ga0530510_0002310 3300061734 Bacteria 13070
1349 Ga0530510_0002651 3300061734 Bacteria 12299
1350 Ga0530510_0003178 3300061734 Bacteria 11292
1351 Ga0530510_0008881 3300061734 Bacteria 7034
1352 Ga0530510_0015323 3300061734 Bacteria 5416
1353 Ga0530510_0037216 3300061734 Bacteria 3508
1354 Ga0530510_0062641 3300061734 Bacteria 2692
1355 Ga0530510_0119230 3300061734 Bacteria 1936
1356 Ga0530510_0195403 3300061734 Bacteria 1502
1357 Ga0530510_0287902 3300061734 Bacteria 1228

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0209384 Ga0501067_0209384_116_1045 308
2 3300046462 Ga0495651_0212309 Ga0495651_0212309_12_974 309
3 3300035724 Ga0373933_0237832 Ga0373933_0237832_150_1154 311
4 3300046462 Ga0495651_0271416 Ga0495651_0271416_12_1022 316
5 3300042461 Ga0439460_0042584 Ga0439460_0042584_10_1014 317
6 3300049742 Ga0501080_0482428 Ga0501080_0482428_64_1095 320
7 3300049587 Ga0501071_0218701 Ga0501071_0218701_394_1416 321
8 3300042011 Ga0439454_001128 Ga0439454_001128_1393_2418 324
9 3300041411 Ga0439466_0038315 Ga0439466_0038315_521_1558 327
10 3300048088 Ga0495602_0040015 Ga0495602_0040015_3278_4294 327
11 3300035695 Ga0373927_0105699 Ga0373927_0105699_803_1822 328
12 3300053094 Ga0500566_0000576 Ga0500566_0000576_1874_3064 333
13 3300049571 Ga0501034_0033730 Ga0501034_0033730_1762_2952 339
14 3300046474 Ga0495605_0122391 Ga0495605_0122391_10_1107 340
15 3300003203 JGI25406J46586_10001652 JGI25406J46586_100016527 342
16 3300005985 Ga0081539_10000515 Ga0081539_1000051571 342
17 3300049576 Ga0501040_0188766 Ga0501040_0188766_14_1081 342
18 3300046477 Ga0495664_0106108 Ga0495664_0106108_394_1587 344
19 3300046543 Ga0495645_0150856 Ga0495645_0150856_263_1456 344
20 3300042013 Ga0439456_009050 Ga0439456_009050_619_1716 346
21 3300059424 Ga0590075_007396 Ga0590075_007396_956_2158 346
22 3300046477 Ga0495664_0107941 Ga0495664_0107941_570_1646 347
23 3300046675 Ga0495657_0077507 Ga0495657_0077507_1053_2129 347
24 3300049569 Ga0501032_0022357 Ga0501032_0022357_684_1880 347
25 3300049573 Ga0501037_0006264 Ga0501037_0006264_3427_4623 347
26 3300049574 Ga0501038_0018014 Ga0501038_0018014_1868_3064 347
27 3300049575 Ga0501039_0000222 Ga0501039_0000222_12290_13486 347
28 3300049576 Ga0501040_0000424 Ga0501040_0000424_12439_13635 347
29 3300049577 Ga0501041_0000572 Ga0501041_0000572_6717_7913 347
30 3300049578 Ga0501042_0000173 Ga0501042_0000173_23022_24218 347
31 3300049580 Ga0501046_0002551 Ga0501046_0002551_12301_13497 347
32 3300049582 Ga0501048_0000590 Ga0501048_0000590_16579_17775 347
33 3300049588 Ga0501072_0040870 Ga0501072_0040870_1029_2225 347
34 3300049591 Ga0501075_0002120 Ga0501075_0002120_3238_4434 347
35 3300049592 Ga0501076_0028807 Ga0501076_0028807_2466_3662 347
36 3300049593 Ga0501077_0059864 Ga0501077_0059864_976_2172 347
37 3300049742 Ga0501080_0063661 Ga0501080_0063661_611_1807 347
38 3300049743 Ga0501081_0000803 Ga0501081_0000803_13558_14754 347
39 3300061734 Ga0530510_0002310 Ga0530510_0002310_11667_12863 347
40 3300048912 Ga0496109_0163962 Ga0496109_0163962_211_1392 348
41 3300042437 Ga0439444_0012243 Ga0439444_0012243_249_1355 349
42 3300046523 Ga0495644_0060094 Ga0495644_0060094_211_1311 349
43 3300053139 Ga0500568_0000141 Ga0500568_0000141_40592_41788 349
44 3300025941 Ga0207711_10150222 Ga0207711_101502221 350
45 3300048912 Ga0496109_0242085 Ga0496109_0242085_613_1686 351
46 3300049571 Ga0501034_0031081 Ga0501034_0031081_1330_2523 351
47 3300049741 Ga0501079_0329027 Ga0501079_0329027_20_1117 351
48 3300049570 Ga0501033_0020505 Ga0501033_0020505_2136_3314 353
49 3300049822 Ga0501035_0261165 Ga0501035_0261165_44_1222 353
50 3300053153 Ga0500616_0000693 Ga0500616_0000693_25161_26354 353
51 3300005530 Ga0070679_100073779 Ga0070679_1000737793 354
52 3300025910 Ga0207684_10310332 Ga0207684_103103321 354
53 3300025921 Ga0207652_10051314 Ga0207652_100513143 354
54 3300037418 Ga0395900_0189589 Ga0395900_0189589_328_1506 355
55 3300038443 Ga0395901_0016207 Ga0395901_0016207_5662_6840 355
56 3300048907 Ga0496104_0009768 Ga0496104_0009768_6496_7647 355
57 3300048908 Ga0496105_0260257 Ga0496105_0260257_111_1262 355
58 3300049585 Ga0501069_0072254 Ga0501069_0072254_11_1123 355
59 3300006038 Ga0075365_10176986 Ga0075365_101769861 356
60 3300035118 Ga0373954_0132874 Ga0373954_0132874_85_1191 356
61 3300048923 Ga0496120_0022832 Ga0496120_0022832_2149_3333 356
62 3300050492 nmdc:mga0yw44_115229_c1 nmdc:mga0yw44_115229_c1_170_1363 356
63 3300048915 Ga0496112_0018256 Ga0496112_0018256_569_1768 357
64 3300031824 Ga0307413_10165453 Ga0307413_101654531 358
65 3300037312 Ga0395899_0039193 Ga0395899_0039193_2336_3493 358
66 3300037312 Ga0395899_0131297 Ga0395899_0131297_216_1373 358
67 3300037418 Ga0395900_0043160 Ga0395900_0043160_1806_2963 358
68 3300037466 Ga0395898_0308232 Ga0395898_0308232_42_1199 358
69 3300038443 Ga0395901_0091515 Ga0395901_0091515_1600_2757 358
70 3300042435 Ga0439434_0036091 Ga0439434_0036091_53_1207 358
71 3300049581 Ga0501047_0021474 Ga0501047_0021474_3749_4930 358
72 3300009098 Ga0105245_10085193 Ga0105245_100851933 359
73 3300025922 Ga0207646_10075914 Ga0207646_100759144 359
74 3300025927 Ga0207687_10095658 Ga0207687_100956582 359
75 3300046683 Ga0495658_0092145 Ga0495658_0092145_688_1767 359
76 3300050507 nmdc:mga05p37_11750_c2 nmdc:mga05p37_11750_c2_49_1164 359
77 3300032002 Ga0307416_100080280 Ga0307416_1000802802 360
78 3300032126 Ga0307415_100223668 Ga0307415_1002236681 360
79 3300035398 Ga0316574_0001663 Ga0316574_0001663_3402_4514 360
80 3300036712 Ga0316584_0027566 Ga0316584_0027566_992_2104 360
81 3300048924 Ga0496121_0173615 Ga0496121_0173615_471_1553 360
82 3300003760 Ga0055527_1000003 Ga0055527_100000330 361
83 3300003762 Ga0055542_1000066 Ga0055542_1000066108 361
84 3300003763 Ga0055529_1000006 Ga0055529_100000630 361
85 3300006846 Ga0075430_100130981 Ga0075430_1001309813 361
86 3300014326 Ga0157380_10187239 Ga0157380_101872392 361
87 3300025228 Ga0209672_100003 Ga0209672_100003869 361
88 3300025229 Ga0209147_100287 Ga0209147_10028711 361
89 3300025254 Ga0209148_1000004 Ga0209148_10000041164 361
90 3300025272 Ga0209455_1000046 Ga0209455_1000046183 361
91 3300031901 Ga0307406_10022797 Ga0307406_100227972 361
92 3300038443 Ga0395901_0236028 Ga0395901_0236028_291_1493 361
93 3300061734 Ga0530510_0287902 Ga0530510_0287902_34_1212 361
94 3300003373 JGI25407J50210_10017589 JGI25407J50210_100175892 362
95 3300005981 Ga0081538_10029706 Ga0081538_100297062 362
96 3300009147 Ga0114129_10121412 Ga0114129_101214122 362
97 3300031727 Ga0316576_10012197 Ga0316576_100121976 362
98 3300031852 Ga0307410_10036662 Ga0307410_100366623 362
99 3300032002 Ga0307416_100103120 Ga0307416_1001031203 362
100 3300032004 Ga0307414_10012270 Ga0307414_100122701 362
101 3300035118 Ga0373954_0008179 Ga0373954_0008179_1640_2767 362
102 3300035119 Ga0373956_0000372 Ga0373956_0000372_13763_14890 362
103 3300035398 Ga0316574_0002355 Ga0316574_0002355_2125_3303 362
104 3300050507 nmdc:mga05p37_173136_c1 nmdc:mga05p37_173136_c1_454_1620 362
105 3300009148 Ga0105243_10000837 Ga0105243_1000083711 363
106 3300009176 Ga0105242_10003317 Ga0105242_100033176 363
107 3300025935 Ga0207709_10000029 Ga0207709_10000029126 363
108 3300032126 Ga0307415_100143353 Ga0307415_1001433532 363
109 3300033179 Ga0307507_10006561 Ga0307507_100065618 363
110 3300049574 Ga0501038_0007001 Ga0501038_0007001_1802_2986 363
111 3300049576 Ga0501040_0027207 Ga0501040_0027207_2153_3337 363
112 3300049578 Ga0501042_0018574 Ga0501042_0018574_1099_2283 363
113 3300049590 Ga0501074_0003411 Ga0501074_0003411_4714_5898 363
114 3300049824 Ga0501045_0000037 Ga0501045_0000037_47585_48769 363
115 3300005457 Ga0070662_100030835 Ga0070662_1000308351 364
116 3300025922 Ga0207646_10089073 Ga0207646_100890732 364
117 3300025933 Ga0207706_10002030 Ga0207706_1000203012 364
118 3300025934 Ga0207686_10000728 Ga0207686_1000072811 364
119 3300025972 Ga0207668_10060220 Ga0207668_100602202 364
120 3300026118 Ga0207675_100023017 Ga0207675_1000230172 364
121 3300037418 Ga0395900_0022515 Ga0395900_0022515_3080_4258 364
122 3300038443 Ga0395901_0067093 Ga0395901_0067093_566_1744 364
123 3300005535 Ga0070684_100065731 Ga0070684_1000657312 365
124 iso_pu_bacteria 2808606384 2808970357 365
125 iso_pu_bacteria 2808606390 2809005536 365
126 iso_pu_bacteria 2808606391 2809012063 365
127 iso_pu_bacteria 3001889506 3001892390 365
128 3300009148 Ga0105243_10001220 Ga0105243_1000122018 366
129 3300025935 Ga0207709_10003047 Ga0207709_100030478 366
130 3300031731 Ga0307405_10051925 Ga0307405_100519252 366
131 3300035695 Ga0373927_0107143 Ga0373927_0107143_631_1806 366
132 3300046460 Ga0495638_0035146 Ga0495638_0035146_402_1583 366
133 3300047447 Ga0495685_000894 Ga0495685_000894_5006_6187 366
134 3300047469 Ga0495673_0002925 Ga0495673_0002925_8736_9917 366
135 3300005445 Ga0070708_100014032 Ga0070708_1000140324 367
136 3300005468 Ga0070707_100022895 Ga0070707_1000228955 367
137 3300025922 Ga0207646_10021898 Ga0207646_100218985 367
138 3300037312 Ga0395899_0005670 Ga0395899_0005670_2612_3796 367
139 3300044719 Ga0466971_0011349 Ga0466971_0011349_1168_2316 367
140 3300045836 Ga0466958_0037845 Ga0466958_0037845_1413_2561 367
141 3300046491 Ga0495584_0032323 Ga0495584_0032323_1138_2322 367
142 3300046499 Ga0495594_0001554 Ga0495594_0001554_1167_2354 367
143 3300046523 Ga0495644_0013471 Ga0495644_0013471_1681_2865 367
144 3300046525 Ga0495663_0009481 Ga0495663_0009481_333_1517 367
145 3300046528 Ga0495642_0007939 Ga0495642_0007939_124_1308 367
146 3300046536 Ga0495587_0012129 Ga0495587_0012129_2210_3397 367
147 3300046542 Ga0495597_0071514 Ga0495597_0071514_141_1325 367
148 3300046616 Ga0495668_0015163 Ga0495668_0015163_47_1231 367
149 3300046665 Ga0495661_0034811 Ga0495661_0034811_780_1964 367
150 3300046691 Ga0495670_0008752 Ga0495670_0008752_2713_3897 367
151 3300046692 Ga0495671_0018314 Ga0495671_0018314_425_1609 367
152 3300046794 Ga0495589_0036618 Ga0495589_0036618_641_1825 367
153 3300047470 Ga0495681_0027408 Ga0495681_0027408_1470_2654 367
154 3300048907 Ga0496104_0255258 Ga0496104_0255258_48_1232 367
155 3300049570 Ga0501033_0002936 Ga0501033_0002936_12458_13639 367
156 3300049581 Ga0501047_0271129 Ga0501047_0271129_126_1307 367
157 3300049823 Ga0501044_0007577 Ga0501044_0007577_5171_6352 367
158 iso_pu_bacteria 2506783011 2506868042 367
159 iso_pu_bacteria 2773857933 2774904369 367
160 iso_pu_bacteria 2912723979 2912729190 367
161 iso_pu_bacteria 2915358134 2915358479 367
162 iso_pu_bacteria 8054472261 8054478556 367
163 iso_pu_bacteria 8056207758 8056213248 367
164 3300005937 Ga0081455_10058023 Ga0081455_100580234 368
165 3300005985 Ga0081539_10012766 Ga0081539_100127667 368
166 3300031251 Ga0265327_10000406 Ga0265327_1000040672 368
167 3300031727 Ga0316576_10051408 Ga0316576_100514082 368
168 3300032002 Ga0307416_100001552 Ga0307416_10000155211 368
169 3300035398 Ga0316574_0054549 Ga0316574_0054549_952_2100 368
170 3300049568 Ga0501031_0025249 Ga0501031_0025249_1264_2433 368
171 3300049571 Ga0501034_0291744 Ga0501034_0291744_10_1179 368
172 3300049572 Ga0501036_0000410 Ga0501036_0000410_3094_4263 368
173 3300049573 Ga0501037_0023151 Ga0501037_0023151_1759_2928 368
174 3300049574 Ga0501038_0002491 Ga0501038_0002491_15771_16940 368
175 3300049575 Ga0501039_0004014 Ga0501039_0004014_2677_3846 368
176 3300049577 Ga0501041_0000442 Ga0501041_0000442_16439_17608 368
177 3300049578 Ga0501042_0004267 Ga0501042_0004267_5293_6462 368
178 3300049580 Ga0501046_0030030 Ga0501046_0030030_2471_3640 368
179 3300049582 Ga0501048_0000155 Ga0501048_0000155_19988_21157 368
180 3300049584 Ga0501068_0046580 Ga0501068_0046580_469_1638 368
181 3300049586 Ga0501070_0143874 Ga0501070_0143874_444_1613 368
182 3300049587 Ga0501071_0005640 Ga0501071_0005640_2704_3873 368
183 3300049587 Ga0501071_0184270 Ga0501071_0184270_282_1469 368
184 3300049588 Ga0501072_0006190 Ga0501072_0006190_3467_4636 368
185 3300049590 Ga0501074_0017274 Ga0501074_0017274_1907_3076 368
186 3300049591 Ga0501075_0001630 Ga0501075_0001630_8762_9931 368
187 3300049592 Ga0501076_0000457 Ga0501076_0000457_23995_25164 368
188 3300049593 Ga0501077_0000353 Ga0501077_0000353_1402_2571 368
189 3300049741 Ga0501079_0000271 Ga0501079_0000271_27383_28552 368
190 3300049742 Ga0501080_0026902 Ga0501080_0026902_1194_2363 368
191 3300049822 Ga0501035_0131797 Ga0501035_0131797_113_1282 368
192 3300049824 Ga0501045_0008822 Ga0501045_0008822_2881_4050 368
193 3300054114 Ga0501084_0332986 Ga0501084_0332986_70_1263 368
194 3300060353 Ga0501082_0000435 Ga0501082_0000435_24490_25659 368
195 3300061734 Ga0530510_0000096 Ga0530510_0000096_24467_25636 368
196 iso_pu_bacteria 2582581314 2585315997 368
197 iso_pu_bacteria 2585427649 2586061278 368
198 iso_pu_bacteria 2643221670 2644385987 368
199 iso_pu_bacteria 2671180195 2671838538 368
200 iso_pu_bacteria 2684623035 2686539048 368
201 iso_pu_bacteria 2687453743 2689990398 368
202 iso_pu_bacteria 2738541308 2738889358 368
203 iso_pu_bacteria 2773857922 2774856694 368
204 iso_pu_bacteria 2808606522 2809589632 368
205 iso_pu_bacteria 2837183177 2837185386 368
206 iso_pu_bacteria 2862507626 2862509832 368
207 iso_pu_bacteria 2895880812 2895883856 368
208 iso_pu_bacteria 2915768154 2915769704 368
209 iso_pu_bacteria 2919395869 2919398845 368
210 3300003373 JGI25407J50210_10008386 JGI25407J50210_100083861 369
211 3300005981 Ga0081538_10000174 Ga0081538_1000017437 369
212 3300005981 Ga0081538_10000644 Ga0081538_1000064427 369
213 3300005981 Ga0081538_10001092 Ga0081538_100010926 369
214 3300005981 Ga0081538_10002697 Ga0081538_100026977 369
215 3300005981 Ga0081538_10005256 Ga0081538_100052568 369
216 3300005981 Ga0081538_10007825 Ga0081538_1000782510 369
217 3300006852 Ga0075433_10079860 Ga0075433_100798602 369
218 3300006871 Ga0075434_100201022 Ga0075434_1002010223 369
219 3300009147 Ga0114129_10035947 Ga0114129_100359476 369
220 3300009147 Ga0114129_10360900 Ga0114129_103609001 369
221 3300031731 Ga0307405_10026476 Ga0307405_100264764 369
222 3300031731 Ga0307405_10161572 Ga0307405_101615722 369
223 3300031852 Ga0307410_10015336 Ga0307410_100153364 369
224 3300031901 Ga0307406_10039626 Ga0307406_100396265 369
225 3300031903 Ga0307407_10003243 Ga0307407_100032433 369
226 3300031903 Ga0307407_10027225 Ga0307407_100272255 369
227 3300031911 Ga0307412_10177560 Ga0307412_101775602 369
228 3300031995 Ga0307409_100000609 Ga0307409_1000006096 369
229 3300031995 Ga0307409_100007938 Ga0307409_1000079386 369
230 3300031995 Ga0307409_100052153 Ga0307409_1000521533 369
231 3300032002 Ga0307416_100005870 Ga0307416_1000058707 369
232 3300032002 Ga0307416_100015762 Ga0307416_1000157624 369
233 3300032002 Ga0307416_100026128 Ga0307416_1000261283 369
234 3300032002 Ga0307416_100026813 Ga0307416_1000268135 369
235 3300032004 Ga0307414_10016565 Ga0307414_100165657 369
236 3300032005 Ga0307411_10046872 Ga0307411_100468722 369
237 3300032126 Ga0307415_100003403 Ga0307415_1000034033 369
238 3300032126 Ga0307415_100012829 Ga0307415_1000128294 369
239 3300032126 Ga0307415_100043611 Ga0307415_1000436115 369
240 3300032126 Ga0307415_100077521 Ga0307415_1000775213 369
241 3300042008 Ga0439450_000293 Ga0439450_000293_3655_4851 369
242 3300042012 Ga0439455_0004175 Ga0439455_0004175_287_1483 369
243 3300042016 Ga0439463_000426 Ga0439463_000426_2401_3597 369
244 3300042142 Ga0450905_001621 Ga0450905_001621_931_2127 369
245 3300042439 Ga0439464_0012368 Ga0439464_0012368_76_1272 369
246 3300046463 Ga0495653_0048847 Ga0495653_0048847_179_1372 369
247 3300046499 Ga0495594_0052211 Ga0495594_0052211_1009_2214 369
248 3300046511 Ga0495608_0004452 Ga0495608_0004452_1583_2776 369
249 3300046536 Ga0495587_0027163 Ga0495587_0027163_1949_3142 369
250 3300046559 Ga0495667_0007993 Ga0495667_0007993_335_1528 369
251 3300046675 Ga0495657_0012077 Ga0495657_0012077_3486_4679 369
252 3300046809 Ga0495600_0049762 Ga0495600_0049762_34_1227 369
253 3300047317 Ga0495604_0149658 Ga0495604_0149658_248_1441 369
254 3300047322 Ga0495680_0022189 Ga0495680_0022189_179_1372 369
255 3300047444 Ga0495675_0004188 Ga0495675_0004188_5522_6715 369
256 3300047471 Ga0495684_0067820 Ga0495684_0067820_1451_2644 369
257 3300048088 Ga0495602_0119001 Ga0495602_0119001_874_2067 369
258 3300048913 Ga0496110_0043162 Ga0496110_0043162_886_2061 369
259 3300049570 Ga0501033_0000295 Ga0501033_0000295_25291_26484 369
260 3300049581 Ga0501047_0166175 Ga0501047_0166175_821_2047 369
261 3300050512 nmdc:mga0n895_18738_c1 nmdc:mga0n895_18738_c1_677_1879 369
262 3300050515 nmdc:mga0a205_10249_c1 nmdc:mga0a205_10249_c1_3276_4478 369
263 3300053084 Ga0495595_0020057 Ga0495595_0020057_1464_2657 369
264 3300005445 Ga0070708_100002162 Ga0070708_10000216210 370
265 3300005468 Ga0070707_100061260 Ga0070707_1000612604 370
266 3300021384 Ga0213876_10020134 Ga0213876_100201342 370
267 3300025922 Ga0207646_10052652 Ga0207646_100526522 370
268 3300030521 Ga0307511_10082344 Ga0307511_100823442 370
269 3300030522 Ga0307512_10006934 Ga0307512_1000693411 370
270 3300038443 Ga0395901_0017089 Ga0395901_0017089_3029_4198 370
271 3300039437 Ga0436365_1521394 Ga0436365_1521394_976_2175 370
272 3300046517 Ga0495630_0077856 Ga0495630_0077856_546_1754 370
273 3300048908 Ga0496105_0152102 Ga0496105_0152102_133_1275 370
274 3300048913 Ga0496110_0272086 Ga0496110_0272086_110_1315 370
275 3300049571 Ga0501034_0027637 Ga0501034_0027637_1332_2519 370
276 3300049573 Ga0501037_0011155 Ga0501037_0011155_2341_3528 370
277 3300049584 Ga0501068_0001141 Ga0501068_0001141_6789_7976 370
278 3300049586 Ga0501070_0007683 Ga0501070_0007683_7655_8842 370
279 3300049588 Ga0501072_0024373 Ga0501072_0024373_1053_2240 370
280 3300049589 Ga0501073_0008544 Ga0501073_0008544_1985_3172 370
281 3300049590 Ga0501074_0003776 Ga0501074_0003776_7047_8234 370
282 3300049742 Ga0501080_0001144 Ga0501080_0001144_12485_13672 370
283 3300053142 Ga0500577_0007500 Ga0500577_0007500_1358_2521 370
284 3300003203 JGI25406J46586_10042249 JGI25406J46586_100422492 371
285 3300003578 Ga0006562J51391_1026012 Ga0006562J51391_102601214 371
286 3300003578 Ga0006562J51391_1026013 Ga0006562J51391_10260132 371
287 3300005328 Ga0070676_10050975 Ga0070676_100509753 371
288 3300005445 Ga0070708_100000349 Ga0070708_1000003497 371
289 3300005445 Ga0070708_100001311 Ga0070708_10000131117 371
290 3300005445 Ga0070708_100022101 Ga0070708_1000221012 371
291 3300005467 Ga0070706_100003646 Ga0070706_1000036463 371
292 3300005468 Ga0070707_100002591 Ga0070707_10000259114 371
293 3300005468 Ga0070707_100072303 Ga0070707_1000723032 371
294 3300005471 Ga0070698_100033429 Ga0070698_1000334293 371
295 3300005535 Ga0070684_100187761 Ga0070684_1001877612 371
296 3300005543 Ga0070672_100125493 Ga0070672_1001254932 371
297 3300005546 Ga0070696_100042987 Ga0070696_1000429874 371
298 3300005985 Ga0081539_10000257 Ga0081539_1000025734 371
299 3300007076 Ga0075435_100081727 Ga0075435_1000817274 371
300 3300009101 Ga0105247_10000098 Ga0105247_1000009840 371
301 3300009147 Ga0114129_10362527 Ga0114129_103625272 371
302 3300009177 Ga0105248_10009163 Ga0105248_100091634 371
303 3300014325 Ga0163163_10050489 Ga0163163_100504891 371
304 3300014968 Ga0157379_10030912 Ga0157379_100309122 371
305 3300025900 Ga0207710_10000065 Ga0207710_1000006545 371
306 3300025910 Ga0207684_10003142 Ga0207684_1000314214 371
307 3300025910 Ga0207684_10074978 Ga0207684_100749781 371
308 3300025922 Ga0207646_10143856 Ga0207646_101438562 371
309 3300025929 Ga0207664_10137394 Ga0207664_101373942 371
310 3300025940 Ga0207691_10020316 Ga0207691_100203165 371
311 3300026121 Ga0207683_10146554 Ga0207683_101465542 371
312 3300028666 Ga0265336_10016311 Ga0265336_100163112 371
313 3300035692 Ga0373935_0079239 Ga0373935_0079239_693_1904 371
314 3300035725 Ga0373947_0006797 Ga0373947_0006797_3287_4498 371
315 3300037068 Ga0373925_0014597 Ga0373925_0014597_2654_3865 371
316 3300037853 Ga0436364_0227828 Ga0436364_0227828_222_1412 371
317 3300039062 Ga0400483_019236 Ga0400483_019236_3125_4297 371
318 3300039062 Ga0400483_284406 Ga0400483_284406_2056_3228 371
319 3300042435 Ga0439434_0018890 Ga0439434_0018890_446_1657 371
320 3300044683 Ga0466965_0020704 Ga0466965_0020704_949_2124 371
321 3300046459 Ga0495629_0008205 Ga0495629_0008205_1796_3007 371
322 3300046473 Ga0495582_0000090 Ga0495582_0000090_36635_37846 371
323 3300046475 Ga0495639_0010081 Ga0495639_0010081_1404_2615 371
324 3300046531 Ga0495665_0011841 Ga0495665_0011841_1471_2682 371
325 3300046678 Ga0495599_0117725 Ga0495599_0117725_376_1590 371
326 3300046683 Ga0495658_0000460 Ga0495658_0000460_15596_16807 371
327 3300046689 Ga0495613_0000300 Ga0495613_0000300_12922_14133 371
328 3300047315 Ga0495581_0006491 Ga0495581_0006491_3621_4832 371
329 3300047322 Ga0495680_0240434 Ga0495680_0240434_53_1267 371
330 3300047673 Ga0495593_0095353 Ga0495593_0095353_28_1224 371
331 3300048908 Ga0496105_0142424 Ga0496105_0142424_379_1545 371
332 3300048914 Ga0496111_0048717 Ga0496111_0048717_1307_2473 371
333 3300048922 Ga0496119_0000389 Ga0496119_0000389_43735_44940 371
334 3300048923 Ga0496120_0000475 Ga0496120_0000475_43735_44940 371
335 3300048928 Ga0496125_0000444 Ga0496125_0000444_23501_24673 371
336 3300048929 Ga0496126_0079526 Ga0496126_0079526_1286_2449 371
337 3300049570 Ga0501033_0044076 Ga0501033_0044076_580_1758 371
338 3300049572 Ga0501036_0045934 Ga0501036_0045934_239_1417 371
339 3300049574 Ga0501038_0139617 Ga0501038_0139617_310_1488 371
340 3300049575 Ga0501039_0020815 Ga0501039_0020815_1910_3088 371
341 3300049576 Ga0501040_0032827 Ga0501040_0032827_676_1854 371
342 3300049577 Ga0501041_0007625 Ga0501041_0007625_3112_4290 371
343 3300049578 Ga0501042_0013485 Ga0501042_0013485_3862_5040 371
344 3300049579 Ga0501043_0045035 Ga0501043_0045035_559_1737 371
345 3300049580 Ga0501046_0016496 Ga0501046_0016496_1522_2700 371
346 3300049582 Ga0501048_0010061 Ga0501048_0010061_2772_3950 371
347 3300049584 Ga0501068_0026225 Ga0501068_0026225_2118_3296 371
348 3300049585 Ga0501069_0000034 Ga0501069_0000034_77063_78250 371
349 3300049586 Ga0501070_0000013 Ga0501070_0000013_92725_93912 371
350 3300049587 Ga0501071_0003071 Ga0501071_0003071_8133_9320 371
351 3300049590 Ga0501074_0080181 Ga0501074_0080181_340_1518 371
352 3300049593 Ga0501077_0007087 Ga0501077_0007087_2198_3376 371
353 3300049741 Ga0501079_0011345 Ga0501079_0011345_3011_4189 371
354 3300049822 Ga0501035_0103241 Ga0501035_0103241_769_1947 371
355 3300049824 Ga0501045_0023862 Ga0501045_0023862_2671_3849 371
356 3300050511 nmdc:mga08y16_72784_c1 nmdc:mga08y16_72784_c1_366_1520 371
357 3300053077 Ga0495601_0058473 Ga0495601_0058473_526_1740 371
358 3300060353 Ga0501082_0032315 Ga0501082_0032315_2264_3448 371
359 3300061734 Ga0530510_0008881 Ga0530510_0008881_4852_6030 371
360 iso_pu_bacteria 2857710386 2857710763 371
361 3300005334 Ga0068869_100112712 Ga0068869_1001127122 372
362 3300005335 Ga0070666_10017054 Ga0070666_100170542 372
363 3300005338 Ga0068868_100015846 Ga0068868_1000158462 372
364 3300005339 Ga0070660_100200036 Ga0070660_1002000362 372
365 3300005341 Ga0070691_10037150 Ga0070691_100371502 372
366 3300005345 Ga0070692_10018697 Ga0070692_100186971 372
367 3300005347 Ga0070668_100052643 Ga0070668_1000526432 372
368 3300005356 Ga0070674_100106223 Ga0070674_1001062232 372
369 3300005365 Ga0070688_100069407 Ga0070688_1000694072 372
370 3300005367 Ga0070667_100138603 Ga0070667_1001386031 372
371 3300005435 Ga0070714_100016670 Ga0070714_1000166702 372
372 3300005435 Ga0070714_100294540 Ga0070714_1002945401 372
373 3300005436 Ga0070713_100036605 Ga0070713_1000366054 372
374 3300005440 Ga0070705_100027206 Ga0070705_1000272061 372
375 3300005440 Ga0070705_100110883 Ga0070705_1001108832 372
376 3300005444 Ga0070694_100027435 Ga0070694_1000274354 372
377 3300005445 Ga0070708_100000690 Ga0070708_10000069031 372
378 3300005445 Ga0070708_100077002 Ga0070708_1000770021 372
379 3300005445 Ga0070708_100110460 Ga0070708_1001104603 372
380 3300005445 Ga0070708_100251797 Ga0070708_1002517971 372
381 3300005445 Ga0070708_100326978 Ga0070708_1003269781 372
382 3300005455 Ga0070663_100230046 Ga0070663_1002300461 372
383 3300005457 Ga0070662_100014694 Ga0070662_1000146944 372
384 3300005458 Ga0070681_10063857 Ga0070681_100638573 372
385 3300005467 Ga0070706_100000468 Ga0070706_10000046818 372
386 3300005467 Ga0070706_100001386 Ga0070706_10000138631 372
387 3300005468 Ga0070707_100001184 Ga0070707_1000011841 372
388 3300005468 Ga0070707_100005919 Ga0070707_10000591916 372
389 3300005468 Ga0070707_100089632 Ga0070707_1000896321 372
390 3300005468 Ga0070707_100149077 Ga0070707_1001490771 372
391 3300005471 Ga0070698_100048615 Ga0070698_1000486153 372
392 3300005471 Ga0070698_100149232 Ga0070698_1001492322 372
393 3300005518 Ga0070699_100001383 Ga0070699_10000138311 372
394 3300005518 Ga0070699_100006603 Ga0070699_1000066034 372
395 3300005518 Ga0070699_100013622 Ga0070699_1000136221 372
396 3300005518 Ga0070699_100237630 Ga0070699_1002376301 372
397 3300005518 Ga0070699_100248637 Ga0070699_1002486371 372
398 3300005536 Ga0070697_100000009 Ga0070697_10000000959 372
399 3300005536 Ga0070697_100016676 Ga0070697_1000166762 372
400 3300005536 Ga0070697_100031234 Ga0070697_1000312341 372
401 3300005536 Ga0070697_100075680 Ga0070697_1000756802 372
402 3300005536 Ga0070697_100190997 Ga0070697_1001909972 372
403 3300005536 Ga0070697_100202062 Ga0070697_1002020622 372
404 3300005536 Ga0070697_100215866 Ga0070697_1002158661 372
405 3300005536 Ga0070697_100234357 Ga0070697_1002343572 372
406 3300005545 Ga0070695_100065244 Ga0070695_1000652441 372
407 3300005547 Ga0070693_100018180 Ga0070693_1000181802 372
408 3300005548 Ga0070665_100072091 Ga0070665_1000720913 372
409 3300005549 Ga0070704_100000858 Ga0070704_10000085818 372
410 3300005549 Ga0070704_100006236 Ga0070704_1000062366 372
411 3300005549 Ga0070704_100030090 Ga0070704_1000300903 372
412 3300005563 Ga0068855_100205411 Ga0068855_1002054112 372
413 3300005563 Ga0068855_100288539 Ga0068855_1002885391 372
414 3300005578 Ga0068854_100005717 Ga0068854_1000057176 372
415 3300005614 Ga0068856_100066302 Ga0068856_1000663023 372
416 3300005614 Ga0068856_100148439 Ga0068856_1001484392 372
417 3300005615 Ga0070702_100014359 Ga0070702_1000143592 372
418 3300005618 Ga0068864_100185407 Ga0068864_1001854072 372
419 3300005719 Ga0068861_100017995 Ga0068861_1000179953 372
420 3300005834 Ga0068851_10002905 Ga0068851_100029058 372
421 3300005840 Ga0068870_10057281 Ga0068870_100572811 372
422 3300005841 Ga0068863_100036931 Ga0068863_1000369313 372
423 3300005842 Ga0068858_100016152 Ga0068858_1000161525 372
424 3300005843 Ga0068860_100120828 Ga0068860_1001208282 372
425 3300005937 Ga0081455_10032862 Ga0081455_100328622 372
426 3300005983 Ga0081540_1045757 Ga0081540_10457572 372
427 3300006028 Ga0070717_10020785 Ga0070717_100207856 372
428 3300006038 Ga0075365_10064373 Ga0075365_100643733 372
429 3300006163 Ga0070715_10011734 Ga0070715_100117343 372
430 3300006173 Ga0070716_100053469 Ga0070716_1000534692 372
431 3300006852 Ga0075433_10226758 Ga0075433_102267582 372
432 3300006871 Ga0075434_100031972 Ga0075434_1000319723 372
433 3300007076 Ga0075435_100005151 Ga0075435_1000051516 372
434 3300007076 Ga0075435_100215259 Ga0075435_1002152593 372
435 3300007265 Ga0099794_10008996 Ga0099794_100089964 372
436 3300007265 Ga0099794_10014117 Ga0099794_100141175 372
437 3300009093 Ga0105240_10465368 Ga0105240_104653681 372
438 3300009098 Ga0105245_10045220 Ga0105245_100452204 372
439 3300009147 Ga0114129_10358109 Ga0114129_103581092 372
440 3300009148 Ga0105243_10050562 Ga0105243_100505623 372
441 3300009174 Ga0105241_10040303 Ga0105241_100403033 372
442 3300009545 Ga0105237_10283529 Ga0105237_102835291 372
443 3300011119 Ga0105246_10019387 Ga0105246_100193872 372
444 3300013102 Ga0157371_10176806 Ga0157371_101768062 372
445 3300013104 Ga0157370_10069263 Ga0157370_100692631 372
446 3300013105 Ga0157369_10066535 Ga0157369_100665354 372
447 3300013307 Ga0157372_10233349 Ga0157372_102333492 372
448 3300013308 Ga0157375_10242880 Ga0157375_102428802 372
449 3300014326 Ga0157380_10000641 Ga0157380_100006417 372
450 3300014969 Ga0157376_10104047 Ga0157376_101040472 372
451 3300017792 Ga0163161_10002689 Ga0163161_100026893 372
452 3300021384 Ga0213876_10013319 Ga0213876_100133193 372
453 3300021384 Ga0213876_10129089 Ga0213876_101290891 372
454 3300024225 Ga0224572_1003464 Ga0224572_10034642 372
455 3300025900 Ga0207710_10027973 Ga0207710_100279733 372
456 3300025901 Ga0207688_10000775 Ga0207688_100007758 372
457 3300025903 Ga0207680_10144248 Ga0207680_101442482 372
458 3300025906 Ga0207699_10180315 Ga0207699_101803152 372
459 3300025908 Ga0207643_10063592 Ga0207643_100635921 372
460 3300025910 Ga0207684_10000003 Ga0207684_10000003668 372
461 3300025910 Ga0207684_10000165 Ga0207684_1000016538 372
462 3300025910 Ga0207684_10000936 Ga0207684_1000093611 372
463 3300025910 Ga0207684_10010250 Ga0207684_100102503 372
464 3300025910 Ga0207684_10013997 Ga0207684_100139976 372
465 3300025911 Ga0207654_10037418 Ga0207654_100374182 372
466 3300025912 Ga0207707_10166585 Ga0207707_101665852 372
467 3300025915 Ga0207693_10000510 Ga0207693_100005106 372
468 3300025917 Ga0207660_10195385 Ga0207660_101953851 372
469 3300025918 Ga0207662_10041671 Ga0207662_100416712 372
470 3300025919 Ga0207657_10029316 Ga0207657_100293162 372
471 3300025922 Ga0207646_10000079 Ga0207646_1000007917 372
472 3300025922 Ga0207646_10001830 Ga0207646_100018301 372
473 3300025922 Ga0207646_10001851 Ga0207646_100018515 372
474 3300025922 Ga0207646_10002086 Ga0207646_100020864 372
475 3300025922 Ga0207646_10006689 Ga0207646_100066894 372
476 3300025922 Ga0207646_10011708 Ga0207646_100117081 372
477 3300025922 Ga0207646_10027719 Ga0207646_100277195 372
478 3300025922 Ga0207646_10046359 Ga0207646_100463594 372
479 3300025922 Ga0207646_10138431 Ga0207646_101384311 372
480 3300025924 Ga0207694_10099575 Ga0207694_100995752 372
481 3300025927 Ga0207687_10006821 Ga0207687_100068215 372
482 3300025928 Ga0207700_10092464 Ga0207700_100924642 372
483 3300025929 Ga0207664_10052865 Ga0207664_100528654 372
484 3300025929 Ga0207664_10068716 Ga0207664_100687161 372
485 3300025932 Ga0207690_10068110 Ga0207690_100681102 372
486 3300025933 Ga0207706_10020512 Ga0207706_100205123 372
487 3300025935 Ga0207709_10024077 Ga0207709_100240771 372
488 3300025939 Ga0207665_10001555 Ga0207665_100015556 372
489 3300025940 Ga0207691_10101701 Ga0207691_101017012 372
490 3300025949 Ga0207667_10026130 Ga0207667_100261305 372
491 3300025949 Ga0207667_10452242 Ga0207667_104522421 372
492 3300025960 Ga0207651_10106329 Ga0207651_101063291 372
493 3300025961 Ga0207712_10044475 Ga0207712_100444753 372
494 3300025972 Ga0207668_10012138 Ga0207668_100121384 372
495 3300026023 Ga0207677_10036659 Ga0207677_100366593 372
496 3300026067 Ga0207678_10043812 Ga0207678_100438122 372
497 3300026078 Ga0207702_10267283 Ga0207702_102672832 372
498 3300026089 Ga0207648_10073321 Ga0207648_100733212 372
499 3300026089 Ga0207648_10209177 Ga0207648_102091772 372
500 3300026118 Ga0207675_100003148 Ga0207675_10000314812 372
501 3300026121 Ga0207683_10035867 Ga0207683_100358672 372
502 3300026142 Ga0207698_10047547 Ga0207698_100475473 372
503 3300028381 Ga0268264_10099798 Ga0268264_100997983 372
504 3300028786 Ga0307517_10013216 Ga0307517_100132168 372
505 3300028794 Ga0307515_10001941 Ga0307515_1000194121 372
506 3300028800 Ga0265338_10014711 Ga0265338_1001471110 372
507 3300030521 Ga0307511_10000323 Ga0307511_1000032319 372
508 3300031090 Ga0265760_10025587 Ga0265760_100255872 372
509 3300031507 Ga0307509_10007688 Ga0307509_1000768814 372
510 3300031507 Ga0307509_10034641 Ga0307509_100346415 372
511 3300031507 Ga0307509_10039411 Ga0307509_100394114 372
512 3300031691 Ga0316579_10035162 Ga0316579_100351621 372
513 3300031727 Ga0316576_10009839 Ga0316576_100098399 372
514 3300031838 Ga0307518_10001877 Ga0307518_100018778 372
515 3300031838 Ga0307518_10024558 Ga0307518_100245582 372
516 3300031852 Ga0307410_10069765 Ga0307410_100697652 372
517 3300031903 Ga0307407_10004134 Ga0307407_100041343 372
518 3300032002 Ga0307416_100002852 Ga0307416_1000028528 372
519 3300032004 Ga0307414_10266013 Ga0307414_102660131 372
520 3300033179 Ga0307507_10036876 Ga0307507_100368764 372
521 3300033179 Ga0307507_10042562 Ga0307507_100425624 372
522 3300033180 Ga0307510_10023432 Ga0307510_100234325 372
523 3300035112 Ga0373932_0015720 Ga0373932_0015720_203_1366 372
524 3300035121 Ga0373960_0001783 Ga0373960_0001783_2330_3493 372
525 3300035725 Ga0373947_0104014 Ga0373947_0104014_113_1267 372
526 3300036401 Ga0373937_0007793 Ga0373937_0007793_4092_5312 372
527 3300036712 Ga0316584_0117736 Ga0316584_0117736_637_1842 372
528 3300037068 Ga0373925_0098705 Ga0373925_0098705_556_1704 372
529 3300037312 Ga0395899_0060476 Ga0395899_0060476_61_1245 372
530 3300037418 Ga0395900_0005157 Ga0395900_0005157_4040_5224 372
531 3300037418 Ga0395900_0026195 Ga0395900_0026195_3643_4836 372
532 3300037466 Ga0395898_0001347 Ga0395898_0001347_13445_14629 372
533 3300037853 Ga0436364_0071314 Ga0436364_0071314_5043_6218 372
534 3300038443 Ga0395901_0003177 Ga0395901_0003177_13235_14428 372
535 3300039062 Ga0400483_062449 Ga0400483_062449_16458_17651 372
536 3300039062 Ga0400483_155225 Ga0400483_155225_17866_19059 372
537 3300039437 Ga0436365_0300094 Ga0436365_0300094_721_1911 372
538 3300039437 Ga0436365_0555887 Ga0436365_0555887_3451_4641 372
539 3300039437 Ga0436365_1830951 Ga0436365_1830951_4632_5807 372
540 3300044658 Ga0466972_0002652 Ga0466972_0002652_4039_5199 372
541 3300044683 Ga0466965_0000829 Ga0466965_0000829_9192_10352 372
542 3300044694 Ga0466963_0041537 Ga0466963_0041537_774_1967 372
543 3300044735 Ga0466968_0002914 Ga0466968_0002914_4653_5813 372
544 3300044842 Ga0466957_0036488 Ga0466957_0036488_1159_2352 372
545 3300044901 Ga0466960_0006439 Ga0466960_0006439_1352_2512 372
546 3300044901 Ga0466960_0008614 Ga0466960_0008614_2777_3973 372
547 3300044901 Ga0466960_0024394 Ga0466960_0024394_1429_2610 372
548 3300045976 Ga0466967_0043369 Ga0466967_0043369_2182_3375 372
549 3300046454 Ga0495592_0016002 Ga0495592_0016002_3065_4234 372
550 3300046459 Ga0495629_0008634 Ga0495629_0008634_2188_3396 372
551 3300046459 Ga0495629_0042053 Ga0495629_0042053_135_1304 372
552 3300046462 Ga0495651_0010451 Ga0495651_0010451_3958_5127 372
553 3300046463 Ga0495653_0030857 Ga0495653_0030857_1888_3075 372
554 3300046476 Ga0495662_0002198 Ga0495662_0002198_6296_7465 372
555 3300046477 Ga0495664_0008145 Ga0495664_0008145_1207_2376 372
556 3300046499 Ga0495594_0018322 Ga0495594_0018322_1996_3189 372
557 3300046514 Ga0495618_0056451 Ga0495618_0056451_126_1295 372
558 3300046517 Ga0495630_0016110 Ga0495630_0016110_1905_3074 372
559 3300046529 Ga0495652_0004136 Ga0495652_0004136_9535_10704 372
560 3300046535 Ga0495586_0013777 Ga0495586_0013777_2490_3680 372
561 3300046536 Ga0495587_0002869 Ga0495587_0002869_489_1658 372
562 3300046559 Ga0495667_0093642 Ga0495667_0093642_317_1477 372
563 3300046642 Ga0495634_0006466 Ga0495634_0006466_7316_8506 372
564 3300046642 Ga0495634_0021313 Ga0495634_0021313_3246_4415 372
565 3300046675 Ga0495657_0022922 Ga0495657_0022922_1821_3023 372
566 3300046675 Ga0495657_0038755 Ga0495657_0038755_31_1200 372
567 3300046680 Ga0495646_0001733 Ga0495646_0001733_5172_6341 372
568 3300046683 Ga0495658_0048171 Ga0495658_0048171_60_1229 372
569 3300046689 Ga0495613_0000766 Ga0495613_0000766_11756_12925 372
570 3300046689 Ga0495613_0001705 Ga0495613_0001705_11115_12305 372
571 3300046689 Ga0495613_0113885 Ga0495613_0113885_372_1541 372
572 3300046690 Ga0495624_0115254 Ga0495624_0115254_125_1294 372
573 3300046692 Ga0495671_0011122 Ga0495671_0011122_1858_3066 372
574 3300046809 Ga0495600_0002700 Ga0495600_0002700_1909_3078 372
575 3300047315 Ga0495581_0001688 Ga0495581_0001688_2605_3774 372
576 3300047317 Ga0495604_0001598 Ga0495604_0001598_3374_4543 372
577 3300047321 Ga0495676_0012384 Ga0495676_0012384_3346_4515 372
578 3300047322 Ga0495680_0002690 Ga0495680_0002690_15265_16443 372
579 3300047322 Ga0495680_0136627 Ga0495680_0136627_206_1393 372
580 3300047443 Ga0495687_002224 Ga0495687_002224_1553_2737 372
581 3300047470 Ga0495681_0004568 Ga0495681_0004568_4657_5865 372
582 3300047471 Ga0495684_0054667 Ga0495684_0054667_30_1199 372
583 3300047673 Ga0495593_0013517 Ga0495593_0013517_893_2062 372
584 3300048088 Ga0495602_0008914 Ga0495602_0008914_5922_7091 372
585 3300048089 Ga0495614_0013108 Ga0495614_0013108_281_1450 372
586 3300048907 Ga0496104_0032050 Ga0496104_0032050_3527_4690 372
587 3300048909 Ga0496106_0073680 Ga0496106_0073680_1249_2412 372
588 3300048911 Ga0496108_0000349 Ga0496108_0000349_29613_30824 372
589 3300048911 Ga0496108_0011709 Ga0496108_0011709_2734_3897 372
590 3300048911 Ga0496108_0059914 Ga0496108_0059914_1025_2173 372
591 3300048911 Ga0496108_0177972 Ga0496108_0177972_490_1686 372
592 3300048912 Ga0496109_0008376 Ga0496109_0008376_861_2009 372
593 3300048913 Ga0496110_0102224 Ga0496110_0102224_162_1310 372
594 3300048915 Ga0496112_0000329 Ga0496112_0000329_23466_24614 372
595 3300048917 Ga0496114_0207978 Ga0496114_0207978_151_1347 372
596 3300048924 Ga0496121_0030700 Ga0496121_0030700_68_1249 372
597 3300048927 Ga0496124_0091490 Ga0496124_0091490_1070_2221 372
598 3300049581 Ga0501047_0000176 Ga0501047_0000176_17411_18604 372
599 3300049582 Ga0501048_0221888 Ga0501048_0221888_122_1315 372
600 3300049583 Ga0501067_0043880 Ga0501067_0043880_837_2027 372
601 3300049585 Ga0501069_0087503 Ga0501069_0087503_99_1253 372
602 3300049587 Ga0501071_0038360 Ga0501071_0038360_1000_2178 372
603 3300049588 Ga0501072_0250527 Ga0501072_0250527_183_1373 372
604 3300050492 nmdc:mga0yw44_53050_c1 nmdc:mga0yw44_53050_c1_1124_2320 372
605 3300050513 nmdc:mga0rr50_17965_c1 nmdc:mga0rr50_17965_c1_1487_2650 372
606 3300050513 nmdc:mga0rr50_265733_c1 nmdc:mga0rr50_265733_c1_228_1382 372
607 3300050515 nmdc:mga0a205_27932_c1 nmdc:mga0a205_27932_c1_2521_3684 372
608 3300053077 Ga0495601_0052164 Ga0495601_0052164_549_1736 372
609 3300053085 Ga0495619_0014472 Ga0495619_0014472_3013_4200 372
610 3300003373 JGI25407J50210_10001942 JGI25407J50210_100019422 373
611 3300005434 Ga0070709_10000415 Ga0070709_100004159 373
612 3300005435 Ga0070714_100013426 Ga0070714_1000134264 373
613 3300005435 Ga0070714_100023393 Ga0070714_1000233932 373
614 3300005435 Ga0070714_100085394 Ga0070714_1000853943 373
615 3300005436 Ga0070713_100001671 Ga0070713_1000016719 373
616 3300005436 Ga0070713_100004967 Ga0070713_1000049675 373
617 3300005439 Ga0070711_100022978 Ga0070711_1000229783 373
618 3300005445 Ga0070708_100010514 Ga0070708_1000105142 373
619 3300005445 Ga0070708_100024160 Ga0070708_1000241602 373
620 3300005445 Ga0070708_100043431 Ga0070708_1000434312 373
621 3300005445 Ga0070708_100044355 Ga0070708_1000443552 373
622 3300005445 Ga0070708_100087507 Ga0070708_1000875071 373
623 3300005458 Ga0070681_10056306 Ga0070681_100563064 373
624 3300005458 Ga0070681_10067382 Ga0070681_100673821 373
625 3300005467 Ga0070706_100000135 Ga0070706_1000001352 373
626 3300005467 Ga0070706_100058229 Ga0070706_1000582293 373
627 3300005468 Ga0070707_100133679 Ga0070707_1001336791 373
628 3300005471 Ga0070698_100090061 Ga0070698_1000900613 373
629 3300005471 Ga0070698_100132234 Ga0070698_1001322341 373
630 3300005518 Ga0070699_100361392 Ga0070699_1003613921 373
631 3300005530 Ga0070679_100024392 Ga0070679_1000243922 373
632 3300005719 Ga0068861_100057942 Ga0068861_1000579423 373
633 3300005937 Ga0081455_10001381 Ga0081455_100013811 373
634 3300005981 Ga0081538_10000273 Ga0081538_1000027319 373
635 3300006028 Ga0070717_10000453 Ga0070717_1000045312 373
636 3300006028 Ga0070717_10003196 Ga0070717_100031967 373
637 3300006028 Ga0070717_10021370 Ga0070717_100213705 373
638 3300006028 Ga0070717_10023206 Ga0070717_100232064 373
639 3300006038 Ga0075365_10111027 Ga0075365_101110272 373
640 3300006051 Ga0075364_10002900 Ga0075364_100029005 373
641 3300006051 Ga0075364_10004132 Ga0075364_100041323 373
642 3300006844 Ga0075428_100000070 Ga0075428_10000007049 373
643 3300007076 Ga0075435_100042206 Ga0075435_1000422062 373
644 3300009993 Ga0105028_102375 Ga0105028_1023752 373
645 3300020081 Ga0206354_10723939 Ga0206354_107239391 373
646 3300021377 Ga0213874_10001931 Ga0213874_100019314 373
647 3300022467 Ga0224712_10053583 Ga0224712_100535831 373
648 3300025906 Ga0207699_10000059 Ga0207699_1000005972 373
649 3300025910 Ga0207684_10000046 Ga0207684_10000046286 373
650 3300025910 Ga0207684_10008463 Ga0207684_100084632 373
651 3300025910 Ga0207684_10102360 Ga0207684_101023602 373
652 3300025910 Ga0207684_10280775 Ga0207684_102807752 373
653 3300025921 Ga0207652_10011392 Ga0207652_100113924 373
654 3300025922 Ga0207646_10007282 Ga0207646_1000728211 373
655 3300025922 Ga0207646_10056126 Ga0207646_100561264 373
656 3300025928 Ga0207700_10008954 Ga0207700_100089542 373
657 3300025929 Ga0207664_10055572 Ga0207664_100555722 373
658 3300025939 Ga0207665_10005098 Ga0207665_100050984 373
659 3300025961 Ga0207712_10041248 Ga0207712_100412484 373
660 3300025981 Ga0207640_10231665 Ga0207640_102316651 373
661 3300028786 Ga0307517_10153658 Ga0307517_101536582 373
662 3300031251 Ga0265327_10000980 Ga0265327_1000098035 373
663 3300031251 Ga0265327_10001997 Ga0265327_100019975 373
664 3300031548 Ga0307408_100193896 Ga0307408_1001938962 373
665 3300031727 Ga0316576_10059141 Ga0316576_100591413 373
666 3300031727 Ga0316576_10079768 Ga0316576_100797683 373
667 3300031728 Ga0316578_10002290 Ga0316578_100022906 373
668 3300031733 Ga0316577_10006615 Ga0316577_100066157 373
669 3300032139 Ga0316580_10004372 Ga0316580_100043726 373
670 3300035118 Ga0373954_0009972 Ga0373954_0009972_650_1807 373
671 3300035398 Ga0316574_0137360 Ga0316574_0137360_354_1520 373
672 3300035692 Ga0373935_0059741 Ga0373935_0059741_311_1468 373
673 3300035695 Ga0373927_0040910 Ga0373927_0040910_1504_2661 373
674 3300036401 Ga0373937_0286366 Ga0373937_0286366_268_1425 373
675 3300036401 Ga0373937_0357658 Ga0373937_0357658_169_1326 373
676 3300036647 Ga0316582_0011567 Ga0316582_0011567_3139_4290 373
677 3300037068 Ga0373925_0078863 Ga0373925_0078863_311_1468 373
678 3300038443 Ga0395901_0159201 Ga0395901_0159201_1039_2271 373
679 3300038443 Ga0395901_0367075 Ga0395901_0367075_91_1260 373
680 3300038735 Ga0400485_06590 Ga0400485_06590_615_1784 373
681 3300039437 Ga0436365_1184635 Ga0436365_1184635_5299_6486 373
682 3300039450 Ga0436363_1641403 Ga0436363_1641403_1116_2282 373
683 3300039450 Ga0436363_1707329 Ga0436363_1707329_1627_2793 373
684 3300039453 Ga0436362_0747267 Ga0436362_0747267_210_1400 373
685 3300046472 Ga0495580_0008231 Ga0495580_0008231_5276_6433 373
686 3300047315 Ga0495581_0152536 Ga0495581_0152536_20_1177 373
687 3300047320 Ga0495672_0002312 Ga0495672_0002312_11177_12367 373
688 3300047320 Ga0495672_0003473 Ga0495672_0003473_10635_11828 373
689 3300047320 Ga0495672_0010268 Ga0495672_0010268_3776_5005 373
690 3300047320 Ga0495672_0065032 Ga0495672_0065032_849_2018 373
691 3300047321 Ga0495676_0172163 Ga0495676_0172163_15_1247 373
692 3300048915 Ga0496112_0078138 Ga0496112_0078138_533_1687 373
693 3300049568 Ga0501031_0002717 Ga0501031_0002717_4473_5651 373
694 3300049568 Ga0501031_0006690 Ga0501031_0006690_4119_5294 373
695 3300049570 Ga0501033_0114065 Ga0501033_0114065_540_1718 373
696 3300049570 Ga0501033_0225810 Ga0501033_0225810_77_1255 373
697 3300049572 Ga0501036_0000993 Ga0501036_0000993_2153_3331 373
698 3300049572 Ga0501036_0085912 Ga0501036_0085912_1280_2455 373
699 3300049572 Ga0501036_0342460 Ga0501036_0342460_25_1191 373
700 3300049573 Ga0501037_0155405 Ga0501037_0155405_329_1504 373
701 3300049574 Ga0501038_0043562 Ga0501038_0043562_2152_3330 373
702 3300049574 Ga0501038_0108141 Ga0501038_0108141_960_2135 373
703 3300049575 Ga0501039_0010937 Ga0501039_0010937_3703_4878 373
704 3300049575 Ga0501039_0139390 Ga0501039_0139390_26_1204 373
705 3300049576 Ga0501040_0017237 Ga0501040_0017237_3112_4287 373
706 3300049576 Ga0501040_0047096 Ga0501040_0047096_329_1507 373
707 3300049576 Ga0501040_0048205 Ga0501040_0048205_1419_2597 373
708 3300049576 Ga0501040_0104794 Ga0501040_0104794_778_1956 373
709 3300049577 Ga0501041_0000689 Ga0501041_0000689_13615_14793 373
710 3300049577 Ga0501041_0001386 Ga0501041_0001386_4741_5916 373
711 3300049577 Ga0501041_0076509 Ga0501041_0076509_783_1961 373
712 3300049578 Ga0501042_0000523 Ga0501042_0000523_11964_13142 373
713 3300049578 Ga0501042_0014719 Ga0501042_0014719_3923_5098 373
714 3300049578 Ga0501042_0065026 Ga0501042_0065026_1011_2189 373
715 3300049578 Ga0501042_0132715 Ga0501042_0132715_355_1533 373
716 3300049578 Ga0501042_0170818 Ga0501042_0170818_182_1372 373
717 3300049579 Ga0501043_0086350 Ga0501043_0086350_193_1368 373
718 3300049580 Ga0501046_0020810 Ga0501046_0020810_1891_3069 373
719 3300049580 Ga0501046_0250897 Ga0501046_0250897_115_1290 373
720 3300049582 Ga0501048_0078021 Ga0501048_0078021_1151_2326 373
721 3300049582 Ga0501048_0154759 Ga0501048_0154759_408_1586 373
722 3300049582 Ga0501048_0224368 Ga0501048_0224368_35_1213 373
723 3300049584 Ga0501068_0087654 Ga0501068_0087654_442_1620 373
724 3300049584 Ga0501068_0192911 Ga0501068_0192911_95_1273 373
725 3300049585 Ga0501069_0042271 Ga0501069_0042271_47_1222 373
726 3300049586 Ga0501070_0020441 Ga0501070_0020441_1040_2218 373
727 3300049587 Ga0501071_0011464 Ga0501071_0011464_47_1225 373
728 3300049587 Ga0501071_0015085 Ga0501071_0015085_3786_4961 373
729 3300049587 Ga0501071_0017061 Ga0501071_0017061_367_1545 373
730 3300049587 Ga0501071_0019850 Ga0501071_0019850_1400_2578 373
731 3300049587 Ga0501071_0231745 Ga0501071_0231745_130_1308 373
732 3300049587 Ga0501071_0238996 Ga0501071_0238996_74_1252 373
733 3300049588 Ga0501072_0001732 Ga0501072_0001732_891_2069 373
734 3300049588 Ga0501072_0005079 Ga0501072_0005079_848_2026 373
735 3300049588 Ga0501072_0010907 Ga0501072_0010907_3475_4650 373
736 3300049588 Ga0501072_0024326 Ga0501072_0024326_1131_2309 373
737 3300049588 Ga0501072_0037680 Ga0501072_0037680_1978_3156 373
738 3300049590 Ga0501074_0000371 Ga0501074_0000371_1189_2367 373
739 3300049590 Ga0501074_0014472 Ga0501074_0014472_4231_5406 373
740 3300049590 Ga0501074_0055310 Ga0501074_0055310_1642_2820 373
741 3300049590 Ga0501074_0145305 Ga0501074_0145305_52_1218 373
742 3300049591 Ga0501075_0007555 Ga0501075_0007555_5042_6220 373
743 3300049591 Ga0501075_0008918 Ga0501075_0008918_3934_5115 373
744 3300049591 Ga0501075_0011928 Ga0501075_0011928_4977_6152 373
745 3300049591 Ga0501075_0037028 Ga0501075_0037028_728_1906 373
746 3300049591 Ga0501075_0064441 Ga0501075_0064441_618_1796 373
747 3300049591 Ga0501075_0075066 Ga0501075_0075066_626_1804 373
748 3300049591 Ga0501075_0104157 Ga0501075_0104157_888_2066 373
749 3300049592 Ga0501076_0004757 Ga0501076_0004757_5839_7017 373
750 3300049592 Ga0501076_0008144 Ga0501076_0008144_6474_7649 373
751 3300049592 Ga0501076_0071128 Ga0501076_0071128_520_1698 373
752 3300049592 Ga0501076_0154512 Ga0501076_0154512_377_1555 373
753 3300049593 Ga0501077_0009984 Ga0501077_0009984_442_1620 373
754 3300049593 Ga0501077_0014723 Ga0501077_0014723_1158_2333 373
755 3300049593 Ga0501077_0047184 Ga0501077_0047184_153_1331 373
756 3300049741 Ga0501079_0012200 Ga0501079_0012200_827_2002 373
757 3300049741 Ga0501079_0033302 Ga0501079_0033302_1431_2609 373
758 3300049741 Ga0501079_0040888 Ga0501079_0040888_1276_2466 373
759 3300049741 Ga0501079_0193513 Ga0501079_0193513_60_1238 373
760 3300049742 Ga0501080_0016256 Ga0501080_0016256_80_1258 373
761 3300049743 Ga0501081_0008090 Ga0501081_0008090_5191_6366 373
762 3300049743 Ga0501081_0009917 Ga0501081_0009917_4951_6129 373
763 3300049743 Ga0501081_0045276 Ga0501081_0045276_89_1270 373
764 3300049743 Ga0501081_0056043 Ga0501081_0056043_366_1544 373
765 3300049743 Ga0501081_0102134 Ga0501081_0102134_100_1293 373
766 3300049822 Ga0501035_0004822 Ga0501035_0004822_2623_3801 373
767 3300049822 Ga0501035_0285377 Ga0501035_0285377_44_1222 373
768 3300049823 Ga0501044_0179932 Ga0501044_0179932_251_1426 373
769 3300049823 Ga0501044_0284787 Ga0501044_0284787_271_1449 373
770 3300049824 Ga0501045_0008488 Ga0501045_0008488_5626_6801 373
771 3300049824 Ga0501045_0022040 Ga0501045_0022040_1790_2968 373
772 3300049824 Ga0501045_0058262 Ga0501045_0058262_50_1228 373
773 3300049824 Ga0501045_0094614 Ga0501045_0094614_804_1970 373
774 3300049824 Ga0501045_0097108 Ga0501045_0097108_880_2058 373
775 3300050491 nmdc:mga00v17_27775_c1 nmdc:mga00v17_27775_c1_748_1941 373
776 3300050491 nmdc:mga00v17_7574_c1 nmdc:mga00v17_7574_c1_4354_5550 373
777 3300050513 nmdc:mga0rr50_107853_c1 nmdc:mga0rr50_107853_c1_981_2150 373
778 3300053139 Ga0500568_0000068 Ga0500568_0000068_91884_93080 373
779 3300053153 Ga0500616_0003044 Ga0500616_0003044_9276_10496 373
780 3300054114 Ga0501084_0005146 Ga0501084_0005146_4232_5407 373
781 3300054114 Ga0501084_0126208 Ga0501084_0126208_120_1298 373
782 3300054114 Ga0501084_0183834 Ga0501084_0183834_78_1256 373
783 3300060353 Ga0501082_0001152 Ga0501082_0001152_19303_20481 373
784 3300060353 Ga0501082_0017210 Ga0501082_0017210_4720_5901 373
785 3300060353 Ga0501082_0026644 Ga0501082_0026644_459_1634 373
786 3300060353 Ga0501082_0048148 Ga0501082_0048148_962_2140 373
787 3300060353 Ga0501082_0051024 Ga0501082_0051024_1405_2583 373
788 3300060353 Ga0501082_0059789 Ga0501082_0059789_124_1302 373
789 3300060353 Ga0501082_0066710 Ga0501082_0066710_1644_2837 373
790 3300060353 Ga0501082_0074479 Ga0501082_0074479_753_1943 373
791 3300060353 Ga0501082_0114431 Ga0501082_0114431_316_1506 373
792 3300061734 Ga0530510_0002651 Ga0530510_0002651_3702_4877 373
793 3300061734 Ga0530510_0003178 Ga0530510_0003178_4811_5989 373
794 3300061734 Ga0530510_0015323 Ga0530510_0015323_3412_4590 373
795 3300061734 Ga0530510_0062641 Ga0530510_0062641_1262_2428 373
796 3300061734 Ga0530510_0119230 Ga0530510_0119230_567_1745 373
797 3300061734 Ga0530510_0195403 Ga0530510_0195403_291_1457 373
798 iso_pu_bacteria 2599185318 2600035769 373
799 iso_pu_bacteria 2857504554 2857507105 373
800 iso_pu_bacteria 2884960567 2884961827 373
801 3300005329 Ga0070683_100046776 Ga0070683_1000467762 374
802 3300005354 Ga0070675_100294787 Ga0070675_1002947871 374
803 3300005434 Ga0070709_10059647 Ga0070709_100596472 374
804 3300005435 Ga0070714_100084032 Ga0070714_1000840322 374
805 3300005435 Ga0070714_100160512 Ga0070714_1001605121 374
806 3300005436 Ga0070713_100030858 Ga0070713_1000308583 374
807 3300005436 Ga0070713_100074784 Ga0070713_1000747842 374
808 3300005436 Ga0070713_100083535 Ga0070713_1000835352 374
809 3300005436 Ga0070713_100084413 Ga0070713_1000844132 374
810 3300005436 Ga0070713_100107375 Ga0070713_1001073752 374
811 3300005436 Ga0070713_100153057 Ga0070713_1001530572 374
812 3300005436 Ga0070713_100205191 Ga0070713_1002051912 374
813 3300005439 Ga0070711_100006917 Ga0070711_1000069172 374
814 3300005445 Ga0070708_100000666 Ga0070708_1000006666 374
815 3300005445 Ga0070708_100013121 Ga0070708_1000131216 374
816 3300005458 Ga0070681_10072624 Ga0070681_100726242 374
817 3300005467 Ga0070706_100147947 Ga0070706_1001479472 374
818 3300005539 Ga0068853_100057914 Ga0068853_1000579142 374
819 3300005539 Ga0068853_100188779 Ga0068853_1001887791 374
820 3300006028 Ga0070717_10059974 Ga0070717_100599742 374
821 3300006186 Ga0075369_10007018 Ga0075369_100070183 374
822 3300006846 Ga0075430_100003589 Ga0075430_1000035899 374
823 3300006847 Ga0075431_100002904 Ga0075431_1000029048 374
824 3300006871 Ga0075434_100143393 Ga0075434_1001433932 374
825 3300006880 Ga0075429_100000389 Ga0075429_10000038919 374
826 3300009093 Ga0105240_10035668 Ga0105240_100356682 374
827 3300009093 Ga0105240_10132149 Ga0105240_101321492 374
828 3300009098 Ga0105245_10001993 Ga0105245_100019932 374
829 3300009147 Ga0114129_10193253 Ga0114129_101932533 374
830 3300009148 Ga0105243_10229896 Ga0105243_102298961 374
831 3300009174 Ga0105241_10242565 Ga0105241_102425651 374
832 3300009177 Ga0105248_10103710 Ga0105248_101037104 374
833 3300013105 Ga0157369_10045142 Ga0157369_100451423 374
834 3300013105 Ga0157369_10135495 Ga0157369_101354952 374
835 3300013296 Ga0157374_10119235 Ga0157374_101192352 374
836 3300013306 Ga0163162_10166944 Ga0163162_101669442 374
837 3300014969 Ga0157376_10100812 Ga0157376_101008122 374
838 3300021384 Ga0213876_10001603 Ga0213876_100016039 374
839 3300024225 Ga0224572_1001046 Ga0224572_10010466 374
840 3300025910 Ga0207684_10171628 Ga0207684_101716282 374
841 3300025915 Ga0207693_10014563 Ga0207693_100145632 374
842 3300025926 Ga0207659_10251203 Ga0207659_102512031 374
843 3300025928 Ga0207700_10001583 Ga0207700_100015834 374
844 3300025928 Ga0207700_10102464 Ga0207700_101024642 374
845 3300025944 Ga0207661_10015243 Ga0207661_100152432 374
846 3300026041 Ga0207639_10027426 Ga0207639_100274262 374
847 3300026041 Ga0207639_10110355 Ga0207639_101103552 374
848 3300031251 Ga0265327_10001468 Ga0265327_100014684 374
849 3300031251 Ga0265327_10022524 Ga0265327_100225243 374
850 3300031251 Ga0265327_10110645 Ga0265327_101106451 374
851 3300031548 Ga0307408_100190975 Ga0307408_1001909752 374
852 3300031691 Ga0316579_10060319 Ga0316579_100603191 374
853 3300031691 Ga0316579_10066654 Ga0316579_100666541 374
854 3300031727 Ga0316576_10108842 Ga0316576_101088421 374
855 3300031728 Ga0316578_10002239 Ga0316578_100022393 374
856 3300031824 Ga0307413_10013493 Ga0307413_100134933 374
857 3300031824 Ga0307413_10089921 Ga0307413_100899212 374
858 3300032002 Ga0307416_100027301 Ga0307416_1000273012 374
859 3300032137 Ga0316585_10022950 Ga0316585_100229502 374
860 3300032139 Ga0316580_10024035 Ga0316580_100240352 374
861 3300035113 Ga0373936_0020341 Ga0373936_0020341_423_1589 374
862 3300035119 Ga0373956_0006401 Ga0373956_0006401_1210_2376 374
863 3300035119 Ga0373956_0023828 Ga0373956_0023828_480_1646 374
864 3300035172 Ga0373955_0002810 Ga0373955_0002810_4625_5791 374
865 3300035398 Ga0316574_0010197 Ga0316574_0010197_2455_3621 374
866 3300035398 Ga0316574_0069183 Ga0316574_0069183_671_1837 374
867 3300035398 Ga0316574_0128294 Ga0316574_0128294_97_1269 374
868 3300035410 Ga0373924_0016578 Ga0373924_0016578_1070_2236 374
869 3300035410 Ga0373924_0021062 Ga0373924_0021062_872_2038 374
870 3300035692 Ga0373935_0001339 Ga0373935_0001339_994_2160 374
871 3300035695 Ga0373927_0002053 Ga0373927_0002053_8625_9791 374
872 3300035725 Ga0373947_0100517 Ga0373947_0100517_464_1630 374
873 3300036401 Ga0373937_0001374 Ga0373937_0001374_10083_11249 374
874 3300036401 Ga0373937_0047722 Ga0373937_0047722_2627_3793 374
875 3300036647 Ga0316582_0054247 Ga0316582_0054247_424_1590 374
876 3300036647 Ga0316582_0195333 Ga0316582_0195333_185_1351 374
877 3300036712 Ga0316584_0002180 Ga0316584_0002180_3805_4971 374
878 3300037068 Ga0373925_0001738 Ga0373925_0001738_14363_15529 374
879 3300037068 Ga0373925_0061423 Ga0373925_0061423_649_1818 374
880 3300037853 Ga0436364_0836106 Ga0436364_0836106_896_2095 374
881 3300039437 Ga0436365_1263598 Ga0436365_1263598_7856_9037 374
882 3300039437 Ga0436365_1764143 Ga0436365_1764143_470_1642 374
883 3300042435 Ga0439434_0001600 Ga0439434_0001600_3300_4487 374
884 3300044735 Ga0466968_0043368 Ga0466968_0043368_284_1462 374
885 3300044842 Ga0466957_0000531 Ga0466957_0000531_4092_5258 374
886 3300044842 Ga0466957_0012606 Ga0466957_0012606_278_1456 374
887 3300045836 Ga0466958_0003983 Ga0466958_0003983_3204_4382 374
888 3300045976 Ga0466967_0089138 Ga0466967_0089138_1563_2741 374
889 3300045976 Ga0466967_0109036 Ga0466967_0109036_541_1719 374
890 3300046459 Ga0495629_0065786 Ga0495629_0065786_832_2019 374
891 3300046461 Ga0495641_0025392 Ga0495641_0025392_387_1550 374
892 3300046462 Ga0495651_0162603 Ga0495651_0162603_152_1318 374
893 3300046472 Ga0495580_0058842 Ga0495580_0058842_262_1431 374
894 3300046473 Ga0495582_0127010 Ga0495582_0127010_159_1325 374
895 3300046473 Ga0495582_0132547 Ga0495582_0132547_168_1364 374
896 3300046511 Ga0495608_0058055 Ga0495608_0058055_347_1534 374
897 3300046511 Ga0495608_0089988 Ga0495608_0089988_47_1252 374
898 3300046516 Ga0495628_0037171 Ga0495628_0037171_2678_3895 374
899 3300046516 Ga0495628_0085939 Ga0495628_0085939_936_2219 374
900 3300046517 Ga0495630_0067018 Ga0495630_0067018_767_1933 374
901 3300046531 Ga0495665_0046990 Ga0495665_0046990_561_1727 374
902 3300046663 Ga0495635_0120953 Ga0495635_0120953_405_1601 374
903 3300046683 Ga0495658_0023206 Ga0495658_0023206_951_2147 374
904 3300047322 Ga0495680_0221076 Ga0495680_0221076_77_1264 374
905 3300048905 Ga0496102_0073613 Ga0496102_0073613_1659_2870 374
906 3300048905 Ga0496102_0140306 Ga0496102_0140306_412_1602 374
907 3300048907 Ga0496104_0122002 Ga0496104_0122002_215_1381 374
908 3300048908 Ga0496105_0011672 Ga0496105_0011672_1684_2850 374
909 3300048911 Ga0496108_0168568 Ga0496108_0168568_182_1369 374
910 3300048913 Ga0496110_0072552 Ga0496110_0072552_176_1372 374
911 3300048913 Ga0496110_0149965 Ga0496110_0149965_372_1538 374
912 3300048915 Ga0496112_0030365 Ga0496112_0030365_2244_3410 374
913 3300048922 Ga0496119_0000067 Ga0496119_0000067_107722_108933 374
914 3300048923 Ga0496120_0001000 Ga0496120_0001000_9522_10733 374
915 3300049569 Ga0501032_0012019 Ga0501032_0012019_1879_3057 374
916 3300049573 Ga0501037_0041894 Ga0501037_0041894_1718_2896 374
917 3300049581 Ga0501047_0011821 Ga0501047_0011821_5825_7027 374
918 3300049584 Ga0501068_0052658 Ga0501068_0052658_953_2155 374
919 3300049585 Ga0501069_0001445 Ga0501069_0001445_1200_2378 374
920 3300049586 Ga0501070_0000325 Ga0501070_0000325_13075_14253 374
921 3300049586 Ga0501070_0014305 Ga0501070_0014305_2854_4032 374
922 3300049586 Ga0501070_0095040 Ga0501070_0095040_1103_2281 374
923 3300049587 Ga0501071_0082398 Ga0501071_0082398_714_1877 374
924 3300049587 Ga0501071_0270097 Ga0501071_0270097_64_1251 374
925 3300049590 Ga0501074_0001214 Ga0501074_0001214_2142_3320 374
926 3300049591 Ga0501075_0207655 Ga0501075_0207655_46_1209 374
927 3300049741 Ga0501079_0001277 Ga0501079_0001277_5602_6780 374
928 3300049742 Ga0501080_0000096 Ga0501080_0000096_12733_13911 374
929 3300049742 Ga0501080_0002735 Ga0501080_0002735_4336_5514 374
930 3300049742 Ga0501080_0058489 Ga0501080_0058489_2248_3426 374
931 3300049744 Ga0501083_0034963 Ga0501083_0034963_626_1813 374
932 3300049823 Ga0501044_0000201 Ga0501044_0000201_57446_58624 374
933 3300049824 Ga0501045_0053180 Ga0501045_0053180_896_2059 374
934 3300050507 nmdc:mga05p37_369670_c1 nmdc:mga05p37_369670_c1_109_1299 374
935 3300050508 nmdc:mga09592_3187_c1 nmdc:mga09592_3187_c1_7379_8569 374
936 3300050509 nmdc:mga0qj67_47840_c1 nmdc:mga0qj67_47840_c1_552_1742 374
937 3300050510 nmdc:mga06r32_4733_c1 nmdc:mga06r32_4733_c1_4341_5531 374
938 3300050512 nmdc:mga0n895_167361_c1 nmdc:mga0n895_167361_c1_282_1442 374
939 3300050516 nmdc:mga0sz30_7582_c1 nmdc:mga0sz30_7582_c1_1297_2469 374
940 3300053084 Ga0495595_0049493 Ga0495595_0049493_626_1813 374
941 3300053139 Ga0500568_0000013 Ga0500568_0000013_16842_18032 374
942 3300053153 Ga0500616_0003638 Ga0500616_0003638_7435_8625 374
943 3300053153 Ga0500616_0031003 Ga0500616_0031003_1321_2517 374
944 3300054114 Ga0501084_0002270 Ga0501084_0002270_2881_4071 374
945 3300054114 Ga0501084_0078251 Ga0501084_0078251_1140_2324 374
946 3300061719 Ga0466962_0085069 Ga0466962_0085069_148_1326 374
947 3300061734 Ga0530510_0037216 Ga0530510_0037216_1391_2578 374
948 iso_pu_bacteria 8056060235 8056065173 374
949 3300005336 Ga0070680_100036780 Ga0070680_1000367804 375
950 3300005336 Ga0070680_100061972 Ga0070680_1000619721 375
951 3300005435 Ga0070714_100313261 Ga0070714_1003132611 375
952 3300005437 Ga0070710_10050450 Ga0070710_100504502 375
953 3300005458 Ga0070681_10035708 Ga0070681_100357082 375
954 3300005563 Ga0068855_100063559 Ga0068855_1000635592 375
955 3300006028 Ga0070717_10233749 Ga0070717_102337491 375
956 3300006028 Ga0070717_10315613 Ga0070717_103156131 375
957 3300006038 Ga0075365_10006322 Ga0075365_100063225 375
958 3300006048 Ga0075363_100079046 Ga0075363_1000790462 375
959 3300006051 Ga0075364_10009982 Ga0075364_100099824 375
960 3300006178 Ga0075367_10072633 Ga0075367_100726332 375
961 3300009093 Ga0105240_10356924 Ga0105240_103569242 375
962 3300025912 Ga0207707_10016514 Ga0207707_100165144 375
963 3300025917 Ga0207660_10001617 Ga0207660_100016176 375
964 3300025917 Ga0207660_10120009 Ga0207660_101200092 375
965 3300025921 Ga0207652_10037287 Ga0207652_100372874 375
966 3300025924 Ga0207694_10231959 Ga0207694_102319591 375
967 3300025949 Ga0207667_10130530 Ga0207667_101305302 375
968 3300031901 Ga0307406_10019480 Ga0307406_100194804 375
969 3300032004 Ga0307414_10112297 Ga0307414_101122972 375
970 3300035695 Ga0373927_0000245 Ga0373927_0000245_12410_13672 375
971 3300036401 Ga0373937_0094334 Ga0373937_0094334_1243_2412 375
972 3300036712 Ga0316584_0113503 Ga0316584_0113503_386_1597 375
973 3300039062 Ga0400483_064439 Ga0400483_064439_57_1229 375
974 3300039062 Ga0400483_113982 Ga0400483_113982_422_1591 375
975 3300039062 Ga0400483_223199 Ga0400483_223199_745_1914 375
976 3300039062 Ga0400483_231711 Ga0400483_231711_151_1323 375
977 3300044658 Ga0466972_0015963 Ga0466972_0015963_1628_2803 375
978 3300044693 Ga0466961_0040179 Ga0466961_0040179_259_1434 375
979 3300045049 Ga0466959_0035382 Ga0466959_0035382_192_1361 375
980 3300045049 Ga0466959_0098951 Ga0466959_0098951_242_1417 375
981 3300046462 Ga0495651_0103448 Ga0495651_0103448_712_1929 375
982 3300047317 Ga0495604_0074840 Ga0495604_0074840_629_1846 375
983 3300048913 Ga0496110_0058462 Ga0496110_0058462_243_1412 375
984 3300048914 Ga0496111_0000546 Ga0496111_0000546_2220_3389 375
985 3300049568 Ga0501031_0108323 Ga0501031_0108323_42_1250 375
986 3300049569 Ga0501032_0001861 Ga0501032_0001861_5439_6650 375
987 3300049573 Ga0501037_0001405 Ga0501037_0001405_1745_2956 375
988 3300049574 Ga0501038_0202689 Ga0501038_0202689_341_1552 375
989 3300049590 Ga0501074_0022859 Ga0501074_0022859_114_1325 375
990 3300049742 Ga0501080_0078684 Ga0501080_0078684_1776_2987 375
991 3300049823 Ga0501044_0009471 Ga0501044_0009471_4004_5215 375
992 3300050490 nmdc:mga03n38_86177_c1 nmdc:mga03n38_86177_c1_177_1349 375
993 3300050491 nmdc:mga00v17_21975_c1 nmdc:mga00v17_21975_c1_1348_2520 375
994 3300050491 nmdc:mga00v17_32382_c1 nmdc:mga00v17_32382_c1_481_1656 375
995 3300050492 nmdc:mga0yw44_1153_c1 nmdc:mga0yw44_1153_c1_5063_6235 375
996 3300050492 nmdc:mga0yw44_28061_c1 nmdc:mga0yw44_28061_c1_2014_3186 375
997 3300050492 nmdc:mga0yw44_4854_c1 nmdc:mga0yw44_4854_c1_1413_2585 375
998 3300050492 nmdc:mga0yw44_60352_c1 nmdc:mga0yw44_60352_c1_124_1296 375
999 3300050494 nmdc:mga06z11_54832_c1 nmdc:mga06z11_54832_c1_717_1889 375
1000 iso_pu_bacteria 2643221580 2643912186 375
1001 iso_pu_bacteria 2862574272 2862580994 375
1002 iso_pu_bacteria 2954691527 2954691825 375
1003 iso_pu_bacteria 2954701450 2954706936 375
1004 iso_pu_bacteria 8055172936 8055176714 375
1005 3300005355 Ga0070671_100020311 Ga0070671_1000203112 376
1006 3300005548 Ga0070665_100001693 Ga0070665_1000016932 376
1007 3300005842 Ga0068858_100000071 Ga0068858_10000007176 376
1008 3300005843 Ga0068860_100001767 Ga0068860_10000176719 376
1009 3300009177 Ga0105248_10001028 Ga0105248_100010283 376
1010 3300014325 Ga0163163_10036377 Ga0163163_100363773 376
1011 3300014968 Ga0157379_10000015 Ga0157379_1000001576 376
1012 3300014968 Ga0157379_10003142 Ga0157379_100031423 376
1013 3300025941 Ga0207711_10000385 Ga0207711_100003853 376
1014 3300026035 Ga0207703_10000094 Ga0207703_1000009476 376
1015 3300028379 Ga0268266_10001878 Ga0268266_100018781 376
1016 3300028381 Ga0268264_10039797 Ga0268264_100397972 376
1017 3300048903 Ga0496100_0003115 Ga0496100_0003115_2398_3606 376
1018 3300048904 Ga0496101_0070340 Ga0496101_0070340_670_1878 376
1019 3300048905 Ga0496102_0000217 Ga0496102_0000217_50413_51621 376
1020 3300048905 Ga0496102_0296567 Ga0496102_0296567_268_1482 376
1021 3300048906 Ga0496103_0000255 Ga0496103_0000255_97_1305 376
1022 3300048907 Ga0496104_0159334 Ga0496104_0159334_596_1804 376
1023 3300048913 Ga0496110_0153141 Ga0496110_0153141_58_1266 376
1024 3300048919 Ga0496116_0000335 Ga0496116_0000335_24364_25572 376
1025 3300048920 Ga0496117_0000389 Ga0496117_0000389_49913_51121 376
1026 3300048921 Ga0496118_0000372 Ga0496118_0000372_24354_25562 376
1027 3300048922 Ga0496119_0000336 Ga0496119_0000336_4757_5971 376
1028 3300048922 Ga0496119_0000618 Ga0496119_0000618_24326_25534 376
1029 3300048922 Ga0496119_0057358 Ga0496119_0057358_1108_2322 376
1030 3300048923 Ga0496120_0012026 Ga0496120_0012026_107_1315 376
1031 3300048924 Ga0496121_0012047 Ga0496121_0012047_4404_5612 376
1032 3300048927 Ga0496124_0010188 Ga0496124_0010188_6157_7365 376
1033 3300048928 Ga0496125_0007511 Ga0496125_0007511_8586_9794 376
1034 3300048929 Ga0496126_0000502 Ga0496126_0000502_50672_51880 376
1035 3300003781 Ga0055536_1002455 Ga0055536_10024554 377
1036 3300003781 Ga0055536_1003250 Ga0055536_10032503 377
1037 3300003791 Ga0055530_10004423 Ga0055530_100044236 377
1038 3300003794 Ga0055531_10001056 Ga0055531_1000105613 377
1039 3300005353 Ga0070669_100001309 Ga0070669_10000130916 377
1040 3300005842 Ga0068858_100185205 Ga0068858_1001852052 377
1041 3300009177 Ga0105248_10035549 Ga0105248_100355494 377
1042 3300025292 Ga0209676_1000043 Ga0209676_100004369 377
1043 3300025292 Ga0209676_1001430 Ga0209676_100143015 377
1044 3300025298 Ga0209050_1001461 Ga0209050_100146115 377
1045 3300025298 Ga0209050_1001802 Ga0209050_100180215 377
1046 3300025303 Ga0209051_1002052 Ga0209051_10020528 377
1047 3300025304 Ga0209257_1000134 Ga0209257_1000134130 377
1048 3300025304 Ga0209257_1004322 Ga0209257_100432210 377
1049 3300025923 Ga0207681_10001702 Ga0207681_1000170210 377
1050 3300026035 Ga0207703_10128595 Ga0207703_101285952 377
1051 3300026095 Ga0207676_10081198 Ga0207676_100811982 377
1052 3300028800 Ga0265338_10017067 Ga0265338_100170675 377
1053 3300046616 Ga0495668_0000061 Ga0495668_0000061_30043_31215 377
1054 3300048915 Ga0496112_0040047 Ga0496112_0040047_187_1356 377
1055 3300050509 nmdc:mga0qj67_137216_c1 nmdc:mga0qj67_137216_c1_207_1379 377
1056 3300053122 Ga0500608_000250 Ga0500608_000250_19793_20965 377
1057 3300053156 Ga0500622_0035839 Ga0500622_0035839_1340_2512 377
1058 3300048927 Ga0496124_0007589 Ga0496124_0007589_1848_3068 378
1059 3300049823 Ga0501044_0374226 Ga0501044_0374226_141_1280 378
1060 iso_pu_bacteria 2643221541 2643727925 378
1061 iso_pu_bacteria 2643221576 2643891717 378
1062 iso_pu_bacteria 2643221590 2643960765 378
1063 iso_pu_bacteria 2643221604 2644035718 378
1064 iso_pu_bacteria 2643221606 2644043125 378
1065 iso_pu_bacteria 2643221615 2644089246 378
1066 iso_pu_bacteria 2643221617 2644101569 378
1067 iso_pu_bacteria 2643221620 2644115632 378
1068 iso_pu_bacteria 2643221657 2644319091 378
1069 iso_pu_bacteria 2643221671 2644395444 378
1070 iso_pu_bacteria 2738541305 2738868183 378
1071 iso_pu_bacteria 2773857762 2774395634 378
1072 iso_pu_bacteria 2808606439 2809198962 378
1073 iso_pu_bacteria 2811994878 2812348278 378
1074 iso_pu_bacteria 2891968417 2891974031 378
1075 3300005439 Ga0070711_100011664 Ga0070711_1000116644 379
1076 3300005467 Ga0070706_100006569 Ga0070706_10000656910 379
1077 3300005467 Ga0070706_100240939 Ga0070706_1002409392 379
1078 3300005471 Ga0070698_100022951 Ga0070698_1000229513 379
1079 3300005471 Ga0070698_100032401 Ga0070698_1000324012 379
1080 3300005471 Ga0070698_100053945 Ga0070698_1000539452 379
1081 3300005518 Ga0070699_100133860 Ga0070699_1001338602 379
1082 3300005614 Ga0068856_100290463 Ga0068856_1002904631 379
1083 3300005985 Ga0081539_10001117 Ga0081539_100011178 379
1084 3300006028 Ga0070717_10004815 Ga0070717_1000481512 379
1085 3300006028 Ga0070717_10059942 Ga0070717_100599423 379
1086 3300006038 Ga0075365_10000969 Ga0075365_100009692 379
1087 3300006163 Ga0070715_10011430 Ga0070715_100114303 379
1088 3300006173 Ga0070716_100010802 Ga0070716_1000108023 379
1089 3300009551 Ga0105238_10031880 Ga0105238_100318804 379
1090 3300010375 Ga0105239_10049347 Ga0105239_100493472 379
1091 3300025905 Ga0207685_10003364 Ga0207685_100033641 379
1092 3300025910 Ga0207684_10001807 Ga0207684_100018071 379
1093 3300025915 Ga0207693_10013690 Ga0207693_100136908 379
1094 3300025916 Ga0207663_10128975 Ga0207663_101289751 379
1095 3300025924 Ga0207694_10024082 Ga0207694_100240823 379
1096 3300025939 Ga0207665_10001502 Ga0207665_1000150210 379
1097 3300026078 Ga0207702_10046622 Ga0207702_100466223 379
1098 3300030744 Ga0316181_1293728 Ga0316181_12937282 379
1099 3300048907 Ga0496104_0051195 Ga0496104_0051195_352_1587 379
1100 3300048908 Ga0496105_0016616 Ga0496105_0016616_2740_3975 379
1101 3300048911 Ga0496108_0063692 Ga0496108_0063692_1130_2365 379
1102 3300048915 Ga0496112_0023802 Ga0496112_0023802_2820_4055 379
1103 3300048918 Ga0496115_0111808 Ga0496115_0111808_892_2127 379
1104 3300049570 Ga0501033_0124397 Ga0501033_0124397_553_1704 379
1105 3300049573 Ga0501037_0123885 Ga0501037_0123885_97_1248 379
1106 3300049574 Ga0501038_0008025 Ga0501038_0008025_4463_5614 379
1107 3300049576 Ga0501040_0020798 Ga0501040_0020798_1283_2434 379
1108 3300049577 Ga0501041_0014442 Ga0501041_0014442_2931_4082 379
1109 3300049582 Ga0501048_0090817 Ga0501048_0090817_686_1837 379
1110 3300049587 Ga0501071_0064951 Ga0501071_0064951_1212_2363 379
1111 3300049590 Ga0501074_0039218 Ga0501074_0039218_1540_2691 379
1112 3300049591 Ga0501075_0025603 Ga0501075_0025603_2121_3272 379
1113 3300049743 Ga0501081_0033137 Ga0501081_0033137_2251_3402 379
1114 3300050492 nmdc:mga0yw44_14602_c1 nmdc:mga0yw44_14602_c1_2461_3624 379
1115 3300054114 Ga0501084_0004389 Ga0501084_0004389_6256_7407 379
1116 3300060353 Ga0501082_0007878 Ga0501082_0007878_4347_5498 379
1117 iso_pu_bacteria 2626541554 2626639853 379
1118 iso_pu_bacteria 2643221962 2645724289 379
1119 iso_pu_bacteria 2671180195 2671836327 379
1120 iso_pu_bacteria 2773857922 2774854483 379
1121 iso_pu_bacteria 2882806704 2882806935 379
1122 iso_pu_bacteria 2904765812 2904770326 379
1123 iso_pu_bacteria 2919420072 2919422340 379
1124 iso_pu_bacteria 2919432681 2919435407 379
1125 iso_pu_bacteria 2643221961 2645721758 380
1126 3300005471 Ga0070698_100001196 Ga0070698_1000011967 381
1127 3300013296 Ga0157374_10426328 Ga0157374_104263282 381
1128 3300046461 Ga0495641_0066257 Ga0495641_0066257_202_1347 381
1129 3300048908 Ga0496105_0156280 Ga0496105_0156280_413_1564 381
1130 3300048911 Ga0496108_0039578 Ga0496108_0039578_1104_2264 381
1131 3300048912 Ga0496109_0048160 Ga0496109_0048160_2630_3790 381
1132 3300048913 Ga0496110_0031193 Ga0496110_0031193_1950_3110 381
1133 3300005445 Ga0070708_100000533 Ga0070708_10000053314 382
1134 3300005445 Ga0070708_100002598 Ga0070708_1000025989 382
1135 3300005445 Ga0070708_100098963 Ga0070708_1000989632 382
1136 3300005445 Ga0070708_100130369 Ga0070708_1001303692 382
1137 3300005456 Ga0070678_100159455 Ga0070678_1001594552 382
1138 3300005467 Ga0070706_100010529 Ga0070706_1000105299 382
1139 3300005468 Ga0070707_100214531 Ga0070707_1002145312 382
1140 3300005937 Ga0081455_10149670 Ga0081455_101496702 382
1141 3300005985 Ga0081539_10080679 Ga0081539_100806792 382
1142 3300006038 Ga0075365_10018126 Ga0075365_100181262 382
1143 3300006038 Ga0075365_10088182 Ga0075365_100881821 382
1144 3300006042 Ga0075368_10003879 Ga0075368_100038792 382
1145 3300006042 Ga0075368_10017362 Ga0075368_100173623 382
1146 3300006048 Ga0075363_100000514 Ga0075363_1000005146 382
1147 3300006178 Ga0075367_10009026 Ga0075367_100090263 382
1148 3300006178 Ga0075367_10011633 Ga0075367_100116334 382
1149 3300007076 Ga0075435_100041182 Ga0075435_1000411823 382
1150 3300009098 Ga0105245_10419579 Ga0105245_104195791 382
1151 3300025910 Ga0207684_10003336 Ga0207684_100033369 382
1152 3300027866 Ga0209813_10000868 Ga0209813_100008685 382
1153 3300028800 Ga0265338_10009613 Ga0265338_1000961310 382
1154 3300031824 Ga0307413_10107743 Ga0307413_101077432 382
1155 3300037418 Ga0395900_0065597 Ga0395900_0065597_1461_2609 382
1156 3300038443 Ga0395901_0203578 Ga0395901_0203578_379_1545 382
1157 3300041452 Ga0451793_1230644 Ga0451793_1230644_459_1637 382
1158 3300041491 Ga0451833_0883155 Ga0451833_0883155_2051_3229 382
1159 3300041494 Ga0451837_0273179 Ga0451837_0273179_4368_5546 382
1160 3300042435 Ga0439434_0003242 Ga0439434_0003242_1739_2899 382
1161 3300048908 Ga0496105_0165956 Ga0496105_0165956_38_1186 382
1162 3300048927 Ga0496124_0252879 Ga0496124_0252879_12_1160 382
1163 3300049572 Ga0501036_0112099 Ga0501036_0112099_428_1594 382
1164 3300049572 Ga0501036_0321566 Ga0501036_0321566_26_1174 382
1165 3300049579 Ga0501043_0006030 Ga0501043_0006030_6299_7465 382
1166 3300049580 Ga0501046_0034798 Ga0501046_0034798_2174_3340 382
1167 3300049581 Ga0501047_0000220 Ga0501047_0000220_17825_18991 382
1168 3300049584 Ga0501068_0037323 Ga0501068_0037323_331_1479 382
1169 3300049589 Ga0501073_0231671 Ga0501073_0231671_116_1264 382
1170 3300049591 Ga0501075_0034503 Ga0501075_0034503_2519_3682 382
1171 3300049592 Ga0501076_0083379 Ga0501076_0083379_394_1557 382
1172 3300049823 Ga0501044_0002240 Ga0501044_0002240_4325_5473 382
1173 3300049824 Ga0501045_0084632 Ga0501045_0084632_904_2067 382
1174 3300050491 nmdc:mga00v17_49060_c1 nmdc:mga00v17_49060_c1_196_1344 382
1175 3300050492 nmdc:mga0yw44_50043_c1 nmdc:mga0yw44_50043_c1_207_1382 382
1176 3300050492 nmdc:mga0yw44_664_c1 nmdc:mga0yw44_664_c1_6477_7652 382
1177 3300050494 nmdc:mga06z11_155649_c1 nmdc:mga06z11_155649_c1_92_1240 382
1178 3300050496 nmdc:mga07m45_16563_c1 nmdc:mga07m45_16563_c1_2381_3544 382
1179 3300050513 nmdc:mga0rr50_4135_c1 nmdc:mga0rr50_4135_c1_5757_6905 382
1180 3300053117 Ga0500593_002084 Ga0500593_002084_943_2106 382
1181 iso_pu_bacteria 2855386786 2855387038 382
1182 3300001976 JGI24752J21851_1000016 JGI24752J21851_100001610 383
1183 3300003781 Ga0055536_1000120 Ga0055536_10001207 383
1184 3300005335 Ga0070666_10017345 Ga0070666_100173452 383
1185 3300005338 Ga0068868_100057974 Ga0068868_1000579743 383
1186 3300005347 Ga0070668_100001679 Ga0070668_1000016794 383
1187 3300005347 Ga0070668_100078046 Ga0070668_1000780463 383
1188 3300005347 Ga0070668_100131986 Ga0070668_1001319862 383
1189 3300005355 Ga0070671_100001302 Ga0070671_1000013025 383
1190 3300005355 Ga0070671_100003136 Ga0070671_10000313613 383
1191 3300005355 Ga0070671_100236961 Ga0070671_1002369611 383
1192 3300005367 Ga0070667_100036976 Ga0070667_1000369765 383
1193 3300005434 Ga0070709_10036118 Ga0070709_100361182 383
1194 3300005435 Ga0070714_100299429 Ga0070714_1002994292 383
1195 3300005436 Ga0070713_100003202 Ga0070713_1000032023 383
1196 3300005437 Ga0070710_10008731 Ga0070710_100087315 383
1197 3300005439 Ga0070711_100006415 Ga0070711_1000064156 383
1198 3300005445 Ga0070708_100005982 Ga0070708_10000598210 383
1199 3300005459 Ga0068867_100118258 Ga0068867_1001182582 383
1200 3300005543 Ga0070672_100304138 Ga0070672_1003041382 383
1201 3300005548 Ga0070665_100056477 Ga0070665_1000564772 383
1202 3300005563 Ga0068855_100111522 Ga0068855_1001115224 383
1203 3300005614 Ga0068856_100033050 Ga0068856_1000330503 383
1204 3300005618 Ga0068864_100161695 Ga0068864_1001616952 383
1205 3300005718 Ga0068866_10012232 Ga0068866_100122323 383
1206 3300005718 Ga0068866_10012771 Ga0068866_100127712 383
1207 3300005719 Ga0068861_100006004 Ga0068861_1000060048 383
1208 3300005841 Ga0068863_100005713 Ga0068863_1000057139 383
1209 3300005844 Ga0068862_100000254 Ga0068862_10000025431 383
1210 3300005844 Ga0068862_100011608 Ga0068862_1000116086 383
1211 3300005844 Ga0068862_100020840 Ga0068862_1000208401 383
1212 3300006042 Ga0075368_10011082 Ga0075368_100110822 383
1213 3300006048 Ga0075363_100001165 Ga0075363_1000011655 383
1214 3300006051 Ga0075364_10029926 Ga0075364_100299261 383
1215 3300006051 Ga0075364_10066542 Ga0075364_100665422 383
1216 3300006163 Ga0070715_10000618 Ga0070715_100006185 383
1217 3300006175 Ga0070712_100002095 Ga0070712_1000020952 383
1218 3300006178 Ga0075367_10000707 Ga0075367_1000070712 383
1219 3300006237 Ga0097621_100016928 Ga0097621_1000169285 383
1220 3300006358 Ga0068871_100010527 Ga0068871_1000105273 383
1221 3300006846 Ga0075430_100238670 Ga0075430_1002386702 383
1222 3300006847 Ga0075431_100039886 Ga0075431_1000398863 383
1223 3300006880 Ga0075429_100033137 Ga0075429_1000331372 383
1224 3300006881 Ga0068865_100038199 Ga0068865_1000381992 383
1225 3300009011 Ga0105251_10012618 Ga0105251_100126184 383
1226 3300009093 Ga0105240_10015604 Ga0105240_100156042 383
1227 3300009094 Ga0111539_10008219 Ga0111539_100082193 383
1228 3300009094 Ga0111539_10118457 Ga0111539_101184572 383
1229 3300009094 Ga0111539_10163403 Ga0111539_101634032 383
1230 3300009098 Ga0105245_10013559 Ga0105245_100135596 383
1231 3300009101 Ga0105247_10092368 Ga0105247_100923682 383
1232 3300009177 Ga0105248_10038628 Ga0105248_100386283 383
1233 3300009177 Ga0105248_10140684 Ga0105248_101406843 383
1234 3300009545 Ga0105237_10050231 Ga0105237_100502314 383
1235 3300009553 Ga0105249_10003362 Ga0105249_1000336213 383
1236 3300010375 Ga0105239_10009458 Ga0105239_100094589 383
1237 3300010375 Ga0105239_10043946 Ga0105239_100439463 383
1238 3300013296 Ga0157374_10024852 Ga0157374_100248522 383
1239 3300013297 Ga0157378_10006762 Ga0157378_100067624 383
1240 3300014968 Ga0157379_10012452 Ga0157379_100124528 383
1241 3300014968 Ga0157379_10012814 Ga0157379_100128143 383
1242 3300014969 Ga0157376_10362631 Ga0157376_103626311 383
1243 3300025292 Ga0209676_1000081 Ga0209676_100008125 383
1244 3300025298 Ga0209050_1031396 Ga0209050_10313962 383
1245 3300025900 Ga0207710_10000115 Ga0207710_1000011586 383
1246 3300025900 Ga0207710_10000210 Ga0207710_1000021053 383
1247 3300025903 Ga0207680_10163068 Ga0207680_101630682 383
1248 3300025906 Ga0207699_10018644 Ga0207699_100186442 383
1249 3300025907 Ga0207645_10001237 Ga0207645_100012379 383
1250 3300025911 Ga0207654_10101179 Ga0207654_101011791 383
1251 3300025916 Ga0207663_10021870 Ga0207663_100218703 383
1252 3300025928 Ga0207700_10082518 Ga0207700_100825182 383
1253 3300025931 Ga0207644_10016838 Ga0207644_100168382 383
1254 3300025931 Ga0207644_10022539 Ga0207644_100225393 383
1255 3300025933 Ga0207706_10008905 Ga0207706_100089057 383
1256 3300025938 Ga0207704_10038565 Ga0207704_100385652 383
1257 3300025938 Ga0207704_10104236 Ga0207704_101042362 383
1258 3300025940 Ga0207691_10001275 Ga0207691_1000127517 383
1259 3300025940 Ga0207691_10170400 Ga0207691_101704002 383
1260 3300025941 Ga0207711_10005140 Ga0207711_100051409 383
1261 3300025941 Ga0207711_10049586 Ga0207711_100495865 383
1262 3300025961 Ga0207712_10001928 Ga0207712_1000192813 383
1263 3300025961 Ga0207712_10128197 Ga0207712_101281972 383
1264 3300025972 Ga0207668_10001606 Ga0207668_1000160614 383
1265 3300026035 Ga0207703_10000021 Ga0207703_10000021109 383
1266 3300026078 Ga0207702_10067266 Ga0207702_100672663 383
1267 3300026078 Ga0207702_10236090 Ga0207702_102360902 383
1268 3300026088 Ga0207641_10029494 Ga0207641_100294943 383
1269 3300026089 Ga0207648_10006902 Ga0207648_100069026 383
1270 3300026089 Ga0207648_10035426 Ga0207648_100354262 383
1271 3300026118 Ga0207675_100007183 Ga0207675_1000071838 383
1272 3300026121 Ga0207683_10000798 Ga0207683_1000079825 383
1273 3300027665 Ga0209983_1000778 Ga0209983_10007786 383
1274 3300027682 Ga0209971_1001080 Ga0209971_10010806 383
1275 3300027717 Ga0209998_10000369 Ga0209998_1000036910 383
1276 3300027866 Ga0209813_10007776 Ga0209813_100077762 383
1277 3300027876 Ga0209974_10000695 Ga0209974_100006953 383
1278 3300028380 Ga0268265_10000273 Ga0268265_1000027326 383
1279 3300028380 Ga0268265_10018226 Ga0268265_100182266 383
1280 3300028380 Ga0268265_10428184 Ga0268265_104281842 383
1281 3300028794 Ga0307515_10037594 Ga0307515_100375948 383
1282 3300031730 Ga0307516_10000051 Ga0307516_1000005114 383
1283 3300031731 Ga0307405_10000504 Ga0307405_100005045 383
1284 3300031824 Ga0307413_10014202 Ga0307413_100142022 383
1285 3300032002 Ga0307416_100039266 Ga0307416_1000392663 383
1286 3300032005 Ga0307411_10001307 Ga0307411_100013076 383
1287 3300035118 Ga0373954_0020809 Ga0373954_0020809_1794_2948 383
1288 3300035172 Ga0373955_0030976 Ga0373955_0030976_229_1383 383
1289 3300035724 Ga0373933_0074120 Ga0373933_0074120_865_2019 383
1290 3300036401 Ga0373937_0362576 Ga0373937_0362576_175_1329 383
1291 3300037068 Ga0373925_0023215 Ga0373925_0023215_2680_3834 383
1292 3300044658 Ga0466972_0018954 Ga0466972_0018954_1318_2472 383
1293 3300046462 Ga0495651_0147001 Ga0495651_0147001_347_1501 383
1294 3300046463 Ga0495653_0055153 Ga0495653_0055153_1268_2422 383
1295 3300046472 Ga0495580_0000466 Ga0495580_0000466_16206_17360 383
1296 3300046472 Ga0495580_0035436 Ga0495580_0035436_502_1656 383
1297 3300046679 Ga0495623_0032584 Ga0495623_0032584_456_1610 383
1298 3300046689 Ga0495613_0091424 Ga0495613_0091424_967_2127 383
1299 3300048088 Ga0495602_0059991 Ga0495602_0059991_465_1619 383
1300 3300048903 Ga0496100_0008120 Ga0496100_0008120_2906_4060 383
1301 3300048905 Ga0496102_0000178 Ga0496102_0000178_48633_49784 383
1302 3300048905 Ga0496102_0043107 Ga0496102_0043107_1809_2963 383
1303 3300048905 Ga0496102_0190665 Ga0496102_0190665_502_1656 383
1304 3300048906 Ga0496103_0000119 Ga0496103_0000119_56806_57957 383
1305 3300048907 Ga0496104_0052029 Ga0496104_0052029_364_1518 383
1306 3300048908 Ga0496105_0000193 Ga0496105_0000193_36582_37733 383
1307 3300048908 Ga0496105_0036874 Ga0496105_0036874_551_1705 383
1308 3300048909 Ga0496106_0057908 Ga0496106_0057908_724_1878 383
1309 3300048910 Ga0496107_0008926 Ga0496107_0008926_1013_2167 383
1310 3300048910 Ga0496107_0185456 Ga0496107_0185456_174_1325 383
1311 3300048911 Ga0496108_0102380 Ga0496108_0102380_57_1226 383
1312 3300048911 Ga0496108_0145893 Ga0496108_0145893_580_1734 383
1313 3300048912 Ga0496109_0106168 Ga0496109_0106168_727_1878 383
1314 3300048912 Ga0496109_0110523 Ga0496109_0110523_744_1898 383
1315 3300048913 Ga0496110_0005735 Ga0496110_0005735_551_1705 383
1316 3300048913 Ga0496110_0075313 Ga0496110_0075313_1329_2480 383
1317 3300048913 Ga0496110_0107291 Ga0496110_0107291_970_2139 383
1318 3300048914 Ga0496111_0001142 Ga0496111_0001142_11126_12280 383
1319 3300048914 Ga0496111_0008808 Ga0496111_0008808_2345_3496 383
1320 3300048914 Ga0496111_0178899 Ga0496111_0178899_377_1528 383
1321 3300048916 Ga0496113_0041403 Ga0496113_0041403_1957_3111 383
1322 3300048917 Ga0496114_0002414 Ga0496114_0002414_3678_4829 383
1323 3300048917 Ga0496114_0013956 Ga0496114_0013956_5056_6210 383
1324 3300048918 Ga0496115_0000253 Ga0496115_0000253_42196_43347 383
1325 3300048918 Ga0496115_0017554 Ga0496115_0017554_1256_2410 383
1326 3300048919 Ga0496116_0000265 Ga0496116_0000265_59721_60884 383
1327 3300048919 Ga0496116_0010615 Ga0496116_0010615_2905_4056 383
1328 3300048920 Ga0496117_0000318 Ga0496117_0000318_54843_55994 383
1329 3300048920 Ga0496117_0006208 Ga0496117_0006208_3007_4158 383
1330 3300048920 Ga0496117_0040483 Ga0496117_0040483_519_1682 383
1331 3300048921 Ga0496118_0000155 Ga0496118_0000155_8022_9173 383
1332 3300048921 Ga0496118_0000186 Ga0496118_0000186_48688_49839 383
1333 3300048922 Ga0496119_0005200 Ga0496119_0005200_432_1583 383
1334 3300048922 Ga0496119_0006999 Ga0496119_0006999_1488_2651 383
1335 3300048924 Ga0496121_0001167 Ga0496121_0001167_11857_13008 383
1336 3300048924 Ga0496121_0019766 Ga0496121_0019766_856_2019 383
1337 3300048925 Ga0496122_0017665 Ga0496122_0017665_103_1254 383
1338 3300048926 Ga0496123_0013912 Ga0496123_0013912_3573_4724 383
1339 3300048927 Ga0496124_0000324 Ga0496124_0000324_28349_29500 383
1340 3300048927 Ga0496124_0020940 Ga0496124_0020940_300_1451 383
1341 3300048929 Ga0496126_0001180 Ga0496126_0001180_28350_29501 383
1342 3300048929 Ga0496126_0060725 Ga0496126_0060725_134_1285 383
1343 3300048929 Ga0496126_0118852 Ga0496126_0118852_740_1891 383
1344 3300049569 Ga0501032_0005181 Ga0501032_0005181_570_1721 383
1345 3300049570 Ga0501033_0001353 Ga0501033_0001353_11604_12755 383
1346 3300049570 Ga0501033_0003694 Ga0501033_0003694_1658_2809 383
1347 3300049571 Ga0501034_0002426 Ga0501034_0002426_9625_10776 383
1348 3300049571 Ga0501034_0005350 Ga0501034_0005350_10428_11579 383
1349 3300049571 Ga0501034_0019421 Ga0501034_0019421_1457_2614 383
1350 3300049571 Ga0501034_0119093 Ga0501034_0119093_744_1901 383
1351 3300049572 Ga0501036_0107700 Ga0501036_0107700_888_2039 383
1352 3300049573 Ga0501037_0008952 Ga0501037_0008952_4873_6024 383
1353 3300049574 Ga0501038_0010873 Ga0501038_0010873_2703_3854 383
1354 3300049574 Ga0501038_0044754 Ga0501038_0044754_1474_2625 383
1355 3300049575 Ga0501039_0033579 Ga0501039_0033579_2270_3421 383
1356 3300049579 Ga0501043_0040856 Ga0501043_0040856_1003_2154 383
1357 3300049579 Ga0501043_0082032 Ga0501043_0082032_845_1996 383
1358 3300049581 Ga0501047_0019464 Ga0501047_0019464_2609_3760 383
1359 3300049581 Ga0501047_0159615 Ga0501047_0159615_114_1289 383
1360 3300049822 Ga0501035_0000815 Ga0501035_0000815_25685_26836 383
1361 3300049823 Ga0501044_0003728 Ga0501044_0003728_11094_12245 383
1362 3300050491 nmdc:mga00v17_13817_c1 nmdc:mga00v17_13817_c1_2634_3788 383
1363 3300050494 nmdc:mga06z11_35845_c1 nmdc:mga06z11_35845_c1_156_1307 383
1364 3300050495 nmdc:mga04h51_56923_c1 nmdc:mga04h51_56923_c1_156_1307 383
1365 3300050508 nmdc:mga09592_150916_c1 nmdc:mga09592_150916_c1_28_1179 383
1366 3300050508 nmdc:mga09592_374008_c1 nmdc:mga09592_374008_c1_40_1191 383
1367 3300050510 nmdc:mga06r32_41766_c1 nmdc:mga06r32_41766_c1_1425_2576 383
1368 3300050511 nmdc:mga08y16_13622_c1 nmdc:mga08y16_13622_c1_1842_2996 383
1369 3300050511 nmdc:mga08y16_49690_c1 nmdc:mga08y16_49690_c1_889_2040 383
1370 3300050516 nmdc:mga0sz30_80134_c1 nmdc:mga0sz30_80134_c1_121_1272 383
1371 3300053085 Ga0495619_0144756 Ga0495619_0144756_300_1460 383
1372 3300053092 Ga0500583_0011434 Ga0500583_0011434_1020_2219 383
1373 3300053101 Ga0500553_060231 Ga0500553_060231_77_1237 383
1374 3300053107 Ga0500560_002330 Ga0500560_002330_649_1809 383
1375 3300053125 Ga0500618_004042 Ga0500618_004042_1241_2392 383
1376 3300053139 Ga0500568_0002823 Ga0500568_0002823_7250_8401 383
1377 3300053140 Ga0500573_0000027 Ga0500573_0000027_45915_47069 383
1378 2162886007 SwRhRL2b_contig_234738 SwRhRL2b_0427.00002310 384
1379 3300005289 Ga0065704_10000463 Ga0065704_100004631 384
1380 3300005289 Ga0065704_10070166 Ga0065704_1007016696 384
1381 3300005331 Ga0070670_100063134 Ga0070670_1000631342 384
1382 3300005335 Ga0070666_10087702 Ga0070666_100877022 384
1383 3300005347 Ga0070668_100018380 Ga0070668_1000183803 384
1384 3300005353 Ga0070669_100000199 Ga0070669_10000019936 384
1385 3300005367 Ga0070667_100037134 Ga0070667_1000371344 384
1386 3300005548 Ga0070665_100000163 Ga0070665_10000016353 384
1387 3300009011 Ga0105251_10001177 Ga0105251_1000117712 384
1388 3300009177 Ga0105248_10007376 Ga0105248_100073765 384
1389 3300017792 Ga0163161_10001576 Ga0163161_1000157620 384
1390 3300025735 Ga0207713_1000436 Ga0207713_100043620 384
1391 3300025903 Ga0207680_10049043 Ga0207680_100490432 384
1392 3300025923 Ga0207681_10001754 Ga0207681_100017548 384
1393 3300025923 Ga0207681_10103268 Ga0207681_101032682 384
1394 3300025925 Ga0207650_10039654 Ga0207650_100396544 384
1395 3300025925 Ga0207650_10249165 Ga0207650_102491652 384
1396 3300025931 Ga0207644_10005491 Ga0207644_100054912 384
1397 3300025941 Ga0207711_10001851 Ga0207711_1000185112 384
1398 3300025972 Ga0207668_10003751 Ga0207668_100037514 384
1399 3300025986 Ga0207658_10011684 Ga0207658_100116844 384
1400 3300026088 Ga0207641_10005772 Ga0207641_100057723 384
1401 3300028379 Ga0268266_10000205 Ga0268266_1000020541 384
1402 3300028379 Ga0268266_10237346 Ga0268266_102373462 384
1403 3300032005 Ga0307411_10332161 Ga0307411_103321611 384
1404 3300048911 Ga0496108_0026750 Ga0496108_0026750_81_1235 384
1405 3300048919 Ga0496116_0009914 Ga0496116_0009914_4699_5853 384
1406 3300048921 Ga0496118_0039621 Ga0496118_0039621_1962_3116 384
1407 3300048921 Ga0496118_0103066 Ga0496118_0103066_270_1424 384
1408 3300048922 Ga0496119_0046626 Ga0496119_0046626_92_1246 384
1409 3300048924 Ga0496121_0001102 Ga0496121_0001102_14150_15304 384
1410 3300048927 Ga0496124_0011982 Ga0496124_0011982_2442_3596 384
1411 3300048927 Ga0496124_0015055 Ga0496124_0015055_4351_5505 384
1412 3300048927 Ga0496124_0020083 Ga0496124_0020083_621_1775 384
1413 3300048928 Ga0496125_0015325 Ga0496125_0015325_2785_3939 384
1414 3300048928 Ga0496125_0033548 Ga0496125_0033548_2152_3306 384
1415 3300048929 Ga0496126_0003207 Ga0496126_0003207_7374_8528 384
1416 3300048929 Ga0496126_0017622 Ga0496126_0017622_5945_7099 384

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

322

444

0.99

PF00108

Thiolase_N

Thiolase, N-terminal domain

63

315

0.96

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

122

198

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e1l-assembly1.cif.gz_C crystal structure of acetoacetyl-coa thiolase (thla2) from clostridium difficile 0.9443 1 383
4b3j-assembly1.cif.gz_D crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase and thiolase active sites 0.9371 2 384
4e1l-assembly1.cif.gz_C crystal structure of acetoacetyl-coa thiolase (thla2) from clostridium difficile 0.9367 1 383
7o1g-assembly1.cif.gz_D structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a-h462a, beta-c92a mutant 0.9362 1 384
7o1l-assembly1.cif.gz_D-2 structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-h462a mutant 0.9338 1 384
ID Description Score Start End Superfamily
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9859 270 379 3.40.47.10
af_I6XHJ3_1_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9837 1 384 3.40.47.10
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9819 270 378 3.40.47.10
af_I6XHJ3_1_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9811 1 384 3.40.47.10
4b3jC02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9713 155 380 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A6I3D4C6-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9992 268 384 GO:0003985
AF-A0A4Q3IUW6-F1-model_v4 deleted 0.9973 266 384
AF-A0A537S7L7-F1-model_v4 Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) 0.9971 296 384 GO:0003985
AF-A0A381PP03-F1-model_v4 Thiolase N-terminal domain-containing protein 0.9951 1 384 GO:0016747
AF-A0A2S9NZQ5-F1-model_v4 deleted 0.9941 1 384

Feature Viewer

pLDDT pTM Quality
96.99 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map