F493797

General Info

Members Datasets Scaffolds Average Seq Length
1417 618 1378 98

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101512712|Ga0070680_1015127121
Length 109
Sequence MKKAAKKTTAPVARAYHYDVIVSPIVTEKSTAASEFNKVMFNVHLDATKEDIKASVEALFNVKVSKVNTLRRLGKIKRFRNTVGKLSDTKKAIITLAEGQSIDLSSGVK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
8 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
9 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
10 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
11 2751185800 Brucella pituitosa AA2 Isolate Unclassified
12 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
13 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
14 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
15 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
16 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
17 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
18 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
19 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
20 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
21 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
22 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
23 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
24 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
25 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
26 2902330777 Methylobacterium sp. 2A Isolate Unclassified
27 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
28 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
29 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
30 2909042592 Labrys sp. LIt4 Isolate Nodule
31 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
32 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
33 2922425934
34 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
35 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
36 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
37 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
38 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
39 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
40 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
41 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
42 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
43 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
44 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
45 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
46 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
47 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
48 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
49 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
50 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
51 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
56 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
71 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
85 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
88 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
89 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
90 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
91 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
101 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
102 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
108 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
109 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
110 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
111 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
114 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
115 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
116 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
117 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
120 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
123 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
124 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
125 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
126 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
127 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
128 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
129 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
130 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
133 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
136 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
137 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
138 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
139 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
140 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
141 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
142 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
143 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
144 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
145 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
147 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
148 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
149 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
150 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
151 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
152 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
153 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
154 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
155 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
156 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
157 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
158 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
159 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
160 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
161 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
162 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
183 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
184 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
185 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
186 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
187 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
188 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
189 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
190 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
191 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
192 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
193 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
196 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
198 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
199 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
201 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
202 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
203 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
204 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
205 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
206 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
207 3300023304 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 Metatranscriptome Rhizosphere
208 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
209 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
210 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
211 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
214 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
216 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
287 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
291 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
292 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
293 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
294 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
295 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
296 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
297 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
298 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
299 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
300 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
301 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
302 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
303 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
304 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
305 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
306 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
307 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
308 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
309 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
310 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
311 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
312 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
313 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
314 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
315 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
316 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
317 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
318 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
319 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
320 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
321 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
322 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
323 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
324 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
326 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
327 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
328 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
329 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
330 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
331 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
332 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
333 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
334 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
335 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
336 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
337 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
338 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
339 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
340 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
341 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
342 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
343 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
344 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
345 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
346 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
347 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
348 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
349 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
350 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
351 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
352 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
353 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
354 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
355 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
356 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
357 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
358 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
359 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
360 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
361 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
362 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
363 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
364 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
365 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
366 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
367 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
368 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
369 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
370 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
371 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
372 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
373 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
374 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
375 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
376 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
377 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
378 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
379 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
380 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
381 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
382 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
383 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
384 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
385 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
386 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
387 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
388 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
389 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
390 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
391 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
392 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
393 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
394 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
395 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
396 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
397 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
398 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
399 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
400 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
401 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
402 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
403 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
404 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
405 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
406 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
407 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
408 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
409 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
410 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
411 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
412 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
413 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
414 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
415 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
416 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
417 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
418 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
419 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
420 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
421 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
422 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
423 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
424 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
425 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
426 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
427 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
428 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
429 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
430 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
431 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
432 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
433 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
434 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
435 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
436 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
437 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
438 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
439 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
440 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
441 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
442 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
443 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
444 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
445 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
446 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
447 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
448 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
449 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
450 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
451 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
452 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
453 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
454 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
455 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
456 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
457 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
458 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
459 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
460 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
461 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
462 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
463 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
464 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
465 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
466 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
467 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
468 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
469 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
470 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
475 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
476 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
477 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
478 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
479 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
485 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
488 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
489 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
490 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
503 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
504 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
508 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
510 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
511 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
515 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
516 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
517 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
518 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
519 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
520 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
521 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
522 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
523 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
524 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
525 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
526 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
527 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
528 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
529 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
530 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
531 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
532 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
533 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
534 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
535 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
536 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
537 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
538 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
539 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
540 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
541 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
542 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
543 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
544 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
545 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
546 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
547 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
548 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
549 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
550 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
551 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
552 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
553 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
554 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
555 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
556 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
557 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
558 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
559 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
560 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
561 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
562 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
563 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
564 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
565 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
566 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
567 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
568 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
569 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
570 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
571 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
572 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
573 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
574 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
575 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
576 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
577 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
578 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
579 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
580 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
581 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
582 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
583 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
584 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
585 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
586 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
587 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
588 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
589 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
590 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
591 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
592 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
597 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
598 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
599 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
616 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
617 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
618 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 5.93
Isolates 2.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 0.78
Rhizoplane 6.14
Rhizosphere 77.98
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000040 3300001915 Bacteria 30851
2 JGI24747J21853_1041351 3300001978 Bacteria 547
3 JGI24740J21852_10001488 3300001979 Bacteria 10769
4 JGI24740J21852_10127217 3300001979 Bacteria 636
5 JGI24739J22299_10009835 3300001989 Bacteria 3555
6 JGI24739J22299_10122518 3300001989 Bacteria 776
7 JGI24739J22299_10146276 3300001989 Bacteria 699
8 JGI24737J22298_10002296 3300001990 Bacteria 6798
9 JGI24737J22298_10002957 3300001990 Bacteria 6024
10 JGI24743J22301_10019644 3300001991 Bacteria 1284
11 JGI24735J21928_10003641 3300002067 Bacteria 5227
12 JGI24750J21931_1006031 3300002070 Bacteria 1500
13 JGI24745J21846_1025676 3300002073 Bacteria 701
14 JGI24738J21930_10001475 3300002075 Bacteria 6532
15 JGI24738J21930_10006269 3300002075 Bacteria 2803
16 JGI24749J21850_1030226 3300002076 Bacteria 777
17 JGI24751J29686_10003449 3300002459 Bacteria 3183
18 JGI24751J29686_10015322 3300002459 Bacteria 1581
19 JGI25165J46597_1011340 3300003214 Bacteria 1275
20 JGI25153J46596_10082871 3300003215 Bacteria 794
21 rootH2_10016380 3300003320 Bacteria 1635
22 JGI25404J52841_10035096 3300003659 Bacteria 1068
23 Ga0055539_1021913 3300003752 Bacteria 757
24 JGI25405J52794_10006513 3300003911 Bacteria 2134
25 Ga0058863_11772060 3300004799 Bacteria 625
26 Ga0058863_11874628 3300004799 Bacteria 752
27 Ga0070658_10013737 3300005327 Bacteria 6498
28 Ga0070658_10018691 3300005327 Bacteria 5551
29 Ga0070658_10417429 3300005327 Bacteria 1154
30 Ga0070658_10993116 3300005327 Bacteria 730
31 Ga0070676_10598008 3300005328 Bacteria 795
32 Ga0070683_100014681 3300005329 Bacteria 6861
33 Ga0070683_101643452 3300005329 Bacteria 618
34 Ga0070690_100007778 3300005330 Bacteria 6144
35 Ga0070670_100000376 3300005331 Bacteria 37212
36 Ga0070677_10080667 3300005333 Bacteria 1391
37 Ga0068869_100022833 3300005334 Bacteria 4314
38 Ga0070666_10004644 3300005335 Bacteria 8386
39 Ga0070680_100085545 3300005336 Bacteria 2605
40 Ga0070680_100098147 3300005336 Bacteria 2429
41 Ga0070680_100310121 3300005336 Bacteria 1339
42 Ga0070680_100664914 3300005336 Bacteria 896
43 Ga0070680_101082953 3300005336 Bacteria 692
44 Ga0070680_101512712 3300005336 Bacteria 581
45 Ga0070680_101587842 3300005336 Bacteria 567
46 Ga0070682_100002069 3300005337 Bacteria 11170
47 Ga0070682_100463941 3300005337 Bacteria 973
48 Ga0068868_100202434 3300005338 Bacteria 1655
49 Ga0070660_100000686 3300005339 Bacteria 22383
50 Ga0070660_100662344 3300005339 Bacteria 874
51 Ga0070660_100839069 3300005339 Bacteria 774
52 Ga0070660_101161486 3300005339 Bacteria 654
53 Ga0070689_100000122 3300005340 Bacteria 44668
54 Ga0070691_10000490 3300005341 Bacteria 14859
55 Ga0070691_10862610 3300005341 Bacteria 556
56 Ga0070687_100016035 3300005343 Bacteria 3404
57 Ga0070661_100000385 3300005344 Bacteria 34633
58 Ga0070661_100303958 3300005344 Bacteria 1242
59 Ga0070692_10001302 3300005345 Bacteria 8967
60 Ga0070668_100005991 3300005347 Bacteria 9018
61 Ga0070668_100088347 3300005347 Bacteria 2440
62 Ga0070668_100390585 3300005347 Bacteria 1186
63 Ga0070669_100002082 3300005353 Bacteria 14453
64 Ga0070675_100016237 3300005354 Bacteria 5907
65 Ga0070675_101384211 3300005354 Bacteria 649
66 Ga0070671_100001283 3300005355 Bacteria 18858
67 Ga0070674_100000649 3300005356 Bacteria 17518
68 Ga0070674_100148607 3300005356 Bacteria 1766
69 Ga0070674_100607101 3300005356 Bacteria 925
70 Ga0070673_100002163 3300005364 Bacteria 11899
71 Ga0070688_100000217 3300005365 Bacteria 30556
72 Ga0070688_101153306 3300005365 Bacteria 621
73 Ga0070659_100003485 3300005366 Bacteria 11201
74 Ga0070659_100165834 3300005366 Bacteria 1807
75 Ga0070667_100003614 3300005367 Bacteria 13156
76 Ga0070667_102074007 3300005367 Bacteria 536
77 Ga0070703_10015462 3300005406 Bacteria 2183
78 Ga0070709_10001232 3300005434 Bacteria 14032
79 Ga0070709_10002316 3300005434 Bacteria 10332
80 Ga0070709_10010455 3300005434 Bacteria 5143
81 Ga0070709_10022452 3300005434 Bacteria 3691
82 Ga0070709_10938746 3300005434 Bacteria 686
83 Ga0070714_100009083 3300005435 Bacteria 7794
84 Ga0070714_100017244 3300005435 Bacteria 5847
85 Ga0070714_100025578 3300005435 Bacteria 4872
86 Ga0070714_100026711 3300005435 Bacteria 4773
87 Ga0070714_100142833 3300005435 Bacteria 2150
88 Ga0070714_100177932 3300005435 Bacteria 1934
89 Ga0070714_100207603 3300005435 Bacteria 1794
90 Ga0070714_100562434 3300005435 Bacteria 1092
91 Ga0070714_101608588 3300005435 Bacteria 635
92 Ga0070713_100036694 3300005436 Bacteria 3957
93 Ga0070713_100056912 3300005436 Bacteria 3253
94 Ga0070713_100061311 3300005436 Bacteria 3146
95 Ga0070713_100095838 3300005436 Bacteria 2560
96 Ga0070713_100111867 3300005436 Bacteria 2382
97 Ga0070713_100610599 3300005436 Bacteria 1037
98 Ga0070713_100645737 3300005436 Bacteria 1007
99 Ga0070713_100734475 3300005436 Bacteria 944
100 Ga0070713_101400825 3300005436 Bacteria 678
101 Ga0070713_101869425 3300005436 Bacteria 583
102 Ga0070710_10005644 3300005437 Bacteria 5958
103 Ga0070710_10019970 3300005437 Bacteria 3470
104 Ga0070710_10058672 3300005437 Bacteria 2183
105 Ga0070710_10186643 3300005437 Bacteria 1301
106 Ga0070710_10236423 3300005437 Bacteria 1169
107 Ga0070710_10318422 3300005437 Bacteria 1020
108 Ga0070710_10470708 3300005437 Bacteria 855
109 Ga0070710_11123421 3300005437 Bacteria 578
110 Ga0070701_10000897 3300005438 Bacteria 10740
111 Ga0070711_100000834 3300005439 Bacteria 16154
112 Ga0070711_100004304 3300005439 Bacteria 8381
113 Ga0070711_100009870 3300005439 Bacteria 5888
114 Ga0070711_100155124 3300005439 Bacteria 1730
115 Ga0070711_100159576 3300005439 Bacteria 1708
116 Ga0070711_100663258 3300005439 Bacteria 875
117 Ga0070711_101839668 3300005439 Bacteria 531
118 Ga0070705_100022646 3300005440 Bacteria 3360
119 Ga0070705_100266449 3300005440 Bacteria 1211
120 Ga0070700_100002377 3300005441 Bacteria 9585
121 Ga0070700_100217734 3300005441 Bacteria 1351
122 Ga0070700_100387488 3300005441 Bacteria 1047
123 Ga0070700_100845120 3300005441 Bacteria 741
124 Ga0070700_101711775 3300005441 Bacteria 540
125 Ga0070694_100000195 3300005444 Bacteria 32086
126 Ga0070663_100000352 3300005455 Bacteria 24139
127 Ga0070663_100074211 3300005455 Bacteria 2483
128 Ga0070663_100573677 3300005455 Bacteria 946
129 Ga0070678_100001146 3300005456 Bacteria 14002
130 Ga0070678_100497827 3300005456 Bacteria 1075
131 Ga0070662_100000412 3300005457 Bacteria 25384
132 Ga0070662_100501700 3300005457 Bacteria 1012
133 Ga0070662_101006609 3300005457 Bacteria 713
134 Ga0070662_101760863 3300005457 Bacteria 535
135 Ga0070662_101984517 3300005457 Bacteria 503
136 Ga0070681_10329459 3300005458 Bacteria 1436
137 Ga0070681_10715142 3300005458 Bacteria 918
138 Ga0070681_11170398 3300005458 Bacteria 691
139 Ga0070681_11611799 3300005458 Bacteria 574
140 Ga0068867_100008499 3300005459 Bacteria 7247
141 Ga0068867_100077308 3300005459 Bacteria 2501
142 Ga0070685_10058987 3300005466 Bacteria 2239
143 Ga0070685_10665402 3300005466 Bacteria 756
144 Ga0070707_100127155 3300005468 Bacteria 2476
145 Ga0070698_100118731 3300005471 Bacteria 2605
146 Ga0070698_100482324 3300005471 Bacteria 1177
147 Ga0070699_100160319 3300005518 Bacteria 1990
148 Ga0070679_100040109 3300005530 Bacteria 4658
149 Ga0070679_100288276 3300005530 Bacteria 1593
150 Ga0070684_100047080 3300005535 Bacteria 3737
151 Ga0070684_100061861 3300005535 Bacteria 3278
152 Ga0070684_100356712 3300005535 Bacteria 1345
153 Ga0070684_100886686 3300005535 Bacteria 836
154 Ga0070684_100919194 3300005535 Bacteria 820
155 Ga0070697_100000391 3300005536 Bacteria 34002
156 Ga0070697_100077313 3300005536 Bacteria 2737
157 Ga0070697_101553947 3300005536 Bacteria 592
158 Ga0068853_100001082 3300005539 Bacteria 19264
159 Ga0068853_100345112 3300005539 Bacteria 1384
160 Ga0068853_101848518 3300005539 Bacteria 585
161 Ga0070672_100035019 3300005543 Bacteria 3813
162 Ga0070686_100001391 3300005544 Bacteria 13661
163 Ga0070695_100000238 3300005545 Bacteria 27265
164 Ga0070695_100385596 3300005545 Bacteria 1058
165 Ga0070696_100000815 3300005546 Bacteria 20059
166 Ga0070696_100031634 3300005546 Bacteria 3628
167 Ga0070696_100523824 3300005546 Bacteria 946
168 Ga0070693_100000455 3300005547 Bacteria 18375
169 Ga0070693_100579599 3300005547 Bacteria 807
170 Ga0070693_100721973 3300005547 Bacteria 731
171 Ga0070665_100022864 3300005548 Bacteria 6294
172 Ga0070665_100548593 3300005548 Bacteria 1168
173 Ga0070704_100000124 3300005549 Bacteria 27978
174 Ga0070704_100746471 3300005549 Bacteria 871
175 Ga0068855_100002691 3300005563 Bacteria 21916
176 Ga0068855_100220819 3300005563 Bacteria 2125
177 Ga0068855_100351567 3300005563 Bacteria 1623
178 Ga0068855_100464716 3300005563 Bacteria 1379
179 Ga0068855_100722076 3300005563 Bacteria 1065
180 Ga0070664_100002450 3300005564 Bacteria 14942
181 Ga0070664_100013985 3300005564 Bacteria 6544
182 Ga0070664_100963839 3300005564 Bacteria 801
183 Ga0070664_101879664 3300005564 Bacteria 568
184 Ga0068857_100008457 3300005577 Bacteria 8896
185 Ga0068857_100149759 3300005577 Bacteria 2113
186 Ga0068857_101190118 3300005577 Bacteria 738
187 Ga0068857_101263112 3300005577 Bacteria 716
188 Ga0068854_100007856 3300005578 Bacteria 6824
189 Ga0068854_100405940 3300005578 Bacteria 1128
190 Ga0068854_100596484 3300005578 Bacteria 942
191 Ga0068854_100770040 3300005578 Bacteria 836
192 Ga0068854_101112579 3300005578 Bacteria 704
193 Ga0068856_100001924 3300005614 Bacteria 21647
194 Ga0068856_100005122 3300005614 Bacteria 12946
195 Ga0068856_101512037 3300005614 Bacteria 685
196 Ga0070702_100000018 3300005615 Bacteria 47204
197 Ga0070702_100315096 3300005615 Bacteria 1088
198 Ga0070702_100375110 3300005615 Bacteria 1010
199 Ga0068852_100010938 3300005616 Bacteria 6801
200 Ga0068852_100225709 3300005616 Bacteria 1783
201 Ga0068852_100271636 3300005616 Bacteria 1631
202 Ga0068859_100131708 3300005617 Bacteria 2572
203 Ga0068859_100254511 3300005617 Bacteria 1847
204 Ga0068859_101714941 3300005617 Bacteria 694
205 Ga0068864_100002243 3300005618 Bacteria 15978
206 Ga0068864_100847013 3300005618 Bacteria 901
207 Ga0068864_101603329 3300005618 Bacteria 655
208 Ga0068866_10001983 3300005718 Bacteria 8531
209 Ga0068866_10472774 3300005718 Bacteria 824
210 Ga0068866_10579931 3300005718 Bacteria 754
211 Ga0068861_100000942 3300005719 Bacteria 17675
212 Ga0068851_10055130 3300005834 Bacteria 2025
213 Ga0068851_10281205 3300005834 Bacteria 951
214 Ga0068870_10379278 3300005840 Bacteria 915
215 Ga0068863_100007838 3300005841 Bacteria 10440
216 Ga0068863_100237421 3300005841 Bacteria 1759
217 Ga0068858_100019589 3300005842 Bacteria 6325
218 Ga0068858_100270677 3300005842 Bacteria 1616
219 Ga0068860_100000598 3300005843 Bacteria 43069
220 Ga0068860_100088076 3300005843 Bacteria 2955
221 Ga0068862_100008039 3300005844 Bacteria 8730
222 Ga0068862_100688014 3300005844 Bacteria 990
223 Ga0081455_10021909 3300005937 Bacteria 5985
224 Ga0081455_10288863 3300005937 Bacteria 1181
225 Ga0081538_10006855 3300005981 Bacteria 9922
226 Ga0081538_10029536 3300005981 Bacteria 3743
227 Ga0081540_1015691 3300005983 Bacteria 4782
228 Ga0081540_1017063 3300005983 Bacteria 4513
229 Ga0081540_1053318 3300005983 Bacteria 1984
230 Ga0081540_1065878 3300005983 Bacteria 1701
231 Ga0070717_10003669 3300006028 Bacteria 11020
232 Ga0070717_10027908 3300006028 Bacteria 4513
233 Ga0070717_10102080 3300006028 Bacteria 2436
234 Ga0070717_10381156 3300006028 Bacteria 1264
235 Ga0075365_10013851 3300006038 Bacteria 4838
236 Ga0075365_10452214 3300006038 Bacteria 907
237 Ga0075365_10749770 3300006038 Bacteria 689
238 Ga0075368_10218801 3300006042 Bacteria 809
239 Ga0075368_10282307 3300006042 Bacteria 714
240 Ga0075363_100113521 3300006048 Bacteria 1508
241 Ga0075364_10052785 3300006051 Bacteria 2657
242 Ga0075364_10057357 3300006051 Bacteria 2551
243 Ga0075364_10095261 3300006051 Bacteria 1979
244 Ga0075364_10220551 3300006051 Bacteria 1287
245 Ga0070715_10001643 3300006163 Bacteria 6622
246 Ga0070715_10312847 3300006163 Bacteria 845
247 Ga0070715_10321955 3300006163 Bacteria 835
248 Ga0070716_100001603 3300006173 Bacteria 10188
249 Ga0070716_100026432 3300006173 Bacteria 3108
250 Ga0070716_100079986 3300006173 Bacteria 1947
251 Ga0070716_100226032 3300006173 Bacteria 1260
252 Ga0070716_100397026 3300006173 Bacteria 990
253 Ga0070716_100477478 3300006173 Bacteria 915
254 Ga0070716_101460067 3300006173 Bacteria 558
255 Ga0070712_100027843 3300006175 Bacteria 3776
256 Ga0070712_100052247 3300006175 Bacteria 2849
257 Ga0070712_100058664 3300006175 Bacteria 2708
258 Ga0070712_100058938 3300006175 Bacteria 2702
259 Ga0070712_100201784 3300006175 Bacteria 1563
260 Ga0070712_100412647 3300006175 Bacteria 1117
261 Ga0070712_100515983 3300006175 Bacteria 1003
262 Ga0070712_101410515 3300006175 Bacteria 608
263 Ga0075362_10035975 3300006177 Bacteria 2164
264 Ga0075362_10049062 3300006177 Bacteria 1885
265 Ga0075362_10101966 3300006177 Bacteria 1343
266 Ga0075367_10111670 3300006178 Bacteria 1678
267 Ga0075367_10134243 3300006178 Bacteria 1531
268 Ga0075366_10359251 3300006195 Bacteria 895
269 Ga0075366_10627287 3300006195 Bacteria 667
270 Ga0097621_100107158 3300006237 Bacteria 2358
271 Ga0097621_100165361 3300006237 Bacteria 1904
272 Ga0097621_102073454 3300006237 Bacteria 544
273 Ga0075370_10243707 3300006353 Bacteria 1064
274 Ga0068871_100022307 3300006358 Bacteria 4881
275 Ga0068871_100286866 3300006358 Bacteria 1441
276 Ga0068871_100486469 3300006358 Bacteria 1111
277 Ga0068871_100682814 3300006358 Bacteria 940
278 Ga0075428_100054274 3300006844 Bacteria 4392
279 Ga0075428_100237574 3300006844 Bacteria 1966
280 Ga0075428_101096435 3300006844 Bacteria 841
281 Ga0075430_100103604 3300006846 Bacteria 2375
282 Ga0075431_100003503 3300006847 Bacteria 15211
283 Ga0075433_10023032 3300006852 Bacteria 5237
284 Ga0075434_100025071 3300006871 Bacteria 5834
285 Ga0075434_100036662 3300006871 Bacteria 4851
286 Ga0075434_100215192 3300006871 Bacteria 1941
287 Ga0075434_102159013 3300006871 Bacteria 561
288 Ga0075434_102196873 3300006871 Bacteria 556
289 Ga0075429_100024809 3300006880 Bacteria 5205
290 Ga0075429_101174029 3300006880 Bacteria 670
291 Ga0068865_100096538 3300006881 Bacteria 2155
292 Ga0068865_101186464 3300006881 Bacteria 675
293 Ga0075436_100008941 3300006914 Bacteria 6857
294 Ga0097620_100131716 3300006931 Bacteria 2572
295 Ga0097620_100254508 3300006931 Bacteria 1847
296 Ga0097620_101715029 3300006931 Bacteria 694
297 Ga0075435_100085522 3300007076 Bacteria 2596
298 Ga0075435_100102268 3300007076 Bacteria 2375
299 Ga0075435_100897708 3300007076 Bacteria 773
300 Ga0099795_10003174 3300007788 Bacteria 4033
301 Ga0105251_10110631 3300009011 Bacteria 1251
302 Ga0105250_10008602 3300009092 Bacteria 4327
303 Ga0105250_10188339 3300009092 Bacteria 868
304 Ga0105240_10230206 3300009093 Bacteria 2154
305 Ga0105240_10263935 3300009093 Bacteria 1985
306 Ga0105240_10304110 3300009093 Bacteria 1823
307 Ga0105240_10504075 3300009093 Bacteria 1345
308 Ga0105240_11509248 3300009093 Bacteria 704
309 Ga0111539_10100865 3300009094 Bacteria 3389
310 Ga0111539_10428106 3300009094 Bacteria 1541
311 Ga0111539_10658944 3300009094 Bacteria 1219
312 Ga0105245_10000718 3300009098 Bacteria 29853
313 Ga0105247_10001104 3300009101 Bacteria 20096
314 Ga0105247_10035209 3300009101 Bacteria 3051
315 Ga0105247_10603522 3300009101 Bacteria 814
316 Ga0114129_10401684 3300009147 Bacteria 1806
317 Ga0114129_11726057 3300009147 Bacteria 763
318 Ga0114129_12202468 3300009147 Bacteria 663
319 Ga0105243_10001752 3300009148 Bacteria 18680
320 Ga0105243_10362714 3300009148 Bacteria 1334
321 Ga0105241_10001866 3300009174 Bacteria 15988
322 Ga0105241_10088557 3300009174 Bacteria 2438
323 Ga0105241_10177796 3300009174 Bacteria 1763
324 Ga0105241_10256780 3300009174 Bacteria 1484
325 Ga0105242_10010515 3300009176 Bacteria 7104
326 Ga0105242_11411010 3300009176 Bacteria 724
327 Ga0105242_11845975 3300009176 Bacteria 644
328 Ga0105248_10002832 3300009177 Bacteria 19248
329 Ga0105237_10001618 3300009545 Bacteria 29243
330 Ga0105237_10394223 3300009545 Bacteria 1389
331 Ga0105237_10757616 3300009545 Bacteria 977
332 Ga0105237_10997033 3300009545 Bacteria 844
333 Ga0105237_11842462 3300009545 Bacteria 613
334 Ga0105238_10007984 3300009551 Bacteria 10588
335 Ga0105238_10437534 3300009551 Bacteria 1304
336 Ga0105238_10718602 3300009551 Bacteria 1011
337 Ga0105249_10000814 3300009553 Bacteria 28107
338 Ga0105249_10354541 3300009553 Bacteria 1487
339 Ga0105249_10378887 3300009553 Bacteria 1440
340 Ga0105249_10713244 3300009553 Bacteria 1064
341 Ga0099796_10002269 3300010159 Bacteria 4177
342 Ga0105239_10120316 3300010375 Bacteria 2915
343 Ga0105239_10143574 3300010375 Bacteria 2661
344 Ga0105239_10239229 3300010375 Bacteria 2038
345 Ga0105239_10296034 3300010375 Bacteria 1822
346 Ga0105239_10601978 3300010375 Bacteria 1254
347 Ga0105239_12790328 3300010375 Bacteria 570
348 Ga0105239_12945183 3300010375 Bacteria 555
349 Ga0105246_10002439 3300011119 Bacteria 11222
350 Ga0105246_10045899 3300011119 Bacteria 2978
351 Ga0105246_10120687 3300011119 Bacteria 1942
352 Ga0105246_10630391 3300011119 Bacteria 930
353 Ga0105246_12574566 3300011119 Bacteria 502
354 Ga0157327_1033127 3300012512 Bacteria 656
355 Ga0157373_10019849 3300013100 Bacteria 4890
356 Ga0157373_10027237 3300013100 Bacteria 4123
357 Ga0157373_11308834 3300013100 Bacteria 549
358 Ga0157371_10056437 3300013102 Bacteria 2786
359 Ga0157371_10347917 3300013102 Bacteria 1079
360 Ga0157371_10638770 3300013102 Bacteria 794
361 Ga0157370_10017001 3300013104 Bacteria 7351
362 Ga0157370_10461414 3300013104 Bacteria 1168
363 Ga0157370_10555656 3300013104 Bacteria 1052
364 Ga0157369_10164535 3300013105 Bacteria 2340
365 Ga0157369_10197436 3300013105 Bacteria 2112
366 Ga0157369_10312994 3300013105 Bacteria 1632
367 Ga0157369_10765468 3300013105 Bacteria 993
368 Ga0157369_11138607 3300013105 Bacteria 797
369 Ga0157369_11463227 3300013105 Bacteria 695
370 Ga0157369_12136507 3300013105 Bacteria 568
371 Ga0157374_10012339 3300013296 Bacteria 7433
372 Ga0157374_11221540 3300013296 Bacteria 773
373 Ga0157378_10000470 3300013297 Bacteria 38483
374 Ga0157378_11432213 3300013297 Bacteria 734
375 Ga0163162_10004532 3300013306 Bacteria 13382
376 Ga0163162_11073919 3300013306 Bacteria 912
377 Ga0163162_11470543 3300013306 Bacteria 776
378 Ga0163162_12543142 3300013306 Bacteria 589
379 Ga0163162_12605215 3300013306 Bacteria 582
380 Ga0157372_10001215 3300013307 Bacteria 27865
381 Ga0157372_10297910 3300013307 Bacteria 1876
382 Ga0157372_11055098 3300013307 Bacteria 941
383 Ga0157372_11378347 3300013307 Bacteria 813
384 Ga0157372_11623209 3300013307 Bacteria 744
385 Ga0157372_12129590 3300013307 Bacteria 644
386 Ga0157375_10012604 3300013308 Bacteria 7503
387 Ga0157375_11913853 3300013308 Bacteria 704
388 Ga0157375_13287897 3300013308 Bacteria 539
389 Ga0163163_10002129 3300014325 Bacteria 16714
390 Ga0163163_10005311 3300014325 Bacteria 11124
391 Ga0163163_12084633 3300014325 Bacteria 627
392 Ga0157380_10008515 3300014326 Bacteria 7329
393 Ga0157380_10027055 3300014326 Bacteria 4358
394 Ga0157380_11594359 3300014326 Bacteria 708
395 Ga0182008_10222662 3300014497 Bacteria 966
396 Ga0182008_10365970 3300014497 Bacteria 768
397 Ga0157377_10006965 3300014745 Bacteria 5428
398 Ga0157379_10001927 3300014968 Bacteria 17169
399 Ga0157379_10552180 3300014968 Bacteria 1072
400 Ga0157379_11730006 3300014968 Bacteria 613
401 Ga0157376_10000606 3300014969 Bacteria 23175
402 Ga0157376_10743776 3300014969 Bacteria 989
403 Ga0163161_10002394 3300017792 Bacteria 13438
404 Ga0163161_10573970 3300017792 Bacteria 927
405 Ga0206356_11853575 3300020070 Bacteria 897
406 Ga0206349_1277602 3300020075 Bacteria 1001
407 Ga0206355_1403799 3300020076 Bacteria 1190
408 Ga0206352_10097269 3300020078 Bacteria 589
409 Ga0206352_11227367 3300020078 Bacteria 518
410 Ga0206350_10960778 3300020080 Bacteria 819
411 Ga0206353_10857624 3300020082 Bacteria 1191
412 Ga0154015_1108290 3300020610 Bacteria 599
413 Ga0154015_1214890 3300020610 Bacteria 1033
414 Ga0213873_10106683 3300021358 Bacteria 810
415 Ga0213873_10313968 3300021358 Bacteria 508
416 Ga0213872_10023323 3300021361 Bacteria 2847
417 Ga0213872_10307143 3300021361 Bacteria 657
418 Ga0213874_10001821 3300021377 Bacteria 4469
419 Ga0213874_10009960 3300021377 Bacteria 2367
420 Ga0213874_10010979 3300021377 Bacteria 2283
421 Ga0213874_10220157 3300021377 Bacteria 690
422 Ga0213874_10264446 3300021377 Bacteria 638
423 Ga0213874_10275691 3300021377 Bacteria 627
424 Ga0213874_10354152 3300021377 Bacteria 563
425 Ga0213876_10002961 3300021384 Bacteria 9840
426 Ga0213876_10004772 3300021384 Bacteria 7531
427 Ga0213875_10000089 3300021388 Bacteria 105772
428 Ga0213875_10059627 3300021388 Bacteria 1786
429 Ga0213871_10016747 3300021441 Bacteria 1771
430 Ga0213871_10155626 3300021441 Bacteria 697
431 Ga0224712_10002117 3300022467 Bacteria 4832
432 Ga0224712_10050101 3300022467 Bacteria 1621
433 Ga0256714_113971 3300023304 Bacteria 616
434 Ga0256744_130108 3300023309 Bacteria 789
435 Ga0256743_128847 3300023436 Bacteria 579
436 Ga0256720_139806 3300023438 Bacteria 784
437 Ga0209677_100816 3300025253 Bacteria 15575
438 Ga0209148_1004162 3300025254 Bacteria 3638
439 Ga0209148_1008955 3300025254 Bacteria 1982
440 Ga0209233_1003250 3300025261 Bacteria 5762
441 Ga0209455_1009081 3300025272 Bacteria 2639
442 Ga0209455_1038588 3300025272 Bacteria 743
443 Ga0209758_1040129 3300025297 Bacteria 1770
444 Ga0207697_10057185 3300025315 Bacteria 1619
445 Ga0207656_10012084 3300025321 Bacteria 3278
446 Ga0207656_10173122 3300025321 Bacteria 1033
447 Ga0207696_1128942 3300025711 Bacteria 680
448 Ga0207713_1157248 3300025735 Bacteria 728
449 Ga0207653_10032934 3300025885 Bacteria 1678
450 Ga0207682_10132490 3300025893 Bacteria 1113
451 Ga0207692_10002601 3300025898 Bacteria 6941
452 Ga0207692_10039674 3300025898 Bacteria 2318
453 Ga0207692_10075631 3300025898 Bacteria 1787
454 Ga0207642_10091188 3300025899 Bacteria 1505
455 Ga0207642_10845179 3300025899 Bacteria 584
456 Ga0207710_10003497 3300025900 Bacteria 6990
457 Ga0207688_10002614 3300025901 Bacteria 9749
458 Ga0207688_10044664 3300025901 Bacteria 2469
459 Ga0207680_10006344 3300025903 Bacteria 5711
460 Ga0207647_10001956 3300025904 Bacteria 15734
461 Ga0207647_10027406 3300025904 Bacteria 3714
462 Ga0207685_10005152 3300025905 Bacteria 3415
463 Ga0207685_10019197 3300025905 Bacteria 2249
464 Ga0207685_10075667 3300025905 Bacteria 1378
465 Ga0207685_10103277 3300025905 Bacteria 1222
466 Ga0207685_10228851 3300025905 Bacteria 888
467 Ga0207699_10000692 3300025906 Bacteria 16128
468 Ga0207699_10008214 3300025906 Bacteria 5139
469 Ga0207699_10028433 3300025906 Bacteria 3107
470 Ga0207699_10062019 3300025906 Bacteria 2252
471 Ga0207699_10421039 3300025906 Bacteria 954
472 Ga0207699_10731373 3300025906 Bacteria 725
473 Ga0207699_11028083 3300025906 Unclassified 609
474 Ga0207699_11057182 3300025906 Bacteria 601
475 Ga0207643_10116032 3300025908 Bacteria 1581
476 Ga0207705_10093610 3300025909 Bacteria 2203
477 Ga0207705_10244702 3300025909 Bacteria 1367
478 Ga0207705_10348126 3300025909 Bacteria 1141
479 Ga0207705_10933880 3300025909 Bacteria 671
480 Ga0207705_11096131 3300025909 Bacteria 613
481 Ga0207654_10003285 3300025911 Bacteria 8172
482 Ga0207654_10185216 3300025911 Bacteria 1361
483 Ga0207654_10534960 3300025911 Bacteria 831
484 Ga0207707_10074687 3300025912 Bacteria 2957
485 Ga0207707_10298153 3300025912 Bacteria 1394
486 Ga0207707_10734408 3300025912 Bacteria 827
487 Ga0207695_10056587 3300025913 Bacteria 4080
488 Ga0207695_10104513 3300025913 Bacteria 2821
489 Ga0207695_10228101 3300025913 Bacteria 1768
490 Ga0207695_10284481 3300025913 Bacteria 1547
491 Ga0207695_10930390 3300025913 Bacteria 749
492 Ga0207671_10057494 3300025914 Bacteria 2883
493 Ga0207671_10120775 3300025914 Bacteria 2003
494 Ga0207671_10332555 3300025914 Bacteria 1203
495 Ga0207671_10659429 3300025914 Bacteria 833
496 Ga0207693_10000493 3300025915 Bacteria 35669
497 Ga0207693_10008270 3300025915 Bacteria 8519
498 Ga0207693_10030071 3300025915 Bacteria 4288
499 Ga0207693_10059279 3300025915 Bacteria 2998
500 Ga0207693_10112539 3300025915 Bacteria 2135
501 Ga0207693_10159520 3300025915 Bacteria 1774
502 Ga0207693_10635016 3300025915 Bacteria 830
503 Ga0207693_10705887 3300025915 Bacteria 781
504 Ga0207693_11179653 3300025915 Bacteria 578
505 Ga0207663_10001067 3300025916 Bacteria 12565
506 Ga0207663_10012076 3300025916 Bacteria 4657
507 Ga0207663_10466318 3300025916 Bacteria 976
508 Ga0207663_10961543 3300025916 Bacteria 684
509 Ga0207663_10967373 3300025916 Bacteria 682
510 Ga0207660_10644243 3300025917 Bacteria 864
511 Ga0207660_11115557 3300025917 Bacteria 643
512 Ga0207660_11293772 3300025917 Bacteria 592
513 Ga0207662_10002067 3300025918 Bacteria 9951
514 Ga0207657_10000282 3300025919 Bacteria 54101
515 Ga0207657_10051869 3300025919 Bacteria 3564
516 Ga0207657_10620448 3300025919 Bacteria 843
517 Ga0207657_11124284 3300025919 Bacteria 600
518 Ga0207649_10017750 3300025920 Bacteria 4034
519 Ga0207649_10239309 3300025920 Bacteria 1302
520 Ga0207652_10104736 3300025921 Bacteria 2502
521 Ga0207652_10179342 3300025921 Bacteria 1903
522 Ga0207652_10298273 3300025921 Bacteria 1454
523 Ga0207646_10920567 3300025922 Bacteria 775
524 Ga0207646_10983489 3300025922 Bacteria 746
525 Ga0207681_10015153 3300025923 Bacteria 4807
526 Ga0207694_10006423 3300025924 Bacteria 8959
527 Ga0207694_10137335 3300025924 Bacteria 1964
528 Ga0207694_10234115 3300025924 Bacteria 1500
529 Ga0207650_10069986 3300025925 Bacteria 2636
530 Ga0207659_10005250 3300025926 Bacteria 7843
531 Ga0207659_11051182 3300025926 Bacteria 701
532 Ga0207687_10008551 3300025927 Bacteria 6694
533 Ga0207700_10014261 3300025928 Bacteria 5201
534 Ga0207700_10071645 3300025928 Bacteria 2669
535 Ga0207700_10104591 3300025928 Bacteria 2265
536 Ga0207700_10574500 3300025928 Bacteria 1002
537 Ga0207700_10580562 3300025928 Bacteria 997
538 Ga0207700_10669401 3300025928 Bacteria 926
539 Ga0207700_10929541 3300025928 Bacteria 778
540 Ga0207700_11315927 3300025928 Bacteria 644
541 Ga0207700_11901970 3300025928 Bacteria 521
542 Ga0207664_10012756 3300025929 Bacteria 6015
543 Ga0207664_10023422 3300025929 Bacteria 4626
544 Ga0207664_10054900 3300025929 Bacteria 3159
545 Ga0207664_10086181 3300025929 Bacteria 2565
546 Ga0207664_10125208 3300025929 Bacteria 2157
547 Ga0207664_10303495 3300025929 Bacteria 1405
548 Ga0207664_10503883 3300025929 Bacteria 1084
549 Ga0207644_10048201 3300025931 Bacteria 3044
550 Ga0207690_10003444 3300025932 Bacteria 9444
551 Ga0207690_10019766 3300025932 Bacteria 4153
552 Ga0207706_10000270 3300025933 Bacteria 56584
553 Ga0207706_10008316 3300025933 Bacteria 9567
554 Ga0207706_10200935 3300025933 Bacteria 1748
555 Ga0207706_10302615 3300025933 Bacteria 1393
556 Ga0207709_10048849 3300025935 Bacteria 2580
557 Ga0207709_10120230 3300025935 Bacteria 1772
558 Ga0207709_11104993 3300025935 Bacteria 651
559 Ga0207670_10092363 3300025936 Bacteria 2142
560 Ga0207669_10002208 3300025937 Bacteria 8271
561 Ga0207669_10129680 3300025937 Bacteria 1730
562 Ga0207669_10292009 3300025937 Bacteria 1235
563 Ga0207704_10395404 3300025938 Bacteria 1089
564 Ga0207704_11004593 3300025938 Bacteria 706
565 Ga0207665_10001538 3300025939 Bacteria 15513
566 Ga0207665_10010112 3300025939 Bacteria 6196
567 Ga0207665_10070979 3300025939 Bacteria 2377
568 Ga0207665_10103792 3300025939 Bacteria 1989
569 Ga0207665_10368058 3300025939 Bacteria 1088
570 Ga0207665_10501814 3300025939 Bacteria 937
571 Ga0207665_10578776 3300025939 Bacteria 875
572 Ga0207665_11010106 3300025939 Bacteria 662
573 Ga0207691_10053192 3300025940 Bacteria 3697
574 Ga0207711_10137545 3300025941 Bacteria 2195
575 Ga0207711_10543545 3300025941 Bacteria 1084
576 Ga0207689_10885848 3300025942 Bacteria 753
577 Ga0207661_10025741 3300025944 Bacteria 4476
578 Ga0207661_10050770 3300025944 Bacteria 3306
579 Ga0207661_10148369 3300025944 Bacteria 2025
580 Ga0207661_10847999 3300025944 Bacteria 841
581 Ga0207661_12008276 3300025944 Bacteria 524
582 Ga0207679_10004166 3300025945 Bacteria 8986
583 Ga0207679_10371865 3300025945 Bacteria 1251
584 Ga0207679_10841364 3300025945 Bacteria 838
585 Ga0207667_10011595 3300025949 Bacteria 10234
586 Ga0207667_10186152 3300025949 Bacteria 2131
587 Ga0207667_10309951 3300025949 Bacteria 1612
588 Ga0207651_10004358 3300025960 Bacteria 7116
589 Ga0207712_10047767 3300025961 Bacteria 2974
590 Ga0207712_10738205 3300025961 Bacteria 862
591 Ga0207668_10006213 3300025972 Bacteria 7052
592 Ga0207668_10039960 3300025972 Bacteria 3162
593 Ga0207668_11612398 3300025972 Bacteria 586
594 Ga0207640_10002653 3300025981 Bacteria 9576
595 Ga0207640_10003639 3300025981 Bacteria 8314
596 Ga0207640_10209176 3300025981 Bacteria 1485
597 Ga0207658_10023872 3300025986 Bacteria 4272
598 Ga0207658_11557595 3300025986 Bacteria 604
599 Ga0207677_10103809 3300026023 Bacteria 2099
600 Ga0207677_11197635 3300026023 Bacteria 695
601 Ga0207703_10433391 3300026035 Bacteria 1225
602 Ga0207703_10688729 3300026035 Bacteria 971
603 Ga0207703_10776479 3300026035 Bacteria 914
604 Ga0207639_10000784 3300026041 Bacteria 21626
605 Ga0207639_10017244 3300026041 Bacteria 5119
606 Ga0207678_10000159 3300026067 Bacteria 56028
607 Ga0207678_10000477 3300026067 Bacteria 36336
608 Ga0207678_10476999 3300026067 Bacteria 1086
609 Ga0207708_10000337 3300026075 Bacteria 36962
610 Ga0207708_10282110 3300026075 Bacteria 1346
611 Ga0207708_10441466 3300026075 Bacteria 1082
612 Ga0207702_10007687 3300026078 Bacteria 9165
613 Ga0207702_10046306 3300026078 Bacteria 3661
614 Ga0207702_10458876 3300026078 Bacteria 1237
615 Ga0207641_10017486 3300026088 Bacteria 5870
616 Ga0207641_11062543 3300026088 Bacteria 807
617 Ga0207648_10102108 3300026089 Bacteria 2513
618 Ga0207648_10363858 3300026089 Bacteria 1305
619 Ga0207676_10825727 3300026095 Bacteria 905
620 Ga0207674_10018829 3300026116 Bacteria 7490
621 Ga0207674_10030575 3300026116 Bacteria 5660
622 Ga0207674_10621991 3300026116 Bacteria 1043
623 Ga0207675_100001292 3300026118 Bacteria 25099
624 Ga0207675_100149393 3300026118 Bacteria 2223
625 Ga0207675_101393715 3300026118 Bacteria 722
626 Ga0207683_10001738 3300026121 Bacteria 19398
627 Ga0207683_10353704 3300026121 Bacteria 1348
628 Ga0207683_10966376 3300026121 Bacteria 791
629 Ga0207683_11094234 3300026121 Bacteria 739
630 Ga0207698_10021538 3300026142 Bacteria 4461
631 Ga0207698_10768882 3300026142 Bacteria 963
632 Ga0207698_11455564 3300026142 Bacteria 700
633 Ga0209179_1003967 3300027512 Bacteria 2191
634 Ga0209966_1085348 3300027695 Bacteria 703
635 Ga0209998_10038761 3300027717 Bacteria 1076
636 Ga0209998_10125883 3300027717 Bacteria 648
637 Ga0207428_10008303 3300027907 Bacteria 9386
638 Ga0207428_10670860 3300027907 Bacteria 743
639 Ga0268266_10206194 3300028379 Bacteria 1801
640 Ga0268266_10630747 3300028379 Bacteria 1031
641 Ga0268265_10612294 3300028380 Bacteria 1042
642 Ga0268264_10000377 3300028381 Bacteria 65413
643 Ga0268264_10015446 3300028381 Bacteria 6262
644 Ga0268264_10910854 3300028381 Bacteria 883
645 Ga0307515_10248135 3300028794 Bacteria 1538
646 Ga0311000_100475 3300029272 Bacteria 638
647 Ga0311004_113545 3300029276 Bacteria 667
648 Ga0311001_1079354 3300029277 Bacteria 5162
649 Ga0310981_1002449 3300029285 Bacteria 2299
650 Ga0307511_10057801 3300030521 Bacteria 3009
651 Ga0265340_10045595 3300031247 Bacteria 2141
652 Ga0265339_10011362 3300031249 Bacteria 5484
653 Ga0265327_10069811 3300031251 Bacteria 1762
654 Ga0307513_10340634 3300031456 Bacteria 1250
655 Ga0307509_10276688 3300031507 Bacteria 1442
656 Ga0307408_100016009 3300031548 Bacteria 5000
657 Ga0307408_100092650 3300031548 Bacteria 2284
658 Ga0307408_100395387 3300031548 Bacteria 1185
659 Ga0307408_100681236 3300031548 Bacteria 922
660 Ga0307408_102164597 3300031548 Bacteria 537
661 Ga0307508_10000378 3300031616 Bacteria 53801
662 Ga0307508_10014201 3300031616 Bacteria 7263
663 Ga0310105_121407 3300031666 Bacteria 503
664 Ga0316579_10240025 3300031691 Bacteria 877
665 Ga0265314_10636688 3300031711 Unclassified 545
666 Ga0316576_10978254 3300031727 Bacteria 604
667 Ga0307516_10019779 3300031730 Bacteria 6965
668 Ga0307405_10020264 3300031731 Bacteria 3712
669 Ga0307405_10610613 3300031731 Bacteria 891
670 Ga0307405_10828608 3300031731 Bacteria 777
671 Ga0307405_11844834 3300031731 Bacteria 538
672 Ga0316577_10382766 3300031733 Bacteria 799
673 Ga0307413_11016513 3300031824 Bacteria 711
674 Ga0307410_10088334 3300031852 Bacteria 2194
675 Ga0307410_10159678 3300031852 Bacteria 1687
676 Ga0307410_10384358 3300031852 Bacteria 1130
677 Ga0307410_10678337 3300031852 Bacteria 867
678 Ga0307410_11601175 3300031852 Bacteria 575
679 Ga0307410_11820968 3300031852 Bacteria 541
680 Ga0326468_10002343 3300031889 Bacteria 1579
681 Ga0307406_10173110 3300031901 Bacteria 1564
682 Ga0307406_10326285 3300031901 Bacteria 1189
683 Ga0307406_10608954 3300031901 Bacteria 902
684 Ga0307406_10802626 3300031901 Bacteria 794
685 Ga0307407_10126458 3300031903 Bacteria 1629
686 Ga0307407_10545266 3300031903 Bacteria 856
687 Ga0307412_10001095 3300031911 Bacteria 15519
688 Ga0307412_10102836 3300031911 Bacteria 2024
689 Ga0307412_11036061 3300031911 Bacteria 727
690 Ga0307409_100004876 3300031995 Bacteria 7628
691 Ga0307409_100837912 3300031995 Bacteria 929
692 Ga0307409_101915378 3300031995 Bacteria 622
693 Ga0307416_100036609 3300032002 Bacteria 3765
694 Ga0307416_100057739 3300032002 Bacteria 3142
695 Ga0307416_100419408 3300032002 Bacteria 1382
696 Ga0307416_100824435 3300032002 Bacteria 1024
697 Ga0307414_10054953 3300032004 Bacteria 2785
698 Ga0307411_10077414 3300032005 Bacteria 2276
699 Ga0307411_10528563 3300032005 Bacteria 1002
700 Ga0307411_11376330 3300032005 Bacteria 645
701 Ga0307415_100292801 3300032126 Bacteria 1345
702 Ga0307415_101649487 3300032126 Bacteria 617
703 Ga0316583_10263990 3300032133 Bacteria 596
704 Ga0307507_10070872 3300033179 Bacteria 3157
705 Ga0307510_10243235 3300033180 Bacteria 1292
706 Ga0316596_1037368 3300033541 Bacteria 1270
707 Ga0316215_1002459 3300033544 Bacteria 1751
708 Ga0373950_0005337 3300034818 Bacteria 1917
709 Ga0373958_0005093 3300034819 Bacteria 1979
710 Ga0373959_0030593 3300034820 Bacteria 1085
711 Ga0373938_0003982 3300034957 Bacteria 2442
712 Ga0373926_0003147 3300035083 Bacteria 5299
713 Ga0373926_0005778 3300035083 Bacteria 4089
714 Ga0373928_0006912 3300035084 Bacteria 2186
715 Ga0373940_0072756 3300035088 Bacteria 1004
716 Ga0373944_0445889 3300035089 Bacteria 504
717 Ga0373949_0011140 3300035090 Bacteria 1978
718 Ga0373952_0016138 3300035092 Bacteria 1514
719 Ga0373932_0062532 3300035112 Bacteria 1135
720 Ga0373936_0010464 3300035113 Bacteria 3500
721 Ga0373936_0015906 3300035113 Bacteria 2887
722 Ga0373936_0341737 3300035113 Bacteria 681
723 Ga0373939_0010461 3300035114 Bacteria 2321
724 Ga0373941_0044026 3300035115 Bacteria 1391
725 Ga0373945_0012687 3300035116 Bacteria 2802
726 Ga0373945_0171395 3300035116 Bacteria 889
727 Ga0373953_0099066 3300035117 Bacteria 1225
728 Ga0373953_0106539 3300035117 Bacteria 1183
729 Ga0373954_0006766 3300035118 Bacteria 5002
730 Ga0373956_0012723 3300035119 Bacteria 3493
731 Ga0373957_0106937 3300035120 Bacteria 1124
732 Ga0373957_0168239 3300035120 Bacteria 905
733 Ga0373960_0001622 3300035121 Bacteria 5029
734 Ga0373943_0010548 3300035170 Bacteria 4141
735 Ga0373943_0017321 3300035170 Bacteria 3296
736 Ga0373943_0124534 3300035170 Bacteria 1373
737 Ga0373946_0019180 3300035171 Bacteria 2633
738 Ga0373946_0359825 3300035171 Bacteria 729
739 Ga0373955_0020793 3300035172 Bacteria 3303
740 Ga0373955_0126635 3300035172 Bacteria 1488
741 Ga0373942_0152487 3300035207 Bacteria 743
742 Ga0373962_0126509 3300035242 Bacteria 819
743 Ga0373924_0014731 3300035410 Bacteria 2958
744 Ga0373924_0201528 3300035410 Bacteria 878
745 Ga0373931_0030144 3300035691 Bacteria 2791
746 Ga0373931_0062360 3300035691 Bacteria 2012
747 Ga0373931_0823862 3300035691 Bacteria 620
748 Ga0373935_0012257 3300035692 Bacteria 5156
749 Ga0373935_0053250 3300035692 Bacteria 2574
750 Ga0373935_0286934 3300035692 Bacteria 1160
751 Ga0373927_0004904 3300035695 Bacteria 9294
752 Ga0373927_0222869 3300035695 Bacteria 1238
753 Ga0373927_0333387 3300035695 Bacteria 999
754 Ga0373933_0010736 3300035724 Bacteria 5025
755 Ga0373933_0196707 3300035724 Bacteria 1289
756 Ga0373933_0875935 3300035724 Bacteria 591
757 Ga0373947_0009798 3300035725 Bacteria 5497
758 Ga0373947_0034111 3300035725 Bacteria 3009
759 Ga0373947_0398099 3300035725 Bacteria 928
760 Ga0373947_0871454 3300035725 Bacteria 615
761 Ga0310104_00193 3300036242 Bacteria 3346
762 Ga0373937_0031089 3300036401 Bacteria 4835
763 Ga0373937_0050692 3300036401 Bacteria 3802
764 Ga0373937_0425070 3300036401 Bacteria 1261
765 Ga0316582_0181961 3300036647 Bacteria 1430
766 Ga0373925_0024722 3300037068 Bacteria 4386
767 Ga0373925_0039116 3300037068 Bacteria 3508
768 Ga0373925_0586461 3300037068 Bacteria 918
769 Ga0373925_0685520 3300037068 Bacteria 845
770 Ga0395899_0072585 3300037312 Bacteria 2518
771 Ga0395899_0204290 3300037312 Bacteria 1376
772 Ga0395899_0701927 3300037312 Bacteria 634
773 Ga0395900_0238023 3300037418 Bacteria 1827
774 Ga0395900_0343977 3300037418 Bacteria 1466
775 Ga0395900_0369151 3300037418 Bacteria 1405
776 Ga0395900_0493002 3300037418 Bacteria 1176
777 Ga0395898_0007760 3300037466 Bacteria 11394
778 Ga0395898_0055115 3300037466 Bacteria 3878
779 Ga0395898_0064043 3300037466 Bacteria 3567
780 Ga0395898_0294093 3300037466 Bacteria 1549
781 Ga0395898_0917040 3300037466 Bacteria 814
782 Ga0395898_1122328 3300037466 Bacteria 719
783 Ga0395905_0002506 3300037471 Bacteria 20297
784 Ga0395905_0112513 3300037471 Bacteria 2557
785 Ga0395905_0217669 3300037471 Bacteria 1788
786 Ga0436364_0089033 3300037853 Bacteria 2364
787 Ga0436364_0333324 3300037853 Bacteria 10396
788 Ga0436364_0335675 3300037853 Bacteria 1232
789 Ga0436364_0508030 3300037853 Bacteria 1342
790 Ga0436364_0554121 3300037853 Bacteria 902
791 Ga0436364_1191222 3300037853 Bacteria 1265
792 Ga0436364_1352603 3300037853 Bacteria 2275
793 Ga0395901_0002674 3300038443 Bacteria 17986
794 Ga0395901_0132044 3300038443 Bacteria 2624
795 Ga0395901_0318811 3300038443 Bacteria 1609
796 Ga0395901_0408662 3300038443 Bacteria 1394
797 Ga0395901_0637417 3300038443 Bacteria 1070
798 Ga0395901_1012464 3300038443 Bacteria 806
799 Ga0242420_011095 3300038996 Bacteria 1506
800 Ga0436365_0368899 3300039437 Bacteria 1973
801 Ga0436365_0870893 3300039437 Bacteria 2017
802 Ga0436365_1010396 3300039437 Bacteria 801
803 Ga0436365_1047672 3300039437 Bacteria 1074
804 Ga0436365_1253031 3300039437 Bacteria 47093
805 Ga0436365_1350477 3300039437 Bacteria 523
806 Ga0436365_1529438 3300039437 Bacteria 926
807 Ga0436365_1760276 3300039437 Bacteria 874
808 Ga0436365_1870318 3300039437 Bacteria 5247
809 Ga0436365_1902820 3300039437 Bacteria 1335
810 Ga0436360_0409482 3300039438 Bacteria 1423
811 Ga0436360_0777771 3300039438 Bacteria 1037
812 Ga0436360_0885775 3300039438 Bacteria 829
813 Ga0436360_0888847 3300039438 Bacteria 573
814 Ga0436360_1268636 3300039438 Bacteria 533
815 Ga0436361_0317849 3300039447 Bacteria 1007
816 Ga0436361_0427976 3300039447 Bacteria 1496
817 Ga0436361_0763086 3300039447 Bacteria 801
818 Ga0436361_0963669 3300039447 Bacteria 3298
819 Ga0436363_0131403 3300039450 Bacteria 1132
820 Ga0436363_0242717 3300039450 Bacteria 589
821 Ga0436363_0312775 3300039450 Bacteria 1035
822 Ga0436363_0880899 3300039450 Bacteria 6318
823 Ga0436363_1014283 3300039450 Bacteria 1082
824 Ga0436363_1046285 3300039450 Bacteria 10399
825 Ga0436363_1113612 3300039450 Bacteria 631
826 Ga0436363_1387407 3300039450 Bacteria 1077
827 Ga0436363_1575848 3300039450 Bacteria 1027
828 Ga0436363_1627336 3300039450 Bacteria 720
829 Ga0436362_0002334 3300039453 Bacteria 939
830 Ga0436362_0607333 3300039453 Bacteria 833
831 Ga0436362_0793870 3300039453 Bacteria 1297
832 Ga0436362_0982213 3300039453 Bacteria 745
833 Ga0436362_1142159 3300039453 Bacteria 1204
834 Ga0439439_0132040 3300041406 Bacteria 702
835 Ga0439465_0053801 3300041413 Bacteria 1323
836 Ga0439465_0127160 3300041413 Bacteria 897
837 Ga0451794_34969 3300041446 Bacteria 594
838 Ga0451798_0606664 3300041458 Bacteria 500
839 Ga0451807_2208106 3300041486 Bacteria 579
840 Ga0451837_0342915 3300041494 Bacteria 1221
841 Ga0451855_0769345 3300041511 Bacteria 513
842 Ga0451853_3344493 3300041512 Bacteria 740
843 Ga0439431_0094769 3300041997 Bacteria 816
844 Ga0439432_128392 3300042006 Bacteria 749
845 Ga0439457_151757 3300042014 Bacteria 558
846 Ga0450900_053254 3300042136 Bacteria 623
847 Ga0450903_051975 3300042138 Bacteria 599
848 Ga0439459_0018016 3300042438 Bacteria 1323
849 Ga0450901_002715 3300042533 Bacteria 1880
850 Ga0466969_0217487 3300044656 Bacteria 869
851 Ga0466969_0511409 3300044656 Bacteria 548
852 Ga0466965_0333684 3300044683 Bacteria 828
853 Ga0466966_0037447 3300044684 Bacteria 3128
854 Ga0466966_0038631 3300044684 Bacteria 3076
855 Ga0466966_0063022 3300044684 Bacteria 2337
856 Ga0466961_0017735 3300044693 Bacteria 4574
857 Ga0466961_0058522 3300044693 Bacteria 2452
858 Ga0466963_0016197 3300044694 Bacteria 4633
859 Ga0466963_0037303 3300044694 Bacteria 3172
860 Ga0466963_0070352 3300044694 Bacteria 2353
861 Ga0466963_0354875 3300044694 Bacteria 1033
862 Ga0466963_0358283 3300044694 Bacteria 1027
863 Ga0466963_0543930 3300044694 Bacteria 820
864 Ga0466964_0475103 3300044706 Bacteria 667
865 Ga0466971_0080841 3300044719 Bacteria 1482
866 Ga0466971_0675604 3300044719 Bacteria 518
867 Ga0466968_0060841 3300044735 Bacteria 1628
868 Ga0466970_0122687 3300044765 Bacteria 1424
869 Ga0466970_0201450 3300044765 Bacteria 1107
870 Ga0466970_0506738 3300044765 Bacteria 695
871 Ga0466957_0014805 3300044842 Bacteria 4545
872 Ga0466957_0075585 3300044842 Bacteria 2090
873 Ga0466957_0318692 3300044842 Bacteria 1048
874 Ga0466957_0935663 3300044842 Bacteria 620
875 Ga0466960_0051465 3300044901 Bacteria 1990
876 Ga0466960_0958273 3300044901 Bacteria 524
877 Ga0466959_0098844 3300045049 Bacteria 2090
878 Ga0466959_0744194 3300045049 Bacteria 656
879 Ga0466967_0011664 3300045976 Bacteria 6675
880 Ga0466967_0056204 3300045976 Bacteria 3469
881 Ga0466967_0096571 3300045976 Bacteria 2696
882 Ga0466967_0434220 3300045976 Bacteria 1281
883 Ga0466967_0471064 3300045976 Bacteria 1229
884 Ga0466967_1078797 3300045976 Bacteria 800
885 Ga0495617_093369 3300046452 Bacteria 981
886 Ga0495603_0011756 3300046455 Bacteria 5297
887 Ga0495603_0725840 3300046455 Bacteria 568
888 Ga0495629_0026319 3300046459 Bacteria 4133
889 Ga0495629_0589356 3300046459 Bacteria 744
890 Ga0495641_0210957 3300046461 Bacteria 871
891 Ga0495651_0353235 3300046462 Bacteria 971
892 Ga0495651_0361100 3300046462 Bacteria 957
893 Ga0495650_0056786 3300046471 Bacteria 1587
894 Ga0495580_0111434 3300046472 Bacteria 1900
895 Ga0495580_0791263 3300046472 Bacteria 615
896 Ga0495582_0016883 3300046473 Bacteria 3997
897 Ga0495639_0026164 3300046475 Bacteria 2577
898 Ga0495662_0031478 3300046476 Bacteria 2562
899 Ga0495664_0018921 3300046477 Bacteria 3953
900 Ga0495584_0038672 3300046491 Bacteria 2411
901 Ga0495606_0055089 3300046507 Bacteria 2573
902 Ga0495608_0912010 3300046511 Bacteria 514
903 Ga0495618_0043838 3300046514 Bacteria 2822
904 Ga0495618_0926569 3300046514 Bacteria 502
905 Ga0495630_0095907 3300046517 Bacteria 2242
906 Ga0495630_0170546 3300046517 Bacteria 1658
907 Ga0495630_0274888 3300046517 Bacteria 1287
908 Ga0495666_0087221 3300046526 Bacteria 1474
909 Ga0495652_0204382 3300046529 Bacteria 1496
910 Ga0495652_0526129 3300046529 Bacteria 816
911 Ga0495665_0039396 3300046531 Bacteria 2517
912 Ga0495665_0168192 3300046531 Bacteria 1142
913 Ga0495640_0019304 3300046533 Bacteria 5035
914 Ga0495640_0127966 3300046533 Bacteria 1646
915 Ga0495586_0136518 3300046535 Bacteria 1375
916 Ga0495586_0158041 3300046535 Bacteria 1278
917 Ga0495587_0239915 3300046536 Bacteria 1020
918 Ga0495597_0068164 3300046542 Bacteria 1538
919 Ga0495645_0003533 3300046543 Bacteria 10576
920 Ga0495622_0204243 3300046557 Bacteria 879
921 Ga0495622_0452756 3300046557 Bacteria 550
922 Ga0495667_0108852 3300046559 Bacteria 1790
923 Ga0495667_0319903 3300046559 Bacteria 982
924 Ga0495656_0482666 3300046615 Bacteria 656
925 Ga0495668_0426247 3300046616 Bacteria 730
926 Ga0495668_0430953 3300046616 Bacteria 725
927 Ga0495634_0015564 3300046642 Bacteria 5459
928 Ga0495634_0209436 3300046642 Bacteria 1208
929 Ga0495625_0265563 3300046660 Bacteria 1109
930 Ga0495625_0747054 3300046660 Bacteria 574
931 Ga0495635_0099960 3300046663 Bacteria 1982
932 Ga0495635_0260117 3300046663 Bacteria 1169
933 Ga0495635_0810117 3300046663 Bacteria 603
934 Ga0495657_0732641 3300046675 Bacteria 567
935 Ga0495657_0864147 3300046675 Bacteria 515
936 Ga0495599_0154630 3300046678 Bacteria 1419
937 Ga0495599_0165274 3300046678 Bacteria 1367
938 Ga0495623_0224284 3300046679 Bacteria 1069
939 Ga0495623_0315983 3300046679 Bacteria 859
940 Ga0495646_0054443 3300046680 Bacteria 2406
941 Ga0495646_0560632 3300046680 Bacteria 583
942 Ga0495647_0005756 3300046681 Bacteria 4074
943 Ga0495658_0398360 3300046683 Bacteria 877
944 Ga0495613_0078402 3300046689 Bacteria 2403
945 Ga0495624_0051066 3300046690 Bacteria 2618
946 Ga0495624_0186772 3300046690 Bacteria 1261
947 Ga0495600_0144763 3300046809 Bacteria 1541
948 Ga0495581_0033672 3300047315 Bacteria 2966
949 Ga0495604_0190355 3300047317 Bacteria 1430
950 Ga0495604_0317839 3300047317 Bacteria 1041
951 Ga0495604_0453169 3300047317 Bacteria 838
952 Ga0495604_0644638 3300047317 Bacteria 676
953 Ga0495674_0010137 3300047319 Bacteria 8927
954 Ga0495676_0156541 3300047321 Bacteria 1616
955 Ga0495680_0263931 3300047322 Bacteria 1217
956 Ga0495680_0366455 3300047322 Bacteria 1000
957 Ga0495680_0474417 3300047322 Bacteria 853
958 Ga0495680_0621850 3300047322 Bacteria 720
959 Ga0495675_0033574 3300047444 Bacteria 3275
960 Ga0495675_0852003 3300047444 Unclassified 502
961 Ga0495684_0016236 3300047471 Bacteria 5733
962 Ga0495684_0526279 3300047471 Bacteria 809
963 Ga0495686_0247696 3300047472 Bacteria 1002
964 Ga0495593_0035110 3300047673 Bacteria 2723
965 Ga0495602_0073140 3300048088 Bacteria 2919
966 Ga0495615_0245224 3300048090 Bacteria 566
967 Ga0496100_0017720 3300048903 Bacteria 4210
968 Ga0496100_0086615 3300048903 Bacteria 2128
969 Ga0496100_0088497 3300048903 Bacteria 2108
970 Ga0496100_0252106 3300048903 Bacteria 1306
971 Ga0496100_0427167 3300048903 Bacteria 1013
972 Ga0496100_0849411 3300048903 Bacteria 716
973 Ga0496101_0010556 3300048904 Bacteria 6102
974 Ga0496101_0142858 3300048904 Bacteria 1825
975 Ga0496101_0146063 3300048904 Bacteria 1806
976 Ga0496101_0322108 3300048904 Bacteria 1213
977 Ga0496101_0501719 3300048904 Bacteria 959
978 Ga0496101_1047976 3300048904 Bacteria 641
979 Ga0496101_1537642 3300048904 Bacteria 518
980 Ga0496102_0021341 3300048905 Bacteria 5727
981 Ga0496102_0269233 3300048905 Bacteria 1606
982 Ga0496102_0276267 3300048905 Bacteria 1583
983 Ga0496102_0641575 3300048905 Bacteria 985
984 Ga0496102_1387868 3300048905 Bacteria 621
985 Ga0496103_0067933 3300048906 Bacteria 2227
986 Ga0496103_0112317 3300048906 Bacteria 1731
987 Ga0496103_0172850 3300048906 Bacteria 1388
988 Ga0496104_0001364 3300048907 Bacteria 21131
989 Ga0496104_0044527 3300048907 Bacteria 4169
990 Ga0496104_0044528 3300048907 Bacteria 4169
991 Ga0496104_0108172 3300048907 Bacteria 2664
992 Ga0496104_0274478 3300048907 Bacteria 1598
993 Ga0496105_0004404 3300048908 Bacteria 10600
994 Ga0496105_0005504 3300048908 Bacteria 9611
995 Ga0496105_0148751 3300048908 Bacteria 1925
996 Ga0496105_0615649 3300048908 Bacteria 841
997 Ga0496106_0049371 3300048909 Bacteria 3169
998 Ga0496106_0074612 3300048909 Bacteria 2597
999 Ga0496106_0255760 3300048909 Bacteria 1401
1000 Ga0496106_0784058 3300048909 Bacteria 756
1001 Ga0496107_0111293 3300048910 Bacteria 2013
1002 Ga0496107_0296518 3300048910 Bacteria 1203
1003 Ga0496107_0336293 3300048910 Bacteria 1123
1004 Ga0496107_0450946 3300048910 Bacteria 955
1005 Ga0496107_0687808 3300048910 Bacteria 753
1006 Ga0496108_0001133 3300048911 Bacteria 20819
1007 Ga0496108_0032633 3300048911 Bacteria 4325
1008 Ga0496108_0085334 3300048911 Bacteria 2680
1009 Ga0496108_0224656 3300048911 Bacteria 1632
1010 Ga0496108_0517813 3300048911 Bacteria 1041
1011 Ga0496108_0668902 3300048911 Bacteria 902
1012 Ga0496109_0000583 3300048912 Bacteria 30510
1013 Ga0496109_0005439 3300048912 Bacteria 10654
1014 Ga0496109_0042827 3300048912 Bacteria 4103
1015 Ga0496109_0138169 3300048912 Bacteria 2278
1016 Ga0496109_0557498 3300048912 Bacteria 1081
1017 Ga0496110_0010849 3300048913 Bacteria 7430
1018 Ga0496110_0112064 3300048913 Bacteria 2453
1019 Ga0496110_0181086 3300048913 Bacteria 1913
1020 Ga0496110_0430482 3300048913 Bacteria 1203
1021 Ga0496110_0766449 3300048913 Bacteria 868
1022 Ga0496110_1855276 3300048913 Bacteria 513
1023 Ga0496111_0009370 3300048914 Bacteria 6529
1024 Ga0496111_0074867 3300048914 Bacteria 2466
1025 Ga0496111_0100084 3300048914 Bacteria 2129
1026 Ga0496111_0397434 3300048914 Bacteria 1019
1027 Ga0496111_0783833 3300048914 Bacteria 690
1028 Ga0496112_0000884 3300048915 Bacteria 21517
1029 Ga0496112_0056643 3300048915 Bacteria 3858
1030 Ga0496112_0059398 3300048915 Bacteria 3767
1031 Ga0496112_0262667 3300048915 Bacteria 1676
1032 Ga0496112_0301262 3300048915 Bacteria 1548
1033 Ga0496112_0865970 3300048915 Bacteria 826
1034 Ga0496112_0959312 3300048915 Bacteria 776
1035 Ga0496112_1903594 3300048915 Bacteria 506
1036 Ga0496113_0000351 3300048916 Bacteria 22021
1037 Ga0496113_0004259 3300048916 Bacteria 8765
1038 Ga0496113_0014431 3300048916 Bacteria 5389
1039 Ga0496113_0480557 3300048916 Bacteria 998
1040 Ga0496114_0159980 3300048917 Bacteria 1957
1041 Ga0496114_0325387 3300048917 Bacteria 1359
1042 Ga0496114_0526862 3300048917 Bacteria 1045
1043 Ga0496114_0727902 3300048917 Bacteria 868
1044 Ga0496115_0004536 3300048918 Bacteria 10046
1045 Ga0496115_0117368 3300048918 Bacteria 2189
1046 Ga0496115_0208195 3300048918 Bacteria 1615
1047 Ga0496115_0307943 3300048918 Bacteria 1297
1048 Ga0496115_0774600 3300048918 Bacteria 748
1049 Ga0496115_1004222 3300048918 Bacteria 637
1050 Ga0496116_0104480 3300048919 Bacteria 1683
1051 Ga0496116_0224902 3300048919 Bacteria 957
1052 Ga0496117_0071108 3300048920 Bacteria 2333
1053 Ga0496117_0079014 3300048920 Bacteria 2169
1054 Ga0496117_0126021 3300048920 Bacteria 1562
1055 Ga0496117_0280736 3300048920 Bacteria 892
1056 Ga0496118_0024920 3300048921 Bacteria 5148
1057 Ga0496118_0029731 3300048921 Bacteria 4576
1058 Ga0496118_0073065 3300048921 Bacteria 2459
1059 Ga0496118_0524006 3300048921 Bacteria 584
1060 Ga0496118_0560981 3300048921 Bacteria 555
1061 Ga0496119_0004353 3300048922 Bacteria 14129
1062 Ga0496119_0015798 3300048922 Bacteria 5783
1063 Ga0496119_0047286 3300048922 Bacteria 2678
1064 Ga0496119_0186852 3300048922 Bacteria 1083
1065 Ga0496119_0240910 3300048922 Bacteria 916
1066 Ga0496119_0295542 3300048922 Bacteria 800
1067 Ga0496119_0381273 3300048922 Bacteria 676
1068 Ga0496120_0058656 3300048923 Bacteria 2161
1069 Ga0496120_0072566 3300048923 Bacteria 1886
1070 Ga0496120_0227045 3300048923 Bacteria 889
1071 Ga0496121_0003703 3300048924 Bacteria 21450
1072 Ga0496121_0035490 3300048924 Bacteria 4468
1073 Ga0496121_0076984 3300048924 Bacteria 2658
1074 Ga0496121_0273289 3300048924 Bacteria 1160
1075 Ga0496121_0396206 3300048924 Bacteria 906
1076 Ga0496121_0414452 3300048924 Bacteria 878
1077 Ga0496122_0049328 3300048925 Bacteria 3225
1078 Ga0496122_0133672 3300048925 Bacteria 1569
1079 Ga0496122_0620340 3300048925 Bacteria 502
1080 Ga0496123_0023041 3300048926 Bacteria 4779
1081 Ga0496123_0443489 3300048926 Bacteria 580
1082 Ga0496124_0037995 3300048927 Bacteria 4182
1083 Ga0496124_0201142 3300048927 Bacteria 1515
1084 Ga0496124_0280696 3300048927 Bacteria 1214
1085 Ga0496124_0639254 3300048927 Bacteria 685
1086 Ga0496125_0017448 3300048928 Bacteria 6842
1087 Ga0496125_0187364 3300048928 Bacteria 1370
1088 Ga0496125_0228180 3300048928 Bacteria 1193
1089 Ga0496126_0052029 3300048929 Bacteria 3725
1090 Ga0496126_0062525 3300048929 Bacteria 3340
1091 Ga0496126_0076397 3300048929 Bacteria 2971
1092 Ga0496126_0088438 3300048929 Bacteria 2728
1093 Ga0496126_0110380 3300048929 Bacteria 2396
1094 Ga0496126_0157561 3300048929 Bacteria 1942
1095 Ga0496126_0185973 3300048929 Bacteria 1762
1096 Ga0496126_0552488 3300048929 Bacteria 913
1097 Ga0501306_005013 3300049127 Bacteria 1502
1098 Ga0501309_018091 3300049129 Bacteria 971
1099 Ga0501310_000913 3300049130 Bacteria 2631
1100 Ga0501304_015606 3300049160 Bacteria 713
1101 Ga0501307_051215 3300049162 Bacteria 621
1102 Ga0501307_069927 3300049162 Bacteria 558
1103 Ga0501295_087541 3300049518 Bacteria 716
1104 Ga0501311_058550 3300049527 Bacteria 618
1105 Ga0501311_058695 3300049527 Bacteria 617
1106 Ga0501312_002347 3300049528 Bacteria 2034
1107 Ga0501313_012946 3300049529 Bacteria 976
1108 Ga0501314_004633 3300049530 Bacteria 1147
1109 Ga0501315_000284 3300049531 Bacteria 3262
1110 Ga0501316_001152 3300049532 Bacteria 2158
1111 Ga0501317_000192 3300049533 Bacteria 3649
1112 Ga0501318_000037 3300049534 Bacteria 5323
1113 Ga0501320_007213 3300049536 Bacteria 1064
1114 Ga0501320_033205 3300049536 Bacteria 650
1115 Ga0501323_009389 3300049539 Bacteria 1152
1116 Ga0501324_025965 3300049540 Bacteria 620
1117 Ga0501329_01320 3300049545 Bacteria 1070
1118 Ga0501331_07283 3300049547 Bacteria 656
1119 Ga0501332_19326 3300049548 Bacteria 502
1120 Ga0501335_019758 3300049551 Bacteria 713
1121 Ga0501031_0058878 3300049568 Bacteria 2503
1122 Ga0501031_0189582 3300049568 Bacteria 1343
1123 Ga0501031_0245821 3300049568 Bacteria 1163
1124 Ga0501031_0336341 3300049568 Bacteria 978
1125 Ga0501031_0384727 3300049568 Bacteria 908
1126 Ga0501032_0102312 3300049569 Bacteria 1898
1127 Ga0501032_0196587 3300049569 Bacteria 1317
1128 Ga0501032_0510860 3300049569 Bacteria 767
1129 Ga0501033_0003899 3300049570 Bacteria 12129
1130 Ga0501033_0077789 3300049570 Bacteria 2434
1131 Ga0501033_0087576 3300049570 Bacteria 2279
1132 Ga0501033_0329421 3300049570 Bacteria 1072
1133 Ga0501033_0561852 3300049570 Bacteria 785
1134 Ga0501034_0009013 3300049571 Bacteria 10479
1135 Ga0501034_0045501 3300049571 Bacteria 4434
1136 Ga0501034_0046023 3300049571 Bacteria 4408
1137 Ga0501034_0072791 3300049571 Bacteria 3445
1138 Ga0501034_0215781 3300049571 Bacteria 1872
1139 Ga0501034_0280847 3300049571 Bacteria 1604
1140 Ga0501034_0296749 3300049571 Bacteria 1553
1141 Ga0501034_0660737 3300049571 Bacteria 946
1142 Ga0501034_0789867 3300049571 Bacteria 843
1143 Ga0501034_1100999 3300049571 Bacteria 675
1144 Ga0501034_1586763 3300049571 Bacteria 527
1145 Ga0501036_0042790 3300049572 Bacteria 3834
1146 Ga0501036_0156089 3300049572 Bacteria 1924
1147 Ga0501036_0373840 3300049572 Bacteria 1190
1148 Ga0501036_0761878 3300049572 Bacteria 798
1149 Ga0501036_1036998 3300049572 Bacteria 671
1150 Ga0501037_0038500 3300049573 Bacteria 3522
1151 Ga0501037_0058098 3300049573 Bacteria 2823
1152 Ga0501037_0067461 3300049573 Bacteria 2605
1153 Ga0501037_0147819 3300049573 Bacteria 1680
1154 Ga0501037_0215198 3300049573 Bacteria 1354
1155 Ga0501037_0308671 3300049573 Bacteria 1097
1156 Ga0501037_0610859 3300049573 Bacteria 731
1157 Ga0501038_0046533 3300049574 Bacteria 3761
1158 Ga0501038_0111161 3300049574 Bacteria 2270
1159 Ga0501038_0149812 3300049574 Bacteria 1902
1160 Ga0501038_0178958 3300049574 Bacteria 1712
1161 Ga0501039_0094100 3300049575 Bacteria 2335
1162 Ga0501039_0143242 3300049575 Bacteria 1878
1163 Ga0501039_0220637 3300049575 Bacteria 1490
1164 Ga0501039_1465325 3300049575 Bacteria 525
1165 Ga0501040_0057060 3300049576 Bacteria 2680
1166 Ga0501040_0104821 3300049576 Bacteria 1975
1167 Ga0501042_0006352 3300049578 Bacteria 7666
1168 Ga0501042_1104347 3300049578 Bacteria 578
1169 Ga0501043_0032226 3300049579 Bacteria 4119
1170 Ga0501043_0100195 3300049579 Bacteria 2277
1171 Ga0501043_0374221 3300049579 Bacteria 1079
1172 Ga0501043_0377711 3300049579 Bacteria 1073
1173 Ga0501046_0079981 3300049580 Bacteria 2526
1174 Ga0501046_0104265 3300049580 Bacteria 2173
1175 Ga0501047_0005487 3300049581 Bacteria 11930
1176 Ga0501047_0103854 3300049581 Bacteria 2722
1177 Ga0501047_0322469 3300049581 Bacteria 1384
1178 Ga0501047_0346110 3300049581 Bacteria 1323
1179 Ga0501047_0511199 3300049581 Bacteria 1027
1180 Ga0501047_0622027 3300049581 Bacteria 900
1181 Ga0501048_0010499 3300049582 Bacteria 6911
1182 Ga0501048_0644508 3300049582 Bacteria 761
1183 Ga0501067_0001840 3300049583 Bacteria 11669
1184 Ga0501067_0138882 3300049583 Bacteria 1353
1185 Ga0501068_0031355 3300049584 Bacteria 3157
1186 Ga0501068_0134851 3300049584 Bacteria 1545
1187 Ga0501068_0679595 3300049584 Bacteria 673
1188 Ga0501069_0192433 3300049585 Bacteria 1180
1189 Ga0501069_0553027 3300049585 Bacteria 689
1190 Ga0501069_0965278 3300049585 Bacteria 520
1191 Ga0501070_0025506 3300049586 Bacteria 4958
1192 Ga0501070_0219812 3300049586 Bacteria 1558
1193 Ga0501071_0014068 3300049587 Bacteria 5468
1194 Ga0501072_0184090 3300049588 Bacteria 1666
1195 Ga0501072_0267299 3300049588 Bacteria 1361
1196 Ga0501072_1024082 3300049588 Bacteria 643
1197 Ga0501073_0023164 3300049589 Bacteria 4463
1198 Ga0501073_0039588 3300049589 Bacteria 3338
1199 Ga0501073_1281054 3300049589 Bacteria 502
1200 Ga0501074_0026693 3300049590 Bacteria 4187
1201 Ga0501074_0052758 3300049590 Bacteria 2934
1202 Ga0501075_0433447 3300049591 Bacteria 1002
1203 Ga0501076_0054065 3300049592 Bacteria 3182
1204 Ga0501076_1252901 3300049592 Bacteria 610
1205 Ga0501077_0028790 3300049593 Bacteria 3531
1206 Ga0501077_0769530 3300049593 Bacteria 619
1207 Ga0501198_084030 3300049649 Bacteria 621
1208 Ga0501202_068220 3300049652 Bacteria 815
1209 Ga0501209_090205 3300049656 Bacteria 891
1210 Ga0501261_052301 3300049690 Bacteria 673
1211 Ga0501234_067452 3300049707 Bacteria 614
1212 Ga0501245_092165 3300049708 Bacteria 602
1213 Ga0501079_0024576 3300049741 Bacteria 4623
1214 Ga0501079_0126189 3300049741 Bacteria 1991
1215 Ga0501079_0670703 3300049741 Bacteria 816
1216 Ga0501080_0107267 3300049742 Bacteria 2588
1217 Ga0501080_0137367 3300049742 Bacteria 2261
1218 Ga0501080_0258855 3300049742 Bacteria 1586
1219 Ga0501080_0871114 3300049742 Bacteria 786
1220 Ga0501081_1036619 3300049743 Bacteria 620
1221 Ga0501083_0006724 3300049744 Bacteria 8157
1222 Ga0501083_0023858 3300049744 Bacteria 4242
1223 Ga0501083_0493650 3300049744 Bacteria 797
1224 Ga0501083_0604216 3300049744 Bacteria 714
1225 Ga0501271_028555 3300049768 Bacteria 679
1226 Ga0501035_0069162 3300049822 Bacteria 3130
1227 Ga0501035_0143633 3300049822 Bacteria 2073
1228 Ga0501035_0188785 3300049822 Bacteria 1772
1229 Ga0501035_0274381 3300049822 Bacteria 1426
1230 Ga0501035_0310484 3300049822 Bacteria 1327
1231 Ga0501035_0584051 3300049822 Bacteria 912
1232 Ga0501044_0047177 3300049823 Bacteria 4456
1233 Ga0501044_0096645 3300049823 Bacteria 2975
1234 Ga0501044_0163967 3300049823 Bacteria 2197
1235 Ga0501044_0588757 3300049823 Bacteria 1006
1236 Ga0501044_0984596 3300049823 Bacteria 715
1237 Ga0501044_1040435 3300049823 Bacteria 689
1238 Ga0501045_0484646 3300049824 Bacteria 919
1239 Ga0501045_0496303 3300049824 Bacteria 906
1240 Ga0501045_1397298 3300049824 Bacteria 508
1241 nmdc:mga03683_30010_c1 3300050489 Bacteria 2173
1242 nmdc:mga03683_55888_c1 3300050489 Bacteria 1328
1243 nmdc:mga03683_57927_c1 3300050489 Bacteria 1632
1244 nmdc:mga00v17_128506_c1 3300050491 Bacteria 1618
1245 nmdc:mga00v17_158507_c1 3300050491 Bacteria 1456
1246 nmdc:mga00v17_40128_c1 3300050491 Bacteria 2807
1247 nmdc:mga0yw44_198666_c1 3300050492 Bacteria 1324
1248 nmdc:mga0yw44_72574_c1 3300050492 Bacteria 2140
1249 nmdc:mga0yw44_8112_c1 3300050492 Bacteria 5214
1250 nmdc:mga0k408_107918_c1 3300050493 Bacteria 1644
1251 nmdc:mga0k408_349325_c1 3300050493 Bacteria 882
1252 nmdc:mga06z11_122918_c1 3300050494 Bacteria 1450
1253 nmdc:mga06z11_65629_c1 3300050494 Bacteria 1905
1254 nmdc:mga07m45_26736_c1 3300050496 Bacteria 3172
1255 nmdc:mga07m45_313530_c1 3300050496 Bacteria 912
1256 nmdc:mga05p37_109891_c1 3300050507 Bacteria 3392
1257 nmdc:mga05p37_1141437_c1 3300050507 Bacteria 811
1258 nmdc:mga09592_39027_c1 3300050508 Bacteria 3988
1259 nmdc:mga06r32_11149_c1 3300050510 Bacteria 8095
1260 nmdc:mga08y16_1002128_c1 3300050511 Bacteria 815
1261 nmdc:mga08y16_1237329_c1 3300050511 Bacteria 716
1262 nmdc:mga08y16_704116_c1 3300050511 Bacteria 1010
1263 nmdc:mga0n895_260513_c1 3300050512 Bacteria 1760
1264 nmdc:mga0n895_331977_c1 3300050512 Bacteria 1541
1265 nmdc:mga0n895_5268_c1 3300050512 Bacteria 10768
1266 nmdc:mga0rr50_53041_c1 3300050513 Bacteria 3016
1267 nmdc:mga0rr50_97529_c2 3300050513 Bacteria 1849
1268 nmdc:mga08x19_11254_c1 3300050514 Bacteria 5387
1269 nmdc:mga08x19_816672_c1 3300050514 Bacteria 662
1270 nmdc:mga0a205_44144_c1 3300050515 Bacteria 4297
1271 Ga0495601_0112434 3300053077 Bacteria 1764
1272 Ga0495601_0316895 3300053077 Bacteria 1015
1273 Ga0495612_0089496 3300053078 Bacteria 1301
1274 Ga0495612_0356432 3300053078 Bacteria 661
1275 Ga0495612_0593509 3300053078 Bacteria 511
1276 Ga0500635_0041067 3300053080 Bacteria 1545
1277 Ga0500635_0116565 3300053080 Bacteria 996
1278 Ga0495595_0116849 3300053084 Bacteria 1297
1279 Ga0495619_0253113 3300053085 Bacteria 1220
1280 Ga0495619_0321326 3300053085 Bacteria 1071
1281 Ga0495619_0339923 3300053085 Bacteria 1039
1282 Ga0495619_0705296 3300053085 Bacteria 686
1283 Ga0500647_0175353 3300053091 Bacteria 987
1284 Ga0500647_0233186 3300053091 Bacteria 817
1285 Ga0500566_0000320 3300053094 Bacteria 25974
1286 Ga0500566_0088640 3300053094 Bacteria 1712
1287 Ga0500640_029114 3300053095 Bacteria 2413
1288 Ga0500556_0004256 3300053104 Bacteria 4087
1289 Ga0500558_109295 3300053106 Bacteria 1087
1290 Ga0500562_009418 3300053108 Bacteria 2469
1291 Ga0500572_001638 3300053111 Bacteria 5877
1292 Ga0500572_015788 3300053111 Bacteria 1910
1293 Ga0500591_079976 3300053115 Bacteria 1456
1294 Ga0500608_083229 3300053122 Bacteria 1506
1295 Ga0500614_057503 3300053123 Bacteria 1037
1296 Ga0500614_280998 3300053123 Bacteria 521
1297 Ga0500655_071954 3300053133 Bacteria 705
1298 Ga0500559_0007811 3300053136 Bacteria 4724
1299 Ga0500559_0012275 3300053136 Bacteria 3644
1300 Ga0500559_0120340 3300053136 Bacteria 1220
1301 Ga0500561_0200419 3300053137 Bacteria 631
1302 Ga0500564_290061 3300053138 Bacteria 632
1303 Ga0500568_0113847 3300053139 Bacteria 1010
1304 Ga0500573_0006745 3300053140 Bacteria 6228
1305 Ga0500585_223960 3300053144 Bacteria 613
1306 Ga0500590_151829 3300053148 Bacteria 1043
1307 Ga0500590_307903 3300053148 Bacteria 591
1308 Ga0500603_021102 3300053150 Bacteria 1599
1309 Ga0500603_027424 3300053150 Bacteria 1447
1310 Ga0500603_030409 3300053150 Bacteria 1389
1311 Ga0500616_0006596 3300053153 Bacteria 7567
1312 Ga0500616_0048582 3300053153 Bacteria 2249
1313 Ga0500619_208526 3300053154 Bacteria 654
1314 Ga0500630_005936 3300053159 Bacteria 5975
1315 Ga0500638_035746 3300053162 Bacteria 2408
1316 Ga0500639_019780 3300053163 Bacteria 3551
1317 Ga0500639_044490 3300053163 Bacteria 2324
1318 Ga0500636_0067281 3300053177 Bacteria 2081
1319 Ga0500636_0144725 3300053177 Bacteria 1311
1320 Ga0500637_0072771 3300053178 Bacteria 1978
1321 Ga0500637_0190508 3300053178 Bacteria 1172
1322 Ga0500637_0215172 3300053178 Bacteria 1088
1323 Ga0500576_041535 3300053725 Bacteria 2068
1324 Ga0500657_147716 3300053728 Bacteria 879
1325 Ga0500552_113454 3300053733 Bacteria 523
1326 Ga0500596_003892 3300053735 Bacteria 2792
1327 Ga0500596_007930 3300053735 Bacteria 1714
1328 Ga0500596_051092 3300053735 Bacteria 676
1329 Ga0500601_007073 3300053737 Bacteria 1241
1330 Ga0500601_012157 3300053737 Bacteria 970
1331 Ga0501084_0080043 3300054114 Bacteria 2739
1332 Ga0501084_0424221 3300054114 Bacteria 1124
1333 Ga0500661_118751 3300055283 Bacteria 510
1334 Ga0590077_180360 3300059426 Bacteria 510
1335 Ga0587093_049355 3300059478 Bacteria 660
1336 Ga0587066_027970 3300059490 Bacteria 984
1337 Ga0587070_023933 3300059491 Bacteria 1053
1338 Ga0587073_0145918 3300059492 Bacteria 664
1339 Ga0587073_0272404 3300059492 Bacteria 540
1340 Ga0587080_108329 3300059503 Bacteria 603
1341 Ga0587082_107359 3300059504 Bacteria 616
1342 Ga0587082_120957 3300059504 Bacteria 591
1343 Ga0587083_0169989 3300059505 Bacteria 603
1344 Ga0587085_122805 3300059506 Bacteria 572
1345 Ga0587086_029713 3300059507 Bacteria 797
1346 Ga0587090_001023 3300059510 Bacteria 2677
1347 Ga0587098_048040 3300059604 Bacteria 640
1348 Ga0587106_013279 3300059605 Bacteria 1117
1349 Ga0587106_108624 3300059605 Bacteria 575
1350 Ga0587101_004242 3300059623 Bacteria 1520
1351 Ga0587101_105964 3300059623 Bacteria 565
1352 Ga0587101_106800 3300059623 Bacteria 563
1353 Ga0587101_120350 3300059623 Bacteria 542
1354 Ga0587109_103867 3300059624 Bacteria 656
1355 Ga0587117_024481 3300059627 Bacteria 868
1356 Ga0587067_174578 3300059640 Bacteria 556
1357 Ga0587067_220962 3300059640 Bacteria 513
1358 Ga0587069_083867 3300059642 Bacteria 626
1359 Ga0587069_097416 3300059642 Bacteria 596
1360 Ga0587072_023778 3300059643 Bacteria 1103
1361 Ga0587079_074253 3300059647 Bacteria 765
1362 Ga0587079_157835 3300059647 Bacteria 591
1363 Ga0587107_024275 3300059652 Bacteria 873
1364 Ga0587107_038016 3300059652 Bacteria 765
1365 Ga0587107_051941 3300059652 Bacteria 698
1366 Ga0587107_112242 3300059652 Bacteria 552
1367 Ga0587107_112462 3300059652 Bacteria 552
1368 Ga0587108_004748 3300059653 Bacteria 1003
1369 Ga0587116_06220 3300059656 Bacteria 732
1370 Ga0587119_036177 3300059658 Bacteria 693
1371 Ga0501082_0171311 3300060353 Bacteria 1887
1372 Ga0501082_0526106 3300060353 Bacteria 1034
1373 Ga0501082_1408072 3300060353 Bacteria 609
1374 Ga0466962_0243768 3300061719 Bacteria 882
1375 Ga0466962_0487514 3300061719 Bacteria 623
1376 Ga0530510_0050130 3300061734 Bacteria 3015
1377 Ga0530510_0261262 3300061734 Bacteria 1291
1378 Ga0530510_0473104 3300061734 Bacteria 949

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_11509248 Ga0105240_115092482 87
2 3300046660 Ga0495625_0747054 Ga0495625_0747054_197_493 91
3 3300035725 Ga0373947_0871454 Ga0373947_0871454_114_392 92
4 3300048912 Ga0496109_0557498 Ga0496109_0557498_177_455 92
5 3300061719 Ga0466962_0487514 Ga0466962_0487514_291_569 92
6 3300053085 Ga0495619_0339923 Ga0495619_0339923_276_587 93
7 iso_pu_bacteria 2751185800 2753359575 93
8 iso_pu_bacteria 2758568016 2758641836 93
9 iso_pu_bacteria 2765235802 2765465535 93
10 iso_pu_bacteria 2839993093 2839995597 93
11 iso_pu_bacteria 2840764183 2840768016 93
12 iso_pu_bacteria 2891048133 2891050820 93
13 iso_pu_bacteria 2904578770 2904583234 93
14 iso_pu_bacteria 2919119836 2919123882 93
15 iso_pu_bacteria 2995392953 2995397021 93
16 iso_pu_bacteria 3002141150 3002143950 93
17 iso_pu_bacteria 2508501050 2508735863 94
18 iso_pu_bacteria 2595698237 2596374054 94
19 iso_pu_bacteria 2738541281 2738745705 94
20 iso_pu_bacteria 2738543032 2739354935 94
21 iso_pu_bacteria 2775506901 2776259137 94
22 iso_pu_bacteria 2829745981 2829749930 94
23 iso_pu_bacteria 2842698319 2842701718 94
24 iso_pu_bacteria 2861691609 2861692149 94
25 iso_pu_bacteria 2889306138 2889311569 94
26 iso_pu_bacteria 2894232714 2894240768 94
27 iso_pu_bacteria 2902330777 2902334109 94
28 iso_pu_bacteria 2902405164 2902411804 94
29 iso_pu_bacteria 2909042592 2909043598 94
30 iso_pu_bacteria 2928125067 2928129945 94
31 3300003320 rootH2_10016380 rootH2_100163803 95
32 3300005539 Ga0068853_100345112 Ga0068853_1003451123 95
33 3300059503 Ga0587080_108329 Ga0587080_108329_77_364 95
34 iso_pu_bacteria 2508501128 2509149632 95
35 iso_pu_bacteria 2513237098 2513678617 95
36 iso_pu_bacteria 2513237141 2513894229 95
37 iso_pu_bacteria 2524023210 2524469971 95
38 iso_pu_bacteria 2721755755 2723846171 95
39 iso_pu_bacteria 2885383462 2885384445 95
40 iso_pu_bacteria 2903768456 2903770862 95
41 iso_pu_bacteria 2922361189 2922361967 95
42 iso_pu_bacteria 2922425934 2922428989 95
43 iso_pu_bacteria 8056681323 8056684520 95
44 3300037068 Ga0373925_0685520 Ga0373925_0685520_61_351 96
45 3300053085 Ga0495619_0705296 Ga0495619_0705296_220_510 96
46 iso_pu_bacteria 3005506211 3005512709 96
47 iso_pu_bacteria 3005594810 3005598068 96
48 3300001978 JGI24747J21853_1041351 JGI24747J21853_10413512 97
49 3300001989 JGI24739J22299_10122518 JGI24739J22299_101225182 97
50 3300001989 JGI24739J22299_10146276 JGI24739J22299_101462762 97
51 3300001990 JGI24737J22298_10002957 JGI24737J22298_1000295712 97
52 3300001991 JGI24743J22301_10019644 JGI24743J22301_100196442 97
53 3300002070 JGI24750J21931_1006031 JGI24750J21931_10060312 97
54 3300002073 JGI24745J21846_1025676 JGI24745J21846_10256762 97
55 3300002075 JGI24738J21930_10006269 JGI24738J21930_100062696 97
56 3300002076 JGI24749J21850_1030226 JGI24749J21850_10302262 97
57 3300002459 JGI24751J29686_10003449 JGI24751J29686_100034496 97
58 3300005328 Ga0070676_10598008 Ga0070676_105980082 97
59 3300005329 Ga0070683_100014681 Ga0070683_1000146812 97
60 3300005330 Ga0070690_100007778 Ga0070690_1000077785 97
61 3300005331 Ga0070670_100000376 Ga0070670_10000037624 97
62 3300005333 Ga0070677_10080667 Ga0070677_100806672 97
63 3300005334 Ga0068869_100022833 Ga0068869_1000228336 97
64 3300005335 Ga0070666_10004644 Ga0070666_100046443 97
65 3300005336 Ga0070680_100085545 Ga0070680_1000855452 97
66 3300005337 Ga0070682_100002069 Ga0070682_1000020695 97
67 3300005337 Ga0070682_100463941 Ga0070682_1004639412 97
68 3300005338 Ga0068868_100202434 Ga0068868_1002024343 97
69 3300005339 Ga0070660_100000686 Ga0070660_1000006869 97
70 3300005339 Ga0070660_101161486 Ga0070660_1011614862 97
71 3300005340 Ga0070689_100000122 Ga0070689_10000012234 97
72 3300005341 Ga0070691_10000490 Ga0070691_1000049010 97
73 3300005341 Ga0070691_10862610 Ga0070691_108626101 97
74 3300005343 Ga0070687_100016035 Ga0070687_1000160355 97
75 3300005344 Ga0070661_100000385 Ga0070661_10000038519 97
76 3300005345 Ga0070692_10001302 Ga0070692_100013025 97
77 3300005347 Ga0070668_100005991 Ga0070668_1000059919 97
78 3300005347 Ga0070668_100390585 Ga0070668_1003905852 97
79 3300005353 Ga0070669_100002082 Ga0070669_10000208218 97
80 3300005354 Ga0070675_100016237 Ga0070675_1000162374 97
81 3300005355 Ga0070671_100001283 Ga0070671_1000012838 97
82 3300005356 Ga0070674_100000649 Ga0070674_1000006499 97
83 3300005356 Ga0070674_100607101 Ga0070674_1006071012 97
84 3300005364 Ga0070673_100002163 Ga0070673_10000216320 97
85 3300005365 Ga0070688_100000217 Ga0070688_10000021721 97
86 3300005366 Ga0070659_100003485 Ga0070659_1000034856 97
87 3300005367 Ga0070667_100003614 Ga0070667_10000361422 97
88 3300005406 Ga0070703_10015462 Ga0070703_100154622 97
89 3300005434 Ga0070709_10001232 Ga0070709_100012322 97
90 3300005434 Ga0070709_10010455 Ga0070709_100104559 97
91 3300005435 Ga0070714_100025578 Ga0070714_1000255786 97
92 3300005435 Ga0070714_100142833 Ga0070714_1001428334 97
93 3300005435 Ga0070714_100177932 Ga0070714_1001779323 97
94 3300005436 Ga0070713_100111867 Ga0070713_1001118672 97
95 3300005437 Ga0070710_10236423 Ga0070710_102364232 97
96 3300005437 Ga0070710_11123421 Ga0070710_111234211 97
97 3300005438 Ga0070701_10000897 Ga0070701_100008973 97
98 3300005439 Ga0070711_100000834 Ga0070711_1000008349 97
99 3300005439 Ga0070711_100155124 Ga0070711_1001551241 97
100 3300005440 Ga0070705_100022646 Ga0070705_1000226465 97
101 3300005440 Ga0070705_100266449 Ga0070705_1002664492 97
102 3300005441 Ga0070700_100002377 Ga0070700_1000023772 97
103 3300005441 Ga0070700_100387488 Ga0070700_1003874881 97
104 3300005444 Ga0070694_100000195 Ga0070694_10000019522 97
105 3300005455 Ga0070663_100000352 Ga0070663_10000035225 97
106 3300005456 Ga0070678_100001146 Ga0070678_1000011463 97
107 3300005457 Ga0070662_100000412 Ga0070662_10000041221 97
108 3300005457 Ga0070662_101760863 Ga0070662_1017608632 97
109 3300005459 Ga0068867_100008499 Ga0068867_1000084995 97
110 3300005459 Ga0068867_100077308 Ga0068867_1000773083 97
111 3300005466 Ga0070685_10058987 Ga0070685_100589874 97
112 3300005518 Ga0070699_100160319 Ga0070699_1001603193 97
113 3300005530 Ga0070679_100040109 Ga0070679_1000401096 97
114 3300005535 Ga0070684_100061861 Ga0070684_1000618612 97
115 3300005536 Ga0070697_100000391 Ga0070697_10000039124 97
116 3300005536 Ga0070697_101553947 Ga0070697_1015539471 97
117 3300005539 Ga0068853_100001082 Ga0068853_1000010826 97
118 3300005543 Ga0070672_100035019 Ga0070672_1000350193 97
119 3300005544 Ga0070686_100001391 Ga0070686_1000013913 97
120 3300005545 Ga0070695_100000238 Ga0070695_10000023829 97
121 3300005546 Ga0070696_100000815 Ga0070696_10000081518 97
122 3300005546 Ga0070696_100523824 Ga0070696_1005238242 97
123 3300005547 Ga0070693_100000455 Ga0070693_10000045524 97
124 3300005548 Ga0070665_100022864 Ga0070665_1000228646 97
125 3300005549 Ga0070704_100000124 Ga0070704_10000012424 97
126 3300005563 Ga0068855_100002691 Ga0068855_1000026919 97
127 3300005564 Ga0070664_100002450 Ga0070664_10000245020 97
128 3300005577 Ga0068857_100008457 Ga0068857_10000845711 97
129 3300005577 Ga0068857_101263112 Ga0068857_1012631121 97
130 3300005578 Ga0068854_100007856 Ga0068854_1000078569 97
131 3300005578 Ga0068854_101112579 Ga0068854_1011125792 97
132 3300005614 Ga0068856_100005122 Ga0068856_10000512220 97
133 3300005615 Ga0070702_100000018 Ga0070702_10000001812 97
134 3300005615 Ga0070702_100375110 Ga0070702_1003751102 97
135 3300005616 Ga0068852_100010938 Ga0068852_1000109385 97
136 3300005617 Ga0068859_100131708 Ga0068859_1001317084 97
137 3300005618 Ga0068864_100002243 Ga0068864_10000224318 97
138 3300005718 Ga0068866_10001983 Ga0068866_100019836 97
139 3300005718 Ga0068866_10579931 Ga0068866_105799312 97
140 3300005719 Ga0068861_100000942 Ga0068861_10000094225 97
141 3300005834 Ga0068851_10055130 Ga0068851_100551304 97
142 3300005841 Ga0068863_100007838 Ga0068863_10000783813 97
143 3300005842 Ga0068858_100019589 Ga0068858_1000195896 97
144 3300005843 Ga0068860_100000598 Ga0068860_10000059831 97
145 3300005844 Ga0068862_100008039 Ga0068862_1000080398 97
146 3300006163 Ga0070715_10001643 Ga0070715_100016434 97
147 3300006173 Ga0070716_100001603 Ga0070716_1000016035 97
148 3300006173 Ga0070716_101460067 Ga0070716_1014600672 97
149 3300006175 Ga0070712_100027843 Ga0070712_1000278436 97
150 3300006175 Ga0070712_100052247 Ga0070712_1000522475 97
151 3300006237 Ga0097621_100107158 Ga0097621_1001071584 97
152 3300006358 Ga0068871_100022307 Ga0068871_1000223075 97
153 3300006844 Ga0075428_100054274 Ga0075428_1000542744 97
154 3300006847 Ga0075431_100003503 Ga0075431_1000035034 97
155 3300006852 Ga0075433_10023032 Ga0075433_100230322 97
156 3300006871 Ga0075434_100215192 Ga0075434_1002151923 97
157 3300006871 Ga0075434_102159013 Ga0075434_1021590132 97
158 3300006871 Ga0075434_102196873 Ga0075434_1021968732 97
159 3300006880 Ga0075429_100024809 Ga0075429_1000248095 97
160 3300006881 Ga0068865_100096538 Ga0068865_1000965382 97
161 3300006881 Ga0068865_101186464 Ga0068865_1011864641 97
162 3300006914 Ga0075436_100008941 Ga0075436_1000089416 97
163 3300006931 Ga0097620_100131716 Ga0097620_1001317162 97
164 3300007076 Ga0075435_100085522 Ga0075435_1000855222 97
165 3300009011 Ga0105251_10110631 Ga0105251_101106312 97
166 3300009092 Ga0105250_10008602 Ga0105250_100086026 97
167 3300009093 Ga0105240_10263935 Ga0105240_102639353 97
168 3300009094 Ga0111539_10100865 Ga0111539_101008652 97
169 3300009098 Ga0105245_10000718 Ga0105245_1000071817 97
170 3300009101 Ga0105247_10001104 Ga0105247_1000110429 97
171 3300009101 Ga0105247_10603522 Ga0105247_106035222 97
172 3300009147 Ga0114129_10401684 Ga0114129_104016842 97
173 3300009148 Ga0105243_10001752 Ga0105243_100017523 97
174 3300009174 Ga0105241_10088557 Ga0105241_100885572 97
175 3300009176 Ga0105242_10010515 Ga0105242_100105155 97
176 3300009177 Ga0105248_10002832 Ga0105248_100028324 97
177 3300009545 Ga0105237_10001618 Ga0105237_1000161819 97
178 3300009551 Ga0105238_10007984 Ga0105238_100079847 97
179 3300009553 Ga0105249_10000814 Ga0105249_1000081429 97
180 3300010375 Ga0105239_10296034 Ga0105239_102960344 97
181 3300011119 Ga0105246_10002439 Ga0105246_1000243916 97
182 3300011119 Ga0105246_10045899 Ga0105246_100458993 97
183 3300013100 Ga0157373_10019849 Ga0157373_100198495 97
184 3300013102 Ga0157371_10056437 Ga0157371_100564372 97
185 3300013104 Ga0157370_10555656 Ga0157370_105556562 97
186 3300013105 Ga0157369_10197436 Ga0157369_101974363 97
187 3300013296 Ga0157374_10012339 Ga0157374_100123398 97
188 3300013296 Ga0157374_11221540 Ga0157374_112215402 97
189 3300013297 Ga0157378_10000470 Ga0157378_100004706 97
190 3300013306 Ga0163162_10004532 Ga0163162_100045329 97
191 3300013306 Ga0163162_12543142 Ga0163162_125431422 97
192 3300013307 Ga0157372_10001215 Ga0157372_100012155 97
193 3300013308 Ga0157375_10012604 Ga0157375_100126046 97
194 3300014325 Ga0163163_10005311 Ga0163163_100053114 97
195 3300014326 Ga0157380_10027055 Ga0157380_100270556 97
196 3300014497 Ga0182008_10365970 Ga0182008_103659702 97
197 3300014745 Ga0157377_10006965 Ga0157377_100069652 97
198 3300014968 Ga0157379_10001927 Ga0157379_100019276 97
199 3300014969 Ga0157376_10000606 Ga0157376_1000060615 97
200 3300017792 Ga0163161_10002394 Ga0163161_100023949 97
201 3300025315 Ga0207697_10057185 Ga0207697_100571852 97
202 3300025321 Ga0207656_10173122 Ga0207656_101731222 97
203 3300025735 Ga0207713_1157248 Ga0207713_11572482 97
204 3300025885 Ga0207653_10032934 Ga0207653_100329343 97
205 3300025893 Ga0207682_10132490 Ga0207682_101324902 97
206 3300025898 Ga0207692_10002601 Ga0207692_100026012 97
207 3300025899 Ga0207642_10845179 Ga0207642_108451792 97
208 3300025900 Ga0207710_10003497 Ga0207710_100034973 97
209 3300025901 Ga0207688_10002614 Ga0207688_1000261419 97
210 3300025903 Ga0207680_10006344 Ga0207680_100063446 97
211 3300025904 Ga0207647_10001956 Ga0207647_1000195610 97
212 3300025905 Ga0207685_10019197 Ga0207685_100191972 97
213 3300025905 Ga0207685_10075667 Ga0207685_100756672 97
214 3300025906 Ga0207699_10000692 Ga0207699_1000069211 97
215 3300025906 Ga0207699_10062019 Ga0207699_100620192 97
216 3300025906 Ga0207699_11028083 Ga0207699_110280832 97
217 3300025909 Ga0207705_10093610 Ga0207705_100936104 97
218 3300025911 Ga0207654_10003285 Ga0207654_100032856 97
219 3300025913 Ga0207695_10228101 Ga0207695_102281012 97
220 3300025914 Ga0207671_10120775 Ga0207671_101207752 97
221 3300025915 Ga0207693_10000493 Ga0207693_1000049341 97
222 3300025915 Ga0207693_10030071 Ga0207693_100300715 97
223 3300025916 Ga0207663_10001067 Ga0207663_1000106714 97
224 3300025917 Ga0207660_10644243 Ga0207660_106442432 97
225 3300025918 Ga0207662_10002067 Ga0207662_100020678 97
226 3300025919 Ga0207657_10000282 Ga0207657_1000028225 97
227 3300025919 Ga0207657_11124284 Ga0207657_111242841 97
228 3300025920 Ga0207649_10017750 Ga0207649_100177509 97
229 3300025921 Ga0207652_10104736 Ga0207652_101047364 97
230 3300025923 Ga0207681_10015153 Ga0207681_100151532 97
231 3300025924 Ga0207694_10137335 Ga0207694_101373353 97
232 3300025925 Ga0207650_10069986 Ga0207650_100699864 97
233 3300025926 Ga0207659_10005250 Ga0207659_1000525011 97
234 3300025927 Ga0207687_10008551 Ga0207687_100085515 97
235 3300025929 Ga0207664_10012756 Ga0207664_1001275611 97
236 3300025929 Ga0207664_10303495 Ga0207664_103034952 97
237 3300025931 Ga0207644_10048201 Ga0207644_100482014 97
238 3300025932 Ga0207690_10003444 Ga0207690_100034446 97
239 3300025933 Ga0207706_10000270 Ga0207706_1000027026 97
240 3300025935 Ga0207709_10048849 Ga0207709_100488492 97
241 3300025936 Ga0207670_10092363 Ga0207670_100923632 97
242 3300025937 Ga0207669_10002208 Ga0207669_100022086 97
243 3300025937 Ga0207669_10292009 Ga0207669_102920092 97
244 3300025938 Ga0207704_10395404 Ga0207704_103954042 97
245 3300025938 Ga0207704_11004593 Ga0207704_110045931 97
246 3300025939 Ga0207665_10001538 Ga0207665_100015384 97
247 3300025939 Ga0207665_11010106 Ga0207665_110101062 97
248 3300025940 Ga0207691_10053192 Ga0207691_100531926 97
249 3300025941 Ga0207711_10137545 Ga0207711_101375453 97
250 3300025944 Ga0207661_10148369 Ga0207661_101483694 97
251 3300025945 Ga0207679_10004166 Ga0207679_100041666 97
252 3300025949 Ga0207667_10011595 Ga0207667_100115956 97
253 3300025960 Ga0207651_10004358 Ga0207651_100043586 97
254 3300025961 Ga0207712_10047767 Ga0207712_100477673 97
255 3300025972 Ga0207668_10006213 Ga0207668_100062132 97
256 3300025981 Ga0207640_10003639 Ga0207640_100036396 97
257 3300025981 Ga0207640_10209176 Ga0207640_102091762 97
258 3300025986 Ga0207658_10023872 Ga0207658_100238723 97
259 3300026023 Ga0207677_10103809 Ga0207677_101038095 97
260 3300026035 Ga0207703_10688729 Ga0207703_106887291 97
261 3300026035 Ga0207703_10776479 Ga0207703_107764792 97
262 3300026041 Ga0207639_10017244 Ga0207639_100172442 97
263 3300026067 Ga0207678_10000477 Ga0207678_1000047744 97
264 3300026075 Ga0207708_10000337 Ga0207708_100003376 97
265 3300026075 Ga0207708_10441466 Ga0207708_104414661 97
266 3300026078 Ga0207702_10046306 Ga0207702_100463065 97
267 3300026088 Ga0207641_10017486 Ga0207641_100174863 97
268 3300026089 Ga0207648_10102108 Ga0207648_101021082 97
269 3300026089 Ga0207648_10363858 Ga0207648_103638583 97
270 3300026095 Ga0207676_10825727 Ga0207676_108257272 97
271 3300026116 Ga0207674_10030575 Ga0207674_100305756 97
272 3300026118 Ga0207675_100001292 Ga0207675_10000129224 97
273 3300026121 Ga0207683_10001738 Ga0207683_1000173817 97
274 3300026121 Ga0207683_10966376 Ga0207683_109663762 97
275 3300026142 Ga0207698_10021538 Ga0207698_100215382 97
276 3300027717 Ga0209998_10038761 Ga0209998_100387612 97
277 3300027907 Ga0207428_10008303 Ga0207428_100083036 97
278 3300028379 Ga0268266_10206194 Ga0268266_102061944 97
279 3300028381 Ga0268264_10015446 Ga0268264_100154467 97
280 3300028381 Ga0268264_10910854 Ga0268264_109108542 97
281 3300028794 Ga0307515_10248135 Ga0307515_102481353 97
282 3300029276 Ga0311004_113545 Ga0311004_1135452 97
283 3300031456 Ga0307513_10340634 Ga0307513_103406342 97
284 3300031691 Ga0316579_10240025 Ga0316579_102400252 97
285 3300031727 Ga0316576_10978254 Ga0316576_109782541 97
286 3300031733 Ga0316577_10382766 Ga0316577_103827662 97
287 3300031852 Ga0307410_10678337 Ga0307410_106783372 97
288 3300032002 Ga0307416_100419408 Ga0307416_1004194082 97
289 3300032133 Ga0316583_10263990 Ga0316583_102639902 97
290 3300033541 Ga0316596_1037368 Ga0316596_10373683 97
291 3300034819 Ga0373958_0005093 Ga0373958_0005093_930_1223 97
292 3300034957 Ga0373938_0003982 Ga0373938_0003982_13_306 97
293 3300035084 Ga0373928_0006912 Ga0373928_0006912_1439_1732 97
294 3300035088 Ga0373940_0072756 Ga0373940_0072756_530_823 97
295 3300035090 Ga0373949_0011140 Ga0373949_0011140_131_424 97
296 3300035112 Ga0373932_0062532 Ga0373932_0062532_551_844 97
297 3300035114 Ga0373939_0010461 Ga0373939_0010461_1983_2276 97
298 3300035115 Ga0373941_0044026 Ga0373941_0044026_256_549 97
299 3300035117 Ga0373953_0106539 Ga0373953_0106539_781_1074 97
300 3300035120 Ga0373957_0168239 Ga0373957_0168239_387_680 97
301 3300035121 Ga0373960_0001622 Ga0373960_0001622_3314_3607 97
302 3300035172 Ga0373955_0020793 Ga0373955_0020793_2244_2537 97
303 3300035242 Ga0373962_0126509 Ga0373962_0126509_366_659 97
304 3300035410 Ga0373924_0201528 Ga0373924_0201528_331_624 97
305 3300035691 Ga0373931_0030144 Ga0373931_0030144_1896_2189 97
306 3300035691 Ga0373931_0062360 Ga0373931_0062360_317_610 97
307 3300035691 Ga0373931_0823862 Ga0373931_0823862_91_384 97
308 3300035724 Ga0373933_0196707 Ga0373933_0196707_943_1236 97
309 3300036401 Ga0373937_0425070 Ga0373937_0425070_636_929 97
310 3300036647 Ga0316582_0181961 Ga0316582_0181961_897_1190 97
311 3300037312 Ga0395899_0204290 Ga0395899_0204290_871_1164 97
312 3300037312 Ga0395899_0701927 Ga0395899_0701927_248_541 97
313 3300037418 Ga0395900_0238023 Ga0395900_0238023_1282_1575 97
314 3300037418 Ga0395900_0493002 Ga0395900_0493002_871_1164 97
315 3300037466 Ga0395898_0007760 Ga0395898_0007760_3451_3744 97
316 3300037466 Ga0395898_0055115 Ga0395898_0055115_41_334 97
317 3300037471 Ga0395905_0002506 Ga0395905_0002506_10721_11014 97
318 3300037471 Ga0395905_0217669 Ga0395905_0217669_563_856 97
319 3300038443 Ga0395901_0002674 Ga0395901_0002674_3285_3578 97
320 3300038443 Ga0395901_1012464 Ga0395901_1012464_336_629 97
321 3300038996 Ga0242420_011095 Ga0242420_011095_722_1015 97
322 3300039450 Ga0436363_1113612 Ga0436363_1113612_199_495 97
323 3300041413 Ga0439465_0053801 Ga0439465_0053801_256_549 97
324 3300044706 Ga0466964_0475103 Ga0466964_0475103_356_649 97
325 3300046462 Ga0495651_0353235 Ga0495651_0353235_262_555 97
326 3300046511 Ga0495608_0912010 Ga0495608_0912010_136_429 97
327 3300046529 Ga0495652_0526129 Ga0495652_0526129_148_441 97
328 3300046536 Ga0495587_0239915 Ga0495587_0239915_709_1002 97
329 3300046559 Ga0495667_0319903 Ga0495667_0319903_89_382 97
330 3300046642 Ga0495634_0209436 Ga0495634_0209436_136_429 97
331 3300046660 Ga0495625_0265563 Ga0495625_0265563_467_760 97
332 3300046663 Ga0495635_0260117 Ga0495635_0260117_46_339 97
333 3300047317 Ga0495604_0453169 Ga0495604_0453169_229_522 97
334 3300047322 Ga0495680_0474417 Ga0495680_0474417_247_540 97
335 3300047444 Ga0495675_0852003 Ga0495675_0852003_89_382 97
336 3300047471 Ga0495684_0526279 Ga0495684_0526279_30_323 97
337 3300048088 Ga0495602_0073140 Ga0495602_0073140_387_680 97
338 3300048903 Ga0496100_0017720 Ga0496100_0017720_2238_2531 97
339 3300048903 Ga0496100_0252106 Ga0496100_0252106_420_713 97
340 3300048903 Ga0496100_0427167 Ga0496100_0427167_238_531 97
341 3300048904 Ga0496101_0142858 Ga0496101_0142858_1371_1664 97
342 3300048904 Ga0496101_0322108 Ga0496101_0322108_644_937 97
343 3300048904 Ga0496101_0501719 Ga0496101_0501719_385_678 97
344 3300048905 Ga0496102_0021341 Ga0496102_0021341_1552_1845 97
345 3300048905 Ga0496102_0269233 Ga0496102_0269233_70_363 97
346 3300048906 Ga0496103_0067933 Ga0496103_0067933_785_1078 97
347 3300048906 Ga0496103_0112317 Ga0496103_0112317_1277_1570 97
348 3300048907 Ga0496104_0108172 Ga0496104_0108172_2140_2433 97
349 3300048907 Ga0496104_0274478 Ga0496104_0274478_302_595 97
350 3300048908 Ga0496105_0148751 Ga0496105_0148751_629_922 97
351 3300048908 Ga0496105_0615649 Ga0496105_0615649_346_639 97
352 3300048909 Ga0496106_0074612 Ga0496106_0074612_655_948 97
353 3300048909 Ga0496106_0784058 Ga0496106_0784058_162_455 97
354 3300048910 Ga0496107_0296518 Ga0496107_0296518_490_783 97
355 3300048910 Ga0496107_0450946 Ga0496107_0450946_629_922 97
356 3300048911 Ga0496108_0032633 Ga0496108_0032633_2980_3273 97
357 3300048911 Ga0496108_0085334 Ga0496108_0085334_1710_2003 97
358 3300048911 Ga0496108_0224656 Ga0496108_0224656_329_622 97
359 3300048911 Ga0496108_0668902 Ga0496108_0668902_531_824 97
360 3300048912 Ga0496109_0005439 Ga0496109_0005439_414_707 97
361 3300048912 Ga0496109_0042827 Ga0496109_0042827_1181_1474 97
362 3300048912 Ga0496109_0138169 Ga0496109_0138169_1440_1733 97
363 3300048913 Ga0496110_0112064 Ga0496110_0112064_1512_1805 97
364 3300048913 Ga0496110_0766449 Ga0496110_0766449_34_327 97
365 3300048913 Ga0496110_1855276 Ga0496110_1855276_85_378 97
366 3300048914 Ga0496111_0074867 Ga0496111_0074867_2140_2433 97
367 3300048914 Ga0496111_0783833 Ga0496111_0783833_208_501 97
368 3300048915 Ga0496112_0056643 Ga0496112_0056643_318_611 97
369 3300048915 Ga0496112_0262667 Ga0496112_0262667_675_968 97
370 3300048915 Ga0496112_0865970 Ga0496112_0865970_11_304 97
371 3300048915 Ga0496112_1903594 Ga0496112_1903594_72_365 97
372 3300048916 Ga0496113_0014431 Ga0496113_0014431_3408_3701 97
373 3300048916 Ga0496113_0480557 Ga0496113_0480557_213_506 97
374 3300048917 Ga0496114_0325387 Ga0496114_0325387_23_316 97
375 3300048917 Ga0496114_0727902 Ga0496114_0727902_542_835 97
376 3300048918 Ga0496115_0117368 Ga0496115_0117368_1512_1805 97
377 3300048918 Ga0496115_0307943 Ga0496115_0307943_749_1042 97
378 3300048918 Ga0496115_1004222 Ga0496115_1004222_88_381 97
379 3300048920 Ga0496117_0280736 Ga0496117_0280736_21_314 97
380 3300048922 Ga0496119_0015798 Ga0496119_0015798_3566_3859 97
381 3300048922 Ga0496119_0240910 Ga0496119_0240910_80_373 97
382 3300048923 Ga0496120_0058656 Ga0496120_0058656_86_379 97
383 3300048924 Ga0496121_0414452 Ga0496121_0414452_393_686 97
384 3300048925 Ga0496122_0049328 Ga0496122_0049328_1680_1973 97
385 3300048926 Ga0496123_0023041 Ga0496123_0023041_2277_2570 97
386 3300048928 Ga0496125_0187364 Ga0496125_0187364_704_997 97
387 3300048929 Ga0496126_0076397 Ga0496126_0076397_1852_2145 97
388 3300049568 Ga0501031_0245821 Ga0501031_0245821_297_590 97
389 3300049571 Ga0501034_0009013 Ga0501034_0009013_3449_3742 97
390 3300049571 Ga0501034_0296749 Ga0501034_0296749_382_675 97
391 3300049571 Ga0501034_1586763 Ga0501034_1586763_26_319 97
392 3300049579 Ga0501043_0374221 Ga0501043_0374221_544_837 97
393 3300049581 Ga0501047_0511199 Ga0501047_0511199_215_508 97
394 3300049583 Ga0501067_0138882 Ga0501067_0138882_930_1223 97
395 3300049742 Ga0501080_0871114 Ga0501080_0871114_183_476 97
396 3300050507 nmdc:mga05p37_109891_c1 nmdc:mga05p37_109891_c1_555_848 97
397 3300050508 nmdc:mga09592_39027_c1 nmdc:mga09592_39027_c1_2244_2537 97
398 3300050510 nmdc:mga06r32_11149_c1 nmdc:mga06r32_11149_c1_4096_4389 97
399 3300050511 nmdc:mga08y16_704116_c1 nmdc:mga08y16_704116_c1_476_769 97
400 3300050512 nmdc:mga0n895_331977_c1 nmdc:mga0n895_331977_c1_773_1066 97
401 3300050513 nmdc:mga0rr50_53041_c1 nmdc:mga0rr50_53041_c1_1087_1380 97
402 3300050514 nmdc:mga08x19_11254_c1 nmdc:mga08x19_11254_c1_964_1257 97
403 3300050515 nmdc:mga0a205_44144_c1 nmdc:mga0a205_44144_c1_773_1066 97
404 3300053077 Ga0495601_0112434 Ga0495601_0112434_871_1164 97
405 3300053078 Ga0495612_0593509 Ga0495612_0593509_116_409 97
406 3300053084 Ga0495595_0116849 Ga0495595_0116849_493_786 97
407 3300053085 Ga0495619_0321326 Ga0495619_0321326_62_355 97
408 3300053153 Ga0500616_0048582 Ga0500616_0048582_475_768 97
409 3300059504 Ga0587082_107359 Ga0587082_107359_224_517 97
410 3300059623 Ga0587101_120350 Ga0587101_120350_78_371 97
411 iso_pu_bacteria 2828305725 2828310148 97
412 3300002459 JGI24751J29686_10015322 JGI24751J29686_100153222 98
413 3300005347 Ga0070668_100088347 Ga0070668_1000883472 98
414 3300005354 Ga0070675_101384211 Ga0070675_1013842112 98
415 3300005356 Ga0070674_100148607 Ga0070674_1001486072 98
416 3300005365 Ga0070688_101153306 Ga0070688_1011533062 98
417 3300005437 Ga0070710_10470708 Ga0070710_104707082 98
418 3300005441 Ga0070700_100217734 Ga0070700_1002177342 98
419 3300005441 Ga0070700_100845120 Ga0070700_1008451202 98
420 3300005455 Ga0070663_100573677 Ga0070663_1005736772 98
421 3300005456 Ga0070678_100497827 Ga0070678_1004978272 98
422 3300005457 Ga0070662_100501700 Ga0070662_1005017002 98
423 3300005466 Ga0070685_10665402 Ga0070685_106654021 98
424 3300005547 Ga0070693_100579599 Ga0070693_1005795992 98
425 3300005548 Ga0070665_100548593 Ga0070665_1005485932 98
426 3300005564 Ga0070664_100963839 Ga0070664_1009638392 98
427 3300005564 Ga0070664_101879664 Ga0070664_1018796642 98
428 3300005577 Ga0068857_101190118 Ga0068857_1011901182 98
429 3300005615 Ga0070702_100315096 Ga0070702_1003150962 98
430 3300005617 Ga0068859_101714941 Ga0068859_1017149412 98
431 3300005618 Ga0068864_101603329 Ga0068864_1016033292 98
432 3300005718 Ga0068866_10472774 Ga0068866_104727742 98
433 3300005840 Ga0068870_10379278 Ga0068870_103792782 98
434 3300005981 Ga0081538_10006855 Ga0081538_100068552 98
435 3300006038 Ga0075365_10013851 Ga0075365_100138512 98
436 3300006038 Ga0075365_10452214 Ga0075365_104522142 98
437 3300006038 Ga0075365_10749770 Ga0075365_107497702 98
438 3300006042 Ga0075368_10218801 Ga0075368_102188012 98
439 3300006042 Ga0075368_10282307 Ga0075368_102823072 98
440 3300006048 Ga0075363_100113521 Ga0075363_1001135212 98
441 3300006051 Ga0075364_10057357 Ga0075364_100573573 98
442 3300006051 Ga0075364_10095261 Ga0075364_100952614 98
443 3300006051 Ga0075364_10220551 Ga0075364_102205512 98
444 3300006177 Ga0075362_10049062 Ga0075362_100490621 98
445 3300006177 Ga0075362_10101966 Ga0075362_101019663 98
446 3300006178 Ga0075367_10111670 Ga0075367_101116703 98
447 3300006178 Ga0075367_10134243 Ga0075367_101342432 98
448 3300006195 Ga0075366_10359251 Ga0075366_103592512 98
449 3300006353 Ga0075370_10243707 Ga0075370_102437072 98
450 3300006844 Ga0075428_101096435 Ga0075428_1010964352 98
451 3300006880 Ga0075429_101174029 Ga0075429_1011740292 98
452 3300006931 Ga0097620_101715029 Ga0097620_1017150292 98
453 3300009094 Ga0111539_10428106 Ga0111539_104281062 98
454 3300009094 Ga0111539_10658944 Ga0111539_106589441 98
455 3300009148 Ga0105243_10362714 Ga0105243_103627141 98
456 3300009176 Ga0105242_11845975 Ga0105242_118459752 98
457 3300009553 Ga0105249_10354541 Ga0105249_103545412 98
458 3300009553 Ga0105249_10378887 Ga0105249_103788872 98
459 3300009553 Ga0105249_10713244 Ga0105249_107132442 98
460 3300010375 Ga0105239_10601978 Ga0105239_106019782 98
461 3300011119 Ga0105246_10120687 Ga0105246_101206872 98
462 3300011119 Ga0105246_10630391 Ga0105246_106303912 98
463 3300013105 Ga0157369_11138607 Ga0157369_111386072 98
464 3300013306 Ga0163162_11470543 Ga0163162_114705432 98
465 3300013306 Ga0163162_12605215 Ga0163162_126052152 98
466 3300013307 Ga0157372_11623209 Ga0157372_116232092 98
467 3300013308 Ga0157375_11913853 Ga0157375_119138532 98
468 3300014325 Ga0163163_10002129 Ga0163163_1000212912 98
469 3300014325 Ga0163163_12084633 Ga0163163_120846332 98
470 3300014326 Ga0157380_10008515 Ga0157380_100085152 98
471 3300014326 Ga0157380_11594359 Ga0157380_115943592 98
472 3300014497 Ga0182008_10222662 Ga0182008_102226622 98
473 3300014968 Ga0157379_11730006 Ga0157379_117300061 98
474 3300017792 Ga0163161_10573970 Ga0163161_105739702 98
475 3300020078 Ga0206352_11227367 Ga0206352_112273671 98
476 3300021358 Ga0213873_10313968 Ga0213873_103139681 98
477 3300021377 Ga0213874_10001821 Ga0213874_100018216 98
478 3300021377 Ga0213874_10354152 Ga0213874_103541522 98
479 3300021384 Ga0213876_10004772 Ga0213876_100047726 98
480 3300023304 Ga0256714_113971 Ga0256714_1139712 98
481 3300023309 Ga0256744_130108 Ga0256744_1301082 98
482 3300023436 Ga0256743_128847 Ga0256743_1288472 98
483 3300023438 Ga0256720_139806 Ga0256720_1398062 98
484 3300025899 Ga0207642_10091188 Ga0207642_100911883 98
485 3300025901 Ga0207688_10044664 Ga0207688_100446645 98
486 3300025908 Ga0207643_10116032 Ga0207643_101160322 98
487 3300025909 Ga0207705_11096131 Ga0207705_110961312 98
488 3300025926 Ga0207659_11051182 Ga0207659_110511822 98
489 3300025928 Ga0207700_10669401 Ga0207700_106694012 98
490 3300025933 Ga0207706_10302615 Ga0207706_103026152 98
491 3300025935 Ga0207709_10120230 Ga0207709_101202303 98
492 3300025935 Ga0207709_11104993 Ga0207709_111049932 98
493 3300025937 Ga0207669_10129680 Ga0207669_101296802 98
494 3300025942 Ga0207689_10885848 Ga0207689_108858482 98
495 3300025945 Ga0207679_10841364 Ga0207679_108413642 98
496 3300025961 Ga0207712_10738205 Ga0207712_107382052 98
497 3300025972 Ga0207668_10039960 Ga0207668_100399603 98
498 3300025972 Ga0207668_11612398 Ga0207668_116123982 98
499 3300026067 Ga0207678_10476999 Ga0207678_104769992 98
500 3300026075 Ga0207708_10282110 Ga0207708_102821102 98
501 3300026116 Ga0207674_10621991 Ga0207674_106219912 98
502 3300026118 Ga0207675_100149393 Ga0207675_1001493934 98
503 3300026121 Ga0207683_10353704 Ga0207683_103537042 98
504 3300027695 Ga0209966_1085348 Ga0209966_10853482 98
505 3300027907 Ga0207428_10670860 Ga0207428_106708601 98
506 3300028379 Ga0268266_10630747 Ga0268266_106307472 98
507 3300029272 Ga0311000_100475 Ga0311000_1004752 98
508 3300029277 Ga0311001_1079354 Ga0311001_107935411 98
509 3300029285 Ga0310981_1002449 Ga0310981_10024492 98
510 3300031251 Ga0265327_10069811 Ga0265327_100698113 98
511 3300031548 Ga0307408_100092650 Ga0307408_1000926502 98
512 3300031548 Ga0307408_100395387 Ga0307408_1003953872 98
513 3300031548 Ga0307408_100681236 Ga0307408_1006812361 98
514 3300031548 Ga0307408_102164597 Ga0307408_1021645972 98
515 3300031731 Ga0307405_10610613 Ga0307405_106106132 98
516 3300031731 Ga0307405_10828608 Ga0307405_108286081 98
517 3300031731 Ga0307405_11844834 Ga0307405_118448341 98
518 3300031824 Ga0307413_11016513 Ga0307413_110165132 98
519 3300031852 Ga0307410_10159678 Ga0307410_101596783 98
520 3300031852 Ga0307410_10384358 Ga0307410_103843582 98
521 3300031852 Ga0307410_11601175 Ga0307410_116011752 98
522 3300031852 Ga0307410_11820968 Ga0307410_118209682 98
523 3300031889 Ga0326468_10002343 Ga0326468_100023432 98
524 3300031901 Ga0307406_10173110 Ga0307406_101731103 98
525 3300031901 Ga0307406_10608954 Ga0307406_106089542 98
526 3300031901 Ga0307406_10802626 Ga0307406_108026262 98
527 3300031903 Ga0307407_10126458 Ga0307407_101264582 98
528 3300031911 Ga0307412_10102836 Ga0307412_101028363 98
529 3300031911 Ga0307412_11036061 Ga0307412_110360612 98
530 3300031995 Ga0307409_100004876 Ga0307409_1000048762 98
531 3300031995 Ga0307409_101915378 Ga0307409_1019153782 98
532 3300032002 Ga0307416_100036609 Ga0307416_1000366099 98
533 3300032002 Ga0307416_100057739 Ga0307416_1000577395 98
534 3300032005 Ga0307411_10077414 Ga0307411_100774143 98
535 3300032005 Ga0307411_11376330 Ga0307411_113763302 98
536 3300032126 Ga0307415_100292801 Ga0307415_1002928012 98
537 3300032126 Ga0307415_101649487 Ga0307415_1016494872 98
538 3300035089 Ga0373944_0445889 Ga0373944_0445889_147_443 98
539 3300035170 Ga0373943_0017321 Ga0373943_0017321_2527_2823 98
540 3300035695 Ga0373927_0333387 Ga0373927_0333387_341_637 98
541 3300035725 Ga0373947_0009798 Ga0373947_0009798_3788_4084 98
542 3300036401 Ga0373937_0031089 Ga0373937_0031089_2209_2505 98
543 3300037068 Ga0373925_0586461 Ga0373925_0586461_399_695 98
544 3300037853 Ga0436364_0089033 Ga0436364_0089033_10_306 98
545 3300039437 Ga0436365_0870893 Ga0436365_0870893_158_454 98
546 3300039437 Ga0436365_1010396 Ga0436365_1010396_20_316 98
547 3300039437 Ga0436365_1047672 Ga0436365_1047672_465_761 98
548 3300039437 Ga0436365_1253031 Ga0436365_1253031_41785_42081 98
549 3300039438 Ga0436360_0888847 Ga0436360_0888847_96_392 98
550 3300039450 Ga0436363_1046285 Ga0436363_1046285_6288_6584 98
551 3300039453 Ga0436362_0607333 Ga0436362_0607333_351_647 98
552 3300039453 Ga0436362_0793870 Ga0436362_0793870_816_1112 98
553 3300041406 Ga0439439_0132040 Ga0439439_0132040_25_321 98
554 3300041413 Ga0439465_0127160 Ga0439465_0127160_167_463 98
555 3300041997 Ga0439431_0094769 Ga0439431_0094769_353_649 98
556 3300042006 Ga0439432_128392 Ga0439432_128392_323_619 98
557 3300042014 Ga0439457_151757 Ga0439457_151757_196_492 98
558 3300042136 Ga0450900_053254 Ga0450900_053254_12_308 98
559 3300042138 Ga0450903_051975 Ga0450903_051975_252_548 98
560 3300042438 Ga0439459_0018016 Ga0439459_0018016_272_568 98
561 3300042533 Ga0450901_002715 Ga0450901_002715_1343_1639 98
562 3300044683 Ga0466965_0333684 Ga0466965_0333684_120_416 98
563 3300044684 Ga0466966_0038631 Ga0466966_0038631_500_796 98
564 3300044693 Ga0466961_0058522 Ga0466961_0058522_1546_1842 98
565 3300044694 Ga0466963_0543930 Ga0466963_0543930_288_584 98
566 3300044719 Ga0466971_0080841 Ga0466971_0080841_1082_1378 98
567 3300044735 Ga0466968_0060841 Ga0466968_0060841_809_1105 98
568 3300044765 Ga0466970_0506738 Ga0466970_0506738_172_468 98
569 3300044842 Ga0466957_0935663 Ga0466957_0935663_96_392 98
570 3300044901 Ga0466960_0051465 Ga0466960_0051465_145_441 98
571 3300046455 Ga0495603_0725840 Ga0495603_0725840_189_485 98
572 3300046459 Ga0495629_0589356 Ga0495629_0589356_400_696 98
573 3300046462 Ga0495651_0361100 Ga0495651_0361100_622_918 98
574 3300046471 Ga0495650_0056786 Ga0495650_0056786_329_625 98
575 3300046514 Ga0495618_0926569 Ga0495618_0926569_89_385 98
576 3300046517 Ga0495630_0170546 Ga0495630_0170546_740_1036 98
577 3300046517 Ga0495630_0274888 Ga0495630_0274888_65_361 98
578 3300046531 Ga0495665_0168192 Ga0495665_0168192_414_710 98
579 3300046533 Ga0495640_0127966 Ga0495640_0127966_720_1016 98
580 3300046535 Ga0495586_0158041 Ga0495586_0158041_603_899 98
581 3300046616 Ga0495668_0426247 Ga0495668_0426247_382_678 98
582 3300046663 Ga0495635_0810117 Ga0495635_0810117_10_306 98
583 3300046680 Ga0495646_0560632 Ga0495646_0560632_33_329 98
584 3300046690 Ga0495624_0186772 Ga0495624_0186772_563_859 98
585 3300046809 Ga0495600_0144763 Ga0495600_0144763_813_1109 98
586 3300047317 Ga0495604_0190355 Ga0495604_0190355_650_946 98
587 3300047321 Ga0495676_0156541 Ga0495676_0156541_435_731 98
588 3300047322 Ga0495680_0366455 Ga0495680_0366455_225_521 98
589 3300047444 Ga0495675_0033574 Ga0495675_0033574_1239_1535 98
590 3300048090 Ga0495615_0245224 Ga0495615_0245224_216_512 98
591 3300048904 Ga0496101_0010556 Ga0496101_0010556_2815_3111 98
592 3300048904 Ga0496101_0146063 Ga0496101_0146063_1490_1786 98
593 3300048905 Ga0496102_0276267 Ga0496102_0276267_622_918 98
594 3300048905 Ga0496102_0641575 Ga0496102_0641575_597_893 98
595 3300048907 Ga0496104_0001364 Ga0496104_0001364_19636_19932 98
596 3300048907 Ga0496104_0044527 Ga0496104_0044527_2257_2553 98
597 3300048907 Ga0496104_0044528 Ga0496104_0044528_2257_2553 98
598 3300048908 Ga0496105_0004404 Ga0496105_0004404_9291_9587 98
599 3300048908 Ga0496105_0005504 Ga0496105_0005504_7359_7655 98
600 3300048910 Ga0496107_0111293 Ga0496107_0111293_654_950 98
601 3300048911 Ga0496108_0001133 Ga0496108_0001133_1220_1516 98
602 3300048911 Ga0496108_0517813 Ga0496108_0517813_439_735 98
603 3300048912 Ga0496109_0000583 Ga0496109_0000583_11346_11642 98
604 3300048913 Ga0496110_0010849 Ga0496110_0010849_4350_4646 98
605 3300048913 Ga0496110_0181086 Ga0496110_0181086_442_738 98
606 3300048914 Ga0496111_0009370 Ga0496111_0009370_2963_3259 98
607 3300048914 Ga0496111_0100084 Ga0496111_0100084_1033_1329 98
608 3300048915 Ga0496112_0000884 Ga0496112_0000884_14857_15153 98
609 3300048915 Ga0496112_0059398 Ga0496112_0059398_1482_1778 98
610 3300048916 Ga0496113_0000351 Ga0496113_0000351_6275_6571 98
611 3300048916 Ga0496113_0004259 Ga0496113_0004259_1990_2286 98
612 3300048917 Ga0496114_0159980 Ga0496114_0159980_1023_1319 98
613 3300048918 Ga0496115_0004536 Ga0496115_0004536_5984_6280 98
614 3300048918 Ga0496115_0208195 Ga0496115_0208195_658_954 98
615 3300048920 Ga0496117_0126021 Ga0496117_0126021_785_1081 98
616 3300048921 Ga0496118_0524006 Ga0496118_0524006_127_423 98
617 3300048922 Ga0496119_0004353 Ga0496119_0004353_11853_12149 98
618 3300048922 Ga0496119_0186852 Ga0496119_0186852_563_859 98
619 3300048926 Ga0496123_0443489 Ga0496123_0443489_27_323 98
620 3300048927 Ga0496124_0201142 Ga0496124_0201142_398_694 98
621 3300048927 Ga0496124_0639254 Ga0496124_0639254_91_387 98
622 3300048928 Ga0496125_0017448 Ga0496125_0017448_5599_5895 98
623 3300049127 Ga0501306_005013 Ga0501306_005013_219_515 98
624 3300049129 Ga0501309_018091 Ga0501309_018091_589_885 98
625 3300049130 Ga0501310_000913 Ga0501310_000913_2117_2413 98
626 3300049160 Ga0501304_015606 Ga0501304_015606_362_658 98
627 3300049162 Ga0501307_051215 Ga0501307_051215_107_403 98
628 3300049162 Ga0501307_069927 Ga0501307_069927_213_509 98
629 3300049518 Ga0501295_087541 Ga0501295_087541_205_501 98
630 3300049527 Ga0501311_058550 Ga0501311_058550_213_509 98
631 3300049528 Ga0501312_002347 Ga0501312_002347_1627_1923 98
632 3300049529 Ga0501313_012946 Ga0501313_012946_43_339 98
633 3300049530 Ga0501314_004633 Ga0501314_004633_841_1137 98
634 3300049531 Ga0501315_000284 Ga0501315_000284_2302_2598 98
635 3300049532 Ga0501316_001152 Ga0501316_001152_1845_2141 98
636 3300049533 Ga0501317_000192 Ga0501317_000192_3167_3463 98
637 3300049534 Ga0501318_000037 Ga0501318_000037_4841_5137 98
638 3300049536 Ga0501320_007213 Ga0501320_007213_712_1008 98
639 3300049539 Ga0501323_009389 Ga0501323_009389_632_928 98
640 3300049540 Ga0501324_025965 Ga0501324_025965_299_595 98
641 3300049545 Ga0501329_01320 Ga0501329_01320_460_756 98
642 3300049547 Ga0501331_07283 Ga0501331_07283_282_578 98
643 3300049548 Ga0501332_19326 Ga0501332_19326_112_408 98
644 3300049551 Ga0501335_019758 Ga0501335_019758_91_387 98
645 3300049568 Ga0501031_0058878 Ga0501031_0058878_271_567 98
646 3300049568 Ga0501031_0336341 Ga0501031_0336341_448_744 98
647 3300049569 Ga0501032_0510860 Ga0501032_0510860_74_370 98
648 3300049570 Ga0501033_0003899 Ga0501033_0003899_5434_5730 98
649 3300049571 Ga0501034_0046023 Ga0501034_0046023_2155_2451 98
650 3300049571 Ga0501034_0215781 Ga0501034_0215781_679_975 98
651 3300049571 Ga0501034_0789867 Ga0501034_0789867_474_770 98
652 3300049572 Ga0501036_0042790 Ga0501036_0042790_71_367 98
653 3300049572 Ga0501036_0156089 Ga0501036_0156089_1065_1361 98
654 3300049573 Ga0501037_0038500 Ga0501037_0038500_3125_3421 98
655 3300049573 Ga0501037_0147819 Ga0501037_0147819_649_945 98
656 3300049573 Ga0501037_0610859 Ga0501037_0610859_334_630 98
657 3300049574 Ga0501038_0046533 Ga0501038_0046533_3392_3688 98
658 3300049574 Ga0501038_0149812 Ga0501038_0149812_393_689 98
659 3300049575 Ga0501039_0094100 Ga0501039_0094100_227_523 98
660 3300049575 Ga0501039_0220637 Ga0501039_0220637_102_398 98
661 3300049576 Ga0501040_0057060 Ga0501040_0057060_1696_1992 98
662 3300049578 Ga0501042_0006352 Ga0501042_0006352_193_489 98
663 3300049579 Ga0501043_0032226 Ga0501043_0032226_3695_3991 98
664 3300049579 Ga0501043_0100195 Ga0501043_0100195_1908_2204 98
665 3300049580 Ga0501046_0079981 Ga0501046_0079981_294_590 98
666 3300049581 Ga0501047_0005487 Ga0501047_0005487_8108_8404 98
667 3300049581 Ga0501047_0322469 Ga0501047_0322469_876_1172 98
668 3300049582 Ga0501048_0010499 Ga0501048_0010499_507_803 98
669 3300049582 Ga0501048_0644508 Ga0501048_0644508_318_614 98
670 3300049583 Ga0501067_0001840 Ga0501067_0001840_9219_9515 98
671 3300049584 Ga0501068_0031355 Ga0501068_0031355_2626_2922 98
672 3300049584 Ga0501068_0134851 Ga0501068_0134851_1158_1454 98
673 3300049585 Ga0501069_0192433 Ga0501069_0192433_398_694 98
674 3300049587 Ga0501071_0014068 Ga0501071_0014068_4743_5039 98
675 3300049588 Ga0501072_0184090 Ga0501072_0184090_851_1147 98
676 3300049588 Ga0501072_1024082 Ga0501072_1024082_252_548 98
677 3300049589 Ga0501073_0039588 Ga0501073_0039588_2958_3254 98
678 3300049590 Ga0501074_0052758 Ga0501074_0052758_1918_2214 98
679 3300049591 Ga0501075_0433447 Ga0501075_0433447_300_596 98
680 3300049592 Ga0501076_0054065 Ga0501076_0054065_1823_2119 98
681 3300049593 Ga0501077_0028790 Ga0501077_0028790_833_1129 98
682 3300049649 Ga0501198_084030 Ga0501198_084030_128_424 98
683 3300049652 Ga0501202_068220 Ga0501202_068220_462_758 98
684 3300049656 Ga0501209_090205 Ga0501209_090205_336_632 98
685 3300049690 Ga0501261_052301 Ga0501261_052301_63_359 98
686 3300049707 Ga0501234_067452 Ga0501234_067452_244_540 98
687 3300049708 Ga0501245_092165 Ga0501245_092165_104_400 98
688 3300049741 Ga0501079_0024576 Ga0501079_0024576_3631_3927 98
689 3300049742 Ga0501080_0107267 Ga0501080_0107267_1093_1389 98
690 3300049744 Ga0501083_0006724 Ga0501083_0006724_166_462 98
691 3300049768 Ga0501271_028555 Ga0501271_028555_217_513 98
692 3300049822 Ga0501035_0143633 Ga0501035_0143633_564_860 98
693 3300049822 Ga0501035_0188785 Ga0501035_0188785_1394_1690 98
694 3300049823 Ga0501044_0047177 Ga0501044_0047177_129_425 98
695 3300049823 Ga0501044_0163967 Ga0501044_0163967_1848_2144 98
696 3300049823 Ga0501044_0588757 Ga0501044_0588757_73_369 98
697 3300049824 Ga0501045_0484646 Ga0501045_0484646_306_602 98
698 3300049824 Ga0501045_0496303 Ga0501045_0496303_513_809 98
699 3300050489 nmdc:mga03683_55888_c1 nmdc:mga03683_55888_c1_1008_1304 98
700 3300050489 nmdc:mga03683_57927_c1 nmdc:mga03683_57927_c1_1026_1322 98
701 3300050491 nmdc:mga00v17_128506_c1 nmdc:mga00v17_128506_c1_1205_1501 98
702 3300050491 nmdc:mga00v17_158507_c1 nmdc:mga00v17_158507_c1_798_1094 98
703 3300050491 nmdc:mga00v17_40128_c1 nmdc:mga00v17_40128_c1_1487_1783 98
704 3300050492 nmdc:mga0yw44_198666_c1 nmdc:mga0yw44_198666_c1_125_421 98
705 3300050492 nmdc:mga0yw44_8112_c1 nmdc:mga0yw44_8112_c1_502_798 98
706 3300050493 nmdc:mga0k408_107918_c1 nmdc:mga0k408_107918_c1_1036_1332 98
707 3300050493 nmdc:mga0k408_349325_c1 nmdc:mga0k408_349325_c1_431_727 98
708 3300050494 nmdc:mga06z11_122918_c1 nmdc:mga06z11_122918_c1_263_559 98
709 3300050494 nmdc:mga06z11_65629_c1 nmdc:mga06z11_65629_c1_724_1020 98
710 3300050496 nmdc:mga07m45_26736_c1 nmdc:mga07m45_26736_c1_2051_2347 98
711 3300050511 nmdc:mga08y16_1237329_c1 nmdc:mga08y16_1237329_c1_83_379 98
712 3300053078 Ga0495612_0356432 Ga0495612_0356432_331_627 98
713 3300053085 Ga0495619_0253113 Ga0495619_0253113_828_1124 98
714 3300053104 Ga0500556_0004256 Ga0500556_0004256_312_608 98
715 3300053108 Ga0500562_009418 Ga0500562_009418_1816_2112 98
716 3300053153 Ga0500616_0006596 Ga0500616_0006596_593_889 98
717 3300054114 Ga0501084_0080043 Ga0501084_0080043_2391_2687 98
718 3300059490 Ga0587066_027970 Ga0587066_027970_236_532 98
719 3300059623 Ga0587101_105964 Ga0587101_105964_50_346 98
720 3300059640 Ga0587067_220962 Ga0587067_220962_100_396 98
721 3300060353 Ga0501082_0171311 Ga0501082_0171311_1341_1637 98
722 3300060353 Ga0501082_1408072 Ga0501082_1408072_128_424 98
723 3300061734 Ga0530510_0473104 Ga0530510_0473104_416_712 98
724 3300001979 JGI24740J21852_10127217 JGI24740J21852_101272171 99
725 3300003214 JGI25165J46597_1011340 JGI25165J46597_10113401 99
726 3300003215 JGI25153J46596_10082871 JGI25153J46596_100828711 99
727 3300003659 JGI25404J52841_10035096 JGI25404J52841_100350962 99
728 3300003752 Ga0055539_1021913 Ga0055539_10219132 99
729 3300003911 JGI25405J52794_10006513 JGI25405J52794_100065132 99
730 3300004799 Ga0058863_11772060 Ga0058863_117720601 99
731 3300005327 Ga0070658_10018691 Ga0070658_100186916 99
732 3300005327 Ga0070658_10417429 Ga0070658_104174291 99
733 3300005327 Ga0070658_10993116 Ga0070658_109931161 99
734 3300005336 Ga0070680_100098147 Ga0070680_1000981474 99
735 3300005336 Ga0070680_100664914 Ga0070680_1006649142 99
736 3300005336 Ga0070680_101082953 Ga0070680_1010829532 99
737 3300005336 Ga0070680_101587842 Ga0070680_1015878422 99
738 3300005339 Ga0070660_100839069 Ga0070660_1008390691 99
739 3300005367 Ga0070667_102074007 Ga0070667_1020740071 99
740 3300005434 Ga0070709_10002316 Ga0070709_1000231616 99
741 3300005434 Ga0070709_10022452 Ga0070709_100224525 99
742 3300005434 Ga0070709_10938746 Ga0070709_109387461 99
743 3300005435 Ga0070714_100009083 Ga0070714_10000908314 99
744 3300005435 Ga0070714_100017244 Ga0070714_1000172446 99
745 3300005435 Ga0070714_100026711 Ga0070714_1000267118 99
746 3300005435 Ga0070714_100207603 Ga0070714_1002076032 99
747 3300005435 Ga0070714_100562434 Ga0070714_1005624341 99
748 3300005435 Ga0070714_101608588 Ga0070714_1016085881 99
749 3300005436 Ga0070713_100036694 Ga0070713_1000366945 99
750 3300005436 Ga0070713_100056912 Ga0070713_1000569125 99
751 3300005436 Ga0070713_100061311 Ga0070713_1000613112 99
752 3300005436 Ga0070713_100095838 Ga0070713_1000958382 99
753 3300005436 Ga0070713_100610599 Ga0070713_1006105991 99
754 3300005436 Ga0070713_100645737 Ga0070713_1006457372 99
755 3300005436 Ga0070713_100734475 Ga0070713_1007344752 99
756 3300005436 Ga0070713_101400825 Ga0070713_1014008252 99
757 3300005436 Ga0070713_101869425 Ga0070713_1018694251 99
758 3300005437 Ga0070710_10005644 Ga0070710_100056444 99
759 3300005437 Ga0070710_10019970 Ga0070710_100199702 99
760 3300005437 Ga0070710_10058672 Ga0070710_100586723 99
761 3300005437 Ga0070710_10186643 Ga0070710_101866432 99
762 3300005437 Ga0070710_10318422 Ga0070710_103184222 99
763 3300005439 Ga0070711_100004304 Ga0070711_1000043046 99
764 3300005439 Ga0070711_100009870 Ga0070711_1000098703 99
765 3300005439 Ga0070711_100159576 Ga0070711_1001595762 99
766 3300005439 Ga0070711_100663258 Ga0070711_1006632582 99
767 3300005439 Ga0070711_101839668 Ga0070711_1018396681 99
768 3300005441 Ga0070700_101711775 Ga0070700_1017117752 99
769 3300005457 Ga0070662_101984517 Ga0070662_1019845172 99
770 3300005458 Ga0070681_10715142 Ga0070681_107151422 99
771 3300005458 Ga0070681_11170398 Ga0070681_111703982 99
772 3300005458 Ga0070681_11611799 Ga0070681_116117991 99
773 3300005468 Ga0070707_100127155 Ga0070707_1001271554 99
774 3300005471 Ga0070698_100118731 Ga0070698_1001187312 99
775 3300005471 Ga0070698_100482324 Ga0070698_1004823242 99
776 3300005530 Ga0070679_100288276 Ga0070679_1002882762 99
777 3300005535 Ga0070684_100047080 Ga0070684_1000470807 99
778 3300005535 Ga0070684_100356712 Ga0070684_1003567122 99
779 3300005535 Ga0070684_100886686 Ga0070684_1008866862 99
780 3300005536 Ga0070697_100077313 Ga0070697_1000773133 99
781 3300005539 Ga0068853_101848518 Ga0068853_1018485182 99
782 3300005545 Ga0070695_100385596 Ga0070695_1003855962 99
783 3300005546 Ga0070696_100031634 Ga0070696_1000316345 99
784 3300005547 Ga0070693_100721973 Ga0070693_1007219732 99
785 3300005549 Ga0070704_100746471 Ga0070704_1007464712 99
786 3300005563 Ga0068855_100220819 Ga0068855_1002208193 99
787 3300005578 Ga0068854_100596484 Ga0068854_1005964842 99
788 3300005578 Ga0068854_100770040 Ga0068854_1007700402 99
789 3300005614 Ga0068856_101512037 Ga0068856_1015120372 99
790 3300005616 Ga0068852_100271636 Ga0068852_1002716362 99
791 3300005617 Ga0068859_100254511 Ga0068859_1002545113 99
792 3300005618 Ga0068864_100847013 Ga0068864_1008470132 99
793 3300005841 Ga0068863_100237421 Ga0068863_1002374213 99
794 3300005842 Ga0068858_100270677 Ga0068858_1002706772 99
795 3300005843 Ga0068860_100088076 Ga0068860_1000880763 99
796 3300005844 Ga0068862_100688014 Ga0068862_1006880142 99
797 3300005937 Ga0081455_10021909 Ga0081455_100219092 99
798 3300005937 Ga0081455_10288863 Ga0081455_102888632 99
799 3300005981 Ga0081538_10029536 Ga0081538_100295368 99
800 3300005983 Ga0081540_1015691 Ga0081540_10156912 99
801 3300005983 Ga0081540_1017063 Ga0081540_10170638 99
802 3300005983 Ga0081540_1053318 Ga0081540_10533183 99
803 3300005983 Ga0081540_1065878 Ga0081540_10658782 99
804 3300006028 Ga0070717_10003669 Ga0070717_100036695 99
805 3300006028 Ga0070717_10027908 Ga0070717_100279085 99
806 3300006028 Ga0070717_10102080 Ga0070717_101020803 99
807 3300006028 Ga0070717_10381156 Ga0070717_103811562 99
808 3300006051 Ga0075364_10052785 Ga0075364_100527851 99
809 3300006163 Ga0070715_10312847 Ga0070715_103128472 99
810 3300006163 Ga0070715_10321955 Ga0070715_103219552 99
811 3300006173 Ga0070716_100026432 Ga0070716_1000264325 99
812 3300006173 Ga0070716_100079986 Ga0070716_1000799862 99
813 3300006173 Ga0070716_100226032 Ga0070716_1002260322 99
814 3300006173 Ga0070716_100397026 Ga0070716_1003970261 99
815 3300006173 Ga0070716_100477478 Ga0070716_1004774782 99
816 3300006175 Ga0070712_100058664 Ga0070712_1000586644 99
817 3300006175 Ga0070712_100058938 Ga0070712_1000589383 99
818 3300006175 Ga0070712_100201784 Ga0070712_1002017842 99
819 3300006175 Ga0070712_100412647 Ga0070712_1004126472 99
820 3300006175 Ga0070712_100515983 Ga0070712_1005159832 99
821 3300006175 Ga0070712_101410515 Ga0070712_1014105152 99
822 3300006177 Ga0075362_10035975 Ga0075362_100359752 99
823 3300006195 Ga0075366_10627287 Ga0075366_106272871 99
824 3300006237 Ga0097621_100165361 Ga0097621_1001653613 99
825 3300006237 Ga0097621_102073454 Ga0097621_1020734542 99
826 3300006358 Ga0068871_100286866 Ga0068871_1002868663 99
827 3300006358 Ga0068871_100486469 Ga0068871_1004864692 99
828 3300006358 Ga0068871_100682814 Ga0068871_1006828142 99
829 3300006844 Ga0075428_100237574 Ga0075428_1002375743 99
830 3300006846 Ga0075430_100103604 Ga0075430_1001036045 99
831 3300006871 Ga0075434_100025071 Ga0075434_1000250717 99
832 3300006871 Ga0075434_100036662 Ga0075434_1000366627 99
833 3300006931 Ga0097620_100254508 Ga0097620_1002545083 99
834 3300007076 Ga0075435_100102268 Ga0075435_1001022683 99
835 3300007076 Ga0075435_100897708 Ga0075435_1008977082 99
836 3300007788 Ga0099795_10003174 Ga0099795_100031743 99
837 3300009092 Ga0105250_10188339 Ga0105250_101883392 99
838 3300009093 Ga0105240_10504075 Ga0105240_105040752 99
839 3300009101 Ga0105247_10035209 Ga0105247_100352095 99
840 3300009147 Ga0114129_11726057 Ga0114129_117260572 99
841 3300009147 Ga0114129_12202468 Ga0114129_122024682 99
842 3300009174 Ga0105241_10177796 Ga0105241_101777963 99
843 3300009174 Ga0105241_10256780 Ga0105241_102567802 99
844 3300009176 Ga0105242_11411010 Ga0105242_114110101 99
845 3300009545 Ga0105237_10394223 Ga0105237_103942232 99
846 3300009545 Ga0105237_10997033 Ga0105237_109970332 99
847 3300009545 Ga0105237_11842462 Ga0105237_118424621 99
848 3300010159 Ga0099796_10002269 Ga0099796_100022695 99
849 3300010375 Ga0105239_10143574 Ga0105239_101435745 99
850 3300010375 Ga0105239_10239229 Ga0105239_102392292 99
851 3300010375 Ga0105239_12790328 Ga0105239_127903282 99
852 3300010375 Ga0105239_12945183 Ga0105239_129451831 99
853 3300012512 Ga0157327_1033127 Ga0157327_10331271 99
854 3300013100 Ga0157373_11308834 Ga0157373_113088342 99
855 3300013102 Ga0157371_10638770 Ga0157371_106387702 99
856 3300013104 Ga0157370_10461414 Ga0157370_104614141 99
857 3300013105 Ga0157369_10164535 Ga0157369_101645353 99
858 3300013105 Ga0157369_10312994 Ga0157369_103129942 99
859 3300013105 Ga0157369_11463227 Ga0157369_114632272 99
860 3300013105 Ga0157369_12136507 Ga0157369_121365072 99
861 3300013297 Ga0157378_11432213 Ga0157378_114322132 99
862 3300013306 Ga0163162_11073919 Ga0163162_110739192 99
863 3300013307 Ga0157372_10297910 Ga0157372_102979103 99
864 3300013307 Ga0157372_11055098 Ga0157372_110550981 99
865 3300013307 Ga0157372_11378347 Ga0157372_113783472 99
866 3300014968 Ga0157379_10552180 Ga0157379_105521802 99
867 3300014969 Ga0157376_10743776 Ga0157376_107437762 99
868 3300020070 Ga0206356_11853575 Ga0206356_118535751 99
869 3300020078 Ga0206352_10097269 Ga0206352_100972692 99
870 3300020080 Ga0206350_10960778 Ga0206350_109607782 99
871 3300020082 Ga0206353_10857624 Ga0206353_108576242 99
872 3300020610 Ga0154015_1214890 Ga0154015_12148902 99
873 3300021358 Ga0213873_10106683 Ga0213873_101066832 99
874 3300021361 Ga0213872_10307143 Ga0213872_103071432 99
875 3300021377 Ga0213874_10009960 Ga0213874_100099602 99
876 3300021377 Ga0213874_10220157 Ga0213874_102201572 99
877 3300021377 Ga0213874_10264446 Ga0213874_102644462 99
878 3300021377 Ga0213874_10275691 Ga0213874_102756912 99
879 3300021384 Ga0213876_10002961 Ga0213876_100029616 99
880 3300021388 Ga0213875_10000089 Ga0213875_10000089115 99
881 3300021388 Ga0213875_10059627 Ga0213875_100596273 99
882 3300021441 Ga0213871_10016747 Ga0213871_100167472 99
883 3300021441 Ga0213871_10155626 Ga0213871_101556262 99
884 3300022467 Ga0224712_10050101 Ga0224712_100501012 99
885 3300025253 Ga0209677_100816 Ga0209677_1008163 99
886 3300025254 Ga0209148_1004162 Ga0209148_10041623 99
887 3300025261 Ga0209233_1003250 Ga0209233_10032508 99
888 3300025272 Ga0209455_1009081 Ga0209455_10090814 99
889 3300025272 Ga0209455_1038588 Ga0209455_10385882 99
890 3300025297 Ga0209758_1040129 Ga0209758_10401292 99
891 3300025711 Ga0207696_1128942 Ga0207696_11289422 99
892 3300025898 Ga0207692_10039674 Ga0207692_100396743 99
893 3300025898 Ga0207692_10075631 Ga0207692_100756312 99
894 3300025905 Ga0207685_10005152 Ga0207685_100051526 99
895 3300025905 Ga0207685_10103277 Ga0207685_101032772 99
896 3300025905 Ga0207685_10228851 Ga0207685_102288512 99
897 3300025906 Ga0207699_10008214 Ga0207699_100082149 99
898 3300025906 Ga0207699_10028433 Ga0207699_100284332 99
899 3300025906 Ga0207699_10421039 Ga0207699_104210392 99
900 3300025906 Ga0207699_10731373 Ga0207699_107313732 99
901 3300025906 Ga0207699_11057182 Ga0207699_110571822 99
902 3300025909 Ga0207705_10244702 Ga0207705_102447023 99
903 3300025911 Ga0207654_10185216 Ga0207654_101852162 99
904 3300025912 Ga0207707_10074687 Ga0207707_100746876 99
905 3300025912 Ga0207707_10298153 Ga0207707_102981532 99
906 3300025912 Ga0207707_10734408 Ga0207707_107344082 99
907 3300025913 Ga0207695_10284481 Ga0207695_102844812 99
908 3300025913 Ga0207695_10930390 Ga0207695_109303902 99
909 3300025914 Ga0207671_10057494 Ga0207671_100574945 99
910 3300025914 Ga0207671_10659429 Ga0207671_106594292 99
911 3300025915 Ga0207693_10008270 Ga0207693_100082705 99
912 3300025915 Ga0207693_10059279 Ga0207693_100592792 99
913 3300025915 Ga0207693_10112539 Ga0207693_101125393 99
914 3300025915 Ga0207693_10159520 Ga0207693_101595202 99
915 3300025915 Ga0207693_10635016 Ga0207693_106350161 99
916 3300025915 Ga0207693_10705887 Ga0207693_107058872 99
917 3300025915 Ga0207693_11179653 Ga0207693_111796531 99
918 3300025916 Ga0207663_10012076 Ga0207663_100120763 99
919 3300025916 Ga0207663_10466318 Ga0207663_104663182 99
920 3300025916 Ga0207663_10961543 Ga0207663_109615432 99
921 3300025916 Ga0207663_10967373 Ga0207663_109673732 99
922 3300025917 Ga0207660_11293772 Ga0207660_112937722 99
923 3300025919 Ga0207657_10620448 Ga0207657_106204482 99
924 3300025921 Ga0207652_10179342 Ga0207652_101793423 99
925 3300025921 Ga0207652_10298273 Ga0207652_102982732 99
926 3300025922 Ga0207646_10920567 Ga0207646_109205672 99
927 3300025922 Ga0207646_10983489 Ga0207646_109834892 99
928 3300025924 Ga0207694_10234115 Ga0207694_102341153 99
929 3300025928 Ga0207700_10014261 Ga0207700_100142613 99
930 3300025928 Ga0207700_10071645 Ga0207700_100716455 99
931 3300025928 Ga0207700_10104591 Ga0207700_101045915 99
932 3300025928 Ga0207700_10574500 Ga0207700_105745002 99
933 3300025928 Ga0207700_10580562 Ga0207700_105805622 99
934 3300025928 Ga0207700_10929541 Ga0207700_109295412 99
935 3300025928 Ga0207700_11315927 Ga0207700_113159272 99
936 3300025928 Ga0207700_11901970 Ga0207700_119019702 99
937 3300025929 Ga0207664_10023422 Ga0207664_1002342210 99
938 3300025929 Ga0207664_10054900 Ga0207664_100549002 99
939 3300025929 Ga0207664_10086181 Ga0207664_100861812 99
940 3300025929 Ga0207664_10125208 Ga0207664_101252083 99
941 3300025929 Ga0207664_10503883 Ga0207664_105038831 99
942 3300025939 Ga0207665_10010112 Ga0207665_1001011213 99
943 3300025939 Ga0207665_10070979 Ga0207665_100709792 99
944 3300025939 Ga0207665_10103792 Ga0207665_101037923 99
945 3300025939 Ga0207665_10368058 Ga0207665_103680582 99
946 3300025939 Ga0207665_10501814 Ga0207665_105018142 99
947 3300025939 Ga0207665_10578776 Ga0207665_105787762 99
948 3300025944 Ga0207661_10025741 Ga0207661_100257416 99
949 3300025944 Ga0207661_10050770 Ga0207661_100507706 99
950 3300025944 Ga0207661_10847999 Ga0207661_108479992 99
951 3300025949 Ga0207667_10186152 Ga0207667_101861522 99
952 3300025986 Ga0207658_11557595 Ga0207658_115575951 99
953 3300026023 Ga0207677_11197635 Ga0207677_111976352 99
954 3300026035 Ga0207703_10433391 Ga0207703_104333912 99
955 3300026078 Ga0207702_10458876 Ga0207702_104588762 99
956 3300026088 Ga0207641_11062543 Ga0207641_110625432 99
957 3300026118 Ga0207675_101393715 Ga0207675_1013937152 99
958 3300026142 Ga0207698_10768882 Ga0207698_107688822 99
959 3300027512 Ga0209179_1003967 Ga0209179_10039673 99
960 3300027717 Ga0209998_10125883 Ga0209998_101258832 99
961 3300028380 Ga0268265_10612294 Ga0268265_106122942 99
962 3300028381 Ga0268264_10000377 Ga0268264_1000037757 99
963 3300030521 Ga0307511_10057801 Ga0307511_100578015 99
964 3300031247 Ga0265340_10045595 Ga0265340_100455953 99
965 3300031249 Ga0265339_10011362 Ga0265339_100113625 99
966 3300031507 Ga0307509_10276688 Ga0307509_102766882 99
967 3300031616 Ga0307508_10000378 Ga0307508_1000037847 99
968 3300031616 Ga0307508_10014201 Ga0307508_100142012 99
969 3300031666 Ga0310105_121407 Ga0310105_1214072 99
970 3300031730 Ga0307516_10019779 Ga0307516_100197796 99
971 3300033179 Ga0307507_10070872 Ga0307507_100708725 99
972 3300033180 Ga0307510_10243235 Ga0307510_102432352 99
973 3300033544 Ga0316215_1002459 Ga0316215_10024594 99
974 3300034818 Ga0373950_0005337 Ga0373950_0005337_23_322 99
975 3300034820 Ga0373959_0030593 Ga0373959_0030593_622_921 99
976 3300035083 Ga0373926_0003147 Ga0373926_0003147_1165_1464 99
977 3300035083 Ga0373926_0005778 Ga0373926_0005778_1901_2200 99
978 3300035092 Ga0373952_0016138 Ga0373952_0016138_425_724 99
979 3300035113 Ga0373936_0010464 Ga0373936_0010464_809_1108 99
980 3300035113 Ga0373936_0015906 Ga0373936_0015906_1337_1636 99
981 3300035113 Ga0373936_0341737 Ga0373936_0341737_259_558 99
982 3300035116 Ga0373945_0012687 Ga0373945_0012687_907_1206 99
983 3300035116 Ga0373945_0171395 Ga0373945_0171395_476_775 99
984 3300035117 Ga0373953_0099066 Ga0373953_0099066_11_310 99
985 3300035118 Ga0373954_0006766 Ga0373954_0006766_1960_2259 99
986 3300035119 Ga0373956_0012723 Ga0373956_0012723_2685_2984 99
987 3300035120 Ga0373957_0106937 Ga0373957_0106937_391_690 99
988 3300035170 Ga0373943_0010548 Ga0373943_0010548_3221_3520 99
989 3300035170 Ga0373943_0124534 Ga0373943_0124534_969_1268 99
990 3300035171 Ga0373946_0019180 Ga0373946_0019180_1762_2061 99
991 3300035171 Ga0373946_0359825 Ga0373946_0359825_80_379 99
992 3300035172 Ga0373955_0126635 Ga0373955_0126635_853_1152 99
993 3300035207 Ga0373942_0152487 Ga0373942_0152487_159_458 99
994 3300035410 Ga0373924_0014731 Ga0373924_0014731_346_645 99
995 3300035692 Ga0373935_0012257 Ga0373935_0012257_1142_1441 99
996 3300035692 Ga0373935_0053250 Ga0373935_0053250_2076_2375 99
997 3300035695 Ga0373927_0004904 Ga0373927_0004904_3509_3808 99
998 3300035695 Ga0373927_0222869 Ga0373927_0222869_603_902 99
999 3300035724 Ga0373933_0010736 Ga0373933_0010736_2098_2397 99
1000 3300035724 Ga0373933_0875935 Ga0373933_0875935_84_383 99
1001 3300035725 Ga0373947_0034111 Ga0373947_0034111_1839_2138 99
1002 3300035725 Ga0373947_0398099 Ga0373947_0398099_523_822 99
1003 3300036242 Ga0310104_00193 Ga0310104_00193_882_1181 99
1004 3300036401 Ga0373937_0050692 Ga0373937_0050692_781_1080 99
1005 3300037068 Ga0373925_0024722 Ga0373925_0024722_2199_2498 99
1006 3300037068 Ga0373925_0039116 Ga0373925_0039116_2093_2392 99
1007 3300037312 Ga0395899_0072585 Ga0395899_0072585_1164_1463 99
1008 3300037418 Ga0395900_0343977 Ga0395900_0343977_633_932 99
1009 3300037418 Ga0395900_0369151 Ga0395900_0369151_715_1014 99
1010 3300037466 Ga0395898_0064043 Ga0395898_0064043_1167_1466 99
1011 3300037466 Ga0395898_0294093 Ga0395898_0294093_501_800 99
1012 3300037466 Ga0395898_0917040 Ga0395898_0917040_13_312 99
1013 3300037466 Ga0395898_1122328 Ga0395898_1122328_174_473 99
1014 3300037471 Ga0395905_0112513 Ga0395905_0112513_1141_1440 99
1015 3300037853 Ga0436364_0333324 Ga0436364_0333324_7027_7326 99
1016 3300037853 Ga0436364_0335675 Ga0436364_0335675_39_338 99
1017 3300037853 Ga0436364_0508030 Ga0436364_0508030_995_1294 99
1018 3300037853 Ga0436364_0554121 Ga0436364_0554121_314_613 99
1019 3300037853 Ga0436364_1191222 Ga0436364_1191222_598_897 99
1020 3300038443 Ga0395901_0132044 Ga0395901_0132044_1552_1851 99
1021 3300038443 Ga0395901_0318811 Ga0395901_0318811_374_673 99
1022 3300038443 Ga0395901_0408662 Ga0395901_0408662_132_431 99
1023 3300038443 Ga0395901_0637417 Ga0395901_0637417_385_684 99
1024 3300039437 Ga0436365_0368899 Ga0436365_0368899_797_1096 99
1025 3300039437 Ga0436365_1350477 Ga0436365_1350477_128_427 99
1026 3300039437 Ga0436365_1529438 Ga0436365_1529438_387_686 99
1027 3300039437 Ga0436365_1760276 Ga0436365_1760276_533_832 99
1028 3300039437 Ga0436365_1870318 Ga0436365_1870318_1793_2092 99
1029 3300039437 Ga0436365_1902820 Ga0436365_1902820_826_1125 99
1030 3300039438 Ga0436360_0409482 Ga0436360_0409482_624_923 99
1031 3300039438 Ga0436360_0777771 Ga0436360_0777771_288_587 99
1032 3300039438 Ga0436360_0885775 Ga0436360_0885775_141_440 99
1033 3300039438 Ga0436360_1268636 Ga0436360_1268636_217_516 99
1034 3300039447 Ga0436361_0317849 Ga0436361_0317849_267_566 99
1035 3300039447 Ga0436361_0427976 Ga0436361_0427976_349_648 99
1036 3300039450 Ga0436363_0131403 Ga0436363_0131403_377_676 99
1037 3300039450 Ga0436363_0242717 Ga0436363_0242717_13_312 99
1038 3300039450 Ga0436363_0312775 Ga0436363_0312775_121_420 99
1039 3300039450 Ga0436363_0880899 Ga0436363_0880899_3148_3447 99
1040 3300039450 Ga0436363_1014283 Ga0436363_1014283_285_584 99
1041 3300039450 Ga0436363_1387407 Ga0436363_1387407_540_839 99
1042 3300039450 Ga0436363_1575848 Ga0436363_1575848_493_792 99
1043 3300039453 Ga0436362_0002334 Ga0436362_0002334_251_550 99
1044 3300039453 Ga0436362_0982213 Ga0436362_0982213_90_392 99
1045 3300039453 Ga0436362_1142159 Ga0436362_1142159_29_328 99
1046 3300041446 Ga0451794_34969 Ga0451794_34969_142_441 99
1047 3300041458 Ga0451798_0606664 Ga0451798_0606664_78_377 99
1048 3300041486 Ga0451807_2208106 Ga0451807_2208106_31_330 99
1049 3300041494 Ga0451837_0342915 Ga0451837_0342915_421_723 99
1050 3300041511 Ga0451855_0769345 Ga0451855_0769345_117_416 99
1051 3300041512 Ga0451853_3344493 Ga0451853_3344493_327_626 99
1052 3300044656 Ga0466969_0217487 Ga0466969_0217487_479_778 99
1053 3300044656 Ga0466969_0511409 Ga0466969_0511409_39_341 99
1054 3300044684 Ga0466966_0037447 Ga0466966_0037447_859_1161 99
1055 3300044684 Ga0466966_0063022 Ga0466966_0063022_49_348 99
1056 3300044693 Ga0466961_0017735 Ga0466961_0017735_1270_1572 99
1057 3300044694 Ga0466963_0016197 Ga0466963_0016197_510_809 99
1058 3300044694 Ga0466963_0037303 Ga0466963_0037303_1030_1329 99
1059 3300044694 Ga0466963_0070352 Ga0466963_0070352_994_1296 99
1060 3300044694 Ga0466963_0354875 Ga0466963_0354875_360_659 99
1061 3300044694 Ga0466963_0358283 Ga0466963_0358283_323_622 99
1062 3300044719 Ga0466971_0675604 Ga0466971_0675604_101_403 99
1063 3300044765 Ga0466970_0122687 Ga0466970_0122687_830_1129 99
1064 3300044765 Ga0466970_0201450 Ga0466970_0201450_514_816 99
1065 3300044842 Ga0466957_0014805 Ga0466957_0014805_824_1123 99
1066 3300044842 Ga0466957_0075585 Ga0466957_0075585_444_743 99
1067 3300044842 Ga0466957_0318692 Ga0466957_0318692_433_735 99
1068 3300044901 Ga0466960_0958273 Ga0466960_0958273_151_450 99
1069 3300045049 Ga0466959_0098844 Ga0466959_0098844_97_399 99
1070 3300045049 Ga0466959_0744194 Ga0466959_0744194_68_367 99
1071 3300045976 Ga0466967_0011664 Ga0466967_0011664_4701_5000 99
1072 3300045976 Ga0466967_0056204 Ga0466967_0056204_895_1197 99
1073 3300045976 Ga0466967_0096571 Ga0466967_0096571_2242_2541 99
1074 3300045976 Ga0466967_0434220 Ga0466967_0434220_679_978 99
1075 3300045976 Ga0466967_0471064 Ga0466967_0471064_886_1185 99
1076 3300045976 Ga0466967_1078797 Ga0466967_1078797_359_658 99
1077 3300046452 Ga0495617_093369 Ga0495617_093369_596_895 99
1078 3300046455 Ga0495603_0011756 Ga0495603_0011756_732_1031 99
1079 3300046459 Ga0495629_0026319 Ga0495629_0026319_2157_2456 99
1080 3300046461 Ga0495641_0210957 Ga0495641_0210957_451_750 99
1081 3300046472 Ga0495580_0111434 Ga0495580_0111434_573_872 99
1082 3300046472 Ga0495580_0791263 Ga0495580_0791263_271_570 99
1083 3300046473 Ga0495582_0016883 Ga0495582_0016883_1921_2220 99
1084 3300046475 Ga0495639_0026164 Ga0495639_0026164_11_310 99
1085 3300046476 Ga0495662_0031478 Ga0495662_0031478_298_597 99
1086 3300046477 Ga0495664_0018921 Ga0495664_0018921_2102_2401 99
1087 3300046491 Ga0495584_0038672 Ga0495584_0038672_1136_1435 99
1088 3300046507 Ga0495606_0055089 Ga0495606_0055089_243_542 99
1089 3300046514 Ga0495618_0043838 Ga0495618_0043838_1583_1882 99
1090 3300046517 Ga0495630_0095907 Ga0495630_0095907_702_1001 99
1091 3300046526 Ga0495666_0087221 Ga0495666_0087221_933_1232 99
1092 3300046529 Ga0495652_0204382 Ga0495652_0204382_228_527 99
1093 3300046531 Ga0495665_0039396 Ga0495665_0039396_906_1205 99
1094 3300046533 Ga0495640_0019304 Ga0495640_0019304_924_1223 99
1095 3300046535 Ga0495586_0136518 Ga0495586_0136518_161_460 99
1096 3300046542 Ga0495597_0068164 Ga0495597_0068164_200_499 99
1097 3300046543 Ga0495645_0003533 Ga0495645_0003533_1309_1608 99
1098 3300046557 Ga0495622_0204243 Ga0495622_0204243_387_686 99
1099 3300046557 Ga0495622_0452756 Ga0495622_0452756_139_438 99
1100 3300046559 Ga0495667_0108852 Ga0495667_0108852_1321_1620 99
1101 3300046615 Ga0495656_0482666 Ga0495656_0482666_27_326 99
1102 3300046616 Ga0495668_0430953 Ga0495668_0430953_308_607 99
1103 3300046642 Ga0495634_0015564 Ga0495634_0015564_2903_3202 99
1104 3300046663 Ga0495635_0099960 Ga0495635_0099960_778_1077 99
1105 3300046675 Ga0495657_0732641 Ga0495657_0732641_170_469 99
1106 3300046675 Ga0495657_0864147 Ga0495657_0864147_112_411 99
1107 3300046678 Ga0495599_0154630 Ga0495599_0154630_1013_1312 99
1108 3300046678 Ga0495599_0165274 Ga0495599_0165274_610_909 99
1109 3300046679 Ga0495623_0224284 Ga0495623_0224284_314_613 99
1110 3300046679 Ga0495623_0315983 Ga0495623_0315983_477_776 99
1111 3300046680 Ga0495646_0054443 Ga0495646_0054443_906_1205 99
1112 3300046681 Ga0495647_0005756 Ga0495647_0005756_2709_3008 99
1113 3300046683 Ga0495658_0398360 Ga0495658_0398360_478_777 99
1114 3300046689 Ga0495613_0078402 Ga0495613_0078402_787_1086 99
1115 3300046690 Ga0495624_0051066 Ga0495624_0051066_1619_1918 99
1116 3300047315 Ga0495581_0033672 Ga0495581_0033672_1808_2107 99
1117 3300047317 Ga0495604_0317839 Ga0495604_0317839_613_912 99
1118 3300047317 Ga0495604_0644638 Ga0495604_0644638_275_574 99
1119 3300047319 Ga0495674_0010137 Ga0495674_0010137_5004_5303 99
1120 3300047322 Ga0495680_0263931 Ga0495680_0263931_449_748 99
1121 3300047322 Ga0495680_0621850 Ga0495680_0621850_79_378 99
1122 3300047471 Ga0495684_0016236 Ga0495684_0016236_2532_2831 99
1123 3300047472 Ga0495686_0247696 Ga0495686_0247696_503_802 99
1124 3300047673 Ga0495593_0035110 Ga0495593_0035110_701_1000 99
1125 3300048903 Ga0496100_0086615 Ga0496100_0086615_53_352 99
1126 3300048903 Ga0496100_0088497 Ga0496100_0088497_1223_1522 99
1127 3300048903 Ga0496100_0849411 Ga0496100_0849411_170_469 99
1128 3300048904 Ga0496101_1047976 Ga0496101_1047976_28_327 99
1129 3300048904 Ga0496101_1537642 Ga0496101_1537642_168_467 99
1130 3300048905 Ga0496102_1387868 Ga0496102_1387868_228_527 99
1131 3300048909 Ga0496106_0049371 Ga0496106_0049371_684_983 99
1132 3300048909 Ga0496106_0255760 Ga0496106_0255760_712_1011 99
1133 3300048910 Ga0496107_0336293 Ga0496107_0336293_220_519 99
1134 3300048910 Ga0496107_0687808 Ga0496107_0687808_280_579 99
1135 3300048913 Ga0496110_0430482 Ga0496110_0430482_361_660 99
1136 3300048914 Ga0496111_0397434 Ga0496111_0397434_358_657 99
1137 3300048915 Ga0496112_0301262 Ga0496112_0301262_294_593 99
1138 3300048915 Ga0496112_0959312 Ga0496112_0959312_109_408 99
1139 3300048917 Ga0496114_0526862 Ga0496114_0526862_380_679 99
1140 3300048918 Ga0496115_0774600 Ga0496115_0774600_200_499 99
1141 3300048919 Ga0496116_0104480 Ga0496116_0104480_988_1287 99
1142 3300048920 Ga0496117_0071108 Ga0496117_0071108_48_347 99
1143 3300048921 Ga0496118_0024920 Ga0496118_0024920_2840_3139 99
1144 3300048921 Ga0496118_0073065 Ga0496118_0073065_120_419 99
1145 3300048922 Ga0496119_0295542 Ga0496119_0295542_140_439 99
1146 3300048922 Ga0496119_0381273 Ga0496119_0381273_14_313 99
1147 3300048923 Ga0496120_0072566 Ga0496120_0072566_1469_1768 99
1148 3300048923 Ga0496120_0227045 Ga0496120_0227045_159_458 99
1149 3300048924 Ga0496121_0003703 Ga0496121_0003703_2772_3071 99
1150 3300048924 Ga0496121_0035490 Ga0496121_0035490_544_843 99
1151 3300048924 Ga0496121_0076984 Ga0496121_0076984_949_1248 99
1152 3300048924 Ga0496121_0273289 Ga0496121_0273289_391_690 99
1153 3300048925 Ga0496122_0133672 Ga0496122_0133672_210_509 99
1154 3300048927 Ga0496124_0037995 Ga0496124_0037995_515_814 99
1155 3300048928 Ga0496125_0228180 Ga0496125_0228180_202_501 99
1156 3300048929 Ga0496126_0052029 Ga0496126_0052029_200_499 99
1157 3300048929 Ga0496126_0062525 Ga0496126_0062525_2003_2302 99
1158 3300048929 Ga0496126_0088438 Ga0496126_0088438_1813_2112 99
1159 3300048929 Ga0496126_0110380 Ga0496126_0110380_1509_1808 99
1160 3300048929 Ga0496126_0157561 Ga0496126_0157561_183_482 99
1161 3300048929 Ga0496126_0552488 Ga0496126_0552488_469_768 99
1162 3300049527 Ga0501311_058695 Ga0501311_058695_115_414 99
1163 3300049568 Ga0501031_0189582 Ga0501031_0189582_919_1218 99
1164 3300049568 Ga0501031_0384727 Ga0501031_0384727_291_590 99
1165 3300049569 Ga0501032_0102312 Ga0501032_0102312_288_587 99
1166 3300049570 Ga0501033_0077789 Ga0501033_0077789_1279_1578 99
1167 3300049570 Ga0501033_0087576 Ga0501033_0087576_591_890 99
1168 3300049570 Ga0501033_0329421 Ga0501033_0329421_625_924 99
1169 3300049570 Ga0501033_0561852 Ga0501033_0561852_79_378 99
1170 3300049571 Ga0501034_0045501 Ga0501034_0045501_4084_4383 99
1171 3300049571 Ga0501034_0280847 Ga0501034_0280847_890_1189 99
1172 3300049571 Ga0501034_0660737 Ga0501034_0660737_102_401 99
1173 3300049571 Ga0501034_1100999 Ga0501034_1100999_159_458 99
1174 3300049572 Ga0501036_0761878 Ga0501036_0761878_250_549 99
1175 3300049572 Ga0501036_1036998 Ga0501036_1036998_63_362 99
1176 3300049573 Ga0501037_0067461 Ga0501037_0067461_886_1185 99
1177 3300049573 Ga0501037_0215198 Ga0501037_0215198_524_823 99
1178 3300049573 Ga0501037_0308671 Ga0501037_0308671_372_671 99
1179 3300049574 Ga0501038_0111161 Ga0501038_0111161_1355_1654 99
1180 3300049574 Ga0501038_0178958 Ga0501038_0178958_278_577 99
1181 3300049575 Ga0501039_0143242 Ga0501039_0143242_824_1123 99
1182 3300049575 Ga0501039_1465325 Ga0501039_1465325_83_382 99
1183 3300049576 Ga0501040_0104821 Ga0501040_0104821_1271_1570 99
1184 3300049578 Ga0501042_1104347 Ga0501042_1104347_212_511 99
1185 3300049579 Ga0501043_0377711 Ga0501043_0377711_367_666 99
1186 3300049580 Ga0501046_0104265 Ga0501046_0104265_1101_1400 99
1187 3300049581 Ga0501047_0103854 Ga0501047_0103854_1046_1345 99
1188 3300049581 Ga0501047_0346110 Ga0501047_0346110_973_1272 99
1189 3300049581 Ga0501047_0622027 Ga0501047_0622027_178_477 99
1190 3300049584 Ga0501068_0679595 Ga0501068_0679595_40_339 99
1191 3300049585 Ga0501069_0553027 Ga0501069_0553027_250_549 99
1192 3300049585 Ga0501069_0965278 Ga0501069_0965278_198_497 99
1193 3300049586 Ga0501070_0025506 Ga0501070_0025506_149_448 99
1194 3300049586 Ga0501070_0219812 Ga0501070_0219812_947_1246 99
1195 3300049588 Ga0501072_0267299 Ga0501072_0267299_544_843 99
1196 3300049589 Ga0501073_0023164 Ga0501073_0023164_982_1281 99
1197 3300049589 Ga0501073_1281054 Ga0501073_1281054_105_404 99
1198 3300049590 Ga0501074_0026693 Ga0501074_0026693_2098_2397 99
1199 3300049592 Ga0501076_1252901 Ga0501076_1252901_290_589 99
1200 3300049593 Ga0501077_0769530 Ga0501077_0769530_123_422 99
1201 3300049741 Ga0501079_0126189 Ga0501079_0126189_378_677 99
1202 3300049741 Ga0501079_0670703 Ga0501079_0670703_80_379 99
1203 3300049742 Ga0501080_0137367 Ga0501080_0137367_1486_1785 99
1204 3300049742 Ga0501080_0258855 Ga0501080_0258855_293_592 99
1205 3300049743 Ga0501081_1036619 Ga0501081_1036619_34_333 99
1206 3300049744 Ga0501083_0023858 Ga0501083_0023858_3493_3792 99
1207 3300049744 Ga0501083_0493650 Ga0501083_0493650_96_395 99
1208 3300049744 Ga0501083_0604216 Ga0501083_0604216_118_417 99
1209 3300049822 Ga0501035_0069162 Ga0501035_0069162_840_1139 99
1210 3300049822 Ga0501035_0274381 Ga0501035_0274381_261_560 99
1211 3300049822 Ga0501035_0584051 Ga0501035_0584051_267_566 99
1212 3300049823 Ga0501044_0096645 Ga0501044_0096645_693_992 99
1213 3300049823 Ga0501044_0984596 Ga0501044_0984596_85_384 99
1214 3300049823 Ga0501044_1040435 Ga0501044_1040435_196_495 99
1215 3300049824 Ga0501045_1397298 Ga0501045_1397298_132_431 99
1216 3300050489 nmdc:mga03683_30010_c1 nmdc:mga03683_30010_c1_390_689 99
1217 3300050492 nmdc:mga0yw44_72574_c1 nmdc:mga0yw44_72574_c1_1030_1329 99
1218 3300050496 nmdc:mga07m45_313530_c1 nmdc:mga07m45_313530_c1_277_576 99
1219 3300050507 nmdc:mga05p37_1141437_c1 nmdc:mga05p37_1141437_c1_379_678 99
1220 3300050511 nmdc:mga08y16_1002128_c1 nmdc:mga08y16_1002128_c1_434_733 99
1221 3300050512 nmdc:mga0n895_260513_c1 nmdc:mga0n895_260513_c1_71_370 99
1222 3300050512 nmdc:mga0n895_5268_c1 nmdc:mga0n895_5268_c1_6137_6436 99
1223 3300050513 nmdc:mga0rr50_97529_c2 nmdc:mga0rr50_97529_c2_1536_1835 99
1224 3300050514 nmdc:mga08x19_816672_c1 nmdc:mga08x19_816672_c1_215_514 99
1225 3300053077 Ga0495601_0316895 Ga0495601_0316895_604_903 99
1226 3300053078 Ga0495612_0089496 Ga0495612_0089496_81_380 99
1227 3300053080 Ga0500635_0041067 Ga0500635_0041067_121_420 99
1228 3300053080 Ga0500635_0116565 Ga0500635_0116565_636_935 99
1229 3300053091 Ga0500647_0175353 Ga0500647_0175353_88_387 99
1230 3300053091 Ga0500647_0233186 Ga0500647_0233186_150_449 99
1231 3300053094 Ga0500566_0000320 Ga0500566_0000320_23445_23744 99
1232 3300053094 Ga0500566_0088640 Ga0500566_0088640_412_711 99
1233 3300053095 Ga0500640_029114 Ga0500640_029114_1572_1871 99
1234 3300053106 Ga0500558_109295 Ga0500558_109295_104_403 99
1235 3300053111 Ga0500572_001638 Ga0500572_001638_3185_3484 99
1236 3300053111 Ga0500572_015788 Ga0500572_015788_26_325 99
1237 3300053115 Ga0500591_079976 Ga0500591_079976_145_444 99
1238 3300053122 Ga0500608_083229 Ga0500608_083229_1013_1312 99
1239 3300053123 Ga0500614_057503 Ga0500614_057503_242_541 99
1240 3300053123 Ga0500614_280998 Ga0500614_280998_35_334 99
1241 3300053133 Ga0500655_071954 Ga0500655_071954_98_397 99
1242 3300053136 Ga0500559_0007811 Ga0500559_0007811_1078_1377 99
1243 3300053136 Ga0500559_0012275 Ga0500559_0012275_2973_3272 99
1244 3300053136 Ga0500559_0120340 Ga0500559_0120340_138_437 99
1245 3300053137 Ga0500561_0200419 Ga0500561_0200419_201_500 99
1246 3300053138 Ga0500564_290061 Ga0500564_290061_265_564 99
1247 3300053139 Ga0500568_0113847 Ga0500568_0113847_45_344 99
1248 3300053140 Ga0500573_0006745 Ga0500573_0006745_1250_1549 99
1249 3300053144 Ga0500585_223960 Ga0500585_223960_201_500 99
1250 3300053148 Ga0500590_151829 Ga0500590_151829_376_675 99
1251 3300053148 Ga0500590_307903 Ga0500590_307903_113_412 99
1252 3300053150 Ga0500603_021102 Ga0500603_021102_1048_1347 99
1253 3300053150 Ga0500603_027424 Ga0500603_027424_104_403 99
1254 3300053150 Ga0500603_030409 Ga0500603_030409_76_375 99
1255 3300053154 Ga0500619_208526 Ga0500619_208526_155_454 99
1256 3300053159 Ga0500630_005936 Ga0500630_005936_3841_4140 99
1257 3300053162 Ga0500638_035746 Ga0500638_035746_1380_1679 99
1258 3300053163 Ga0500639_019780 Ga0500639_019780_2951_3250 99
1259 3300053163 Ga0500639_044490 Ga0500639_044490_465_764 99
1260 3300053177 Ga0500636_0067281 Ga0500636_0067281_1702_2001 99
1261 3300053177 Ga0500636_0144725 Ga0500636_0144725_10_309 99
1262 3300053178 Ga0500637_0072771 Ga0500637_0072771_1165_1464 99
1263 3300053178 Ga0500637_0190508 Ga0500637_0190508_680_979 99
1264 3300053178 Ga0500637_0215172 Ga0500637_0215172_357_656 99
1265 3300053725 Ga0500576_041535 Ga0500576_041535_1704_2003 99
1266 3300053728 Ga0500657_147716 Ga0500657_147716_381_680 99
1267 3300053733 Ga0500552_113454 Ga0500552_113454_121_420 99
1268 3300053735 Ga0500596_003892 Ga0500596_003892_1135_1434 99
1269 3300053735 Ga0500596_007930 Ga0500596_007930_826_1125 99
1270 3300053735 Ga0500596_051092 Ga0500596_051092_17_316 99
1271 3300053737 Ga0500601_007073 Ga0500601_007073_895_1194 99
1272 3300053737 Ga0500601_012157 Ga0500601_012157_471_770 99
1273 3300054114 Ga0501084_0424221 Ga0501084_0424221_239_538 99
1274 3300055283 Ga0500661_118751 Ga0500661_118751_65_364 99
1275 3300059426 Ga0590077_180360 Ga0590077_180360_68_367 99
1276 3300059478 Ga0587093_049355 Ga0587093_049355_228_527 99
1277 3300059491 Ga0587070_023933 Ga0587070_023933_285_584 99
1278 3300059492 Ga0587073_0145918 Ga0587073_0145918_221_520 99
1279 3300059492 Ga0587073_0272404 Ga0587073_0272404_27_326 99
1280 3300059504 Ga0587082_120957 Ga0587082_120957_38_337 99
1281 3300059505 Ga0587083_0169989 Ga0587083_0169989_29_328 99
1282 3300059506 Ga0587085_122805 Ga0587085_122805_112_411 99
1283 3300059507 Ga0587086_029713 Ga0587086_029713_391_690 99
1284 3300059604 Ga0587098_048040 Ga0587098_048040_243_542 99
1285 3300059605 Ga0587106_013279 Ga0587106_013279_546_848 99
1286 3300059605 Ga0587106_108624 Ga0587106_108624_238_537 99
1287 3300059623 Ga0587101_004242 Ga0587101_004242_423_725 99
1288 3300059623 Ga0587101_106800 Ga0587101_106800_225_524 99
1289 3300059624 Ga0587109_103867 Ga0587109_103867_152_451 99
1290 3300059627 Ga0587117_024481 Ga0587117_024481_200_499 99
1291 3300059640 Ga0587067_174578 Ga0587067_174578_49_348 99
1292 3300059642 Ga0587069_083867 Ga0587069_083867_110_409 99
1293 3300059642 Ga0587069_097416 Ga0587069_097416_37_336 99
1294 3300059643 Ga0587072_023778 Ga0587072_023778_548_847 99
1295 3300059647 Ga0587079_074253 Ga0587079_074253_388_687 99
1296 3300059647 Ga0587079_157835 Ga0587079_157835_38_337 99
1297 3300059652 Ga0587107_024275 Ga0587107_024275_244_543 99
1298 3300059652 Ga0587107_038016 Ga0587107_038016_212_511 99
1299 3300059652 Ga0587107_051941 Ga0587107_051941_247_546 99
1300 3300059652 Ga0587107_112242 Ga0587107_112242_152_454 99
1301 3300059652 Ga0587107_112462 Ga0587107_112462_214_513 99
1302 3300059653 Ga0587108_004748 Ga0587108_004748_447_746 99
1303 3300059656 Ga0587116_06220 Ga0587116_06220_172_474 99
1304 3300059658 Ga0587119_036177 Ga0587119_036177_193_492 99
1305 3300060353 Ga0501082_0526106 Ga0501082_0526106_73_372 99
1306 3300061719 Ga0466962_0243768 Ga0466962_0243768_367_669 99
1307 3300061734 Ga0530510_0050130 Ga0530510_0050130_604_903 99
1308 3300061734 Ga0530510_0261262 Ga0530510_0261262_958_1257 99
1309 3300004799 Ga0058863_11874628 Ga0058863_118746282 100
1310 3300005329 Ga0070683_101643452 Ga0070683_1016434522 100
1311 3300005336 Ga0070680_100310121 Ga0070680_1003101212 100
1312 3300005458 Ga0070681_10329459 Ga0070681_103294592 100
1313 3300005563 Ga0068855_100351567 Ga0068855_1003515672 100
1314 3300005563 Ga0068855_100722076 Ga0068855_1007220763 100
1315 3300009093 Ga0105240_10230206 Ga0105240_102302062 100
1316 3300009551 Ga0105238_10437534 Ga0105238_104375342 100
1317 3300011119 Ga0105246_12574566 Ga0105246_125745662 100
1318 3300025254 Ga0209148_1008955 Ga0209148_10089554 100
1319 3300025909 Ga0207705_10933880 Ga0207705_109338802 100
1320 3300025913 Ga0207695_10104513 Ga0207695_101045135 100
1321 3300025917 Ga0207660_11115557 Ga0207660_111155572 100
1322 3300025933 Ga0207706_10200935 Ga0207706_102009352 100
1323 3300025941 Ga0207711_10543545 Ga0207711_105435452 100
1324 3300025944 Ga0207661_12008276 Ga0207661_120082762 100
1325 3300026121 Ga0207683_11094234 Ga0207683_110942342 100
1326 3300035692 Ga0373935_0286934 Ga0373935_0286934_158_460 100
1327 3300039447 Ga0436361_0763086 Ga0436361_0763086_92_394 100
1328 iso_pu_bacteria 2512564014 2512642897 100
1329 iso_pu_bacteria 2775507255 2778126625 101
1330 3300048921 Ga0496118_0560981 Ga0496118_0560981_95_406 103
1331 3300048924 Ga0496121_0396206 Ga0496121_0396206_180_491 103
1332 3300048929 Ga0496126_0185973 Ga0496126_0185973_120_431 103
1333 3300049569 Ga0501032_0196587 Ga0501032_0196587_872_1183 103
1334 3300049571 Ga0501034_0072791 Ga0501034_0072791_367_678 103
1335 3300049572 Ga0501036_0373840 Ga0501036_0373840_762_1073 103
1336 3300049573 Ga0501037_0058098 Ga0501037_0058098_562_873 103
1337 3300049822 Ga0501035_0310484 Ga0501035_0310484_879_1190 103
1338 3300021361 Ga0213872_10023323 Ga0213872_100233234 104
1339 3300021377 Ga0213874_10010979 Ga0213874_100109792 104
1340 3300031711 Ga0265314_10636688 Ga0265314_106366881 104
1341 3300037853 Ga0436364_1352603 Ga0436364_1352603_1533_1850 104
1342 3300039447 Ga0436361_0963669 Ga0436361_0963669_2177_2494 104
1343 3300039450 Ga0436363_1627336 Ga0436363_1627336_101_418 104
1344 3300048906 Ga0496103_0172850 Ga0496103_0172850_813_1127 104
1345 3300048919 Ga0496116_0224902 Ga0496116_0224902_503_817 104
1346 3300048920 Ga0496117_0079014 Ga0496117_0079014_793_1107 104
1347 3300048921 Ga0496118_0029731 Ga0496118_0029731_2703_3017 104
1348 3300048922 Ga0496119_0047286 Ga0496119_0047286_633_947 104
1349 3300048927 Ga0496124_0280696 Ga0496124_0280696_796_1110 104
1350 3300001915 JGI24741J21665_1000040 JGI24741J21665_100004032 105
1351 3300001979 JGI24740J21852_10001488 JGI24740J21852_100014886 105
1352 3300001989 JGI24739J22299_10009835 JGI24739J22299_100098354 105
1353 3300001990 JGI24737J22298_10002296 JGI24737J22298_100022967 105
1354 3300002067 JGI24735J21928_10003641 JGI24735J21928_100036414 105
1355 3300002075 JGI24738J21930_10001475 JGI24738J21930_100014756 105
1356 3300005327 Ga0070658_10013737 Ga0070658_100137373 105
1357 3300005336 Ga0070680_101512712 Ga0070680_1015127121 105
1358 3300005339 Ga0070660_100662344 Ga0070660_1006623442 105
1359 3300005344 Ga0070661_100303958 Ga0070661_1003039582 105
1360 3300005366 Ga0070659_100165834 Ga0070659_1001658342 105
1361 3300005455 Ga0070663_100074211 Ga0070663_1000742115 105
1362 3300005457 Ga0070662_101006609 Ga0070662_1010066091 105
1363 3300005535 Ga0070684_100919194 Ga0070684_1009191942 105
1364 3300005563 Ga0068855_100464716 Ga0068855_1004647162 105
1365 3300005564 Ga0070664_100013985 Ga0070664_1000139855 105
1366 3300005577 Ga0068857_100149759 Ga0068857_1001497592 105
1367 3300005578 Ga0068854_100405940 Ga0068854_1004059402 105
1368 3300005614 Ga0068856_100001924 Ga0068856_10000192414 105
1369 3300005616 Ga0068852_100225709 Ga0068852_1002257092 105
1370 3300005834 Ga0068851_10281205 Ga0068851_102812052 105
1371 3300009093 Ga0105240_10304110 Ga0105240_103041103 105
1372 3300009174 Ga0105241_10001866 Ga0105241_1000186616 105
1373 3300009545 Ga0105237_10757616 Ga0105237_107576162 105
1374 3300009551 Ga0105238_10718602 Ga0105238_107186022 105
1375 3300010375 Ga0105239_10120316 Ga0105239_101203162 105
1376 3300013100 Ga0157373_10027237 Ga0157373_100272372 105
1377 3300013102 Ga0157371_10347917 Ga0157371_103479172 105
1378 3300013104 Ga0157370_10017001 Ga0157370_100170018 105
1379 3300013105 Ga0157369_10765468 Ga0157369_107654682 105
1380 3300013307 Ga0157372_12129590 Ga0157372_121295902 105
1381 3300013308 Ga0157375_13287897 Ga0157375_132878972 105
1382 3300020075 Ga0206349_1277602 Ga0206349_12776022 105
1383 3300020076 Ga0206355_1403799 Ga0206355_14037992 105
1384 3300020610 Ga0154015_1108290 Ga0154015_11082902 105
1385 3300022467 Ga0224712_10002117 Ga0224712_100021176 105
1386 3300025321 Ga0207656_10012084 Ga0207656_100120845 105
1387 3300025904 Ga0207647_10027406 Ga0207647_100274065 105
1388 3300025909 Ga0207705_10348126 Ga0207705_103481261 105
1389 3300025911 Ga0207654_10534960 Ga0207654_105349602 105
1390 3300025913 Ga0207695_10056587 Ga0207695_100565875 105
1391 3300025914 Ga0207671_10332555 Ga0207671_103325552 105
1392 3300025919 Ga0207657_10051869 Ga0207657_100518695 105
1393 3300025920 Ga0207649_10239309 Ga0207649_102393092 105
1394 3300025924 Ga0207694_10006423 Ga0207694_100064236 105
1395 3300025932 Ga0207690_10019766 Ga0207690_100197663 105
1396 3300025933 Ga0207706_10008316 Ga0207706_100083167 105
1397 3300025945 Ga0207679_10371865 Ga0207679_103718652 105
1398 3300025949 Ga0207667_10309951 Ga0207667_103099513 105
1399 3300025981 Ga0207640_10002653 Ga0207640_100026535 105
1400 3300026041 Ga0207639_10000784 Ga0207639_1000078422 105
1401 3300026067 Ga0207678_10000159 Ga0207678_1000015947 105
1402 3300026078 Ga0207702_10007687 Ga0207702_100076872 105
1403 3300026116 Ga0207674_10018829 Ga0207674_100188297 105
1404 3300026142 Ga0207698_11455564 Ga0207698_114555642 105
1405 3300031548 Ga0307408_100016009 Ga0307408_1000160096 105
1406 3300031731 Ga0307405_10020264 Ga0307405_100202645 105
1407 3300031852 Ga0307410_10088334 Ga0307410_100883342 105
1408 3300031901 Ga0307406_10326285 Ga0307406_103262852 105
1409 3300031903 Ga0307407_10545266 Ga0307407_105452662 105
1410 3300031911 Ga0307412_10001095 Ga0307412_100010957 105
1411 3300031995 Ga0307409_100837912 Ga0307409_1008379122 105
1412 3300032002 Ga0307416_100824435 Ga0307416_1008244352 105
1413 3300032004 Ga0307414_10054953 Ga0307414_100549533 105
1414 3300032005 Ga0307411_10528563 Ga0307411_105285632 105
1415 3300048925 Ga0496122_0620340 Ga0496122_0620340_26_343 105
1416 3300049536 Ga0501320_033205 Ga0501320_033205_53_370 105
1417 3300059510 Ga0587090_001023 Ga0587090_001023_421_738 105

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

19

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ce4-assembly1.cif.gz_X 39s large subunit of the porcine mitochondrial ribosome 0.882 32 99
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.8398 15 100
7jil-assembly1.cif.gz_T 70s ribosome flavobacterium johnsoniae 0.8396 17 100
7pak-assembly1.cif.gz_s 70s ribosome with ef-tu-trna and p-site trna in mycoplasma pneumoniae cells 0.8325 20 100
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.8311 16 98
ID Description Score Start End Superfamily
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8194 14 99 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8134 15 100 3.30.70.330
af_G5EGK6_273_340_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8056 33 94 3.30.70.330
af_Q4D4H5_321_440_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7798 32 93 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7775 14 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1E3YSJ4-F1-model_v4 Large ribosomal subunit protein uL23 0.9892 31 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1V5X8V8-F1-model_v4 50S ribosomal protein L23 0.9808 33 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X1WP25-F1-model_v4 deleted 0.9575 31 100
AF-A0A1F5B507-F1-model_v4 50S ribosomal protein L23 0.9526 32 100 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A382FB94-F1-model_v4 50S ribosomal protein L23 0.9306 30 104 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
75.83 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map