F493799

General Info

Members Datasets Scaffolds Average Seq Length
1417 339 1417 134

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10000427|Ga0105243_100004279
Length 151
Sequence VDDAKITADWVRINRLSDNKGKILVADDDPAILRLITMILEKEGYEVVGARDGKEAYKALQDNANITAAIFDVVMPHIAGPELVRFMKTEKRFMGIPVMMMTAEQDPKLSRDSFSAGAVVFLPKPFTNAQLQTMLRMLIGKAKTENQNRER

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
195 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
196 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
223 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
228 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
229 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
230 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
265 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
266 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
267 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
268 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
269 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
270 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
271 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
278 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
279 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
280 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
281 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
282 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
283 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
284 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
285 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
286 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
287 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
288 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
289 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
290 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
291 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
292 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
293 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
294 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
295 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
296 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
297 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
298 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
299 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
300 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
301 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
302 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
303 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
304 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
305 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
306 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
307 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
308 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
311 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
312 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
313 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
314 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
315 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
316 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
317 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
318 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
319 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
320 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
321 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
322 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
323 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
324 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
325 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
326 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
327 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.93
Metatranscriptomes 0.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 2.05
Rhizosphere 96.97
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2744889 2162886007 Bacteria 1136
2 SwRhRL2b_contig_51888 2162886007 Bacteria 1136
3 CNAas_1000001 3300000532 Bacteria 18512
4 LJNas_1003656 3300000546 Bacteria 1755
5 JGI24748J21848_1000011 3300002074 Bacteria 157004
6 JGI24034J26672_10000037 3300002239 Bacteria 76023
7 JGI24751J29686_10000090 3300002459 Bacteria 50913
8 JGI25406J46586_10021885 3300003203 Bacteria 2558
9 rootH2_10200195 3300003320 Bacteria 1296
10 Ga0058862_10623831 3300004803 Bacteria 690
11 Ga0065714_10064436 3300005288 Bacteria 116206
12 Ga0065704_10003281 3300005289 Bacteria 4192
13 Ga0065704_10016047 3300005289 Bacteria 4566
14 Ga0065704_10112810 3300005289 Bacteria 1926
15 Ga0065704_10580733 3300005289 Unclassified 600
16 Ga0065712_10000112 3300005290 Bacteria 340011
17 Ga0065712_10005780 3300005290 Unclassified 2942
18 Ga0065712_10020803 3300005290 Bacteria 1969
19 Ga0065712_10112434 3300005290 Bacteria 1800
20 Ga0065712_10119130 3300005290 Bacteria 1696
21 Ga0065715_10006031 3300005293 Unclassified 4316
22 Ga0065715_10059194 3300005293 Bacteria 762
23 Ga0065715_10092721 3300005293 Bacteria 4971
24 Ga0065715_10093501 3300005293 Bacteria 4647
25 Ga0065715_10100889 3300005293 Unclassified 3250
26 Ga0065715_10100980 3300005293 Bacteria 3240
27 Ga0065715_10101130 3300005293 Bacteria 3234
28 Ga0065715_10105039 3300005293 Bacteria 2919
29 Ga0065715_10135543 3300005293 Bacteria 1937
30 Ga0065715_10205221 3300005293 Bacteria 1340
31 Ga0065715_10246604 3300005293 Bacteria 1160
32 Ga0065715_10280522 3300005293 Bacteria 1087
33 Ga0065715_10327115 3300005293 Bacteria 991
34 Ga0065715_10570565 3300005293 Unclassified 727
35 Ga0065715_10607740 3300005293 Bacteria 703
36 Ga0065715_10620417 3300005293 Unclassified 686
37 Ga0065715_10678556 3300005293 Bacteria 664
38 Ga0065715_10698760 3300005293 Unclassified 654
39 Ga0065707_10002788 3300005295 Bacteria 4262
40 Ga0065707_10012351 3300005295 Bacteria 1890
41 Ga0065707_10018438 3300005295 Bacteria 2013
42 Ga0065707_10107142 3300005295 Bacteria 2567
43 Ga0065707_10118963 3300005295 Bacteria 2172
44 Ga0065707_10140539 3300005295 Bacteria 1779
45 Ga0065707_10172124 3300005295 Bacteria 1477
46 Ga0065707_10292646 3300005295 Unclassified 1022
47 Ga0065707_10615879 3300005295 Bacteria 681
48 Ga0070676_10012828 3300005328 Bacteria 4586
49 Ga0070676_10077269 3300005328 Archaea 2012
50 Ga0070676_10756140 3300005328 Bacteria 714
51 Ga0070676_10854435 3300005328 Unclassified 675
52 Ga0070676_10900281 3300005328 Bacteria 659
53 Ga0070676_11137491 3300005328 Bacteria 591
54 Ga0070676_11588502 3300005328 Unclassified 505
55 Ga0070690_100008434 3300005330 Bacteria 5934
56 Ga0070690_100122669 3300005330 Bacteria 1746
57 Ga0070690_100151808 3300005330 Bacteria 1581
58 Ga0070690_100205527 3300005330 Bacteria 1372
59 Ga0070690_100262428 3300005330 Bacteria 1226
60 Ga0070670_100000662 3300005331 Bacteria 26796
61 Ga0070670_100026181 3300005331 Bacteria 5021
62 Ga0070670_100028553 3300005331 Bacteria 4801
63 Ga0070670_100038712 3300005331 Unclassified 4100
64 Ga0070670_100500305 3300005331 Bacteria 1081
65 Ga0070670_100629187 3300005331 Bacteria 962
66 Ga0070670_100648495 3300005331 Bacteria 947
67 Ga0070670_101511712 3300005331 Bacteria 617
68 Ga0070670_101781326 3300005331 Unclassified 567
69 Ga0070677_10132271 3300005333 Bacteria 1140
70 Ga0070677_10846944 3300005333 Unclassified 525
71 Ga0068869_100015114 3300005334 Bacteria 5169
72 Ga0068869_100023093 3300005334 Bacteria 4292
73 Ga0068869_100032721 3300005334 Bacteria 3666
74 Ga0068869_100048093 3300005334 Unclassified 3082
75 Ga0068869_100137670 3300005334 Bacteria 1882
76 Ga0068869_100145678 3300005334 Bacteria 1833
77 Ga0068869_100506032 3300005334 Bacteria 1009
78 Ga0068869_100521001 3300005334 Bacteria 995
79 Ga0068869_100857724 3300005334 Unclassified 784
80 Ga0070666_10030326 3300005335 Bacteria 3562
81 Ga0070666_10475273 3300005335 Bacteria 904
82 Ga0070680_100000184 3300005336 Bacteria 40378
83 Ga0070680_100032882 3300005336 Bacteria 4175
84 Ga0070680_100051276 3300005336 Bacteria 3366
85 Ga0070680_100328517 3300005336 Bacteria 1299
86 Ga0070682_100000056 3300005337 Bacteria 108991
87 Ga0070682_100041960 3300005337 Bacteria 2822
88 Ga0070682_100447739 3300005337 Unclassified 988
89 Ga0070682_100769253 3300005337 Bacteria 779
90 Ga0068868_100025684 3300005338 Unclassified 4484
91 Ga0068868_100184502 3300005338 Archaea 1732
92 Ga0068868_100320575 3300005338 Bacteria 1320
93 Ga0068868_100602653 3300005338 Bacteria 973
94 Ga0068868_101032229 3300005338 Bacteria 753
95 Ga0070660_100020439 3300005339 Unclassified 4865
96 Ga0070689_100036244 3300005340 Bacteria 3772
97 Ga0070689_100222576 3300005340 Bacteria 1548
98 Ga0070689_100224335 3300005340 Bacteria 1543
99 Ga0070689_100512527 3300005340 Bacteria 1029
100 Ga0070689_100548176 3300005340 Bacteria 996
101 Ga0070689_100753361 3300005340 Bacteria 854
102 Ga0070689_101071782 3300005340 Bacteria 719
103 Ga0070687_100019337 3300005343 Bacteria 3166
104 Ga0070687_100142385 3300005343 Bacteria 1398
105 Ga0070687_100352144 3300005343 Bacteria 951
106 Ga0070687_100361123 3300005343 Bacteria 940
107 Ga0070687_100365703 3300005343 Bacteria 935
108 Ga0070687_100843263 3300005343 Unclassified 653
109 Ga0070687_101007386 3300005343 Unclassified 604
110 Ga0070661_100114169 3300005344 Bacteria 2019
111 Ga0070692_10128815 3300005345 Unclassified 1420
112 Ga0070692_10176336 3300005345 Bacteria 1236
113 Ga0070692_10362598 3300005345 Bacteria 904
114 Ga0070692_10497778 3300005345 Bacteria 789
115 Ga0070692_10964808 3300005345 Unclassified 594
116 Ga0070668_100003549 3300005347 Bacteria 11506
117 Ga0070668_100484583 3300005347 Bacteria 1068
118 Ga0070668_100637706 3300005347 Archaea 935
119 Ga0070668_100834151 3300005347 Bacteria 821
120 Ga0070668_102176376 3300005347 Bacteria 512
121 Ga0070669_100011406 3300005353 Bacteria 6309
122 Ga0070669_100014917 3300005353 Bacteria 5537
123 Ga0070669_100021830 3300005353 Bacteria 4578
124 Ga0070669_100032501 3300005353 Bacteria 3768
125 Ga0070669_101436510 3300005353 Unclassified 599
126 Ga0070669_101532359 3300005353 Unclassified 580
127 Ga0070675_100018187 3300005354 Bacteria 5593
128 Ga0070675_100277940 3300005354 Bacteria 1471
129 Ga0070675_101067894 3300005354 Unclassified 742
130 Ga0070671_100045396 3300005355 Unclassified 3652
131 Ga0070671_100111521 3300005355 Bacteria 2298
132 Ga0070671_100225853 3300005355 Unclassified 1589
133 Ga0070671_100263410 3300005355 Bacteria 1465
134 Ga0070671_100365826 3300005355 Bacteria 1231
135 Ga0070674_100247880 3300005356 Archaea 1397
136 Ga0070674_100420086 3300005356 Bacteria 1097
137 Ga0070674_101146170 3300005356 Unclassified 688
138 Ga0070673_100014868 3300005364 Bacteria 5445
139 Ga0070673_100027626 3300005364 Bacteria 4208
140 Ga0070673_100046168 3300005364 Bacteria 3382
141 Ga0070673_100078332 3300005364 Bacteria 2674
142 Ga0070673_100559305 3300005364 Unclassified 1040
143 Ga0070673_100754672 3300005364 Unclassified 896
144 Ga0070673_100830063 3300005364 Bacteria 855
145 Ga0070673_100877654 3300005364 Bacteria 831
146 Ga0070673_100957073 3300005364 Bacteria 796
147 Ga0070673_101007778 3300005364 Bacteria 776
148 Ga0070673_101030139 3300005364 Bacteria 767
149 Ga0070673_101470371 3300005364 Bacteria 642
150 Ga0070673_101638718 3300005364 Bacteria 608
151 Ga0070673_101786310 3300005364 Unclassified 582
152 Ga0070688_100054074 3300005365 Bacteria 2513
153 Ga0070688_100308635 3300005365 Bacteria 1146
154 Ga0070688_100371754 3300005365 Bacteria 1052
155 Ga0070688_101009740 3300005365 Unclassified 661
156 Ga0070659_100002005 3300005366 Bacteria 14544
157 Ga0070659_100498007 3300005366 Bacteria 1038
158 Ga0070659_100548975 3300005366 Bacteria 989
159 Ga0070659_101068449 3300005366 Bacteria 710
160 Ga0070667_100949240 3300005367 Bacteria 801
161 Ga0070701_10006984 3300005438 Bacteria 4788
162 Ga0070701_10055325 3300005438 Bacteria 2072
163 Ga0070701_10129706 3300005438 Bacteria 1431
164 Ga0070701_10460039 3300005438 Bacteria 818
165 Ga0070701_10478221 3300005438 Archaea 804
166 Ga0070701_11293673 3300005438 Unclassified 521
167 Ga0070705_100025560 3300005440 Bacteria 3202
168 Ga0070705_100090127 3300005440 Bacteria 1908
169 Ga0070705_100109618 3300005440 Bacteria 1761
170 Ga0070705_100126843 3300005440 Bacteria 1658
171 Ga0070705_100151687 3300005440 Bacteria 1538
172 Ga0070705_100339429 3300005440 Archaea 1091
173 Ga0070705_101013329 3300005440 Bacteria 675
174 Ga0070700_100002821 3300005441 Bacteria 8914
175 Ga0070700_100036305 3300005441 Bacteria 2988
176 Ga0070700_100079913 3300005441 Bacteria 2108
177 Ga0070700_100116519 3300005441 Bacteria 1784
178 Ga0070700_100151251 3300005441 Bacteria 1588
179 Ga0070700_100400892 3300005441 Bacteria 1031
180 Ga0070700_100904507 3300005441 Bacteria 719
181 Ga0070694_100020337 3300005444 Bacteria 4230
182 Ga0070694_100026012 3300005444 Bacteria 3790
183 Ga0070694_100038370 3300005444 Bacteria 3183
184 Ga0070694_100130693 3300005444 Bacteria 1813
185 Ga0070694_100134018 3300005444 Unclassified 1793
186 Ga0070694_100209823 3300005444 Bacteria 1456
187 Ga0070694_100283364 3300005444 Bacteria 1264
188 Ga0070694_100296134 3300005444 Bacteria 1238
189 Ga0070694_100506611 3300005444 Bacteria 961
190 Ga0070694_100553336 3300005444 Bacteria 921
191 Ga0070694_100608117 3300005444 Bacteria 881
192 Ga0070694_100705191 3300005444 Bacteria 821
193 Ga0070694_101120718 3300005444 Bacteria 657
194 Ga0070708_100000828 3300005445 Bacteria 23303
195 Ga0070708_100036564 3300005445 Bacteria 4283
196 Ga0070708_100054011 3300005445 Bacteria 3567
197 Ga0070708_100231614 3300005445 Unclassified 1733
198 Ga0070708_100297974 3300005445 Bacteria 1518
199 Ga0070708_100524098 3300005445 Bacteria 1118
200 Ga0070708_100738224 3300005445 Unclassified 926
201 Ga0070678_100127844 3300005456 Bacteria 2014
202 Ga0070678_100983174 3300005456 Bacteria 775
203 Ga0070662_100643004 3300005457 Bacteria 894
204 Ga0070662_101341455 3300005457 Unclassified 616
205 Ga0070681_10000011 3300005458 Bacteria 139059
206 Ga0070681_10003256 3300005458 Bacteria 15142
207 Ga0070681_10018743 3300005458 Bacteria 6926
208 Ga0070681_10025179 3300005458 Bacteria 5986
209 Ga0070681_10415655 3300005458 Bacteria 1257
210 Ga0068867_100035325 3300005459 Bacteria 3625
211 Ga0068867_100052768 3300005459 Bacteria 3001
212 Ga0068867_100290573 3300005459 Bacteria 1344
213 Ga0068867_100566262 3300005459 Bacteria 986
214 Ga0068867_100656911 3300005459 Archaea 920
215 Ga0068867_100760320 3300005459 Unclassified 861
216 Ga0068867_100833789 3300005459 Unclassified 825
217 Ga0068867_102059087 3300005459 Bacteria 540
218 Ga0070685_10697508 3300005466 Bacteria 740
219 Ga0070685_11262843 3300005466 Unclassified 563
220 Ga0070706_100001332 3300005467 Bacteria 26269
221 Ga0070706_100005717 3300005467 Bacteria 11827
222 Ga0070706_100007078 3300005467 Bacteria 10560
223 Ga0070706_100015812 3300005467 Bacteria 6968
224 Ga0070706_100021294 3300005467 Bacteria 5972
225 Ga0070706_100130842 3300005467 Bacteria 2341
226 Ga0070706_100221407 3300005467 Bacteria 1766
227 Ga0070706_100310223 3300005467 Bacteria 1472
228 Ga0070706_100655835 3300005467 Bacteria 974
229 Ga0070706_100664793 3300005467 Unclassified 967
230 Ga0070707_100000659 3300005468 Bacteria 34403
231 Ga0070707_100006655 3300005468 Bacteria 10707
232 Ga0070707_100012709 3300005468 Bacteria 7861
233 Ga0070707_100024325 3300005468 Bacteria 5736
234 Ga0070707_100144722 3300005468 Bacteria 2314
235 Ga0070707_100168722 3300005468 Unclassified 2133
236 Ga0070707_100277460 3300005468 Bacteria 1629
237 Ga0070707_100529347 3300005468 Unclassified 1140
238 Ga0070707_100612841 3300005468 Bacteria 1051
239 Ga0070707_100618499 3300005468 Bacteria 1046
240 Ga0070707_100690047 3300005468 Bacteria 984
241 Ga0070707_100882092 3300005468 Bacteria 859
242 Ga0070698_100000852 3300005471 Bacteria 33433
243 Ga0070698_100002468 3300005471 Bacteria 20412
244 Ga0070698_100007161 3300005471 Bacteria 12082
245 Ga0070698_100022983 3300005471 Bacteria 6520
246 Ga0070698_100029589 3300005471 Bacteria 5687
247 Ga0070698_100060045 3300005471 Bacteria 3838
248 Ga0070698_100065360 3300005471 Bacteria 3663
249 Ga0070698_100066841 3300005471 Bacteria 3616
250 Ga0070698_100096004 3300005471 Bacteria 2941
251 Ga0070698_100531048 3300005471 Bacteria 1115
252 Ga0070698_100597535 3300005471 Bacteria 1044
253 Ga0070698_100945854 3300005471 Unclassified 808
254 Ga0070698_101283793 3300005471 Bacteria 682
255 Ga0070698_101483762 3300005471 Bacteria 629
256 Ga0070698_101825374 3300005471 Unclassified 561
257 Ga0070698_101832920 3300005471 Unclassified 559
258 Ga0070699_100001459 3300005518 Bacteria 21671
259 Ga0070699_100002725 3300005518 Bacteria 15760
260 Ga0070699_100013675 3300005518 Bacteria 6982
261 Ga0070699_100015116 3300005518 Bacteria 6632
262 Ga0070699_100054055 3300005518 Unclassified 3475
263 Ga0070699_100162697 3300005518 Bacteria 1976
264 Ga0070699_100330934 3300005518 Bacteria 1370
265 Ga0070699_100558657 3300005518 Unclassified 1042
266 Ga0070699_101128189 3300005518 Bacteria 719
267 Ga0070699_101206819 3300005518 Unclassified 694
268 Ga0070699_101514197 3300005518 Unclassified 615
269 Ga0070699_102149088 3300005518 Unclassified 510
270 Ga0070679_100000082 3300005530 Bacteria 71054
271 Ga0070679_100129079 3300005530 Bacteria 2509
272 Ga0070679_100211518 3300005530 Bacteria 1903
273 Ga0070679_101935145 3300005530 Unclassified 538
274 Ga0070684_102219897 3300005535 Unclassified 518
275 Ga0070697_100000128 3300005536 Bacteria 60251
276 Ga0070697_100008611 3300005536 Bacteria 7964
277 Ga0070697_100020469 3300005536 Bacteria 5235
278 Ga0070697_100038988 3300005536 Bacteria 3840
279 Ga0070697_100098607 3300005536 Bacteria 2425
280 Ga0070697_100114890 3300005536 Bacteria 2247
281 Ga0070697_100164915 3300005536 Bacteria 1873
282 Ga0070697_100260313 3300005536 Bacteria 1485
283 Ga0070697_100398511 3300005536 Unclassified 1194
284 Ga0070697_100521869 3300005536 Bacteria 1040
285 Ga0070697_100644166 3300005536 Bacteria 933
286 Ga0070697_100765357 3300005536 Bacteria 854
287 Ga0070697_100865596 3300005536 Unclassified 801
288 Ga0070697_101697535 3300005536 Unclassified 565
289 Ga0068853_100004734 3300005539 Bacteria 10568
290 Ga0068853_100056915 3300005539 Bacteria 3373
291 Ga0068853_100735234 3300005539 Bacteria 942
292 Ga0068853_101789253 3300005539 Unclassified 596
293 Ga0070672_100175010 3300005543 Bacteria 1786
294 Ga0070672_100310628 3300005543 Bacteria 1338
295 Ga0070672_101566607 3300005543 Bacteria 591
296 Ga0070686_100019050 3300005544 Bacteria 4038
297 Ga0070686_100086541 3300005544 Bacteria 2087
298 Ga0070686_100945745 3300005544 Unclassified 704
299 Ga0070695_100007438 3300005545 Bacteria 6496
300 Ga0070695_100137785 3300005545 Bacteria 1689
301 Ga0070695_100160136 3300005545 Bacteria 1579
302 Ga0070695_100240685 3300005545 Bacteria 1312
303 Ga0070695_100317022 3300005545 Unclassified 1158
304 Ga0070695_100338129 3300005545 Unclassified 1124
305 Ga0070695_100353240 3300005545 Bacteria 1102
306 Ga0070695_100419601 3300005545 Unclassified 1018
307 Ga0070695_100664879 3300005545 Bacteria 824
308 Ga0070695_100685467 3300005545 Unclassified 812
309 Ga0070695_100889543 3300005545 Bacteria 719
310 Ga0070695_100954410 3300005545 Unclassified 695
311 Ga0070695_100986063 3300005545 Unclassified 685
312 Ga0070695_101050509 3300005545 Bacteria 665
313 Ga0070695_101120491 3300005545 Unclassified 645
314 Ga0070695_101177223 3300005545 Bacteria 630
315 Ga0070696_100013583 3300005546 Bacteria 5466
316 Ga0070696_100014797 3300005546 Bacteria 5236
317 Ga0070696_100025109 3300005546 Bacteria 4050
318 Ga0070696_100033578 3300005546 Bacteria 3526
319 Ga0070696_100052543 3300005546 Bacteria 2835
320 Ga0070696_100105789 3300005546 Bacteria 2022
321 Ga0070696_100165295 3300005546 Unclassified 1633
322 Ga0070696_100270367 3300005546 Bacteria 1292
323 Ga0070696_100336761 3300005546 Bacteria 1165
324 Ga0070696_100337580 3300005546 Bacteria 1164
325 Ga0070696_100372716 3300005546 Bacteria 1111
326 Ga0070696_100378477 3300005546 Bacteria 1103
327 Ga0070696_100409314 3300005546 Bacteria 1063
328 Ga0070696_100576304 3300005546 Bacteria 905
329 Ga0070696_100625213 3300005546 Bacteria 870
330 Ga0070696_101048811 3300005546 Bacteria 683
331 Ga0070696_101136782 3300005546 Unclassified 658
332 Ga0070696_101263227 3300005546 Unclassified 626
333 Ga0070696_101361631 3300005546 Unclassified 604
334 Ga0070693_100031560 3300005547 Bacteria 2905
335 Ga0070693_100050747 3300005547 Bacteria 2373
336 Ga0070693_100078585 3300005547 Bacteria 1961
337 Ga0070693_100084524 3300005547 Bacteria 1900
338 Ga0070693_100137432 3300005547 Bacteria 1534
339 Ga0070693_100264915 3300005547 Bacteria 1145
340 Ga0070693_100375454 3300005547 Unclassified 979
341 Ga0070693_100429750 3300005547 Bacteria 922
342 Ga0070665_100030452 3300005548 Bacteria 5429
343 Ga0070665_100537594 3300005548 Bacteria 1181
344 Ga0070665_100767375 3300005548 Bacteria 977
345 Ga0070665_101536546 3300005548 Unclassified 674
346 Ga0070704_100000663 3300005549 Bacteria 16621
347 Ga0070704_100144967 3300005549 Bacteria 1860
348 Ga0070704_100153511 3300005549 Bacteria 1813
349 Ga0070704_100271732 3300005549 Unclassified 1401
350 Ga0070704_100314499 3300005549 Bacteria 1309
351 Ga0070704_100383377 3300005549 Bacteria 1195
352 Ga0070704_100565776 3300005549 Bacteria 995
353 Ga0068855_100211858 3300005563 Bacteria 2177
354 Ga0070664_100000648 3300005564 Bacteria 26692
355 Ga0070664_100064173 3300005564 Bacteria 3132
356 Ga0070664_100268899 3300005564 Bacteria 1535
357 Ga0070664_100410689 3300005564 Bacteria 1239
358 Ga0070664_100822479 3300005564 Bacteria 869
359 Ga0068857_100002248 3300005577 Bacteria 15713
360 Ga0068857_100063112 3300005577 Bacteria 3293
361 Ga0068857_100188075 3300005577 Bacteria 1880
362 Ga0068857_100346680 3300005577 Bacteria 1375
363 Ga0068857_100463505 3300005577 Unclassified 1186
364 Ga0068857_100534155 3300005577 Bacteria 1103
365 Ga0068857_101716540 3300005577 Bacteria 614
366 Ga0068854_100240512 3300005578 Bacteria 1441
367 Ga0068854_100624563 3300005578 Bacteria 922
368 Ga0068854_101170314 3300005578 Bacteria 688
369 Ga0068854_101953813 3300005578 Unclassified 540
370 Ga0068856_100178237 3300005614 Bacteria 2138
371 Ga0070702_100011855 3300005615 Unclassified 4348
372 Ga0070702_100045498 3300005615 Bacteria 2483
373 Ga0070702_100108056 3300005615 Bacteria 1719
374 Ga0070702_100120299 3300005615 Bacteria 1643
375 Ga0070702_100197801 3300005615 Bacteria 1328
376 Ga0070702_100343681 3300005615 Unclassified 1048
377 Ga0070702_100408060 3300005615 Bacteria 974
378 Ga0068852_100248759 3300005616 Bacteria 1702
379 Ga0068852_100284026 3300005616 Archaea 1596
380 Ga0068852_101360094 3300005616 Bacteria 732
381 Ga0068852_101663737 3300005616 Unclassified 661
382 Ga0068859_100005196 3300005617 Bacteria 13227
383 Ga0068859_100020470 3300005617 Bacteria 6639
384 Ga0068859_100066178 3300005617 Bacteria 3648
385 Ga0068859_100119246 3300005617 Bacteria 2704
386 Ga0068859_100142620 3300005617 Bacteria 2469
387 Ga0068859_100165049 3300005617 Bacteria 2294
388 Ga0068859_100178819 3300005617 Bacteria 2204
389 Ga0068859_100219312 3300005617 Unclassified 1990
390 Ga0068859_100308323 3300005617 Bacteria 1676
391 Ga0068859_100338193 3300005617 Bacteria 1599
392 Ga0068859_100544983 3300005617 Bacteria 1255
393 Ga0068859_100795984 3300005617 Unclassified 1033
394 Ga0068859_100994567 3300005617 Unclassified 921
395 Ga0068859_102306391 3300005617 Unclassified 593
396 Ga0068864_100015044 3300005618 Bacteria 6431
397 Ga0068864_100153645 3300005618 Bacteria 2087
398 Ga0068864_100327584 3300005618 Bacteria 1440
399 Ga0068864_100345804 3300005618 Unclassified 1402
400 Ga0068864_100823375 3300005618 Bacteria 913
401 Ga0068864_100970420 3300005618 Unclassified 842
402 Ga0068864_101515049 3300005618 Bacteria 674
403 Ga0068866_10005903 3300005718 Bacteria 5089
404 Ga0068866_10089465 3300005718 Bacteria 1673
405 Ga0068866_10151344 3300005718 Bacteria 1344
406 Ga0068861_100003664 3300005719 Bacteria 10247
407 Ga0068861_100008766 3300005719 Bacteria 6965
408 Ga0068861_100013305 3300005719 Bacteria 5756
409 Ga0068861_100062108 3300005719 Unclassified 2869
410 Ga0068861_100092414 3300005719 Bacteria 2390
411 Ga0068861_100157565 3300005719 Bacteria 1869
412 Ga0068861_101319383 3300005719 Unclassified 702
413 Ga0068870_10081337 3300005840 Unclassified 1791
414 Ga0068870_10137569 3300005840 Bacteria 1426
415 Ga0068870_10591810 3300005840 Unclassified 752
416 Ga0068863_100069364 3300005841 Bacteria 3333
417 Ga0068863_100159546 3300005841 Bacteria 2160
418 Ga0068863_100310209 3300005841 Bacteria 1531
419 Ga0068863_100360659 3300005841 Bacteria 1417
420 Ga0068863_100391081 3300005841 Unclassified 1359
421 Ga0068863_100800834 3300005841 Unclassified 940
422 Ga0068863_101139234 3300005841 Unclassified 785
423 Ga0068863_102595439 3300005841 Unclassified 516
424 Ga0068858_100000052 3300005842 Bacteria 119935
425 Ga0068858_100042340 3300005842 Bacteria 4222
426 Ga0068858_100048547 3300005842 Bacteria 3932
427 Ga0068858_100072309 3300005842 Bacteria 3200
428 Ga0068858_100076555 3300005842 Bacteria 3107
429 Ga0068858_100208725 3300005842 Bacteria 1848
430 Ga0068858_100233895 3300005842 Bacteria 1742
431 Ga0068858_100317169 3300005842 Bacteria 1489
432 Ga0068858_100366131 3300005842 Bacteria 1382
433 Ga0068858_100386376 3300005842 Bacteria 1343
434 Ga0068858_101051497 3300005842 Bacteria 798
435 Ga0068860_100009117 3300005843 Bacteria 9872
436 Ga0068860_100009579 3300005843 Bacteria 9625
437 Ga0068860_100031523 3300005843 Bacteria 5095
438 Ga0068860_100067810 3300005843 Bacteria 3389
439 Ga0068860_100218274 3300005843 Bacteria 1851
440 Ga0068860_100707737 3300005843 Bacteria 1017
441 Ga0068860_100791228 3300005843 Unclassified 961
442 Ga0068860_100946375 3300005843 Bacteria 878
443 Ga0068860_101131784 3300005843 Bacteria 802
444 Ga0068860_101166809 3300005843 Bacteria 790
445 Ga0068860_101562509 3300005843 Bacteria 682
446 Ga0068862_100042496 3300005844 Bacteria 3872
447 Ga0068862_100186358 3300005844 Bacteria 1865
448 Ga0068862_100320895 3300005844 Bacteria 1430
449 Ga0068862_100512311 3300005844 Bacteria 1140
450 Ga0068862_101015444 3300005844 Bacteria 821
451 Ga0068862_101310509 3300005844 Unclassified 726
452 Ga0068862_101548399 3300005844 Unclassified 669
453 Ga0081540_1076379 3300005983 Unclassified 1526
454 Ga0081539_10000491 3300005985 Bacteria 83392
455 Ga0081539_10000886 3300005985 Bacteria 57243
456 Ga0081539_10034360 3300005985 Bacteria 3068
457 Ga0081539_10133700 3300005985 Bacteria 1215
458 Ga0081539_10178574 3300005985 Bacteria 998
459 Ga0075432_10135010 3300006058 Bacteria 937
460 Ga0070715_10000032 3300006163 Bacteria 83594
461 Ga0070716_100000014 3300006173 Bacteria 92762
462 Ga0070716_100072797 3300006173 Bacteria 2025
463 Ga0070716_100235408 3300006173 Bacteria 1239
464 Ga0070716_100811684 3300006173 Unclassified 725
465 Ga0097621_100011948 3300006237 Bacteria 6422
466 Ga0097621_100028445 3300006237 Bacteria 4405
467 Ga0097621_101014405 3300006237 Bacteria 777
468 Ga0097621_101402010 3300006237 Unclassified 661
469 Ga0097621_101887084 3300006237 Bacteria 570
470 Ga0068871_100011823 3300006358 Bacteria 6417
471 Ga0068871_100014630 3300006358 Bacteria 5853
472 Ga0068871_100067396 3300006358 Bacteria 2936
473 Ga0068871_100122006 3300006358 Bacteria 2202
474 Ga0068871_100138451 3300006358 Bacteria 2068
475 Ga0068871_100801960 3300006358 Unclassified 868
476 Ga0075428_100394983 3300006844 Bacteria 1482
477 Ga0075428_100450624 3300006844 Bacteria 1378
478 Ga0075428_100507214 3300006844 Bacteria 1290
479 Ga0075428_101228268 3300006844 Unclassified 790
480 Ga0075430_100219373 3300006846 Bacteria 1578
481 Ga0075430_100256229 3300006846 Bacteria 1449
482 Ga0075431_100187660 3300006847 Bacteria 2119
483 Ga0075431_100764518 3300006847 Bacteria 941
484 Ga0075431_100969092 3300006847 Bacteria 818
485 Ga0075433_10035324 3300006852 Bacteria 4297
486 Ga0075433_10040116 3300006852 Unclassified 4051
487 Ga0075433_10065981 3300006852 Bacteria 3175
488 Ga0075433_10066566 3300006852 Unclassified 3161
489 Ga0075433_10071600 3300006852 Bacteria 3047
490 Ga0075433_10083996 3300006852 Bacteria 2810
491 Ga0075433_10157685 3300006852 Bacteria 2019
492 Ga0075433_10178573 3300006852 Bacteria 1889
493 Ga0075433_10182930 3300006852 Bacteria 1865
494 Ga0075433_10234673 3300006852 Bacteria 1628
495 Ga0075433_10286377 3300006852 Unclassified 1459
496 Ga0075433_10637176 3300006852 Bacteria 935
497 Ga0075433_10808316 3300006852 Bacteria 819
498 Ga0075434_100034703 3300006871 Unclassified 4983
499 Ga0075434_100254888 3300006871 Bacteria 1773
500 Ga0075434_100257785 3300006871 Bacteria 1763
501 Ga0075434_100275926 3300006871 Unclassified 1700
502 Ga0075434_100362261 3300006871 Bacteria 1471
503 Ga0075434_100769310 3300006871 Bacteria 979
504 Ga0075434_101318205 3300006871 Unclassified 733
505 Ga0075434_101330975 3300006871 Unclassified 729
506 Ga0075429_100073304 3300006880 Unclassified 2982
507 Ga0075429_100209058 3300006880 Unclassified 1710
508 Ga0075429_100262033 3300006880 Bacteria 1513
509 Ga0075429_100858448 3300006880 Bacteria 795
510 Ga0075429_100881622 3300006880 Bacteria 783
511 Ga0068865_100119051 3300006881 Bacteria 1960
512 Ga0068865_100315920 3300006881 Bacteria 1255
513 Ga0068865_100389982 3300006881 Bacteria 1138
514 Ga0068865_100664349 3300006881 Bacteria 887
515 Ga0068865_100741643 3300006881 Unclassified 843
516 Ga0068865_101157090 3300006881 Unclassified 683
517 Ga0068865_101294518 3300006881 Unclassified 648
518 Ga0075436_100000052 3300006914 Bacteria 70308
519 Ga0097620_100005196 3300006931 Bacteria 13227
520 Ga0097620_100020470 3300006931 Bacteria 6639
521 Ga0097620_100066182 3300006931 Bacteria 3648
522 Ga0097620_100119259 3300006931 Bacteria 2704
523 Ga0097620_100142618 3300006931 Bacteria 2469
524 Ga0097620_100165041 3300006931 Bacteria 2294
525 Ga0097620_100178810 3300006931 Bacteria 2204
526 Ga0097620_100219319 3300006931 Unclassified 1990
527 Ga0097620_100308332 3300006931 Bacteria 1676
528 Ga0097620_100338170 3300006931 Bacteria 1599
529 Ga0097620_100544900 3300006931 Bacteria 1255
530 Ga0097620_100796125 3300006931 Unclassified 1033
531 Ga0097620_100994722 3300006931 Unclassified 921
532 Ga0097620_102306344 3300006931 Unclassified 593
533 Ga0075435_100000691 3300007076 Bacteria 20946
534 Ga0075435_100034223 3300007076 Bacteria 4024
535 Ga0075435_100516862 3300007076 Bacteria 1033
536 Ga0075435_100627706 3300007076 Bacteria 932
537 Ga0099794_10007230 3300007265 Bacteria 4547
538 Ga0099795_10169746 3300007788 Unclassified 906
539 Ga0105251_10057779 3300009011 Bacteria 1833
540 Ga0105251_10441401 3300009011 Unclassified 602
541 Ga0105250_10039522 3300009092 Bacteria 1892
542 Ga0105240_10077602 3300009093 Bacteria 4092
543 Ga0105240_10077833 3300009093 Bacteria 4085
544 Ga0105240_10862437 3300009093 Bacteria 976
545 Ga0111539_10013513 3300009094 Bacteria 10204
546 Ga0111539_10409054 3300009094 Bacteria 1580
547 Ga0111539_12474092 3300009094 Bacteria 602
548 Ga0105245_10054989 3300009098 Unclassified 3575
549 Ga0105245_10078701 3300009098 Bacteria 3009
550 Ga0105245_10197286 3300009098 Bacteria 1931
551 Ga0105245_10510575 3300009098 Bacteria 1219
552 Ga0105245_10575529 3300009098 Bacteria 1150
553 Ga0105245_10609330 3300009098 Unclassified 1119
554 Ga0105245_10737743 3300009098 Bacteria 1020
555 Ga0105245_11337155 3300009098 Bacteria 766
556 Ga0105245_11519437 3300009098 Unclassified 721
557 Ga0105245_11539957 3300009098 Bacteria 716
558 Ga0105245_11701532 3300009098 Unclassified 683
559 Ga0105245_11753660 3300009098 Bacteria 673
560 Ga0105247_10000003 3300009101 Bacteria 694517
561 Ga0105247_10001595 3300009101 Bacteria 16052
562 Ga0105247_10098872 3300009101 Bacteria 1863
563 Ga0105247_10128607 3300009101 Bacteria 1649
564 Ga0105247_10376178 3300009101 Bacteria 1006
565 Ga0114129_10003205 3300009147 Bacteria 22958
566 Ga0114129_10015304 3300009147 Bacteria 10916
567 Ga0114129_10016688 3300009147 Bacteria 10457
568 Ga0114129_10038541 3300009147 Bacteria 6740
569 Ga0114129_10166228 3300009147 Bacteria 3010
570 Ga0114129_10244831 3300009147 Bacteria 2409
571 Ga0114129_10360627 3300009147 Bacteria 1923
572 Ga0114129_10448119 3300009147 Bacteria 1693
573 Ga0114129_10546221 3300009147 Bacteria 1507
574 Ga0114129_10574696 3300009147 Bacteria 1463
575 Ga0114129_11105174 3300009147 Bacteria 992
576 Ga0114129_11144593 3300009147 Bacteria 972
577 Ga0114129_11558126 3300009147 Unclassified 810
578 Ga0114129_11565728 3300009147 Bacteria 808
579 Ga0114129_12390483 3300009147 Unclassified 633
580 Ga0105243_10000427 3300009148 Bacteria 44095
581 Ga0105243_10024532 3300009148 Bacteria 4600
582 Ga0105243_10028525 3300009148 Bacteria 4285
583 Ga0105243_10053572 3300009148 Bacteria 3201
584 Ga0105243_10061491 3300009148 Bacteria 3004
585 Ga0105243_10128825 3300009148 Bacteria 2144
586 Ga0105243_10157483 3300009148 Bacteria 1955
587 Ga0105243_10202676 3300009148 Bacteria 1741
588 Ga0105243_10390086 3300009148 Unclassified 1290
589 Ga0105243_10416318 3300009148 Bacteria 1252
590 Ga0105243_10496831 3300009148 Bacteria 1155
591 Ga0105243_10587014 3300009148 Bacteria 1070
592 Ga0105243_10592556 3300009148 Bacteria 1066
593 Ga0105243_10752995 3300009148 Bacteria 955
594 Ga0105243_12008994 3300009148 Bacteria 613
595 Ga0105243_12305440 3300009148 Unclassified 576
596 Ga0105241_10016397 3300009174 Bacteria 5433
597 Ga0105241_10049240 3300009174 Bacteria 3208
598 Ga0105241_10063119 3300009174 Bacteria 2857
599 Ga0105241_10113615 3300009174 Bacteria 2171
600 Ga0105241_10276228 3300009174 Bacteria 1433
601 Ga0105241_10301084 3300009174 Bacteria 1376
602 Ga0105241_10624990 3300009174 Bacteria 975
603 Ga0105241_10644921 3300009174 Bacteria 961
604 Ga0105241_10697845 3300009174 Bacteria 926
605 Ga0105241_10792837 3300009174 Bacteria 872
606 Ga0105241_10810754 3300009174 Bacteria 863
607 Ga0105241_12553672 3300009174 Unclassified 512
608 Ga0105242_10000055 3300009176 Bacteria 76298
609 Ga0105242_10001400 3300009176 Bacteria 18973
610 Ga0105242_10002872 3300009176 Bacteria 13493
611 Ga0105242_10053809 3300009176 Bacteria 3288
612 Ga0105242_10136022 3300009176 Bacteria 2127
613 Ga0105242_10467778 3300009176 Bacteria 1192
614 Ga0105242_10671319 3300009176 Bacteria 1010
615 Ga0105242_10929747 3300009176 Bacteria 872
616 Ga0105242_10947289 3300009176 Unclassified 865
617 Ga0105242_10998989 3300009176 Bacteria 844
618 Ga0105242_11903883 3300009176 Bacteria 635
619 Ga0105242_12175760 3300009176 Bacteria 599
620 Ga0105248_10005046 3300009177 Bacteria 14576
621 Ga0105248_10057855 3300009177 Bacteria 4352
622 Ga0105248_10064802 3300009177 Bacteria 4102
623 Ga0105248_10078295 3300009177 Bacteria 3716
624 Ga0105248_10130364 3300009177 Bacteria 2837
625 Ga0105248_10213824 3300009177 Bacteria 2172
626 Ga0105248_10236368 3300009177 Bacteria 2057
627 Ga0105248_10356722 3300009177 Bacteria 1646
628 Ga0105248_10405593 3300009177 Bacteria 1535
629 Ga0105248_10416402 3300009177 Bacteria 1513
630 Ga0105248_10474267 3300009177 Unclassified 1410
631 Ga0105248_10539287 3300009177 Bacteria 1316
632 Ga0105248_10544930 3300009177 Bacteria 1309
633 Ga0105248_10676164 3300009177 Bacteria 1165
634 Ga0105248_11214043 3300009177 Bacteria 853
635 Ga0105248_12576999 3300009177 Unclassified 580
636 Ga0105237_10031999 3300009545 Bacteria 5327
637 Ga0105237_10041337 3300009545 Bacteria 4650
638 Ga0105237_10174084 3300009545 Bacteria 2152
639 Ga0105237_10384581 3300009545 Bacteria 1408
640 Ga0105237_10520558 3300009545 Bacteria 1196
641 Ga0105238_10186989 3300009551 Bacteria 2048
642 Ga0105238_10196168 3300009551 Bacteria 1995
643 Ga0105238_10654257 3300009551 Archaea 1061
644 Ga0105238_11516798 3300009551 Unclassified 699
645 Ga0105249_10000118 3300009553 Bacteria 107887
646 Ga0105249_10033970 3300009553 Bacteria 4619
647 Ga0105249_10082892 3300009553 Unclassified 2984
648 Ga0105249_10088973 3300009553 Bacteria 2885
649 Ga0105249_10256746 3300009553 Bacteria 1735
650 Ga0105249_10299096 3300009553 Bacteria 1613
651 Ga0105249_10330601 3300009553 Unclassified 1538
652 Ga0105249_10585876 3300009553 Bacteria 1169
653 Ga0105249_10609932 3300009553 Archaea 1147
654 Ga0105249_11152484 3300009553 Bacteria 846
655 Ga0105249_11537789 3300009553 Unclassified 738
656 Ga0105249_13065372 3300009553 Unclassified 537
657 Ga0105249_13223273 3300009553 Unclassified 525
658 Ga0099796_10282158 3300010159 Bacteria 699
659 Ga0105239_10026669 3300010375 Bacteria 6359
660 Ga0105239_10117981 3300010375 Bacteria 2945
661 Ga0105239_10139187 3300010375 Bacteria 2704
662 Ga0105239_11083104 3300010375 Bacteria 922
663 Ga0105239_11432919 3300010375 Unclassified 798
664 Ga0105239_11490507 3300010375 Bacteria 782
665 Ga0105239_11613306 3300010375 Bacteria 750
666 Ga0105246_10111539 3300011119 Bacteria 2010
667 Ga0105246_10116298 3300011119 Archaea 1974
668 Ga0105246_10282236 3300011119 Bacteria 1333
669 Ga0105246_10448294 3300011119 Bacteria 1084
670 Ga0105246_10479748 3300011119 Bacteria 1052
671 Ga0105246_10496056 3300011119 Unclassified 1036
672 Ga0105246_10592702 3300011119 Bacteria 956
673 Ga0105246_10621262 3300011119 Unclassified 936
674 Ga0105246_10661845 3300011119 Bacteria 910
675 Ga0105246_11441763 3300011119 Bacteria 644
676 Ga0105246_12499301 3300011119 Unclassified 508
677 Ga0157373_10094007 3300013100 Bacteria 2111
678 Ga0157373_10096261 3300013100 Bacteria 2084
679 Ga0157373_10160957 3300013100 Bacteria 1579
680 Ga0157373_10292036 3300013100 Bacteria 1156
681 Ga0157373_10427780 3300013100 Bacteria 951
682 Ga0157373_10451053 3300013100 Bacteria 925
683 Ga0157373_10461869 3300013100 Bacteria 914
684 Ga0157371_10808081 3300013102 Unclassified 707
685 Ga0157371_10889914 3300013102 Unclassified 675
686 Ga0157371_11359422 3300013102 Unclassified 551
687 Ga0157374_10018663 3300013296 Bacteria 6125
688 Ga0157374_10032094 3300013296 Bacteria 4780
689 Ga0157374_10567230 3300013296 Bacteria 1144
690 Ga0157374_10754075 3300013296 Unclassified 988
691 Ga0157374_12206128 3300013296 Unclassified 578
692 Ga0157374_12578649 3300013296 Unclassified 536
693 Ga0157378_10000306 3300013297 Bacteria 47715
694 Ga0157378_10021111 3300013297 Bacteria 5728
695 Ga0157378_10021650 3300013297 Bacteria 5653
696 Ga0157378_10032668 3300013297 Bacteria 4598
697 Ga0157378_10051740 3300013297 Bacteria 3654
698 Ga0157378_10055592 3300013297 Bacteria 3526
699 Ga0157378_10060314 3300013297 Bacteria 3385
700 Ga0157378_10089077 3300013297 Bacteria 2802
701 Ga0157378_10385772 3300013297 Bacteria 1377
702 Ga0157378_10421544 3300013297 Bacteria 1319
703 Ga0157378_10436336 3300013297 Bacteria 1297
704 Ga0157378_10477599 3300013297 Bacteria 1241
705 Ga0157378_10518998 3300013297 Bacteria 1192
706 Ga0157378_10835213 3300013297 Bacteria 949
707 Ga0157378_10922494 3300013297 Bacteria 905
708 Ga0157378_11054280 3300013297 Bacteria 849
709 Ga0157378_11469214 3300013297 Unclassified 726
710 Ga0157378_11654225 3300013297 Unclassified 687
711 Ga0157378_11883608 3300013297 Bacteria 647
712 Ga0157378_12131244 3300013297 Unclassified 611
713 Ga0163162_10000059 3300013306 Bacteria 107864
714 Ga0163162_10002421 3300013306 Bacteria 17570
715 Ga0163162_10025299 3300013306 Bacteria 5865
716 Ga0163162_10045933 3300013306 Bacteria 4377
717 Ga0163162_10050219 3300013306 Unclassified 4183
718 Ga0163162_10104199 3300013306 Bacteria 2931
719 Ga0163162_10176579 3300013306 Unclassified 2261
720 Ga0163162_10210776 3300013306 Unclassified 2073
721 Ga0163162_10294551 3300013306 Bacteria 1754
722 Ga0163162_10392645 3300013306 Bacteria 1520
723 Ga0163162_10475405 3300013306 Bacteria 1381
724 Ga0163162_10492330 3300013306 Bacteria 1357
725 Ga0163162_10720123 3300013306 Bacteria 1118
726 Ga0163162_10761098 3300013306 Bacteria 1087
727 Ga0163162_10838813 3300013306 Archaea 1035
728 Ga0163162_11207487 3300013306 Unclassified 858
729 Ga0163162_11645210 3300013306 Bacteria 733
730 Ga0163162_12180583 3300013306 Unclassified 636
731 Ga0157372_10022642 3300013307 Bacteria 6801
732 Ga0157372_10070402 3300013307 Bacteria 3935
733 Ga0157372_11191646 3300013307 Unclassified 880
734 Ga0157372_11799194 3300013307 Bacteria 704
735 Ga0157372_12120185 3300013307 Bacteria 646
736 Ga0157372_12149970 3300013307 Bacteria 641
737 Ga0157375_10008693 3300013308 Bacteria 8901
738 Ga0157375_10038260 3300013308 Bacteria 4605
739 Ga0157375_10159458 3300013308 Bacteria 2397
740 Ga0157375_10159543 3300013308 Bacteria 2397
741 Ga0157375_10212627 3300013308 Bacteria 2092
742 Ga0157375_10551849 3300013308 Bacteria 1314
743 Ga0157375_10891053 3300013308 Bacteria 1034
744 Ga0157375_10923909 3300013308 Unclassified 1016
745 Ga0157375_10995843 3300013308 Bacteria 978
746 Ga0157375_11095886 3300013308 Bacteria 932
747 Ga0157375_11193622 3300013308 Bacteria 892
748 Ga0157375_11208898 3300013308 Bacteria 887
749 Ga0157375_11400537 3300013308 Unclassified 824
750 Ga0157375_11636013 3300013308 Bacteria 762
751 Ga0157375_11721584 3300013308 Bacteria 742
752 Ga0157375_11875784 3300013308 Bacteria 711
753 Ga0157375_12833808 3300013308 Unclassified 580
754 Ga0157375_13721024 3300013308 Unclassified 507
755 Ga0163163_10012071 3300014325 Bacteria 7859
756 Ga0163163_10016408 3300014325 Bacteria 6882
757 Ga0163163_10049466 3300014325 Bacteria 4138
758 Ga0163163_10063488 3300014325 Bacteria 3662
759 Ga0163163_10088196 3300014325 Bacteria 3114
760 Ga0163163_10093223 3300014325 Unclassified 3028
761 Ga0163163_10097484 3300014325 Bacteria 2960
762 Ga0163163_10112598 3300014325 Bacteria 2751
763 Ga0163163_10131741 3300014325 Bacteria 2540
764 Ga0163163_10160546 3300014325 Bacteria 2293
765 Ga0163163_10282154 3300014325 Bacteria 1712
766 Ga0163163_10531421 3300014325 Bacteria 1238
767 Ga0163163_10993938 3300014325 Bacteria 902
768 Ga0163163_11390546 3300014325 Unclassified 763
769 Ga0163163_11756487 3300014325 Bacteria 681
770 Ga0163163_11939884 3300014325 Unclassified 649
771 Ga0163163_11966031 3300014325 Unclassified 645
772 Ga0163163_13078711 3300014325 Unclassified 520
773 Ga0157380_10001946 3300014326 Bacteria 13736
774 Ga0157380_10014118 3300014326 Bacteria 5839
775 Ga0157380_10029138 3300014326 Bacteria 4218
776 Ga0157380_10039874 3300014326 Bacteria 3655
777 Ga0157380_10041864 3300014326 Bacteria 3577
778 Ga0157380_10094411 3300014326 Bacteria 2476
779 Ga0157380_10277276 3300014326 Bacteria 1532
780 Ga0157380_10551180 3300014326 Bacteria 1131
781 Ga0157380_10594386 3300014326 Unclassified 1094
782 Ga0157380_11163320 3300014326 Bacteria 813
783 Ga0157380_12281924 3300014326 Unclassified 606
784 Ga0157380_12451253 3300014326 Bacteria 587
785 Ga0157377_10043347 3300014745 Bacteria 2504
786 Ga0157377_10167013 3300014745 Bacteria 1373
787 Ga0157377_10253457 3300014745 Bacteria 1142
788 Ga0157379_10091692 3300014968 Bacteria 2726
789 Ga0157379_10298293 3300014968 Bacteria 1468
790 Ga0157379_10305717 3300014968 Bacteria 1450
791 Ga0157379_10554224 3300014968 Bacteria 1070
792 Ga0157379_11362440 3300014968 Bacteria 687
793 Ga0157376_10052025 3300014969 Bacteria 3404
794 Ga0157376_10105617 3300014969 Bacteria 2470
795 Ga0157376_10588165 3300014969 Bacteria 1106
796 Ga0157376_11451885 3300014969 Unclassified 718
797 Ga0182007_10080576 3300015262 Bacteria 1068
798 Ga0182005_1143147 3300015265 Bacteria 692
799 Ga0163161_10135784 3300017792 Bacteria 1859
800 Ga0163161_10274740 3300017792 Archaea 1320
801 Ga0163161_10913039 3300017792 Unclassified 745
802 Ga0163161_11175232 3300017792 Bacteria 662
803 Ga0163161_11494714 3300017792 Unclassified 593
804 Ga0213876_10000097 3300021384 Bacteria 99326
805 Ga0213876_10000494 3300021384 Bacteria 30841
806 Ga0207697_10028512 3300025315 Bacteria 2283
807 Ga0207697_10296384 3300025315 Unclassified 717
808 Ga0207713_1138227 3300025735 Bacteria 798
809 Ga0207653_10070812 3300025885 Bacteria 1191
810 Ga0207653_10228892 3300025885 Unclassified 708
811 Ga0207642_10025163 3300025899 Bacteria 2403
812 Ga0207642_10059546 3300025899 Bacteria 1767
813 Ga0207642_10109693 3300025899 Bacteria 1403
814 Ga0207710_10000001 3300025900 Bacteria 1797433
815 Ga0207710_10015408 3300025900 Bacteria 3230
816 Ga0207710_10037926 3300025900 Bacteria 2130
817 Ga0207710_10358883 3300025900 Unclassified 743
818 Ga0207688_10038831 3300025901 Unclassified 2643
819 Ga0207688_10345069 3300025901 Bacteria 916
820 Ga0207688_10347020 3300025901 Bacteria 914
821 Ga0207688_10938516 3300025901 Unclassified 548
822 Ga0207680_10153438 3300025903 Archaea 1537
823 Ga0207647_10008993 3300025904 Bacteria 7116
824 Ga0207647_10468101 3300025904 Bacteria 705
825 Ga0207685_10000016 3300025905 Bacteria 151990
826 Ga0207645_10127522 3300025907 Archaea 1655
827 Ga0207645_10274022 3300025907 Bacteria 1119
828 Ga0207643_10069259 3300025908 Bacteria 2028
829 Ga0207643_10072857 3300025908 Bacteria 1979
830 Ga0207643_10573152 3300025908 Unclassified 725
831 Ga0207684_10001397 3300025910 Bacteria 26248
832 Ga0207684_10002329 3300025910 Bacteria 19247
833 Ga0207684_10015598 3300025910 Bacteria 6539
834 Ga0207684_10018767 3300025910 Bacteria 5917
835 Ga0207684_10052480 3300025910 Bacteria 3460
836 Ga0207684_10086273 3300025910 Bacteria 2673
837 Ga0207684_10097755 3300025910 Bacteria 2507
838 Ga0207684_10157660 3300025910 Unclassified 1954
839 Ga0207654_10067245 3300025911 Bacteria 2116
840 Ga0207654_10303155 3300025911 Unclassified 1087
841 Ga0207654_10449620 3300025911 Bacteria 903
842 Ga0207654_10805948 3300025911 Bacteria 678
843 Ga0207654_11012913 3300025911 Unclassified 604
844 Ga0207707_10000004 3300025912 Bacteria 391281
845 Ga0207707_10003977 3300025912 Bacteria 13121
846 Ga0207707_10119473 3300025912 Bacteria 2304
847 Ga0207707_10612807 3300025912 Bacteria 920
848 Ga0207707_10816122 3300025912 Bacteria 776
849 Ga0207695_10082222 3300025913 Bacteria 3257
850 Ga0207695_10863482 3300025913 Bacteria 785
851 Ga0207671_10095869 3300025914 Bacteria 2241
852 Ga0207671_10726562 3300025914 Unclassified 789
853 Ga0207660_10044686 3300025917 Bacteria 3117
854 Ga0207660_10045568 3300025917 Bacteria 3090
855 Ga0207660_10366089 3300025917 Bacteria 1157
856 Ga0207660_10742675 3300025917 Bacteria 801
857 Ga0207662_10024469 3300025918 Bacteria 3474
858 Ga0207662_10093430 3300025918 Bacteria 1853
859 Ga0207662_10117654 3300025918 Bacteria 1663
860 Ga0207662_10198364 3300025918 Bacteria 1298
861 Ga0207662_10277928 3300025918 Bacteria 1107
862 Ga0207662_10416908 3300025918 Unclassified 913
863 Ga0207657_10041828 3300025919 Bacteria 4048
864 Ga0207657_10695695 3300025919 Unclassified 790
865 Ga0207649_11265315 3300025920 Unclassified 583
866 Ga0207652_10000104 3300025921 Bacteria 91783
867 Ga0207652_10055486 3300025921 Bacteria 3408
868 Ga0207652_10377793 3300025921 Bacteria 1279
869 Ga0207646_10000702 3300025922 Bacteria 43444
870 Ga0207646_10016167 3300025922 Bacteria 7012
871 Ga0207646_10021026 3300025922 Bacteria 6036
872 Ga0207646_10059323 3300025922 Bacteria 3417
873 Ga0207646_10180303 3300025922 Unclassified 1908
874 Ga0207646_10342432 3300025922 Bacteria 1351
875 Ga0207646_10433373 3300025922 Bacteria 1186
876 Ga0207646_10625742 3300025922 Bacteria 965
877 Ga0207646_11026260 3300025922 Bacteria 728
878 Ga0207646_11857496 3300025922 Unclassified 514
879 Ga0207681_10000496 3300025923 Bacteria 27567
880 Ga0207681_10126558 3300025923 Unclassified 1882
881 Ga0207681_10258435 3300025923 Unclassified 1362
882 Ga0207681_11053857 3300025923 Unclassified 683
883 Ga0207694_10018358 3300025924 Bacteria 5287
884 Ga0207694_10126503 3300025924 Bacteria 2045
885 Ga0207650_10000001 3300025925 Bacteria 1545726
886 Ga0207650_10000611 3300025925 Bacteria 28528
887 Ga0207650_10242232 3300025925 Bacteria 1458
888 Ga0207650_10270187 3300025925 Bacteria 1382
889 Ga0207650_10677453 3300025925 Bacteria 870
890 Ga0207650_10804441 3300025925 Unclassified 797
891 Ga0207650_11044371 3300025925 Bacteria 695
892 Ga0207659_10066051 3300025926 Bacteria 2624
893 Ga0207659_10690846 3300025926 Archaea 873
894 Ga0207687_10341861 3300025927 Unclassified 1217
895 Ga0207687_10642857 3300025927 Bacteria 897
896 Ga0207687_11270486 3300025927 Unclassified 633
897 Ga0207644_10003161 3300025931 Bacteria 10592
898 Ga0207644_10032300 3300025931 Unclassified 3651
899 Ga0207644_10106674 3300025931 Bacteria 2112
900 Ga0207644_10118517 3300025931 Bacteria 2012
901 Ga0207644_10162468 3300025931 Unclassified 1737
902 Ga0207690_10032570 3300025932 Unclassified 3345
903 Ga0207690_10303517 3300025932 Bacteria 1250
904 Ga0207690_10319504 3300025932 Bacteria 1220
905 Ga0207690_10987117 3300025932 Bacteria 700
906 Ga0207690_10996144 3300025932 Bacteria 697
907 Ga0207706_10124508 3300025933 Bacteria 2268
908 Ga0207706_10136562 3300025933 Bacteria 2157
909 Ga0207686_10000038 3300025934 Bacteria 127610
910 Ga0207686_10000523 3300025934 Bacteria 24894
911 Ga0207686_10007695 3300025934 Bacteria 5809
912 Ga0207686_10041081 3300025934 Bacteria 2817
913 Ga0207686_10186426 3300025934 Archaea 1475
914 Ga0207686_10203974 3300025934 Bacteria 1418
915 Ga0207686_10239299 3300025934 Bacteria 1320
916 Ga0207686_10474895 3300025934 Bacteria 966
917 Ga0207686_10621148 3300025934 Unclassified 852
918 Ga0207686_10933088 3300025934 Bacteria 702
919 Ga0207709_10000017 3300025935 Bacteria 470753
920 Ga0207709_10000054 3300025935 Bacteria 223290
921 Ga0207709_10026650 3300025935 Bacteria 3322
922 Ga0207709_10068276 3300025935 Bacteria 2246
923 Ga0207709_10195146 3300025935 Bacteria 1441
924 Ga0207709_10289735 3300025935 Bacteria 1213
925 Ga0207709_10452319 3300025935 Bacteria 993
926 Ga0207709_10701832 3300025935 Bacteria 810
927 Ga0207709_10930856 3300025935 Unclassified 707
928 Ga0207670_10000667 3300025936 Bacteria 18147
929 Ga0207670_10722628 3300025936 Bacteria 826
930 Ga0207670_10750703 3300025936 Bacteria 810
931 Ga0207670_10988764 3300025936 Unclassified 707
932 Ga0207669_10092160 3300025937 Archaea 1976
933 Ga0207704_10015890 3300025938 Bacteria 3851
934 Ga0207704_10350728 3300025938 Bacteria 1149
935 Ga0207704_10842176 3300025938 Unclassified 768
936 Ga0207665_10000029 3300025939 Bacteria 95174
937 Ga0207665_10056725 3300025939 Bacteria 2644
938 Ga0207665_10375075 3300025939 Bacteria 1079
939 Ga0207691_10000304 3300025940 Bacteria 48837
940 Ga0207691_10085102 3300025940 Bacteria 2838
941 Ga0207691_10894244 3300025940 Bacteria 744
942 Ga0207711_10004568 3300025941 Bacteria 11773
943 Ga0207711_10030924 3300025941 Bacteria 4516
944 Ga0207711_10099985 3300025941 Bacteria 2565
945 Ga0207711_10133311 3300025941 Bacteria 2229
946 Ga0207711_10143494 3300025941 Bacteria 2150
947 Ga0207711_10152792 3300025941 Bacteria 2084
948 Ga0207711_10273910 3300025941 Bacteria 1553
949 Ga0207711_10379958 3300025941 Bacteria 1311
950 Ga0207711_10399156 3300025941 Bacteria 1277
951 Ga0207711_10537366 3300025941 Bacteria 1090
952 Ga0207689_10007846 3300025942 Bacteria 9329
953 Ga0207689_10020293 3300025942 Bacteria 5596
954 Ga0207689_10072731 3300025942 Bacteria 2824
955 Ga0207689_10117901 3300025942 Bacteria 2183
956 Ga0207689_10137238 3300025942 Bacteria 2014
957 Ga0207689_10270406 3300025942 Bacteria 1407
958 Ga0207689_10431396 3300025942 Bacteria 1100
959 Ga0207689_10432187 3300025942 Bacteria 1099
960 Ga0207689_10829293 3300025942 Bacteria 780
961 Ga0207679_10016866 3300025945 Unclassified 4856
962 Ga0207679_10043677 3300025945 Bacteria 3229
963 Ga0207679_10222531 3300025945 Bacteria 1589
964 Ga0207679_10402209 3300025945 Unclassified 1205
965 Ga0207679_10973098 3300025945 Bacteria 777
966 Ga0207679_11435429 3300025945 Unclassified 633
967 Ga0207667_10159212 3300025949 Bacteria 2323
968 Ga0207667_10234185 3300025949 Bacteria 1880
969 Ga0207651_10021628 3300025960 Bacteria 3913
970 Ga0207651_10102258 3300025960 Bacteria 2130
971 Ga0207651_10143146 3300025960 Bacteria 1850
972 Ga0207651_10144685 3300025960 Bacteria 1841
973 Ga0207651_10180943 3300025960 Archaea 1672
974 Ga0207651_10382875 3300025960 Bacteria 1192
975 Ga0207651_10425380 3300025960 Bacteria 1135
976 Ga0207651_10439586 3300025960 Unclassified 1117
977 Ga0207651_10577771 3300025960 Unclassified 980
978 Ga0207651_10911857 3300025960 Bacteria 783
979 Ga0207651_11280320 3300025960 Bacteria 659
980 Ga0207712_10000106 3300025961 Bacteria 94950
981 Ga0207712_10011969 3300025961 Bacteria 5535
982 Ga0207712_10038084 3300025961 Bacteria 3286
983 Ga0207712_10089148 3300025961 Bacteria 2267
984 Ga0207712_10149286 3300025961 Bacteria 1804
985 Ga0207712_10196115 3300025961 Unclassified 1597
986 Ga0207712_10444311 3300025961 Bacteria 1098
987 Ga0207712_10712932 3300025961 Bacteria 876
988 Ga0207668_10017983 3300025972 Bacteria 4439
989 Ga0207668_10912587 3300025972 Bacteria 782
990 Ga0207668_10992925 3300025972 Unclassified 750
991 Ga0207640_10477371 3300025981 Bacteria 1033
992 Ga0207640_10541851 3300025981 Bacteria 976
993 Ga0207640_10685713 3300025981 Bacteria 877
994 Ga0207640_10955095 3300025981 Bacteria 752
995 Ga0207640_11484854 3300025981 Bacteria 609
996 Ga0207640_11645095 3300025981 Unclassified 579
997 Ga0207658_10242298 3300025986 Bacteria 1528
998 Ga0207658_10783046 3300025986 Archaea 865
999 Ga0207658_11165236 3300025986 Bacteria 704
1000 Ga0207677_10174552 3300026023 Bacteria 1684
1001 Ga0207677_10321122 3300026023 Bacteria 1287
1002 Ga0207677_10469151 3300026023 Archaea 1082
1003 Ga0207677_10854941 3300026023 Bacteria 818
1004 Ga0207677_10941213 3300026023 Bacteria 781
1005 Ga0207677_11981096 3300026023 Bacteria 541
1006 Ga0207703_10000055 3300026035 Bacteria 143420
1007 Ga0207703_10142173 3300026035 Bacteria 2084
1008 Ga0207703_10153415 3300026035 Bacteria 2011
1009 Ga0207703_10236618 3300026035 Bacteria 1640
1010 Ga0207703_10246555 3300026035 Archaea 1608
1011 Ga0207703_10385491 3300026035 Bacteria 1297
1012 Ga0207703_10466776 3300026035 Bacteria 1181
1013 Ga0207703_10515203 3300026035 Bacteria 1124
1014 Ga0207703_10538181 3300026035 Bacteria 1100
1015 Ga0207703_10664897 3300026035 Bacteria 989
1016 Ga0207703_11104542 3300026035 Bacteria 762
1017 Ga0207639_10026569 3300026041 Bacteria 4207
1018 Ga0207639_10845769 3300026041 Bacteria 854
1019 Ga0207639_11445652 3300026041 Unclassified 645
1020 Ga0207708_10005653 3300026075 Bacteria 9233
1021 Ga0207708_10006071 3300026075 Bacteria 8959
1022 Ga0207708_10032932 3300026075 Bacteria 3936
1023 Ga0207708_10078029 3300026075 Bacteria 2542
1024 Ga0207708_10462297 3300026075 Bacteria 1058
1025 Ga0207708_10666903 3300026075 Bacteria 886
1026 Ga0207708_10735632 3300026075 Bacteria 846
1027 Ga0207702_10008690 3300026078 Bacteria 8566
1028 Ga0207702_10702516 3300026078 Bacteria 997
1029 Ga0207641_10047513 3300026088 Bacteria 3619
1030 Ga0207641_10115071 3300026088 Bacteria 2391
1031 Ga0207641_10276613 3300026088 Archaea 1577
1032 Ga0207641_10313170 3300026088 Bacteria 1486
1033 Ga0207641_10367883 3300026088 Unclassified 1374
1034 Ga0207641_10560445 3300026088 Bacteria 1115
1035 Ga0207641_10640033 3300026088 Bacteria 1044
1036 Ga0207641_10766313 3300026088 Bacteria 953
1037 Ga0207641_10888671 3300026088 Unclassified 884
1038 Ga0207648_10010725 3300026089 Bacteria 8662
1039 Ga0207648_10038634 3300026089 Bacteria 4200
1040 Ga0207648_10062873 3300026089 Bacteria 3236
1041 Ga0207648_10068424 3300026089 Bacteria 3094
1042 Ga0207648_10226507 3300026089 Bacteria 1662
1043 Ga0207648_10301743 3300026089 Bacteria 1436
1044 Ga0207648_10434211 3300026089 Bacteria 1194
1045 Ga0207648_10683889 3300026089 Unclassified 950
1046 Ga0207648_10726450 3300026089 Unclassified 921
1047 Ga0207676_10001857 3300026095 Bacteria 15470
1048 Ga0207676_10058846 3300026095 Bacteria 3032
1049 Ga0207676_10165375 3300026095 Bacteria 1921
1050 Ga0207676_10211303 3300026095 Bacteria 1721
1051 Ga0207676_10268416 3300026095 Unclassified 1544
1052 Ga0207676_10440983 3300026095 Bacteria 1226
1053 Ga0207676_10549896 3300026095 Bacteria 1103
1054 Ga0207676_10555580 3300026095 Bacteria 1097
1055 Ga0207676_10710131 3300026095 Bacteria 975
1056 Ga0207676_10727068 3300026095 Bacteria 964
1057 Ga0207676_10802511 3300026095 Bacteria 918
1058 Ga0207676_10846327 3300026095 Bacteria 894
1059 Ga0207676_10974777 3300026095 Unclassified 834
1060 Ga0207676_11118869 3300026095 Bacteria 779
1061 Ga0207676_11314831 3300026095 Bacteria 718
1062 Ga0207676_11985050 3300026095 Unclassified 580
1063 Ga0207676_12182041 3300026095 Unclassified 552
1064 Ga0207674_10000216 3300026116 Bacteria 71622
1065 Ga0207674_10060027 3300026116 Bacteria 3847
1066 Ga0207674_10105958 3300026116 Bacteria 2789
1067 Ga0207674_10261816 3300026116 Bacteria 1677
1068 Ga0207674_10320129 3300026116 Bacteria 1500
1069 Ga0207674_10325862 3300026116 Bacteria 1486
1070 Ga0207674_10864614 3300026116 Bacteria 872
1071 Ga0207674_11345504 3300026116 Bacteria 684
1072 Ga0207675_100001536 3300026118 Bacteria 23117
1073 Ga0207675_100018802 3300026118 Bacteria 6447
1074 Ga0207675_100024463 3300026118 Bacteria 5615
1075 Ga0207675_100097766 3300026118 Bacteria 2764
1076 Ga0207675_100914609 3300026118 Unclassified 894
1077 Ga0207675_100934623 3300026118 Bacteria 884
1078 Ga0207675_101088259 3300026118 Bacteria 819
1079 Ga0207683_10074349 3300026121 Archaea 3006
1080 Ga0207683_10457644 3300026121 Bacteria 1177
1081 Ga0207683_10998440 3300026121 Bacteria 777
1082 Ga0207698_10335162 3300026142 Bacteria 1423
1083 Ga0207698_11150914 3300026142 Bacteria 789
1084 Ga0207698_11305368 3300026142 Unclassified 740
1085 Ga0207698_11495849 3300026142 Bacteria 690
1086 Ga0207698_11520085 3300026142 Bacteria 685
1087 Ga0207698_11645495 3300026142 Unclassified 657
1088 Ga0209588_1066610 3300027671 Bacteria 1164
1089 Ga0207428_10056807 3300027907 Bacteria 3109
1090 Ga0207428_10180976 3300027907 Bacteria 1593
1091 Ga0268266_10236226 3300028379 Bacteria 1685
1092 Ga0268266_10644512 3300028379 Bacteria 1019
1093 Ga0268266_10870497 3300028379 Bacteria 871
1094 Ga0268265_10014482 3300028380 Bacteria 5374
1095 Ga0268265_10454446 3300028380 Bacteria 1197
1096 Ga0268265_10502560 3300028380 Bacteria 1143
1097 Ga0268265_10764330 3300028380 Bacteria 939
1098 Ga0268265_11453643 3300028380 Bacteria 688
1099 Ga0268265_11848837 3300028380 Unclassified 610
1100 Ga0268264_10009797 3300028381 Bacteria 7930
1101 Ga0268264_10020165 3300028381 Bacteria 5448
1102 Ga0268264_10069010 3300028381 Bacteria 2989
1103 Ga0268264_10126884 3300028381 Bacteria 2256
1104 Ga0268264_10289226 3300028381 Bacteria 1538
1105 Ga0268264_10289900 3300028381 Bacteria 1537
1106 Ga0268264_10340599 3300028381 Bacteria 1424
1107 Ga0268264_10654082 3300028381 Archaea 1040
1108 Ga0268264_10717415 3300028381 Unclassified 994
1109 Ga0268264_11236847 3300028381 Bacteria 756
1110 Ga0268264_11479551 3300028381 Unclassified 690
1111 Ga0268264_11532590 3300028381 Bacteria 677
1112 Ga0314311_1114909 3300030733 Bacteria 1531
1113 Ga0316178_1161888 3300030735 Bacteria 733
1114 Ga0316182_1073585 3300030745 Unclassified 782
1115 Ga0307513_10003024 3300031456 Bacteria 22922
1116 Ga0307513_10712592 3300031456 Bacteria 709
1117 Ga0307408_100001805 3300031548 Bacteria 15614
1118 Ga0307408_100179054 3300031548 Bacteria 1699
1119 Ga0307408_100311970 3300031548 Bacteria 1322
1120 Ga0307408_100821536 3300031548 Bacteria 845
1121 Ga0307408_100903675 3300031548 Bacteria 808
1122 Ga0307405_10003348 3300031731 Bacteria 7345
1123 Ga0307405_10040546 3300031731 Bacteria 2821
1124 Ga0307405_10095164 3300031731 Bacteria 1982
1125 Ga0307405_10143853 3300031731 Bacteria 1667
1126 Ga0307413_10027109 3300031824 Bacteria 3169
1127 Ga0307413_10173837 3300031824 Bacteria 1528
1128 Ga0307410_10719234 3300031852 Bacteria 843
1129 Ga0307410_10858120 3300031852 Bacteria 775
1130 Ga0307410_11058577 3300031852 Bacteria 702
1131 Ga0307406_10001256 3300031901 Bacteria 14213
1132 Ga0307406_10072033 3300031901 Bacteria 2267
1133 Ga0307406_10132729 3300031901 Bacteria 1751
1134 Ga0307407_10090092 3300031903 Bacteria 1878
1135 Ga0307412_10005163 3300031911 Bacteria 7314
1136 Ga0307412_10096546 3300031911 Bacteria 2080
1137 Ga0307412_11566736 3300031911 Bacteria 601
1138 Ga0307409_100079286 3300031995 Bacteria 2646
1139 Ga0307409_100309914 3300031995 Bacteria 1473
1140 Ga0307416_100028260 3300032002 Bacteria 4167
1141 Ga0307416_100223105 3300032002 Bacteria 1809
1142 Ga0307416_100763158 3300032002 Bacteria 1061
1143 Ga0307414_10002516 3300032004 Bacteria 9618
1144 Ga0307414_10045808 3300032004 Unclassified 2998
1145 Ga0307414_10130513 3300032004 Bacteria 1950
1146 Ga0307414_11106072 3300032004 Bacteria 732
1147 Ga0307414_11856497 3300032004 Unclassified 562
1148 Ga0307411_10003361 3300032005 Bacteria 7415
1149 Ga0307411_10007990 3300032005 Bacteria 5446
1150 Ga0307411_10390287 3300032005 Bacteria 1148
1151 Ga0307415_100007668 3300032126 Bacteria 5924
1152 Ga0307415_100052879 3300032126 Bacteria 2764
1153 Ga0307415_100095547 3300032126 Bacteria 2164
1154 Ga0307415_100456418 3300032126 Unclassified 1106
1155 Ga0307415_100574526 3300032126 Unclassified 999
1156 Ga0307415_100824099 3300032126 Bacteria 849
1157 Ga0307415_101885833 3300032126 Bacteria 580
1158 Ga0373938_0053600 3300034957 Bacteria 927
1159 Ga0373940_0114930 3300035088 Bacteria 830
1160 Ga0373951_0008264 3300035091 Bacteria 2356
1161 Ga0373939_0009671 3300035114 Bacteria 2396
1162 Ga0373939_0249631 3300035114 Bacteria 690
1163 Ga0373962_0185164 3300035242 Unclassified 698
1164 Ga0373931_0258986 3300035691 Bacteria 1061
1165 Ga0373931_0424676 3300035691 Bacteria 846
1166 Ga0373937_0249789 3300036401 Bacteria 1672
1167 Ga0373937_2092421 3300036401 Unclassified 512
1168 Ga0395900_0362384 3300037418 Bacteria 1421
1169 Ga0395900_0489873 3300037418 Unclassified 1181
1170 Ga0395900_1279329 3300037418 Bacteria 648
1171 Ga0395898_0095641 3300037466 Bacteria 2854
1172 Ga0395898_0290153 3300037466 Bacteria 1561
1173 Ga0395898_0434197 3300037466 Bacteria 1251
1174 Ga0395898_0767197 3300037466 Unclassified 905
1175 Ga0395905_0336345 3300037471 Bacteria 1401
1176 Ga0395905_0524784 3300037471 Bacteria 1085
1177 Ga0395905_0844260 3300037471 Unclassified 819
1178 Ga0436364_0380639 3300037853 Bacteria 940
1179 Ga0395901_0324289 3300038443 Bacteria 1593
1180 Ga0242422_02188 3300038699 Bacteria 1329
1181 Ga0242420_002071 3300038996 Bacteria 2811
1182 Ga0242420_030651 3300038996 Bacteria 996
1183 Ga0242420_050208 3300038996 Bacteria 814
1184 Ga0436365_0065206 3300039437 Bacteria 6256
1185 Ga0436365_0107567 3300039437 Bacteria 1091
1186 Ga0436365_1230201 3300039437 Bacteria 2675
1187 Ga0436365_1278013 3300039437 Bacteria 31325
1188 Ga0436365_1423688 3300039437 Bacteria 102720
1189 Ga0436362_0942495 3300039453 Bacteria 900
1190 Ga0439461_0046108 3300041410 Bacteria 955
1191 Ga0451839_1070490 3300041496 Unclassified 772
1192 Ga0439455_0020761 3300042012 Unclassified 1560
1193 Ga0450892_012353 3300042130 Bacteria 768
1194 Ga0439446_0017535 3300042156 Bacteria 2002
1195 Ga0439458_0004968 3300042157 Unclassified 3013
1196 Ga0439464_0009854 3300042439 Bacteria 2517
1197 Ga0451577_0100192 3300042876 Unclassified 2588
1198 Ga0451577_0509461 3300042876 Unclassified 1093
1199 Ga0453683_0316896 3300044673 Bacteria 999
1200 Ga0451576_0066981 3300045051 Bacteria 3737
1201 Ga0451576_0125986 3300045051 Bacteria 2669
1202 Ga0451576_0277379 3300045051 Bacteria 1753
1203 Ga0451576_0926750 3300045051 Bacteria 914
1204 Ga0451576_1378023 3300045051 Bacteria 734
1205 Ga0451576_1485419 3300045051 Bacteria 704
1206 Ga0451576_1664642 3300045051 Unclassified 661
1207 Ga0451576_1728688 3300045051 Bacteria 647
1208 Ga0466967_0652159 3300045976 Bacteria 1041
1209 Ga0495610_0073804 3300046512 Bacteria 1584
1210 Ga0495616_0238750 3300046513 Bacteria 785
1211 Ga0495630_0079190 3300046517 Unclassified 2479
1212 Ga0495632_0021859 3300046519 Bacteria 3439
1213 Ga0495663_0000580 3300046525 Bacteria 12852
1214 Ga0495598_0017840 3300046537 Bacteria 1835
1215 Ga0495621_0000070 3300046539 Bacteria 20267
1216 Ga0495621_0002026 3300046539 Bacteria 5351
1217 Ga0495668_0429507 3300046616 Bacteria 727
1218 Ga0495659_0071559 3300046664 Unclassified 1300
1219 Ga0495669_0235404 3300046684 Bacteria 879
1220 Ga0495613_0110878 3300046689 Unclassified 1977
1221 Ga0495670_0212669 3300046691 Bacteria 1026
1222 Ga0495636_0070716 3300047318 Unclassified 1489
1223 Ga0495636_0171137 3300047318 Bacteria 982
1224 Ga0495680_0403150 3300047322 Bacteria 944
1225 Ga0495684_0465111 3300047471 Bacteria 876
1226 Ga0496100_0128162 3300048903 Bacteria 1784
1227 Ga0496100_1325701 3300048903 Unclassified 568
1228 Ga0496102_0004552 3300048905 Bacteria 11720
1229 Ga0496103_0035849 3300048906 Bacteria 3037
1230 Ga0496104_0006912 3300048907 Bacteria 10010
1231 Ga0496104_0408960 3300048907 Bacteria 1269
1232 Ga0496104_1788173 3300048907 Unclassified 517
1233 Ga0496106_0002178 3300048909 Bacteria 14639
1234 Ga0496106_0040898 3300048909 Unclassified 3473
1235 Ga0496106_0088497 3300048909 Bacteria 2387
1236 Ga0496107_0064984 3300048910 Bacteria 2645
1237 Ga0496107_0961156 3300048910 Unclassified 621
1238 Ga0496107_1128050 3300048910 Unclassified 566
1239 Ga0496108_0151246 3300048911 Bacteria 2003
1240 Ga0496108_0301902 3300048911 Bacteria 1395
1241 Ga0496108_0488066 3300048911 Bacteria 1076
1242 Ga0496108_0676700 3300048911 Bacteria 896
1243 Ga0496110_0095119 3300048913 Bacteria 2668
1244 Ga0496110_0102005 3300048913 Bacteria 2573
1245 Ga0496110_0466302 3300048913 Bacteria 1151
1246 Ga0496111_0547280 3300048914 Unclassified 850
1247 Ga0496112_0253342 3300048915 Bacteria 1711
1248 Ga0496112_0448663 3300048915 Bacteria 1228
1249 Ga0496112_0456021 3300048915 Bacteria 1216
1250 Ga0496112_0496101 3300048915 Unclassified 1157
1251 Ga0496112_0595512 3300048915 Bacteria 1038
1252 Ga0496112_0669719 3300048915 Unclassified 967
1253 Ga0496113_0047124 3300048916 Bacteria 3203
1254 Ga0496114_0417798 3300048917 Unclassified 1188
1255 Ga0501291_006352 3300049514 Bacteria 1574
1256 Ga0501292_007253 3300049515 Bacteria 1598
1257 Ga0501292_017461 3300049515 Bacteria 1135
1258 Ga0501293_002850 3300049516 Bacteria 1321
1259 Ga0501293_017014 3300049516 Bacteria 682
1260 Ga0501296_001713 3300049519 Bacteria 2235
1261 Ga0501296_013270 3300049519 Bacteria 1001
1262 Ga0501297_056886 3300049520 Unclassified 589
1263 Ga0501298_005978 3300049521 Bacteria 1976
1264 Ga0501298_015924 3300049521 Bacteria 1358
1265 Ga0501298_069846 3300049521 Bacteria 756
1266 Ga0501299_005825 3300049522 Bacteria 1910
1267 Ga0501299_071910 3300049522 Unclassified 752
1268 Ga0501300_014123 3300049523 Bacteria 1166
1269 Ga0501038_0007225 3300049574 Bacteria 10262
1270 Ga0501040_0350372 3300049576 Bacteria 1058
1271 Ga0501067_0221815 3300049583 Bacteria 1053
1272 Ga0501069_0059807 3300049585 Bacteria 2127
1273 Ga0501074_0421877 3300049590 Unclassified 946
1274 Ga0501198_002258 3300049649 Unclassified 2581
1275 Ga0501198_004547 3300049649 Bacteria 1927
1276 Ga0501198_048984 3300049649 Bacteria 749
1277 Ga0501199_008505 3300049650 Bacteria 1075
1278 Ga0501202_001986 3300049652 Unclassified 3375
1279 Ga0501202_004782 3300049652 Bacteria 2379
1280 Ga0501202_161559 3300049652 Unclassified 593
1281 Ga0501206_049192 3300049653 Bacteria 668
1282 Ga0501207_006825 3300049654 Unclassified 1614
1283 Ga0501208_017472 3300049655 Bacteria 1131
1284 Ga0501209_025400 3300049656 Bacteria 1452
1285 Ga0501216_001937 3300049660 Bacteria 2874
1286 Ga0501216_006745 3300049660 Bacteria 1770
1287 Ga0501216_009723 3300049660 Bacteria 1537
1288 Ga0501217_001103 3300049661 Bacteria 4923
1289 Ga0501217_001520 3300049661 Bacteria 4372
1290 Ga0501217_004189 3300049661 Bacteria 2957
1291 Ga0501223_000430 3300049663 Bacteria 10185
1292 Ga0501223_007351 3300049663 Bacteria 2255
1293 Ga0501223_056081 3300049663 Bacteria 766
1294 Ga0501223_058197 3300049663 Unclassified 753
1295 Ga0501224_000314 3300049664 Bacteria 5648
1296 Ga0501224_001809 3300049664 Unclassified 2880
1297 Ga0501224_009245 3300049664 Bacteria 1441
1298 Ga0501224_053725 3300049664 Unclassified 621
1299 Ga0501227_000962 3300049665 Bacteria 6338
1300 Ga0501227_072643 3300049665 Unclassified 894
1301 Ga0501228_022534 3300049666 Unclassified 722
1302 Ga0501228_028509 3300049666 Bacteria 672
1303 Ga0501230_000860 3300049667 Bacteria 3385
1304 Ga0501233_004184 3300049668 Bacteria 2631
1305 Ga0501233_038529 3300049668 Bacteria 1114
1306 Ga0501233_080557 3300049668 Bacteria 837
1307 Ga0501235_054589 3300049669 Bacteria 929
1308 Ga0501235_090230 3300049669 Bacteria 739
1309 Ga0501235_118604 3300049669 Unclassified 660
1310 Ga0501236_019458 3300049670 Unclassified 990
1311 Ga0501236_064365 3300049670 Unclassified 657
1312 Ga0501239_046700 3300049672 Unclassified 615
1313 Ga0501240_026142 3300049673 Bacteria 910
1314 Ga0501240_028320 3300049673 Bacteria 884
1315 Ga0501243_019652 3300049675 Bacteria 1107
1316 Ga0501246_003017 3300049676 Bacteria 1343
1317 Ga0501247_006048 3300049677 Bacteria 1363
1318 Ga0501249_002082 3300049679 Bacteria 4073
1319 Ga0501249_014428 3300049679 Bacteria 1684
1320 Ga0501249_015946 3300049679 Bacteria 1610
1321 Ga0501249_031435 3300049679 Bacteria 1184
1322 Ga0501252_028104 3300049682 Bacteria 768
1323 Ga0501253_011050 3300049683 Bacteria 1377
1324 Ga0501253_021767 3300049683 Bacteria 1134
1325 Ga0501253_022623 3300049683 Bacteria 1121
1326 Ga0501256_004260 3300049685 Bacteria 1223
1327 Ga0501257_006118 3300049686 Bacteria 2667
1328 Ga0501259_002934 3300049688 Bacteria 2736
1329 Ga0501259_008242 3300049688 Unclassified 1675
1330 Ga0501260_004427 3300049689 Bacteria 1295
1331 Ga0501260_005940 3300049689 Unclassified 1163
1332 Ga0501260_008803 3300049689 Bacteria 997
1333 Ga0501260_013452 3300049689 Bacteria 844
1334 Ga0501261_029358 3300049690 Bacteria 825
1335 Ga0501219_002767 3300049703 Bacteria 1312
1336 Ga0501221_005689 3300049704 Bacteria 2091
1337 Ga0501225_0000370 3300049705 Bacteria 14141
1338 Ga0501225_0009611 3300049705 Bacteria 2748
1339 Ga0501225_0009765 3300049705 Unclassified 2726
1340 Ga0501225_0012984 3300049705 Bacteria 2335
1341 Ga0501225_0317593 3300049705 Bacteria 531
1342 Ga0501234_004627 3300049707 Bacteria 2162
1343 Ga0501234_025304 3300049707 Bacteria 952
1344 Ga0501245_015054 3300049708 Bacteria 1160
1345 Ga0501232_019277 3300049757 Bacteria 865
1346 Ga0501241_105078 3300049758 Unclassified 612
1347 Ga0501264_026215 3300049761 Unclassified 647
1348 Ga0501266_005407 3300049763 Bacteria 1589
1349 Ga0501266_089106 3300049763 Bacteria 533
1350 Ga0501267_023762 3300049764 Bacteria 689
1351 Ga0501268_001359 3300049765 Bacteria 3041
1352 Ga0501268_075228 3300049765 Unclassified 689
1353 Ga0501268_178447 3300049765 Unclassified 505
1354 Ga0501272_005853 3300049769 Bacteria 1305
1355 Ga0501272_031582 3300049769 Unclassified 675
1356 Ga0501273_012787 3300049770 Bacteria 1062
1357 Ga0501276_016040 3300049773 Bacteria 679
1358 Ga0501278_025819 3300049774 Unclassified 570
1359 Ga0501278_028777 3300049774 Unclassified 554
1360 Ga0501280_031056 3300049776 Bacteria 834
1361 Ga0501282_014522 3300049778 Bacteria 855
1362 Ga0501283_002022 3300049779 Unclassified 2630
1363 Ga0501283_008510 3300049779 Bacteria 1481
1364 Ga0501283_011011 3300049779 Bacteria 1339
1365 Ga0501283_042518 3300049779 Unclassified 790
1366 Ga0501204_012717 3300049850 Bacteria 1014
1367 Ga0501212_002018 3300049851 Bacteria 2399
1368 Ga0501226_000453 3300049853 Bacteria 5767
1369 Ga0501226_009746 3300049853 Bacteria 1068
1370 nmdc:mga05p37_102050_c1 3300050507 Bacteria 3533
1371 nmdc:mga05p37_1143790_c1 3300050507 Unclassified 810
1372 nmdc:mga05p37_1342503_c1 3300050507 Unclassified 725
1373 nmdc:mga05p37_149315_c1 3300050507 Bacteria 2860
1374 nmdc:mga05p37_1839557_c1 3300050507 Bacteria 582
1375 nmdc:mga05p37_216288_c1 3300050507 Bacteria 2314
1376 nmdc:mga05p37_387382_c1 3300050507 Bacteria 1636
1377 nmdc:mga05p37_607556_c1 3300050507 Unclassified 1233
1378 nmdc:mga05p37_63790_c1 3300050507 Bacteria 4534
1379 nmdc:mga05p37_75013_c1 3300050507 Bacteria 4163
1380 nmdc:mga05p37_971630_c1 3300050507 Bacteria 906
1381 nmdc:mga05p37_992399_c1 3300050507 Bacteria 893
1382 nmdc:mga0qj67_175556_c1 3300050509 Bacteria 1740
1383 nmdc:mga06r32_1044594_c1 3300050510 Unclassified 768
1384 nmdc:mga08y16_26078_c1 3300050511 Bacteria 6165
1385 nmdc:mga08y16_568872_c1 3300050511 Bacteria 1145
1386 nmdc:mga0n895_119398_c1 3300050512 Unclassified 2657
1387 nmdc:mga0n895_23155_c1 3300050512 Bacteria 5834
1388 nmdc:mga0n895_51621_c1 3300050512 Bacteria 4034
1389 nmdc:mga0n895_583602_c1 3300050512 Unclassified 1121
1390 nmdc:mga0n895_628976_c1 3300050512 Bacteria 1074
1391 nmdc:mga0n895_72110_c1 3300050512 Unclassified 3426
1392 nmdc:mga0n895_872365_c1 3300050512 Unclassified 887
1393 nmdc:mga0rr50_120002_c1 3300050513 Bacteria 2091
1394 nmdc:mga0rr50_1291376_c1 3300050513 Unclassified 619
1395 nmdc:mga0rr50_312936_c1 3300050513 Bacteria 1315
1396 nmdc:mga0rr50_394800_c1 3300050513 Bacteria 1168
1397 nmdc:mga0rr50_599061_c1 3300050513 Bacteria 939
1398 nmdc:mga08x19_106_c1 3300050514 Bacteria 74458
1399 nmdc:mga08x19_138651_c1 3300050514 Unclassified 1641
1400 nmdc:mga0a205_120361_c1 3300050515 Bacteria 2524
1401 nmdc:mga0a205_128230_c1 3300050515 Bacteria 2437
1402 nmdc:mga0a205_180875_c1 3300050515 Bacteria 2003
1403 nmdc:mga0a205_19057_c1 3300050515 Bacteria 6465
1404 nmdc:mga0a205_202814_c1 3300050515 Bacteria 1873
1405 nmdc:mga0a205_266435_c1 3300050515 Bacteria 1590
1406 nmdc:mga0a205_27974_c1 3300050515 Bacteria 5387
1407 nmdc:mga0a205_301114_c1 3300050515 Bacteria 1476
1408 nmdc:mga0a205_34219_c1 3300050515 Bacteria 4875
1409 nmdc:mga0a205_37582_c1 3300050515 Bacteria 4656
1410 nmdc:mga0a205_64084_c1 3300050515 Bacteria 3550
1411 nmdc:mga0a205_75414_c1 3300050515 Bacteria 3258
1412 nmdc:mga0a205_80045_c1 3300050515 Bacteria 3157
1413 nmdc:mga0a205_87476_c1 3300050515 Bacteria 3010
1414 Ga0500577_0003133 3300053142 Bacteria 4280
1415 Ga0500616_0018396 3300053153 Bacteria 3951
1416 Ga0501084_0165873 3300054114 Bacteria 1864
1417 Ga0530510_0072705 3300061734 Bacteria 2496

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025901 Ga0207688_10938516 Ga0207688_109385161 119
2 3300005347 Ga0070668_102176376 Ga0070668_1021763761 120
3 3300005445 Ga0070708_100000828 Ga0070708_1000008289 120
4 3300005467 Ga0070706_100005717 Ga0070706_1000057172 120
5 3300005468 Ga0070707_100012709 Ga0070707_1000127092 120
6 3300005471 Ga0070698_100000852 Ga0070698_10000085212 120
7 3300005518 Ga0070699_100002725 Ga0070699_1000027258 120
8 3300005536 Ga0070697_100038988 Ga0070697_1000389883 120
9 3300005536 Ga0070697_100164915 Ga0070697_1001649152 120
10 3300013306 Ga0163162_10050219 Ga0163162_100502194 120
11 3300025910 Ga0207684_10002329 Ga0207684_100023293 120
12 3300025922 Ga0207646_10433373 Ga0207646_104333732 120
13 3300005289 Ga0065704_10580733 Ga0065704_105807331 121
14 3300005295 Ga0065707_10018438 Ga0065707_100184382 121
15 3300005328 Ga0070676_10012828 Ga0070676_100128285 121
16 3300005334 Ga0068869_100506032 Ga0068869_1005060322 121
17 3300005336 Ga0070680_100032882 Ga0070680_1000328824 121
18 3300005340 Ga0070689_100512527 Ga0070689_1005125272 121
19 3300005364 Ga0070673_100877654 Ga0070673_1008776542 121
20 3300005438 Ga0070701_10129706 Ga0070701_101297062 121
21 3300005440 Ga0070705_100090127 Ga0070705_1000901272 121
22 3300005441 Ga0070700_100904507 Ga0070700_1009045072 121
23 3300005444 Ga0070694_100038370 Ga0070694_1000383704 121
24 3300005456 Ga0070678_100127844 Ga0070678_1001278443 121
25 3300005459 Ga0068867_100566262 Ga0068867_1005662622 121
26 3300005546 Ga0070696_100105789 Ga0070696_1001057892 121
27 3300005547 Ga0070693_100429750 Ga0070693_1004297502 121
28 3300005578 Ga0068854_101953813 Ga0068854_1019538131 121
29 3300005615 Ga0070702_100120299 Ga0070702_1001202992 121
30 3300005617 Ga0068859_100005196 Ga0068859_1000051966 121
31 3300005719 Ga0068861_100092414 Ga0068861_1000924143 121
32 3300005843 Ga0068860_100031523 Ga0068860_1000315234 121
33 3300005844 Ga0068862_100042496 Ga0068862_1000424964 121
34 3300005844 Ga0068862_100186358 Ga0068862_1001863582 121
35 3300006173 Ga0070716_100235408 Ga0070716_1002354082 121
36 3300006844 Ga0075428_100507214 Ga0075428_1005072142 121
37 3300006846 Ga0075430_100219373 Ga0075430_1002193732 121
38 3300006880 Ga0075429_100858448 Ga0075429_1008584482 121
39 3300006914 Ga0075436_100000052 Ga0075436_10000005239 121
40 3300006931 Ga0097620_100005196 Ga0097620_1000051966 121
41 3300007076 Ga0075435_100000691 Ga0075435_1000006915 121
42 3300013297 Ga0157378_10436336 Ga0157378_104363362 121
43 3300013297 Ga0157378_11883608 Ga0157378_118836082 121
44 3300013307 Ga0157372_12120185 Ga0157372_121201851 121
45 3300025981 Ga0207640_11645095 Ga0207640_116450951 121
46 3300026089 Ga0207648_10683889 Ga0207648_106838892 121
47 3300028380 Ga0268265_10014482 Ga0268265_100144823 121
48 3300031548 Ga0307408_100179054 Ga0307408_1001790542 121
49 3300031901 Ga0307406_10072033 Ga0307406_100720333 121
50 3300039437 Ga0436365_1278013 Ga0436365_1278013_8794_9165 121
51 3300039437 Ga0436365_1423688 Ga0436365_1423688_45755_46126 121
52 3300049705 Ga0501225_0009611 Ga0501225_0009611_2034_2453 121
53 3300049764 Ga0501267_023762 Ga0501267_023762_183_602 121
54 3300049776 Ga0501280_031056 Ga0501280_031056_399_818 121
55 3300061734 Ga0530510_0072705 Ga0530510_0072705_1462_1887 121
56 3300005459 Ga0068867_100833789 Ga0068867_1008337891 122
57 3300005471 Ga0070698_100060045 Ga0070698_1000600453 122
58 3300005578 Ga0068854_100624563 Ga0068854_1006245632 122
59 3300011119 Ga0105246_11441763 Ga0105246_114417631 122
60 3300025910 Ga0207684_10018767 Ga0207684_100187676 122
61 3300025917 Ga0207660_10742675 Ga0207660_107426751 122
62 3300025922 Ga0207646_10625742 Ga0207646_106257422 122
63 3300025981 Ga0207640_10685713 Ga0207640_106857132 122
64 3300026089 Ga0207648_10434211 Ga0207648_104342112 122
65 3300044673 Ga0453683_0316896 Ga0453683_0316896_343_711 122
66 3300005293 Ga0065715_10059194 Ga0065715_100591941 123
67 3300005293 Ga0065715_10607740 Ga0065715_106077402 123
68 3300005331 Ga0070670_100629187 Ga0070670_1006291872 123
69 3300005337 Ga0070682_100041960 Ga0070682_1000419603 123
70 3300005345 Ga0070692_10362598 Ga0070692_103625982 123
71 3300005440 Ga0070705_100025560 Ga0070705_1000255603 123
72 3300005444 Ga0070694_100608117 Ga0070694_1006081172 123
73 3300005459 Ga0068867_100035325 Ga0068867_1000353254 123
74 3300005466 Ga0070685_10697508 Ga0070685_106975082 123
75 3300005468 Ga0070707_100529347 Ga0070707_1005293471 123
76 3300005536 Ga0070697_100098607 Ga0070697_1000986073 123
77 3300005539 Ga0068853_100735234 Ga0068853_1007352342 123
78 3300005545 Ga0070695_100160136 Ga0070695_1001601362 123
79 3300005546 Ga0070696_100033578 Ga0070696_1000335784 123
80 3300005546 Ga0070696_101048811 Ga0070696_1010488111 123
81 3300005546 Ga0070696_101361631 Ga0070696_1013616311 123
82 3300005547 Ga0070693_100264915 Ga0070693_1002649152 123
83 3300005617 Ga0068859_100338193 Ga0068859_1003381932 123
84 3300005719 Ga0068861_100157565 Ga0068861_1001575652 123
85 3300005841 Ga0068863_100069364 Ga0068863_1000693645 123
86 3300005841 Ga0068863_100360659 Ga0068863_1003606592 123
87 3300005842 Ga0068858_100072309 Ga0068858_1000723093 123
88 3300005842 Ga0068858_101051497 Ga0068858_1010514972 123
89 3300005843 Ga0068860_100009579 Ga0068860_1000095793 123
90 3300006358 Ga0068871_100014630 Ga0068871_1000146303 123
91 3300006852 Ga0075433_10234673 Ga0075433_102346732 123
92 3300006871 Ga0075434_100769310 Ga0075434_1007693102 123
93 3300006931 Ga0097620_100338170 Ga0097620_1003381702 123
94 3300007788 Ga0099795_10169746 Ga0099795_101697462 123
95 3300009174 Ga0105241_10063119 Ga0105241_100631193 123
96 3300009553 Ga0105249_13065372 Ga0105249_130653722 123
97 3300010159 Ga0099796_10282158 Ga0099796_102821582 123
98 3300010375 Ga0105239_11432919 Ga0105239_114329192 123
99 3300013100 Ga0157373_10427780 Ga0157373_104277802 123
100 3300013297 Ga0157378_12131244 Ga0157378_121312442 123
101 3300013306 Ga0163162_10720123 Ga0163162_107201232 123
102 3300014325 Ga0163163_10012071 Ga0163163_100120714 123
103 3300025914 Ga0207671_10726562 Ga0207671_107265622 123
104 3300025924 Ga0207694_10126503 Ga0207694_101265032 123
105 3300025926 Ga0207659_10066051 Ga0207659_100660513 123
106 3300025935 Ga0207709_10068276 Ga0207709_100682763 123
107 3300026035 Ga0207703_10236618 Ga0207703_102366182 123
108 3300026035 Ga0207703_10385491 Ga0207703_103854912 123
109 3300026041 Ga0207639_10845769 Ga0207639_108457692 123
110 3300026088 Ga0207641_10115071 Ga0207641_101150713 123
111 3300026088 Ga0207641_10313170 Ga0207641_103131702 123
112 3300026089 Ga0207648_10038634 Ga0207648_100386344 123
113 3300026095 Ga0207676_10001857 Ga0207676_100018572 123
114 3300028381 Ga0268264_10020165 Ga0268264_100201653 123
115 3300042876 Ga0451577_0509461 Ga0451577_0509461_522_893 123
116 3300045051 Ga0451576_1664642 Ga0451576_1664642_54_425 123
117 3300048909 Ga0496106_0040898 Ga0496106_0040898_1207_1620 123
118 3300048910 Ga0496107_1128050 Ga0496107_1128050_95_508 123
119 3300048911 Ga0496108_0151246 Ga0496108_0151246_633_1046 123
120 3300048915 Ga0496112_0456021 Ga0496112_0456021_546_917 123
121 3300049516 Ga0501293_002850 Ga0501293_002850_84_455 123
122 3300049519 Ga0501296_001713 Ga0501296_001713_934_1305 123
123 3300049520 Ga0501297_056886 Ga0501297_056886_23_394 123
124 3300049521 Ga0501298_005978 Ga0501298_005978_167_538 123
125 3300049521 Ga0501298_069846 Ga0501298_069846_369_740 123
126 3300049522 Ga0501299_005825 Ga0501299_005825_533_904 123
127 3300049523 Ga0501300_014123 Ga0501300_014123_84_455 123
128 3300049590 Ga0501074_0421877 Ga0501074_0421877_47_418 123
129 3300049649 Ga0501198_048984 Ga0501198_048984_319_690 123
130 3300049653 Ga0501206_049192 Ga0501206_049192_50_421 123
131 3300049655 Ga0501208_017472 Ga0501208_017472_588_959 123
132 3300049661 Ga0501217_001103 Ga0501217_001103_1981_2352 123
133 3300049663 Ga0501223_007351 Ga0501223_007351_1004_1375 123
134 3300049664 Ga0501224_009245 Ga0501224_009245_15_386 123
135 3300049664 Ga0501224_053725 Ga0501224_053725_189_560 123
136 3300049668 Ga0501233_080557 Ga0501233_080557_349_720 123
137 3300049669 Ga0501235_054589 Ga0501235_054589_307_678 123
138 3300049670 Ga0501236_064365 Ga0501236_064365_244_615 123
139 3300049673 Ga0501240_026142 Ga0501240_026142_53_424 123
140 3300049675 Ga0501243_019652 Ga0501243_019652_220_591 123
141 3300049679 Ga0501249_014428 Ga0501249_014428_934_1305 123
142 3300049679 Ga0501249_031435 Ga0501249_031435_18_389 123
143 3300049682 Ga0501252_028104 Ga0501252_028104_94_465 123
144 3300049689 Ga0501260_008803 Ga0501260_008803_537_908 123
145 3300049690 Ga0501261_029358 Ga0501261_029358_412_783 123
146 3300049705 Ga0501225_0012984 Ga0501225_0012984_958_1329 123
147 3300049708 Ga0501245_015054 Ga0501245_015054_153_524 123
148 3300049757 Ga0501232_019277 Ga0501232_019277_110_481 123
149 3300049758 Ga0501241_105078 Ga0501241_105078_167_538 123
150 3300049761 Ga0501264_026215 Ga0501264_026215_197_568 123
151 3300049763 Ga0501266_089106 Ga0501266_089106_30_401 123
152 3300049765 Ga0501268_178447 Ga0501268_178447_41_415 123
153 3300049774 Ga0501278_025819 Ga0501278_025819_173_544 123
154 3300049774 Ga0501278_028777 Ga0501278_028777_53_424 123
155 3300049779 Ga0501283_011011 Ga0501283_011011_329_700 123
156 3300049850 Ga0501204_012717 Ga0501204_012717_192_563 123
157 3300050512 nmdc:mga0n895_23155_c1 nmdc:mga0n895_23155_c1_815_1231 123
158 3300050515 nmdc:mga0a205_180875_c1 nmdc:mga0a205_180875_c1_34_408 123
159 3300050515 nmdc:mga0a205_27974_c1 nmdc:mga0a205_27974_c1_2604_3020 123
160 3300009176 Ga0105242_12175760 Ga0105242_121757601 124
161 3300009174 Ga0105241_10624990 Ga0105241_106249901 125
162 3300035091 Ga0373951_0008264 Ga0373951_0008264_1370_1783 125
163 3300005334 Ga0068869_100857724 Ga0068869_1008577242 126
164 3300005364 Ga0070673_101638718 Ga0070673_1016387181 126
165 3300005441 Ga0070700_100400892 Ga0070700_1004008922 126
166 3300005536 Ga0070697_100765357 Ga0070697_1007653571 126
167 3300005843 Ga0068860_100067810 Ga0068860_1000678102 126
168 3300005289 Ga0065704_10016047 Ga0065704_100160473 127
169 3300005293 Ga0065715_10327115 Ga0065715_103271152 127
170 3300005295 Ga0065707_10012351 Ga0065707_100123512 127
171 3300005331 Ga0070670_100026181 Ga0070670_1000261814 127
172 3300005467 Ga0070706_100021294 Ga0070706_1000212946 127
173 3300005518 Ga0070699_100558657 Ga0070699_1005586571 127
174 3300005546 Ga0070696_100409314 Ga0070696_1004093142 127
175 3300009093 Ga0105240_10077602 Ga0105240_100776023 127
176 3300009098 Ga0105245_11519437 Ga0105245_115194372 127
177 3300010375 Ga0105239_10139187 Ga0105239_101391872 127
178 3300013306 Ga0163162_10392645 Ga0163162_103926452 127
179 3300013306 Ga0163162_12180583 Ga0163162_121805832 127
180 3300013307 Ga0157372_10070402 Ga0157372_100704022 127
181 3300014325 Ga0163163_10282154 Ga0163163_102821542 127
182 3300025933 Ga0207706_10124508 Ga0207706_101245082 127
183 3300028381 Ga0268264_10340599 Ga0268264_103405992 127
184 3300049519 Ga0501296_013270 Ga0501296_013270_439_864 127
185 3300049522 Ga0501299_071910 Ga0501299_071910_205_630 127
186 3300049649 Ga0501198_004547 Ga0501198_004547_691_1116 127
187 3300049652 Ga0501202_161559 Ga0501202_161559_50_475 127
188 3300049654 Ga0501207_006825 Ga0501207_006825_1132_1557 127
189 3300049660 Ga0501216_006745 Ga0501216_006745_750_1175 127
190 3300049661 Ga0501217_001520 Ga0501217_001520_3657_4082 127
191 3300049663 Ga0501223_058197 Ga0501223_058197_252_677 127
192 3300049664 Ga0501224_001809 Ga0501224_001809_1462_1887 127
193 3300049665 Ga0501227_072643 Ga0501227_072643_226_651 127
194 3300049677 Ga0501247_006048 Ga0501247_006048_460_885 127
195 3300049689 Ga0501260_005940 Ga0501260_005940_119_544 127
196 3300049707 Ga0501234_025304 Ga0501234_025304_203_628 127
197 3300049765 Ga0501268_075228 Ga0501268_075228_35_460 127
198 3300049769 Ga0501272_031582 Ga0501272_031582_119_544 127
199 3300049770 Ga0501273_012787 Ga0501273_012787_432_857 127
200 3300049779 Ga0501283_008510 Ga0501283_008510_655_1080 127
201 3300049853 Ga0501226_009746 Ga0501226_009746_271_696 127
202 3300005293 Ga0065715_10100980 Ga0065715_101009804 128
203 3300005334 Ga0068869_100032721 Ga0068869_1000327213 128
204 3300005354 Ga0070675_101067894 Ga0070675_1010678942 128
205 3300005459 Ga0068867_100290573 Ga0068867_1002905732 128
206 3300009147 Ga0114129_10166228 Ga0114129_101662282 128
207 3300009176 Ga0105242_11903883 Ga0105242_119038832 128
208 3300010375 Ga0105239_11083104 Ga0105239_110831042 128
209 3300013297 Ga0157378_10089077 Ga0157378_100890771 128
210 3300013297 Ga0157378_10835213 Ga0157378_108352132 128
211 3300017792 Ga0163161_10135784 Ga0163161_101357843 128
212 3300025942 Ga0207689_10270406 Ga0207689_102704062 128
213 3300026075 Ga0207708_10666903 Ga0207708_106669032 128
214 3300026089 Ga0207648_10301743 Ga0207648_103017432 128
215 3300026121 Ga0207683_10998440 Ga0207683_109984401 128
216 3300027907 Ga0207428_10180976 Ga0207428_101809762 128
217 3300036401 Ga0373937_2092421 Ga0373937_2092421_20_412 128
218 3300045051 Ga0451576_1485419 Ga0451576_1485419_31_423 128
219 3300046517 Ga0495630_0079190 Ga0495630_0079190_1229_1621 128
220 3300046664 Ga0495659_0071559 Ga0495659_0071559_704_1114 128
221 3300046689 Ga0495613_0110878 Ga0495613_0110878_716_1108 128
222 3300046691 Ga0495670_0212669 Ga0495670_0212669_586_996 128
223 3300047322 Ga0495680_0403150 Ga0495680_0403150_84_476 128
224 3300047471 Ga0495684_0465111 Ga0495684_0465111_405_797 128
225 3300050507 nmdc:mga05p37_216288_c1 nmdc:mga05p37_216288_c1_1217_1642 128
226 3300050513 nmdc:mga0rr50_312936_c1 nmdc:mga0rr50_312936_c1_429_815 128
227 3300050515 nmdc:mga0a205_266435_c1 nmdc:mga0a205_266435_c1_451_843 128
228 3300005334 Ga0068869_100048093 Ga0068869_1000480933 129
229 3300005336 Ga0070680_100328517 Ga0070680_1003285172 129
230 3300005356 Ga0070674_101146170 Ga0070674_1011461702 129
231 3300005364 Ga0070673_101470371 Ga0070673_1014703711 129
232 3300005440 Ga0070705_100109618 Ga0070705_1001096182 129
233 3300005456 Ga0070678_100983174 Ga0070678_1009831741 129
234 3300005467 Ga0070706_100130842 Ga0070706_1001308422 129
235 3300005468 Ga0070707_100144722 Ga0070707_1001447221 129
236 3300005471 Ga0070698_100029589 Ga0070698_1000295894 129
237 3300005471 Ga0070698_100066841 Ga0070698_1000668412 129
238 3300005471 Ga0070698_100096004 Ga0070698_1000960043 129
239 3300005471 Ga0070698_101283793 Ga0070698_1012837931 129
240 3300005518 Ga0070699_101514197 Ga0070699_1015141971 129
241 3300005536 Ga0070697_100020469 Ga0070697_1000204693 129
242 3300005546 Ga0070696_100025109 Ga0070696_1000251094 129
243 3300005546 Ga0070696_100576304 Ga0070696_1005763042 129
244 3300005549 Ga0070704_100153511 Ga0070704_1001535111 129
245 3300005564 Ga0070664_100822479 Ga0070664_1008224791 129
246 3300005577 Ga0068857_100463505 Ga0068857_1004635052 129
247 3300005843 Ga0068860_100946375 Ga0068860_1009463752 129
248 3300005985 Ga0081539_10178574 Ga0081539_101785742 129
249 3300009098 Ga0105245_11539957 Ga0105245_115399571 129
250 3300009147 Ga0114129_11144593 Ga0114129_111445932 129
251 3300009148 Ga0105243_10416318 Ga0105243_104163182 129
252 3300009148 Ga0105243_10592556 Ga0105243_105925562 129
253 3300009176 Ga0105242_10136022 Ga0105242_101360223 129
254 3300009177 Ga0105248_10236368 Ga0105248_102363682 129
255 3300013296 Ga0157374_10754075 Ga0157374_107540752 129
256 3300013297 Ga0157378_10032668 Ga0157378_100326682 129
257 3300013297 Ga0157378_10051740 Ga0157378_100517403 129
258 3300013297 Ga0157378_10477599 Ga0157378_104775992 129
259 3300013308 Ga0157375_11875784 Ga0157375_118757842 129
260 3300025910 Ga0207684_10015598 Ga0207684_100155987 129
261 3300025922 Ga0207646_10016167 Ga0207646_100161674 129
262 3300025941 Ga0207711_10143494 Ga0207711_101434942 129
263 3300025942 Ga0207689_10117901 Ga0207689_101179011 129
264 3300025945 Ga0207679_11435429 Ga0207679_114354291 129
265 3300025981 Ga0207640_10541851 Ga0207640_105418512 129
266 3300026116 Ga0207674_10320129 Ga0207674_103201292 129
267 3300032004 Ga0307414_11106072 Ga0307414_111060722 129
268 3300041496 Ga0451839_1070490 Ga0451839_1070490_18_413 129
269 3300048917 Ga0496114_0417798 Ga0496114_0417798_530_925 129
270 3300050507 nmdc:mga05p37_1839557_c1 nmdc:mga05p37_1839557_c1_56_451 129
271 3300050514 nmdc:mga08x19_106_c1 nmdc:mga08x19_106_c1_36600_36995 129
272 3300005293 Ga0065715_10620417 Ga0065715_106204171 130
273 3300005295 Ga0065707_10118963 Ga0065707_101189632 130
274 3300005295 Ga0065707_10140539 Ga0065707_101405392 130
275 3300005330 Ga0070690_100122669 Ga0070690_1001226692 130
276 3300005338 Ga0068868_100025684 Ga0068868_1000256843 130
277 3300005343 Ga0070687_100843263 Ga0070687_1008432632 130
278 3300005353 Ga0070669_101532359 Ga0070669_1015323591 130
279 3300005364 Ga0070673_100046168 Ga0070673_1000461684 130
280 3300005364 Ga0070673_100754672 Ga0070673_1007546722 130
281 3300005364 Ga0070673_101030139 Ga0070673_1010301392 130
282 3300005440 Ga0070705_100151687 Ga0070705_1001516872 130
283 3300005441 Ga0070700_100116519 Ga0070700_1001165192 130
284 3300005444 Ga0070694_100506611 Ga0070694_1005066112 130
285 3300005444 Ga0070694_100553336 Ga0070694_1005533362 130
286 3300005445 Ga0070708_100231614 Ga0070708_1002316142 130
287 3300005445 Ga0070708_100297974 Ga0070708_1002979742 130
288 3300005445 Ga0070708_100524098 Ga0070708_1005240982 130
289 3300005467 Ga0070706_100007078 Ga0070706_1000070786 130
290 3300005467 Ga0070706_100015812 Ga0070706_1000158125 130
291 3300005468 Ga0070707_100000659 Ga0070707_1000006593 130
292 3300005468 Ga0070707_100024325 Ga0070707_1000243252 130
293 3300005471 Ga0070698_100007161 Ga0070698_10000716112 130
294 3300005471 Ga0070698_100597535 Ga0070698_1005975351 130
295 3300005518 Ga0070699_100015116 Ga0070699_1000151164 130
296 3300005535 Ga0070684_102219897 Ga0070684_1022198971 130
297 3300005536 Ga0070697_100008611 Ga0070697_1000086117 130
298 3300005543 Ga0070672_100310628 Ga0070672_1003106282 130
299 3300005544 Ga0070686_100086541 Ga0070686_1000865413 130
300 3300005544 Ga0070686_100945745 Ga0070686_1009457451 130
301 3300005545 Ga0070695_100664879 Ga0070695_1006648791 130
302 3300005545 Ga0070695_100889543 Ga0070695_1008895432 130
303 3300005545 Ga0070695_100986063 Ga0070695_1009860631 130
304 3300005546 Ga0070696_100013583 Ga0070696_1000135833 130
305 3300005546 Ga0070696_101136782 Ga0070696_1011367821 130
306 3300005547 Ga0070693_100050747 Ga0070693_1000507473 130
307 3300005549 Ga0070704_100000663 Ga0070704_1000006638 130
308 3300005549 Ga0070704_100314499 Ga0070704_1003144991 130
309 3300005549 Ga0070704_100565776 Ga0070704_1005657762 130
310 3300005615 Ga0070702_100108056 Ga0070702_1001080562 130
311 3300005615 Ga0070702_100197801 Ga0070702_1001978012 130
312 3300005615 Ga0070702_100343681 Ga0070702_1003436812 130
313 3300005617 Ga0068859_100994567 Ga0068859_1009945672 130
314 3300005718 Ga0068866_10089465 Ga0068866_100894652 130
315 3300005719 Ga0068861_101319383 Ga0068861_1013193832 130
316 3300005842 Ga0068858_100042340 Ga0068858_1000423404 130
317 3300005842 Ga0068858_100317169 Ga0068858_1003171692 130
318 3300005985 Ga0081539_10133700 Ga0081539_101337002 130
319 3300006163 Ga0070715_10000032 Ga0070715_1000003254 130
320 3300006173 Ga0070716_100000014 Ga0070716_10000001475 130
321 3300006358 Ga0068871_100801960 Ga0068871_1008019601 130
322 3300006847 Ga0075431_100764518 Ga0075431_1007645182 130
323 3300006852 Ga0075433_10065981 Ga0075433_100659813 130
324 3300006880 Ga0075429_100881622 Ga0075429_1008816222 130
325 3300006881 Ga0068865_100664349 Ga0068865_1006643492 130
326 3300006931 Ga0097620_100994722 Ga0097620_1009947222 130
327 3300007076 Ga0075435_100516862 Ga0075435_1005168622 130
328 3300009094 Ga0111539_10409054 Ga0111539_104090542 130
329 3300009101 Ga0105247_10000003 Ga0105247_10000003476 130
330 3300009101 Ga0105247_10098872 Ga0105247_100988725 130
331 3300009147 Ga0114129_10016688 Ga0114129_100166884 130
332 3300009148 Ga0105243_10024532 Ga0105243_100245324 130
333 3300009148 Ga0105243_10390086 Ga0105243_103900862 130
334 3300009148 Ga0105243_10496831 Ga0105243_104968312 130
335 3300009174 Ga0105241_10276228 Ga0105241_102762281 130
336 3300009176 Ga0105242_10001400 Ga0105242_100014005 130
337 3300009176 Ga0105242_10002872 Ga0105242_1000287211 130
338 3300009176 Ga0105242_10467778 Ga0105242_104677782 130
339 3300009177 Ga0105248_10213824 Ga0105248_102138243 130
340 3300009177 Ga0105248_10416402 Ga0105248_104164022 130
341 3300009177 Ga0105248_10474267 Ga0105248_104742672 130
342 3300013102 Ga0157371_10889914 Ga0157371_108899142 130
343 3300013297 Ga0157378_10000306 Ga0157378_1000030635 130
344 3300013306 Ga0163162_10176579 Ga0163162_101765793 130
345 3300013308 Ga0157375_10008693 Ga0157375_100086934 130
346 3300013308 Ga0157375_10159543 Ga0157375_101595432 130
347 3300013308 Ga0157375_12833808 Ga0157375_128338082 130
348 3300014325 Ga0163163_10993938 Ga0163163_109939381 130
349 3300014326 Ga0157380_10041864 Ga0157380_100418644 130
350 3300014968 Ga0157379_10091692 Ga0157379_100916923 130
351 3300014968 Ga0157379_11362440 Ga0157379_113624401 130
352 3300014969 Ga0157376_10588165 Ga0157376_105881653 130
353 3300017792 Ga0163161_10913039 Ga0163161_109130392 130
354 3300017792 Ga0163161_11494714 Ga0163161_114947142 130
355 3300021384 Ga0213876_10000097 Ga0213876_1000009742 130
356 3300021384 Ga0213876_10000494 Ga0213876_100004948 130
357 3300025885 Ga0207653_10228892 Ga0207653_102288922 130
358 3300025905 Ga0207685_10000016 Ga0207685_100000169 130
359 3300025910 Ga0207684_10052480 Ga0207684_100524803 130
360 3300025910 Ga0207684_10157660 Ga0207684_101576601 130
361 3300025911 Ga0207654_10303155 Ga0207654_103031551 130
362 3300025922 Ga0207646_10000702 Ga0207646_1000070242 130
363 3300025922 Ga0207646_10021026 Ga0207646_100210263 130
364 3300025922 Ga0207646_10180303 Ga0207646_101803032 130
365 3300025922 Ga0207646_11026260 Ga0207646_110262602 130
366 3300025934 Ga0207686_10000523 Ga0207686_100005237 130
367 3300025934 Ga0207686_10007695 Ga0207686_100076955 130
368 3300025934 Ga0207686_10041081 Ga0207686_100410813 130
369 3300025935 Ga0207709_10195146 Ga0207709_101951462 130
370 3300025935 Ga0207709_10701832 Ga0207709_107018322 130
371 3300025939 Ga0207665_10000029 Ga0207665_1000002922 130
372 3300025945 Ga0207679_10402209 Ga0207679_104022091 130
373 3300025960 Ga0207651_10382875 Ga0207651_103828752 130
374 3300026023 Ga0207677_10941213 Ga0207677_109412132 130
375 3300026035 Ga0207703_10000055 Ga0207703_10000055118 130
376 3300026035 Ga0207703_10153415 Ga0207703_101534152 130
377 3300026118 Ga0207675_100914609 Ga0207675_1009146091 130
378 3300027671 Ga0209588_1066610 Ga0209588_10666101 130
379 3300028381 Ga0268264_11236847 Ga0268264_112368472 130
380 3300030745 Ga0316182_1073585 Ga0316182_10735852 130
381 3300031456 Ga0307513_10003024 Ga0307513_100030246 130
382 3300031824 Ga0307413_10173837 Ga0307413_101738372 130
383 3300031903 Ga0307407_10090092 Ga0307407_100900922 130
384 3300031911 Ga0307412_11566736 Ga0307412_115667362 130
385 3300032004 Ga0307414_10130513 Ga0307414_101305132 130
386 3300032005 Ga0307411_10390287 Ga0307411_103902872 130
387 3300032126 Ga0307415_100095547 Ga0307415_1000955472 130
388 3300032126 Ga0307415_100456418 Ga0307415_1004564182 130
389 3300032126 Ga0307415_101885833 Ga0307415_1018858331 130
390 3300037418 Ga0395900_0489873 Ga0395900_0489873_658_1059 130
391 3300037466 Ga0395898_0767197 Ga0395898_0767197_326_727 130
392 3300037471 Ga0395905_0336345 Ga0395905_0336345_526_927 130
393 3300038996 Ga0242420_050208 Ga0242420_050208_369_770 130
394 3300039437 Ga0436365_0065206 Ga0436365_0065206_258_662 130
395 3300039437 Ga0436365_1230201 Ga0436365_1230201_864_1265 130
396 3300045051 Ga0451576_0125986 Ga0451576_0125986_870_1268 130
397 3300045051 Ga0451576_0926750 Ga0451576_0926750_474_872 130
398 3300045051 Ga0451576_1728688 Ga0451576_1728688_37_438 130
399 3300047318 Ga0495636_0070716 Ga0495636_0070716_631_1029 130
400 3300047318 Ga0495636_0171137 Ga0495636_0171137_329_733 130
401 3300048903 Ga0496100_0128162 Ga0496100_0128162_1123_1527 130
402 3300048903 Ga0496100_1325701 Ga0496100_1325701_72_476 130
403 3300048909 Ga0496106_0002178 Ga0496106_0002178_9520_9924 130
404 3300049705 Ga0501225_0317593 Ga0501225_0317593_44_451 130
405 3300050507 nmdc:mga05p37_102050_c1 nmdc:mga05p37_102050_c1_1189_1590 130
406 3300050511 nmdc:mga08y16_568872_c1 nmdc:mga08y16_568872_c1_410_811 130
407 3300050513 nmdc:mga0rr50_1291376_c1 nmdc:mga0rr50_1291376_c1_100_501 130
408 3300050515 nmdc:mga0a205_301114_c1 nmdc:mga0a205_301114_c1_856_1257 130
409 3300000546 LJNas_1003656 LJNas_10036562 131
410 3300005289 Ga0065704_10112810 Ga0065704_101128102 131
411 3300005331 Ga0070670_100648495 Ga0070670_1006484952 131
412 3300005331 Ga0070670_101781326 Ga0070670_1017813261 131
413 3300005334 Ga0068869_100023093 Ga0068869_1000230932 131
414 3300005366 Ga0070659_100498007 Ga0070659_1004980072 131
415 3300005367 Ga0070667_100949240 Ga0070667_1009492401 131
416 3300005459 Ga0068867_100760320 Ga0068867_1007603202 131
417 3300005459 Ga0068867_102059087 Ga0068867_1020590871 131
418 3300005468 Ga0070707_100277460 Ga0070707_1002774601 131
419 3300005471 Ga0070698_100002468 Ga0070698_10000246811 131
420 3300005471 Ga0070698_101483762 Ga0070698_1014837622 131
421 3300005471 Ga0070698_101825374 Ga0070698_1018253741 131
422 3300005545 Ga0070695_101120491 Ga0070695_1011204911 131
423 3300005617 Ga0068859_100219312 Ga0068859_1002193123 131
424 3300005719 Ga0068861_100003664 Ga0068861_1000036648 131
425 3300005843 Ga0068860_100009117 Ga0068860_1000091176 131
426 3300005844 Ga0068862_101548399 Ga0068862_1015483991 131
427 3300005983 Ga0081540_1076379 Ga0081540_10763792 131
428 3300006852 Ga0075433_10040116 Ga0075433_100401164 131
429 3300006871 Ga0075434_100257785 Ga0075434_1002577852 131
430 3300006871 Ga0075434_101318205 Ga0075434_1013182052 131
431 3300006881 Ga0068865_100741643 Ga0068865_1007416432 131
432 3300006881 Ga0068865_101157090 Ga0068865_1011570902 131
433 3300006881 Ga0068865_101294518 Ga0068865_1012945181 131
434 3300006931 Ga0097620_100219319 Ga0097620_1002193192 131
435 3300009098 Ga0105245_10054989 Ga0105245_100549894 131
436 3300009147 Ga0114129_10574696 Ga0114129_105746963 131
437 3300009147 Ga0114129_11558126 Ga0114129_115581261 131
438 3300009148 Ga0105243_10061491 Ga0105243_100614914 131
439 3300009148 Ga0105243_10128825 Ga0105243_101288253 131
440 3300009553 Ga0105249_10088973 Ga0105249_100889732 131
441 3300009553 Ga0105249_10585876 Ga0105249_105858762 131
442 3300009553 Ga0105249_11152484 Ga0105249_111524842 131
443 3300010375 Ga0105239_10026669 Ga0105239_100266694 131
444 3300010375 Ga0105239_11613306 Ga0105239_116133062 131
445 3300011119 Ga0105246_10621262 Ga0105246_106212621 131
446 3300011119 Ga0105246_12499301 Ga0105246_124993011 131
447 3300013297 Ga0157378_10385772 Ga0157378_103857722 131
448 3300013306 Ga0163162_10025299 Ga0163162_100252993 131
449 3300013306 Ga0163162_10045933 Ga0163162_100459333 131
450 3300013308 Ga0157375_10212627 Ga0157375_102126272 131
451 3300014326 Ga0157380_12281924 Ga0157380_122819241 131
452 3300025901 Ga0207688_10038831 Ga0207688_100388312 131
453 3300025922 Ga0207646_10342432 Ga0207646_103424322 131
454 3300025923 Ga0207681_11053857 Ga0207681_110538571 131
455 3300025925 Ga0207650_10677453 Ga0207650_106774532 131
456 3300025925 Ga0207650_10804441 Ga0207650_108044411 131
457 3300025927 Ga0207687_10341861 Ga0207687_103418612 131
458 3300025932 Ga0207690_10319504 Ga0207690_103195042 131
459 3300025942 Ga0207689_10020293 Ga0207689_100202934 131
460 3300025961 Ga0207712_10038084 Ga0207712_100380843 131
461 3300025961 Ga0207712_10196115 Ga0207712_101961152 131
462 3300025961 Ga0207712_10444311 Ga0207712_104443111 131
463 3300026089 Ga0207648_10726450 Ga0207648_107264502 131
464 3300026118 Ga0207675_100001536 Ga0207675_10000153618 131
465 3300028380 Ga0268265_10454446 Ga0268265_104544462 131
466 3300028381 Ga0268264_10009797 Ga0268264_100097974 131
467 3300031548 Ga0307408_100311970 Ga0307408_1003119702 131
468 3300031731 Ga0307405_10040546 Ga0307405_100405462 131
469 3300032126 Ga0307415_100824099 Ga0307415_1008240991 131
470 3300037418 Ga0395900_1279329 Ga0395900_1279329_17_421 131
471 3300037853 Ga0436364_0380639 Ga0436364_0380639_200_604 131
472 3300039437 Ga0436365_0107567 Ga0436365_0107567_508_912 131
473 3300039453 Ga0436362_0942495 Ga0436362_0942495_27_434 131
474 3300042439 Ga0439464_0009854 Ga0439464_0009854_1817_2224 131
475 3300042876 Ga0451577_0100192 Ga0451577_0100192_1757_2161 131
476 3300045051 Ga0451576_0066981 Ga0451576_0066981_3146_3550 131
477 3300045976 Ga0466967_0652159 Ga0466967_0652159_325_732 131
478 3300046513 Ga0495616_0238750 Ga0495616_0238750_220_627 131
479 3300046519 Ga0495632_0021859 Ga0495632_0021859_1897_2301 131
480 3300049576 Ga0501040_0350372 Ga0501040_0350372_39_485 131
481 3300050507 nmdc:mga05p37_1143790_c1 nmdc:mga05p37_1143790_c1_20_424 131
482 3300050507 nmdc:mga05p37_1342503_c1 nmdc:mga05p37_1342503_c1_254_670 131
483 3300050512 nmdc:mga0n895_628976_c1 nmdc:mga0n895_628976_c1_641_1045 131
484 3300050512 nmdc:mga0n895_72110_c1 nmdc:mga0n895_72110_c1_2931_3338 131
485 3300050515 nmdc:mga0a205_19057_c1 nmdc:mga0a205_19057_c1_275_679 131
486 3300050515 nmdc:mga0a205_202814_c1 nmdc:mga0a205_202814_c1_828_1235 131
487 3300053142 Ga0500577_0003133 Ga0500577_0003133_1738_2145 131
488 3300054114 Ga0501084_0165873 Ga0501084_0165873_12_458 131
489 3300005290 Ga0065712_10005780 Ga0065712_100057804 132
490 3300005293 Ga0065715_10006031 Ga0065715_100060314 132
491 3300005295 Ga0065707_10172124 Ga0065707_101721242 132
492 3300005328 Ga0070676_10077269 Ga0070676_100772692 132
493 3300005334 Ga0068869_100015114 Ga0068869_1000151144 132
494 3300005335 Ga0070666_10030326 Ga0070666_100303264 132
495 3300005338 Ga0068868_100184502 Ga0068868_1001845022 132
496 3300005338 Ga0068868_100602653 Ga0068868_1006026532 132
497 3300005340 Ga0070689_100036244 Ga0070689_1000362442 132
498 3300005343 Ga0070687_100019337 Ga0070687_1000193372 132
499 3300005347 Ga0070668_100637706 Ga0070668_1006377061 132
500 3300005353 Ga0070669_100011406 Ga0070669_1000114066 132
501 3300005354 Ga0070675_100018187 Ga0070675_1000181877 132
502 3300005355 Ga0070671_100111521 Ga0070671_1001115212 132
503 3300005356 Ga0070674_100247880 Ga0070674_1002478802 132
504 3300005365 Ga0070688_100054074 Ga0070688_1000540743 132
505 3300005438 Ga0070701_10478221 Ga0070701_104782211 132
506 3300005440 Ga0070705_100339429 Ga0070705_1003394292 132
507 3300005441 Ga0070700_100036305 Ga0070700_1000363053 132
508 3300005459 Ga0068867_100656911 Ga0068867_1006569112 132
509 3300005543 Ga0070672_100175010 Ga0070672_1001750102 132
510 3300005546 Ga0070696_101263227 Ga0070696_1012632271 132
511 3300005615 Ga0070702_100011855 Ga0070702_1000118554 132
512 3300005616 Ga0068852_100284026 Ga0068852_1002840262 132
513 3300005616 Ga0068852_101663737 Ga0068852_1016637372 132
514 3300005617 Ga0068859_100544983 Ga0068859_1005449832 132
515 3300005617 Ga0068859_102306391 Ga0068859_1023063911 132
516 3300005718 Ga0068866_10005903 Ga0068866_100059034 132
517 3300005719 Ga0068861_100008766 Ga0068861_1000087668 132
518 3300005841 Ga0068863_100159546 Ga0068863_1001595463 132
519 3300005842 Ga0068858_100076555 Ga0068858_1000765552 132
520 3300005843 Ga0068860_100218274 Ga0068860_1002182741 132
521 3300006237 Ga0097621_100028445 Ga0097621_1000284453 132
522 3300006358 Ga0068871_100011823 Ga0068871_1000118234 132
523 3300006881 Ga0068865_100119051 Ga0068865_1001190511 132
524 3300006931 Ga0097620_100544900 Ga0097620_1005449002 132
525 3300006931 Ga0097620_102306344 Ga0097620_1023063441 132
526 3300009094 Ga0111539_12474092 Ga0111539_124740921 132
527 3300009098 Ga0105245_10078701 Ga0105245_100787014 132
528 3300009101 Ga0105247_10376178 Ga0105247_103761782 132
529 3300009147 Ga0114129_10448119 Ga0114129_104481192 132
530 3300009148 Ga0105243_10000427 Ga0105243_100004279 132
531 3300009148 Ga0105243_10028525 Ga0105243_100285252 132
532 3300009176 Ga0105242_10000055 Ga0105242_1000005539 132
533 3300009176 Ga0105242_10053809 Ga0105242_100538094 132
534 3300009177 Ga0105248_10064802 Ga0105248_100648022 132
535 3300009551 Ga0105238_10654257 Ga0105238_106542572 132
536 3300009553 Ga0105249_10082892 Ga0105249_100828924 132
537 3300009553 Ga0105249_10609932 Ga0105249_106099322 132
538 3300011119 Ga0105246_10116298 Ga0105246_101162982 132
539 3300011119 Ga0105246_10661845 Ga0105246_106618452 132
540 3300013102 Ga0157371_11359422 Ga0157371_113594221 132
541 3300013296 Ga0157374_10032094 Ga0157374_100320942 132
542 3300013297 Ga0157378_10055592 Ga0157378_100555922 132
543 3300013306 Ga0163162_10210776 Ga0163162_102107762 132
544 3300013306 Ga0163162_10838813 Ga0163162_108388132 132
545 3300014325 Ga0163163_10093223 Ga0163163_100932231 132
546 3300014325 Ga0163163_10112598 Ga0163163_101125982 132
547 3300014325 Ga0163163_10131741 Ga0163163_101317412 132
548 3300014326 Ga0157380_10039874 Ga0157380_100398742 132
549 3300014969 Ga0157376_10052025 Ga0157376_100520253 132
550 3300017792 Ga0163161_10274740 Ga0163161_102747402 132
551 3300025315 Ga0207697_10028512 Ga0207697_100285122 132
552 3300025899 Ga0207642_10025163 Ga0207642_100251632 132
553 3300025900 Ga0207710_10358883 Ga0207710_103588832 132
554 3300025901 Ga0207688_10345069 Ga0207688_103450692 132
555 3300025903 Ga0207680_10153438 Ga0207680_101534382 132
556 3300025907 Ga0207645_10127522 Ga0207645_101275222 132
557 3300025918 Ga0207662_10024469 Ga0207662_100244692 132
558 3300025918 Ga0207662_10277928 Ga0207662_102779282 132
559 3300025923 Ga0207681_10126558 Ga0207681_101265582 132
560 3300025926 Ga0207659_10690846 Ga0207659_106908462 132
561 3300025931 Ga0207644_10106674 Ga0207644_101066742 132
562 3300025934 Ga0207686_10000038 Ga0207686_1000003874 132
563 3300025934 Ga0207686_10186426 Ga0207686_101864261 132
564 3300025935 Ga0207709_10000017 Ga0207709_1000001767 132
565 3300025935 Ga0207709_10000054 Ga0207709_1000005467 132
566 3300025935 Ga0207709_10026650 Ga0207709_100266502 132
567 3300025937 Ga0207669_10092160 Ga0207669_100921603 132
568 3300025938 Ga0207704_10015890 Ga0207704_100158903 132
569 3300025940 Ga0207691_10000304 Ga0207691_1000030430 132
570 3300025941 Ga0207711_10133311 Ga0207711_101333113 132
571 3300025942 Ga0207689_10007846 Ga0207689_100078465 132
572 3300025960 Ga0207651_10180943 Ga0207651_101809432 132
573 3300025961 Ga0207712_10149286 Ga0207712_101492862 132
574 3300025972 Ga0207668_10992925 Ga0207668_109929252 132
575 3300025986 Ga0207658_10783046 Ga0207658_107830462 132
576 3300026023 Ga0207677_10321122 Ga0207677_103211222 132
577 3300026023 Ga0207677_10469151 Ga0207677_104691511 132
578 3300026035 Ga0207703_10246555 Ga0207703_102465552 132
579 3300026035 Ga0207703_11104542 Ga0207703_111045422 132
580 3300026075 Ga0207708_10032932 Ga0207708_100329323 132
581 3300026088 Ga0207641_10276613 Ga0207641_102766132 132
582 3300026089 Ga0207648_10010725 Ga0207648_100107253 132
583 3300026095 Ga0207676_10440983 Ga0207676_104409832 132
584 3300026095 Ga0207676_10555580 Ga0207676_105555802 132
585 3300026095 Ga0207676_10846327 Ga0207676_108463272 132
586 3300026095 Ga0207676_11985050 Ga0207676_119850501 132
587 3300026118 Ga0207675_100018802 Ga0207675_1000188021 132
588 3300026121 Ga0207683_10074349 Ga0207683_100743492 132
589 3300026142 Ga0207698_10335162 Ga0207698_103351622 132
590 3300026142 Ga0207698_11305368 Ga0207698_113053682 132
591 3300028380 Ga0268265_11848837 Ga0268265_118488371 132
592 3300028381 Ga0268264_10654082 Ga0268264_106540822 132
593 3300031731 Ga0307405_10143853 Ga0307405_101438532 132
594 3300031995 Ga0307409_100309914 Ga0307409_1003099142 132
595 3300032002 Ga0307416_100763158 Ga0307416_1007631582 132
596 3300032004 Ga0307414_10045808 Ga0307414_100458083 132
597 3300032126 Ga0307415_100574526 Ga0307415_1005745262 132
598 3300048907 Ga0496104_1788173 Ga0496104_1788173_87_491 132
599 3300049585 Ga0501069_0059807 Ga0501069_0059807_1218_1622 132
600 3300050507 nmdc:mga05p37_992399_c1 nmdc:mga05p37_992399_c1_341_739 132
601 3300000532 CNAas_1000001 CNAas_100000113 133
602 3300004803 Ga0058862_10623831 Ga0058862_106238312 133
603 3300005293 Ga0065715_10100889 Ga0065715_101008891 133
604 3300005293 Ga0065715_10101130 Ga0065715_101011302 133
605 3300005293 Ga0065715_10698760 Ga0065715_106987602 133
606 3300005330 Ga0070690_100008434 Ga0070690_1000084342 133
607 3300005333 Ga0070677_10132271 Ga0070677_101322712 133
608 3300005334 Ga0068869_100145678 Ga0068869_1001456782 133
609 3300005336 Ga0070680_100000184 Ga0070680_10000018420 133
610 3300005337 Ga0070682_100769253 Ga0070682_1007692531 133
611 3300005338 Ga0068868_100320575 Ga0068868_1003205752 133
612 3300005340 Ga0070689_101071782 Ga0070689_1010717821 133
613 3300005347 Ga0070668_100484583 Ga0070668_1004845832 133
614 3300005353 Ga0070669_100021830 Ga0070669_1000218304 133
615 3300005355 Ga0070671_100045396 Ga0070671_1000453962 133
616 3300005355 Ga0070671_100225853 Ga0070671_1002258531 133
617 3300005364 Ga0070673_100559305 Ga0070673_1005593052 133
618 3300005438 Ga0070701_10460039 Ga0070701_104600392 133
619 3300005444 Ga0070694_100026012 Ga0070694_1000260123 133
620 3300005444 Ga0070694_100296134 Ga0070694_1002961342 133
621 3300005445 Ga0070708_100054011 Ga0070708_1000540114 133
622 3300005457 Ga0070662_100643004 Ga0070662_1006430042 133
623 3300005457 Ga0070662_101341455 Ga0070662_1013414551 133
624 3300005458 Ga0070681_10000011 Ga0070681_1000001176 133
625 3300005458 Ga0070681_10003256 Ga0070681_100032564 133
626 3300005458 Ga0070681_10415655 Ga0070681_104156552 133
627 3300005459 Ga0068867_100052768 Ga0068867_1000527683 133
628 3300005468 Ga0070707_100168722 Ga0070707_1001687223 133
629 3300005471 Ga0070698_100022983 Ga0070698_1000229832 133
630 3300005518 Ga0070699_100054055 Ga0070699_1000540552 133
631 3300005518 Ga0070699_102149088 Ga0070699_1021490881 133
632 3300005530 Ga0070679_100000082 Ga0070679_10000008248 133
633 3300005530 Ga0070679_101935145 Ga0070679_1019351451 133
634 3300005536 Ga0070697_100398511 Ga0070697_1003985112 133
635 3300005536 Ga0070697_100865596 Ga0070697_1008655961 133
636 3300005539 Ga0068853_100056915 Ga0068853_1000569153 133
637 3300005545 Ga0070695_100137785 Ga0070695_1001377852 133
638 3300005545 Ga0070695_100317022 Ga0070695_1003170222 133
639 3300005545 Ga0070695_101050509 Ga0070695_1010505092 133
640 3300005546 Ga0070696_100014797 Ga0070696_1000147975 133
641 3300005546 Ga0070696_100372716 Ga0070696_1003727162 133
642 3300005547 Ga0070693_100078585 Ga0070693_1000785852 133
643 3300005547 Ga0070693_100084524 Ga0070693_1000845242 133
644 3300005548 Ga0070665_100030452 Ga0070665_1000304524 133
645 3300005614 Ga0068856_100178237 Ga0068856_1001782372 133
646 3300005617 Ga0068859_100119246 Ga0068859_1001192463 133
647 3300005618 Ga0068864_100015044 Ga0068864_1000150443 133
648 3300005618 Ga0068864_100970420 Ga0068864_1009704202 133
649 3300005718 Ga0068866_10151344 Ga0068866_101513442 133
650 3300005719 Ga0068861_100013305 Ga0068861_1000133052 133
651 3300005840 Ga0068870_10137569 Ga0068870_101375692 133
652 3300005840 Ga0068870_10591810 Ga0068870_105918102 133
653 3300005841 Ga0068863_100800834 Ga0068863_1008008342 133
654 3300005841 Ga0068863_102595439 Ga0068863_1025954391 133
655 3300005842 Ga0068858_100366131 Ga0068858_1003661312 133
656 3300005843 Ga0068860_101166809 Ga0068860_1011668092 133
657 3300006173 Ga0070716_100811684 Ga0070716_1008116842 133
658 3300006237 Ga0097621_101402010 Ga0097621_1014020102 133
659 3300006358 Ga0068871_100067396 Ga0068871_1000673962 133
660 3300006358 Ga0068871_100122006 Ga0068871_1001220063 133
661 3300006844 Ga0075428_100394983 Ga0075428_1003949832 133
662 3300006852 Ga0075433_10083996 Ga0075433_100839965 133
663 3300006852 Ga0075433_10808316 Ga0075433_108083162 133
664 3300006871 Ga0075434_100034703 Ga0075434_1000347033 133
665 3300006880 Ga0075429_100073304 Ga0075429_1000733042 133
666 3300006931 Ga0097620_100119259 Ga0097620_1001192592 133
667 3300009093 Ga0105240_10077833 Ga0105240_100778332 133
668 3300009098 Ga0105245_10197286 Ga0105245_101972862 133
669 3300009098 Ga0105245_10609330 Ga0105245_106093301 133
670 3300009147 Ga0114129_10546221 Ga0114129_105462212 133
671 3300009174 Ga0105241_10792837 Ga0105241_107928372 133
672 3300009176 Ga0105242_10947289 Ga0105242_109472892 133
673 3300009177 Ga0105248_10130364 Ga0105248_101303641 133
674 3300009177 Ga0105248_12576999 Ga0105248_125769992 133
675 3300009545 Ga0105237_10031999 Ga0105237_100319992 133
676 3300009545 Ga0105237_10041337 Ga0105237_100413374 133
677 3300009545 Ga0105237_10384581 Ga0105237_103845812 133
678 3300009553 Ga0105249_10033970 Ga0105249_100339704 133
679 3300009553 Ga0105249_13223273 Ga0105249_132232731 133
680 3300010375 Ga0105239_10117981 Ga0105239_101179812 133
681 3300011119 Ga0105246_10448294 Ga0105246_104482942 133
682 3300013100 Ga0157373_10094007 Ga0157373_100940072 133
683 3300013296 Ga0157374_10018663 Ga0157374_100186633 133
684 3300013297 Ga0157378_10021650 Ga0157378_100216502 133
685 3300013297 Ga0157378_10421544 Ga0157378_104215442 133
686 3300013306 Ga0163162_10002421 Ga0163162_1000242111 133
687 3300013306 Ga0163162_10492330 Ga0163162_104923302 133
688 3300013307 Ga0157372_10022642 Ga0157372_100226424 133
689 3300013308 Ga0157375_10159458 Ga0157375_101594582 133
690 3300013308 Ga0157375_10923909 Ga0157375_109239091 133
691 3300014325 Ga0163163_10049466 Ga0163163_100494664 133
692 3300014325 Ga0163163_10063488 Ga0163163_100634883 133
693 3300014326 Ga0157380_10029138 Ga0157380_100291382 133
694 3300014326 Ga0157380_12451253 Ga0157380_124512531 133
695 3300014745 Ga0157377_10167013 Ga0157377_101670132 133
696 3300014968 Ga0157379_10298293 Ga0157379_102982931 133
697 3300014968 Ga0157379_10305717 Ga0157379_103057172 133
698 3300014969 Ga0157376_10105617 Ga0157376_101056173 133
699 3300014969 Ga0157376_11451885 Ga0157376_114518852 133
700 3300025315 Ga0207697_10296384 Ga0207697_102963842 133
701 3300025885 Ga0207653_10070812 Ga0207653_100708122 133
702 3300025899 Ga0207642_10109693 Ga0207642_101096932 133
703 3300025901 Ga0207688_10347020 Ga0207688_103470202 133
704 3300025908 Ga0207643_10573152 Ga0207643_105731521 133
705 3300025912 Ga0207707_10000004 Ga0207707_10000004334 133
706 3300025912 Ga0207707_10612807 Ga0207707_106128071 133
707 3300025912 Ga0207707_10816122 Ga0207707_108161222 133
708 3300025913 Ga0207695_10082222 Ga0207695_100822222 133
709 3300025914 Ga0207671_10095869 Ga0207671_100958692 133
710 3300025917 Ga0207660_10044686 Ga0207660_100446863 133
711 3300025921 Ga0207652_10000104 Ga0207652_1000010447 133
712 3300025927 Ga0207687_11270486 Ga0207687_112704862 133
713 3300025931 Ga0207644_10032300 Ga0207644_100323004 133
714 3300025931 Ga0207644_10162468 Ga0207644_101624682 133
715 3300025934 Ga0207686_10621148 Ga0207686_106211482 133
716 3300025942 Ga0207689_10072731 Ga0207689_100727312 133
717 3300025949 Ga0207667_10234185 Ga0207667_102341852 133
718 3300025960 Ga0207651_10143146 Ga0207651_101431462 133
719 3300025960 Ga0207651_10439586 Ga0207651_104395862 133
720 3300025961 Ga0207712_10089148 Ga0207712_100891482 133
721 3300025972 Ga0207668_10912587 Ga0207668_109125872 133
722 3300025981 Ga0207640_11484854 Ga0207640_114848542 133
723 3300025986 Ga0207658_10242298 Ga0207658_102422982 133
724 3300026023 Ga0207677_10174552 Ga0207677_101745522 133
725 3300026041 Ga0207639_11445652 Ga0207639_114456521 133
726 3300026078 Ga0207702_10008690 Ga0207702_100086908 133
727 3300026078 Ga0207702_10702516 Ga0207702_107025161 133
728 3300026088 Ga0207641_10888671 Ga0207641_108886711 133
729 3300026089 Ga0207648_10068424 Ga0207648_100684243 133
730 3300026095 Ga0207676_10974777 Ga0207676_109747772 133
731 3300026095 Ga0207676_11314831 Ga0207676_113148312 133
732 3300026118 Ga0207675_100024463 Ga0207675_1000244635 133
733 3300028379 Ga0268266_10236226 Ga0268266_102362262 133
734 3300028381 Ga0268264_10289900 Ga0268264_102899002 133
735 3300036401 Ga0373937_0249789 Ga0373937_0249789_612_1019 133
736 3300037471 Ga0395905_0844260 Ga0395905_0844260_16_426 133
737 3300038443 Ga0395901_0324289 Ga0395901_0324289_642_1046 133
738 3300038996 Ga0242420_002071 Ga0242420_002071_668_1069 133
739 3300045051 Ga0451576_1378023 Ga0451576_1378023_171_572 133
740 3300048905 Ga0496102_0004552 Ga0496102_0004552_2606_3007 133
741 3300048906 Ga0496103_0035849 Ga0496103_0035849_1755_2156 133
742 3300048907 Ga0496104_0006912 Ga0496104_0006912_1039_1440 133
743 3300048911 Ga0496108_0488066 Ga0496108_0488066_264_665 133
744 3300048913 Ga0496110_0466302 Ga0496110_0466302_506_907 133
745 3300048915 Ga0496112_0669719 Ga0496112_0669719_344_751 133
746 3300048916 Ga0496113_0047124 Ga0496113_0047124_634_1035 133
747 3300050512 nmdc:mga0n895_119398_c1 nmdc:mga0n895_119398_c1_1361_1762 133
748 3300050513 nmdc:mga0rr50_120002_c1 nmdc:mga0rr50_120002_c1_1381_1782 133
749 3300050514 nmdc:mga08x19_138651_c1 nmdc:mga08x19_138651_c1_1158_1571 133
750 3300050515 nmdc:mga0a205_120361_c1 nmdc:mga0a205_120361_c1_1500_1901 133
751 3300050515 nmdc:mga0a205_34219_c1 nmdc:mga0a205_34219_c1_843_1244 133
752 3300050515 nmdc:mga0a205_37582_c1 nmdc:mga0a205_37582_c1_3758_4159 133
753 3300005293 Ga0065715_10280522 Ga0065715_102805222 134
754 3300005328 Ga0070676_11588502 Ga0070676_115885021 134
755 3300005331 Ga0070670_100000662 Ga0070670_1000006626 134
756 3300005331 Ga0070670_100500305 Ga0070670_1005003052 134
757 3300005337 Ga0070682_100000056 Ga0070682_10000005652 134
758 3300005340 Ga0070689_100548176 Ga0070689_1005481762 134
759 3300005343 Ga0070687_100361123 Ga0070687_1003611232 134
760 3300005345 Ga0070692_10964808 Ga0070692_109648082 134
761 3300005353 Ga0070669_100014917 Ga0070669_1000149175 134
762 3300005364 Ga0070673_100078332 Ga0070673_1000783322 134
763 3300005364 Ga0070673_100957073 Ga0070673_1009570732 134
764 3300005365 Ga0070688_100308635 Ga0070688_1003086352 134
765 3300005365 Ga0070688_101009740 Ga0070688_1010097401 134
766 3300005438 Ga0070701_10006984 Ga0070701_100069843 134
767 3300005440 Ga0070705_100126843 Ga0070705_1001268432 134
768 3300005466 Ga0070685_11262843 Ga0070685_112628431 134
769 3300005468 Ga0070707_100690047 Ga0070707_1006900472 134
770 3300005468 Ga0070707_100882092 Ga0070707_1008820921 134
771 3300005471 Ga0070698_100531048 Ga0070698_1005310482 134
772 3300005518 Ga0070699_100330934 Ga0070699_1003309342 134
773 3300005518 Ga0070699_101128189 Ga0070699_1011281892 134
774 3300005536 Ga0070697_100644166 Ga0070697_1006441662 134
775 3300005544 Ga0070686_100019050 Ga0070686_1000190504 134
776 3300005545 Ga0070695_100240685 Ga0070695_1002406852 134
777 3300005548 Ga0070665_100537594 Ga0070665_1005375942 134
778 3300005615 Ga0070702_100408060 Ga0070702_1004080602 134
779 3300005616 Ga0068852_101360094 Ga0068852_1013600942 134
780 3300006852 Ga0075433_10035324 Ga0075433_100353243 134
781 3300006852 Ga0075433_10178573 Ga0075433_101785733 134
782 3300006852 Ga0075433_10286377 Ga0075433_102863772 134
783 3300007076 Ga0075435_100627706 Ga0075435_1006277062 134
784 3300007265 Ga0099794_10007230 Ga0099794_100072302 134
785 3300009098 Ga0105245_11337155 Ga0105245_113371552 134
786 3300009098 Ga0105245_11701532 Ga0105245_117015322 134
787 3300009147 Ga0114129_10003205 Ga0114129_1000320521 134
788 3300009147 Ga0114129_10038541 Ga0114129_100385414 134
789 3300009147 Ga0114129_10244831 Ga0114129_102448312 134
790 3300009147 Ga0114129_10360627 Ga0114129_103606272 134
791 3300009148 Ga0105243_10157483 Ga0105243_101574832 134
792 3300009177 Ga0105248_10356722 Ga0105248_103567222 134
793 3300011119 Ga0105246_10282236 Ga0105246_102822362 134
794 3300013297 Ga0157378_10060314 Ga0157378_100603144 134
795 3300013307 Ga0157372_11191646 Ga0157372_111916462 134
796 3300013307 Ga0157372_11799194 Ga0157372_117991941 134
797 3300013308 Ga0157375_11095886 Ga0157375_110958862 134
798 3300013308 Ga0157375_11721584 Ga0157375_117215841 134
799 3300014325 Ga0163163_11966031 Ga0163163_119660311 134
800 3300014326 Ga0157380_10014118 Ga0157380_100141185 134
801 3300014326 Ga0157380_10551180 Ga0157380_105511801 134
802 3300014326 Ga0157380_10594386 Ga0157380_105943862 134
803 3300025918 Ga0207662_10416908 Ga0207662_104169082 134
804 3300025922 Ga0207646_11857496 Ga0207646_118574961 134
805 3300025923 Ga0207681_10000496 Ga0207681_100004965 134
806 3300025925 Ga0207650_10000611 Ga0207650_1000061115 134
807 3300025925 Ga0207650_11044371 Ga0207650_110443712 134
808 3300025927 Ga0207687_10642857 Ga0207687_106428572 134
809 3300025934 Ga0207686_10933088 Ga0207686_109330882 134
810 3300025935 Ga0207709_10289735 Ga0207709_102897352 134
811 3300025936 Ga0207670_10750703 Ga0207670_107507032 134
812 3300025941 Ga0207711_10399156 Ga0207711_103991562 134
813 3300025960 Ga0207651_10102258 Ga0207651_101022582 134
814 3300025960 Ga0207651_10144685 Ga0207651_101446851 134
815 3300025960 Ga0207651_11280320 Ga0207651_112803202 134
816 3300026075 Ga0207708_10462297 Ga0207708_104622971 134
817 3300026116 Ga0207674_10060027 Ga0207674_100600272 134
818 3300026121 Ga0207683_10457644 Ga0207683_104576441 134
819 3300026142 Ga0207698_11645495 Ga0207698_116454952 134
820 3300028379 Ga0268266_10870497 Ga0268266_108704972 134
821 3300042156 Ga0439446_0017535 Ga0439446_0017535_975_1391 134
822 3300046512 Ga0495610_0073804 Ga0495610_0073804_353_757 134
823 3300046525 Ga0495663_0000580 Ga0495663_0000580_2950_3354 134
824 3300046537 Ga0495598_0017840 Ga0495598_0017840_515_919 134
825 3300046539 Ga0495621_0000070 Ga0495621_0000070_12753_13157 134
826 3300050507 nmdc:mga05p37_149315_c1 nmdc:mga05p37_149315_c1_2052_2468 134
827 3300050507 nmdc:mga05p37_387382_c1 nmdc:mga05p37_387382_c1_583_1008 134
828 3300050507 nmdc:mga05p37_75013_c1 nmdc:mga05p37_75013_c1_2886_3293 134
829 3300050513 nmdc:mga0rr50_599061_c1 nmdc:mga0rr50_599061_c1_290_706 134
830 3300050515 nmdc:mga0a205_128230_c1 nmdc:mga0a205_128230_c1_1031_1438 134
831 3300050515 nmdc:mga0a205_87476_c1 nmdc:mga0a205_87476_c1_1498_1923 134
832 3300002074 JGI24748J21848_1000011 JGI24748J21848_100001120 135
833 3300002239 JGI24034J26672_10000037 JGI24034J26672_1000003710 135
834 3300002459 JGI24751J29686_10000090 JGI24751J29686_1000009018 135
835 3300003320 rootH2_10200195 rootH2_102001952 135
836 3300005288 Ga0065714_10064436 Ga0065714_1006443665 135
837 3300005290 Ga0065712_10000112 Ga0065712_10000112258 135
838 3300005290 Ga0065712_10020803 Ga0065712_100208033 135
839 3300005290 Ga0065712_10112434 Ga0065712_101124342 135
840 3300005293 Ga0065715_10093501 Ga0065715_100935015 135
841 3300005293 Ga0065715_10105039 Ga0065715_101050393 135
842 3300005293 Ga0065715_10135543 Ga0065715_101355432 135
843 3300005293 Ga0065715_10205221 Ga0065715_102052212 135
844 3300005293 Ga0065715_10570565 Ga0065715_105705651 135
845 3300005295 Ga0065707_10107142 Ga0065707_101071423 135
846 3300005295 Ga0065707_10292646 Ga0065707_102926461 135
847 3300005328 Ga0070676_10756140 Ga0070676_107561402 135
848 3300005328 Ga0070676_10900281 Ga0070676_109002812 135
849 3300005330 Ga0070690_100262428 Ga0070690_1002624282 135
850 3300005331 Ga0070670_100028553 Ga0070670_1000285532 135
851 3300005331 Ga0070670_101511712 Ga0070670_1015117121 135
852 3300005333 Ga0070677_10846944 Ga0070677_108469441 135
853 3300005335 Ga0070666_10475273 Ga0070666_104752731 135
854 3300005338 Ga0068868_101032229 Ga0068868_1010322292 135
855 3300005340 Ga0070689_100224335 Ga0070689_1002243352 135
856 3300005340 Ga0070689_100753361 Ga0070689_1007533612 135
857 3300005343 Ga0070687_100352144 Ga0070687_1003521441 135
858 3300005345 Ga0070692_10128815 Ga0070692_101288151 135
859 3300005347 Ga0070668_100003549 Ga0070668_10000354910 135
860 3300005347 Ga0070668_100834151 Ga0070668_1008341511 135
861 3300005353 Ga0070669_100032501 Ga0070669_1000325014 135
862 3300005353 Ga0070669_101436510 Ga0070669_1014365101 135
863 3300005355 Ga0070671_100365826 Ga0070671_1003658262 135
864 3300005356 Ga0070674_100420086 Ga0070674_1004200862 135
865 3300005364 Ga0070673_100027626 Ga0070673_1000276265 135
866 3300005364 Ga0070673_100830063 Ga0070673_1008300632 135
867 3300005364 Ga0070673_101007778 Ga0070673_1010077782 135
868 3300005365 Ga0070688_100371754 Ga0070688_1003717542 135
869 3300005366 Ga0070659_100548975 Ga0070659_1005489752 135
870 3300005438 Ga0070701_10055325 Ga0070701_100553252 135
871 3300005441 Ga0070700_100079913 Ga0070700_1000799132 135
872 3300005444 Ga0070694_100130693 Ga0070694_1001306932 135
873 3300005445 Ga0070708_100738224 Ga0070708_1007382242 135
874 3300005467 Ga0070706_100221407 Ga0070706_1002214071 135
875 3300005471 Ga0070698_101832920 Ga0070698_1018329201 135
876 3300005518 Ga0070699_100162697 Ga0070699_1001626972 135
877 3300005536 Ga0070697_100521869 Ga0070697_1005218692 135
878 3300005536 Ga0070697_101697535 Ga0070697_1016975351 135
879 3300005539 Ga0068853_101789253 Ga0068853_1017892531 135
880 3300005543 Ga0070672_101566607 Ga0070672_1015666071 135
881 3300005545 Ga0070695_100419601 Ga0070695_1004196011 135
882 3300005546 Ga0070696_100052543 Ga0070696_1000525432 135
883 3300005547 Ga0070693_100137432 Ga0070693_1001374322 135
884 3300005548 Ga0070665_101536546 Ga0070665_1015365462 135
885 3300005549 Ga0070704_100144967 Ga0070704_1001449672 135
886 3300005549 Ga0070704_100383377 Ga0070704_1003833772 135
887 3300005577 Ga0068857_100346680 Ga0068857_1003466802 135
888 3300005578 Ga0068854_100240512 Ga0068854_1002405123 135
889 3300005616 Ga0068852_100248759 Ga0068852_1002487592 135
890 3300005617 Ga0068859_100142620 Ga0068859_1001426202 135
891 3300005617 Ga0068859_100165049 Ga0068859_1001650493 135
892 3300005617 Ga0068859_100178819 Ga0068859_1001788193 135
893 3300005617 Ga0068859_100308323 Ga0068859_1003083232 135
894 3300005618 Ga0068864_100153645 Ga0068864_1001536453 135
895 3300005618 Ga0068864_100327584 Ga0068864_1003275842 135
896 3300005618 Ga0068864_101515049 Ga0068864_1015150492 135
897 3300005842 Ga0068858_100000052 Ga0068858_1000000525 135
898 3300005842 Ga0068858_100048547 Ga0068858_1000485472 135
899 3300005842 Ga0068858_100233895 Ga0068858_1002338952 135
900 3300005843 Ga0068860_100791228 Ga0068860_1007912281 135
901 3300005843 Ga0068860_101131784 Ga0068860_1011317842 135
902 3300005843 Ga0068860_101562509 Ga0068860_1015625091 135
903 3300005844 Ga0068862_100512311 Ga0068862_1005123112 135
904 3300005844 Ga0068862_101310509 Ga0068862_1013105092 135
905 3300006173 Ga0070716_100072797 Ga0070716_1000727971 135
906 3300006237 Ga0097621_101014405 Ga0097621_1010144052 135
907 3300006881 Ga0068865_100389982 Ga0068865_1003899821 135
908 3300006931 Ga0097620_100142618 Ga0097620_1001426182 135
909 3300006931 Ga0097620_100165041 Ga0097620_1001650413 135
910 3300006931 Ga0097620_100178810 Ga0097620_1001788103 135
911 3300006931 Ga0097620_100308332 Ga0097620_1003083322 135
912 3300009011 Ga0105251_10441401 Ga0105251_104414012 135
913 3300009092 Ga0105250_10039522 Ga0105250_100395222 135
914 3300009093 Ga0105240_10862437 Ga0105240_108624372 135
915 3300009098 Ga0105245_10575529 Ga0105245_105755291 135
916 3300009098 Ga0105245_11753660 Ga0105245_117536602 135
917 3300009101 Ga0105247_10001595 Ga0105247_1000159515 135
918 3300009148 Ga0105243_10752995 Ga0105243_107529952 135
919 3300009148 Ga0105243_12008994 Ga0105243_120089942 135
920 3300009174 Ga0105241_10049240 Ga0105241_100492405 135
921 3300009174 Ga0105241_12553672 Ga0105241_125536721 135
922 3300009176 Ga0105242_10671319 Ga0105242_106713192 135
923 3300009177 Ga0105248_10539287 Ga0105248_105392872 135
924 3300009177 Ga0105248_10544930 Ga0105248_105449302 135
925 3300009177 Ga0105248_10676164 Ga0105248_106761641 135
926 3300009545 Ga0105237_10174084 Ga0105237_101740841 135
927 3300009551 Ga0105238_10196168 Ga0105238_101961683 135
928 3300009551 Ga0105238_11516798 Ga0105238_115167982 135
929 3300009553 Ga0105249_10000118 Ga0105249_10000118101 135
930 3300009553 Ga0105249_10256746 Ga0105249_102567462 135
931 3300009553 Ga0105249_11537789 Ga0105249_115377892 135
932 3300011119 Ga0105246_10479748 Ga0105246_104797482 135
933 3300013100 Ga0157373_10096261 Ga0157373_100962611 135
934 3300013100 Ga0157373_10160957 Ga0157373_101609572 135
935 3300013296 Ga0157374_12578649 Ga0157374_125786492 135
936 3300013297 Ga0157378_10021111 Ga0157378_100211112 135
937 3300013297 Ga0157378_11054280 Ga0157378_110542802 135
938 3300013306 Ga0163162_10000059 Ga0163162_100000599 135
939 3300013306 Ga0163162_10761098 Ga0163162_107610982 135
940 3300013308 Ga0157375_10038260 Ga0157375_100382602 135
941 3300013308 Ga0157375_10551849 Ga0157375_105518491 135
942 3300013308 Ga0157375_10995843 Ga0157375_109958432 135
943 3300013308 Ga0157375_11193622 Ga0157375_111936222 135
944 3300013308 Ga0157375_13721024 Ga0157375_137210242 135
945 3300014325 Ga0163163_10097484 Ga0163163_100974843 135
946 3300014325 Ga0163163_11390546 Ga0163163_113905462 135
947 3300014325 Ga0163163_11756487 Ga0163163_117564871 135
948 3300014325 Ga0163163_13078711 Ga0163163_130787112 135
949 3300014326 Ga0157380_10094411 Ga0157380_100944112 135
950 3300014745 Ga0157377_10253457 Ga0157377_102534572 135
951 3300014968 Ga0157379_10554224 Ga0157379_105542242 135
952 3300015262 Ga0182007_10080576 Ga0182007_100805762 135
953 3300025899 Ga0207642_10059546 Ga0207642_100595462 135
954 3300025900 Ga0207710_10000001 Ga0207710_10000001834 135
955 3300025900 Ga0207710_10015408 Ga0207710_100154082 135
956 3300025907 Ga0207645_10274022 Ga0207645_102740221 135
957 3300025908 Ga0207643_10069259 Ga0207643_100692592 135
958 3300025910 Ga0207684_10097755 Ga0207684_100977552 135
959 3300025913 Ga0207695_10863482 Ga0207695_108634822 135
960 3300025917 Ga0207660_10366089 Ga0207660_103660892 135
961 3300025918 Ga0207662_10117654 Ga0207662_101176542 135
962 3300025919 Ga0207657_10695695 Ga0207657_106956951 135
963 3300025923 Ga0207681_10258435 Ga0207681_102584352 135
964 3300025924 Ga0207694_10018358 Ga0207694_100183585 135
965 3300025925 Ga0207650_10000001 Ga0207650_100000011197 135
966 3300025925 Ga0207650_10270187 Ga0207650_102701872 135
967 3300025931 Ga0207644_10003161 Ga0207644_100031617 135
968 3300025931 Ga0207644_10118517 Ga0207644_101185172 135
969 3300025932 Ga0207690_10303517 Ga0207690_103035172 135
970 3300025932 Ga0207690_10987117 Ga0207690_109871171 135
971 3300025933 Ga0207706_10136562 Ga0207706_101365623 135
972 3300025934 Ga0207686_10203974 Ga0207686_102039742 135
973 3300025934 Ga0207686_10239299 Ga0207686_102392992 135
974 3300025935 Ga0207709_10452319 Ga0207709_104523192 135
975 3300025935 Ga0207709_10930856 Ga0207709_109308562 135
976 3300025936 Ga0207670_10722628 Ga0207670_107226282 135
977 3300025938 Ga0207704_10842176 Ga0207704_108421762 135
978 3300025939 Ga0207665_10056725 Ga0207665_100567253 135
979 3300025940 Ga0207691_10085102 Ga0207691_100851022 135
980 3300025941 Ga0207711_10152792 Ga0207711_101527922 135
981 3300025941 Ga0207711_10273910 Ga0207711_102739102 135
982 3300025941 Ga0207711_10537366 Ga0207711_105373662 135
983 3300025945 Ga0207679_10973098 Ga0207679_109730981 135
984 3300025961 Ga0207712_10000106 Ga0207712_1000010643 135
985 3300025961 Ga0207712_10011969 Ga0207712_100119695 135
986 3300025972 Ga0207668_10017983 Ga0207668_100179835 135
987 3300025981 Ga0207640_10477371 Ga0207640_104773712 135
988 3300025981 Ga0207640_10955095 Ga0207640_109550952 135
989 3300026035 Ga0207703_10466776 Ga0207703_104667762 135
990 3300026035 Ga0207703_10515203 Ga0207703_105152032 135
991 3300026035 Ga0207703_10538181 Ga0207703_105381812 135
992 3300026075 Ga0207708_10006071 Ga0207708_100060713 135
993 3300026088 Ga0207641_10766313 Ga0207641_107663131 135
994 3300026089 Ga0207648_10062873 Ga0207648_100628734 135
995 3300026095 Ga0207676_10549896 Ga0207676_105498962 135
996 3300026095 Ga0207676_10710131 Ga0207676_107101312 135
997 3300026095 Ga0207676_10727068 Ga0207676_107270681 135
998 3300026095 Ga0207676_11118869 Ga0207676_111188692 135
999 3300026116 Ga0207674_10325862 Ga0207674_103258622 135
1000 3300026116 Ga0207674_10864614 Ga0207674_108646142 135
1001 3300026118 Ga0207675_101088259 Ga0207675_1010882592 135
1002 3300026142 Ga0207698_11150914 Ga0207698_111509142 135
1003 3300026142 Ga0207698_11495849 Ga0207698_114958491 135
1004 3300028380 Ga0268265_10502560 Ga0268265_105025602 135
1005 3300028380 Ga0268265_11453643 Ga0268265_114536432 135
1006 3300028381 Ga0268264_10126884 Ga0268264_101268842 135
1007 3300028381 Ga0268264_10717415 Ga0268264_107174152 135
1008 3300028381 Ga0268264_11479551 Ga0268264_114795512 135
1009 3300031456 Ga0307513_10712592 Ga0307513_107125922 135
1010 3300031852 Ga0307410_11058577 Ga0307410_110585771 135
1011 3300035114 Ga0373939_0249631 Ga0373939_0249631_76_489 135
1012 3300035242 Ga0373962_0185164 Ga0373962_0185164_192_605 135
1013 3300035691 Ga0373931_0424676 Ga0373931_0424676_181_594 135
1014 3300038699 Ga0242422_02188 Ga0242422_02188_769_1182 135
1015 3300038996 Ga0242420_030651 Ga0242420_030651_492_905 135
1016 3300048909 Ga0496106_0088497 Ga0496106_0088497_1100_1513 135
1017 3300048910 Ga0496107_0064984 Ga0496107_0064984_1059_1472 135
1018 3300048910 Ga0496107_0961156 Ga0496107_0961156_142_555 135
1019 3300048915 Ga0496112_0253342 Ga0496112_0253342_440_853 135
1020 3300048915 Ga0496112_0496101 Ga0496112_0496101_629_1042 135
1021 3300049583 Ga0501067_0221815 Ga0501067_0221815_261_680 135
1022 3300003203 JGI25406J46586_10021885 JGI25406J46586_100218851 136
1023 3300005293 Ga0065715_10246604 Ga0065715_102466042 136
1024 3300005328 Ga0070676_10854435 Ga0070676_108544352 136
1025 3300005330 Ga0070690_100151808 Ga0070690_1001518082 136
1026 3300005330 Ga0070690_100205527 Ga0070690_1002055272 136
1027 3300005331 Ga0070670_100038712 Ga0070670_1000387123 136
1028 3300005334 Ga0068869_100521001 Ga0068869_1005210012 136
1029 3300005336 Ga0070680_100051276 Ga0070680_1000512762 136
1030 3300005337 Ga0070682_100447739 Ga0070682_1004477392 136
1031 3300005339 Ga0070660_100020439 Ga0070660_1000204394 136
1032 3300005340 Ga0070689_100222576 Ga0070689_1002225761 136
1033 3300005343 Ga0070687_100365703 Ga0070687_1003657032 136
1034 3300005343 Ga0070687_101007386 Ga0070687_1010073861 136
1035 3300005364 Ga0070673_101786310 Ga0070673_1017863101 136
1036 3300005366 Ga0070659_100002005 Ga0070659_10000200511 136
1037 3300005438 Ga0070701_11293673 Ga0070701_112936731 136
1038 3300005441 Ga0070700_100002821 Ga0070700_1000028213 136
1039 3300005444 Ga0070694_100020337 Ga0070694_1000203373 136
1040 3300005444 Ga0070694_100283364 Ga0070694_1002833642 136
1041 3300005444 Ga0070694_100705191 Ga0070694_1007051912 136
1042 3300005444 Ga0070694_101120718 Ga0070694_1011207181 136
1043 3300005445 Ga0070708_100036564 Ga0070708_1000365643 136
1044 3300005458 Ga0070681_10018743 Ga0070681_100187432 136
1045 3300005467 Ga0070706_100310223 Ga0070706_1003102231 136
1046 3300005467 Ga0070706_100655835 Ga0070706_1006558352 136
1047 3300005467 Ga0070706_100664793 Ga0070706_1006647931 136
1048 3300005468 Ga0070707_100618499 Ga0070707_1006184992 136
1049 3300005471 Ga0070698_100945854 Ga0070698_1009458542 136
1050 3300005518 Ga0070699_100013675 Ga0070699_1000136754 136
1051 3300005518 Ga0070699_101206819 Ga0070699_1012068191 136
1052 3300005530 Ga0070679_100129079 Ga0070679_1001290792 136
1053 3300005536 Ga0070697_100000128 Ga0070697_10000012840 136
1054 3300005536 Ga0070697_100114890 Ga0070697_1001148902 136
1055 3300005539 Ga0068853_100004734 Ga0068853_1000047348 136
1056 3300005545 Ga0070695_100007438 Ga0070695_1000074384 136
1057 3300005545 Ga0070695_100338129 Ga0070695_1003381292 136
1058 3300005545 Ga0070695_100353240 Ga0070695_1003532401 136
1059 3300005545 Ga0070695_100685467 Ga0070695_1006854672 136
1060 3300005546 Ga0070696_100165295 Ga0070696_1001652952 136
1061 3300005546 Ga0070696_100336761 Ga0070696_1003367612 136
1062 3300005546 Ga0070696_100625213 Ga0070696_1006252131 136
1063 3300005547 Ga0070693_100375454 Ga0070693_1003754542 136
1064 3300005548 Ga0070665_100767375 Ga0070665_1007673752 136
1065 3300005563 Ga0068855_100211858 Ga0068855_1002118583 136
1066 3300005564 Ga0070664_100000648 Ga0070664_10000064823 136
1067 3300005564 Ga0070664_100268899 Ga0070664_1002688992 136
1068 3300005564 Ga0070664_100410689 Ga0070664_1004106892 136
1069 3300005577 Ga0068857_100002248 Ga0068857_1000022484 136
1070 3300005577 Ga0068857_100063112 Ga0068857_1000631122 136
1071 3300005577 Ga0068857_101716540 Ga0068857_1017165401 136
1072 3300005578 Ga0068854_101170314 Ga0068854_1011703142 136
1073 3300005617 Ga0068859_100020470 Ga0068859_1000204703 136
1074 3300005617 Ga0068859_100066178 Ga0068859_1000661786 136
1075 3300005617 Ga0068859_100795984 Ga0068859_1007959842 136
1076 3300005618 Ga0068864_100345804 Ga0068864_1003458042 136
1077 3300005840 Ga0068870_10081337 Ga0068870_100813372 136
1078 3300005841 Ga0068863_100310209 Ga0068863_1003102092 136
1079 3300005841 Ga0068863_100391081 Ga0068863_1003910812 136
1080 3300005842 Ga0068858_100208725 Ga0068858_1002087252 136
1081 3300005843 Ga0068860_100707737 Ga0068860_1007077372 136
1082 3300005844 Ga0068862_100320895 Ga0068862_1003208952 136
1083 3300005985 Ga0081539_10000886 Ga0081539_1000088628 136
1084 3300006847 Ga0075431_100969092 Ga0075431_1009690922 136
1085 3300006852 Ga0075433_10066566 Ga0075433_100665662 136
1086 3300006871 Ga0075434_100275926 Ga0075434_1002759262 136
1087 3300006931 Ga0097620_100020470 Ga0097620_1000204703 136
1088 3300006931 Ga0097620_100066182 Ga0097620_1000661822 136
1089 3300006931 Ga0097620_100796125 Ga0097620_1007961252 136
1090 3300009098 Ga0105245_10737743 Ga0105245_107377431 136
1091 3300009147 Ga0114129_12390483 Ga0114129_123904831 136
1092 3300009148 Ga0105243_10202676 Ga0105243_102026762 136
1093 3300009148 Ga0105243_10587014 Ga0105243_105870142 136
1094 3300009174 Ga0105241_10113615 Ga0105241_101136153 136
1095 3300009174 Ga0105241_10644921 Ga0105241_106449212 136
1096 3300009174 Ga0105241_10697845 Ga0105241_106978452 136
1097 3300009174 Ga0105241_10810754 Ga0105241_108107542 136
1098 3300009176 Ga0105242_10929747 Ga0105242_109297472 136
1099 3300009177 Ga0105248_10005046 Ga0105248_100050463 136
1100 3300009177 Ga0105248_10078295 Ga0105248_100782952 136
1101 3300009177 Ga0105248_11214043 Ga0105248_112140432 136
1102 3300009545 Ga0105237_10520558 Ga0105237_105205582 136
1103 3300009553 Ga0105249_10330601 Ga0105249_103306012 136
1104 3300010375 Ga0105239_11490507 Ga0105239_114905072 136
1105 3300011119 Ga0105246_10592702 Ga0105246_105927022 136
1106 3300013100 Ga0157373_10292036 Ga0157373_102920362 136
1107 3300013100 Ga0157373_10451053 Ga0157373_104510532 136
1108 3300013100 Ga0157373_10461869 Ga0157373_104618692 136
1109 3300013102 Ga0157371_10808081 Ga0157371_108080812 136
1110 3300013296 Ga0157374_10567230 Ga0157374_105672302 136
1111 3300013296 Ga0157374_12206128 Ga0157374_122061281 136
1112 3300013297 Ga0157378_10518998 Ga0157378_105189982 136
1113 3300013297 Ga0157378_11469214 Ga0157378_114692141 136
1114 3300013297 Ga0157378_11654225 Ga0157378_116542252 136
1115 3300013306 Ga0163162_10104199 Ga0163162_101041992 136
1116 3300013306 Ga0163162_11207487 Ga0163162_112074871 136
1117 3300013306 Ga0163162_11645210 Ga0163162_116452102 136
1118 3300013307 Ga0157372_12149970 Ga0157372_121499702 136
1119 3300013308 Ga0157375_10891053 Ga0157375_108910532 136
1120 3300013308 Ga0157375_11208898 Ga0157375_112088982 136
1121 3300013308 Ga0157375_11400537 Ga0157375_114005372 136
1122 3300013308 Ga0157375_11636013 Ga0157375_116360132 136
1123 3300014325 Ga0163163_10016408 Ga0163163_100164085 136
1124 3300014325 Ga0163163_10088196 Ga0163163_100881962 136
1125 3300014325 Ga0163163_10160546 Ga0163163_101605462 136
1126 3300014325 Ga0163163_11939884 Ga0163163_119398842 136
1127 3300014326 Ga0157380_10001946 Ga0157380_100019465 136
1128 3300014326 Ga0157380_10277276 Ga0157380_102772762 136
1129 3300015265 Ga0182005_1143147 Ga0182005_11431472 136
1130 3300017792 Ga0163161_11175232 Ga0163161_111752321 136
1131 3300025904 Ga0207647_10468101 Ga0207647_104681011 136
1132 3300025908 Ga0207643_10072857 Ga0207643_100728572 136
1133 3300025910 Ga0207684_10086273 Ga0207684_100862733 136
1134 3300025911 Ga0207654_10067245 Ga0207654_100672452 136
1135 3300025911 Ga0207654_10449620 Ga0207654_104496202 136
1136 3300025911 Ga0207654_10805948 Ga0207654_108059481 136
1137 3300025911 Ga0207654_11012913 Ga0207654_110129132 136
1138 3300025912 Ga0207707_10003977 Ga0207707_100039774 136
1139 3300025917 Ga0207660_10045568 Ga0207660_100455683 136
1140 3300025918 Ga0207662_10198364 Ga0207662_101983642 136
1141 3300025919 Ga0207657_10041828 Ga0207657_100418282 136
1142 3300025921 Ga0207652_10055486 Ga0207652_100554862 136
1143 3300025932 Ga0207690_10032570 Ga0207690_100325702 136
1144 3300025934 Ga0207686_10474895 Ga0207686_104748951 136
1145 3300025936 Ga0207670_10000667 Ga0207670_100006674 136
1146 3300025941 Ga0207711_10004568 Ga0207711_100045682 136
1147 3300025941 Ga0207711_10099985 Ga0207711_100999853 136
1148 3300025942 Ga0207689_10431396 Ga0207689_104313962 136
1149 3300025942 Ga0207689_10829293 Ga0207689_108292932 136
1150 3300025945 Ga0207679_10016866 Ga0207679_100168664 136
1151 3300025945 Ga0207679_10222531 Ga0207679_102225312 136
1152 3300025949 Ga0207667_10159212 Ga0207667_101592123 136
1153 3300025960 Ga0207651_10577771 Ga0207651_105777712 136
1154 3300025960 Ga0207651_10911857 Ga0207651_109118572 136
1155 3300025986 Ga0207658_11165236 Ga0207658_111652362 136
1156 3300026023 Ga0207677_10854941 Ga0207677_108549412 136
1157 3300026023 Ga0207677_11981096 Ga0207677_119810961 136
1158 3300026035 Ga0207703_10142173 Ga0207703_101421732 136
1159 3300026041 Ga0207639_10026569 Ga0207639_100265693 136
1160 3300026075 Ga0207708_10005653 Ga0207708_100056533 136
1161 3300026075 Ga0207708_10735632 Ga0207708_107356321 136
1162 3300026088 Ga0207641_10047513 Ga0207641_100475133 136
1163 3300026088 Ga0207641_10367883 Ga0207641_103678832 136
1164 3300026089 Ga0207648_10226507 Ga0207648_102265072 136
1165 3300026095 Ga0207676_10058846 Ga0207676_100588462 136
1166 3300026095 Ga0207676_10268416 Ga0207676_102684162 136
1167 3300026116 Ga0207674_10000216 Ga0207674_1000021611 136
1168 3300026118 Ga0207675_100097766 Ga0207675_1000977662 136
1169 3300028379 Ga0268266_10644512 Ga0268266_106445122 136
1170 3300028380 Ga0268265_10764330 Ga0268265_107643302 136
1171 3300028381 Ga0268264_10289226 Ga0268264_102892262 136
1172 3300031548 Ga0307408_100001805 Ga0307408_1000018054 136
1173 3300031731 Ga0307405_10003348 Ga0307405_100033483 136
1174 3300031824 Ga0307413_10027109 Ga0307413_100271092 136
1175 3300031852 Ga0307410_10858120 Ga0307410_108581202 136
1176 3300031901 Ga0307406_10001256 Ga0307406_100012563 136
1177 3300031911 Ga0307412_10005163 Ga0307412_100051633 136
1178 3300032002 Ga0307416_100028260 Ga0307416_1000282603 136
1179 3300032004 Ga0307414_10002516 Ga0307414_100025163 136
1180 3300032005 Ga0307411_10003361 Ga0307411_100033614 136
1181 3300032126 Ga0307415_100007668 Ga0307415_1000076682 136
1182 3300034957 Ga0373938_0053600 Ga0373938_0053600_417_830 136
1183 3300035088 Ga0373940_0114930 Ga0373940_0114930_331_744 136
1184 3300035114 Ga0373939_0009671 Ga0373939_0009671_201_614 136
1185 3300035691 Ga0373931_0258986 Ga0373931_0258986_624_1037 136
1186 3300037418 Ga0395900_0362384 Ga0395900_0362384_759_1169 136
1187 3300037466 Ga0395898_0095641 Ga0395898_0095641_766_1176 136
1188 3300037466 Ga0395898_0434197 Ga0395898_0434197_14_427 136
1189 3300037471 Ga0395905_0524784 Ga0395905_0524784_196_606 136
1190 3300041410 Ga0439461_0046108 Ga0439461_0046108_511_933 136
1191 3300042012 Ga0439455_0020761 Ga0439455_0020761_567_980 136
1192 3300042130 Ga0450892_012353 Ga0450892_012353_325_738 136
1193 3300042157 Ga0439458_0004968 Ga0439458_0004968_44_457 136
1194 3300046539 Ga0495621_0002026 Ga0495621_0002026_3158_3580 136
1195 3300049515 Ga0501292_017461 Ga0501292_017461_425_838 136
1196 3300049521 Ga0501298_015924 Ga0501298_015924_216_629 136
1197 3300049574 Ga0501038_0007225 Ga0501038_0007225_8747_9166 136
1198 3300049649 Ga0501198_002258 Ga0501198_002258_2145_2558 136
1199 3300049650 Ga0501199_008505 Ga0501199_008505_621_1034 136
1200 3300049652 Ga0501202_004782 Ga0501202_004782_233_646 136
1201 3300049656 Ga0501209_025400 Ga0501209_025400_730_1143 136
1202 3300049660 Ga0501216_001937 Ga0501216_001937_633_1046 136
1203 3300049661 Ga0501217_004189 Ga0501217_004189_2337_2750 136
1204 3300049663 Ga0501223_000430 Ga0501223_000430_1527_1940 136
1205 3300049664 Ga0501224_000314 Ga0501224_000314_3467_3880 136
1206 3300049665 Ga0501227_000962 Ga0501227_000962_3247_3660 136
1207 3300049666 Ga0501228_022534 Ga0501228_022534_262_675 136
1208 3300049667 Ga0501230_000860 Ga0501230_000860_1385_1798 136
1209 3300049668 Ga0501233_004184 Ga0501233_004184_1135_1548 136
1210 3300049669 Ga0501235_118604 Ga0501235_118604_48_461 136
1211 3300049670 Ga0501236_019458 Ga0501236_019458_564_977 136
1212 3300049672 Ga0501239_046700 Ga0501239_046700_48_461 136
1213 3300049679 Ga0501249_015946 Ga0501249_015946_655_1068 136
1214 3300049683 Ga0501253_021767 Ga0501253_021767_458_871 136
1215 3300049686 Ga0501257_006118 Ga0501257_006118_490_903 136
1216 3300049688 Ga0501259_002934 Ga0501259_002934_1765_2178 136
1217 3300049689 Ga0501260_004427 Ga0501260_004427_495_908 136
1218 3300049703 Ga0501219_002767 Ga0501219_002767_476_889 136
1219 3300049704 Ga0501221_005689 Ga0501221_005689_57_470 136
1220 3300049705 Ga0501225_0000370 Ga0501225_0000370_7995_8408 136
1221 3300049707 Ga0501234_004627 Ga0501234_004627_1422_1835 136
1222 3300049765 Ga0501268_001359 Ga0501268_001359_976_1389 136
1223 3300049779 Ga0501283_042518 Ga0501283_042518_163_576 136
1224 3300049851 Ga0501212_002018 Ga0501212_002018_356_769 136
1225 3300049853 Ga0501226_000453 Ga0501226_000453_3305_3718 136
1226 3300050507 nmdc:mga05p37_607556_c1 nmdc:mga05p37_607556_c1_781_1194 136
1227 3300050510 nmdc:mga06r32_1044594_c1 nmdc:mga06r32_1044594_c1_104_517 136
1228 3300050512 nmdc:mga0n895_872365_c1 nmdc:mga0n895_872365_c1_162_575 136
1229 3300053153 Ga0500616_0018396 Ga0500616_0018396_1449_1871 136
1230 2162886007 SwRhRL2b_contig_2744889 SwRhRL2b_0995.00001560 137
1231 2162886007 SwRhRL2b_contig_51888 SwRhRL2b_0117.00006250 137
1232 3300005289 Ga0065704_10003281 Ga0065704_100032813 137
1233 3300005290 Ga0065712_10119130 Ga0065712_101191302 137
1234 3300005293 Ga0065715_10092721 Ga0065715_100927213 137
1235 3300005293 Ga0065715_10678556 Ga0065715_106785561 137
1236 3300005295 Ga0065707_10002788 Ga0065707_100027883 137
1237 3300005295 Ga0065707_10615879 Ga0065707_106158792 137
1238 3300005328 Ga0070676_11137491 Ga0070676_111374912 137
1239 3300005334 Ga0068869_100137670 Ga0068869_1001376702 137
1240 3300005343 Ga0070687_100142385 Ga0070687_1001423852 137
1241 3300005344 Ga0070661_100114169 Ga0070661_1001141692 137
1242 3300005345 Ga0070692_10176336 Ga0070692_101763362 137
1243 3300005345 Ga0070692_10497778 Ga0070692_104977782 137
1244 3300005354 Ga0070675_100277940 Ga0070675_1002779402 137
1245 3300005355 Ga0070671_100263410 Ga0070671_1002634102 137
1246 3300005364 Ga0070673_100014868 Ga0070673_1000148685 137
1247 3300005366 Ga0070659_101068449 Ga0070659_1010684492 137
1248 3300005440 Ga0070705_101013329 Ga0070705_1010133292 137
1249 3300005441 Ga0070700_100151251 Ga0070700_1001512512 137
1250 3300005444 Ga0070694_100134018 Ga0070694_1001340183 137
1251 3300005444 Ga0070694_100209823 Ga0070694_1002098232 137
1252 3300005458 Ga0070681_10025179 Ga0070681_100251792 137
1253 3300005467 Ga0070706_100001332 Ga0070706_10000133228 137
1254 3300005468 Ga0070707_100006655 Ga0070707_1000066553 137
1255 3300005468 Ga0070707_100612841 Ga0070707_1006128412 137
1256 3300005471 Ga0070698_100065360 Ga0070698_1000653603 137
1257 3300005518 Ga0070699_100001459 Ga0070699_10000145911 137
1258 3300005530 Ga0070679_100211518 Ga0070679_1002115182 137
1259 3300005536 Ga0070697_100260313 Ga0070697_1002603132 137
1260 3300005545 Ga0070695_100954410 Ga0070695_1009544101 137
1261 3300005545 Ga0070695_101177223 Ga0070695_1011772231 137
1262 3300005546 Ga0070696_100270367 Ga0070696_1002703672 137
1263 3300005546 Ga0070696_100337580 Ga0070696_1003375802 137
1264 3300005546 Ga0070696_100378477 Ga0070696_1003784772 137
1265 3300005547 Ga0070693_100031560 Ga0070693_1000315602 137
1266 3300005549 Ga0070704_100271732 Ga0070704_1002717321 137
1267 3300005564 Ga0070664_100064173 Ga0070664_1000641733 137
1268 3300005577 Ga0068857_100188075 Ga0068857_1001880752 137
1269 3300005577 Ga0068857_100534155 Ga0068857_1005341552 137
1270 3300005615 Ga0070702_100045498 Ga0070702_1000454982 137
1271 3300005618 Ga0068864_100823375 Ga0068864_1008233752 137
1272 3300005719 Ga0068861_100062108 Ga0068861_1000621083 137
1273 3300005841 Ga0068863_101139234 Ga0068863_1011392342 137
1274 3300005842 Ga0068858_100386376 Ga0068858_1003863762 137
1275 3300005844 Ga0068862_101015444 Ga0068862_1010154442 137
1276 3300005985 Ga0081539_10000491 Ga0081539_1000049119 137
1277 3300005985 Ga0081539_10034360 Ga0081539_100343602 137
1278 3300006058 Ga0075432_10135010 Ga0075432_101350101 137
1279 3300006237 Ga0097621_100011948 Ga0097621_1000119484 137
1280 3300006237 Ga0097621_101887084 Ga0097621_1018870841 137
1281 3300006358 Ga0068871_100138451 Ga0068871_1001384512 137
1282 3300006844 Ga0075428_100450624 Ga0075428_1004506242 137
1283 3300006844 Ga0075428_101228268 Ga0075428_1012282682 137
1284 3300006846 Ga0075430_100256229 Ga0075430_1002562291 137
1285 3300006847 Ga0075431_100187660 Ga0075431_1001876602 137
1286 3300006852 Ga0075433_10071600 Ga0075433_100716003 137
1287 3300006852 Ga0075433_10157685 Ga0075433_101576852 137
1288 3300006852 Ga0075433_10182930 Ga0075433_101829302 137
1289 3300006852 Ga0075433_10637176 Ga0075433_106371762 137
1290 3300006871 Ga0075434_100254888 Ga0075434_1002548882 137
1291 3300006871 Ga0075434_100362261 Ga0075434_1003622612 137
1292 3300006871 Ga0075434_101330975 Ga0075434_1013309752 137
1293 3300006880 Ga0075429_100209058 Ga0075429_1002090582 137
1294 3300006880 Ga0075429_100262033 Ga0075429_1002620332 137
1295 3300006881 Ga0068865_100315920 Ga0068865_1003159202 137
1296 3300007076 Ga0075435_100034223 Ga0075435_1000342232 137
1297 3300009011 Ga0105251_10057779 Ga0105251_100577792 137
1298 3300009094 Ga0111539_10013513 Ga0111539_100135139 137
1299 3300009098 Ga0105245_10510575 Ga0105245_105105751 137
1300 3300009101 Ga0105247_10128607 Ga0105247_101286072 137
1301 3300009147 Ga0114129_10015304 Ga0114129_100153047 137
1302 3300009147 Ga0114129_11105174 Ga0114129_111051742 137
1303 3300009147 Ga0114129_11565728 Ga0114129_115657282 137
1304 3300009148 Ga0105243_10053572 Ga0105243_100535723 137
1305 3300009148 Ga0105243_12305440 Ga0105243_123054401 137
1306 3300009174 Ga0105241_10016397 Ga0105241_100163972 137
1307 3300009174 Ga0105241_10301084 Ga0105241_103010842 137
1308 3300009176 Ga0105242_10998989 Ga0105242_109989892 137
1309 3300009177 Ga0105248_10057855 Ga0105248_100578552 137
1310 3300009177 Ga0105248_10405593 Ga0105248_104055932 137
1311 3300009551 Ga0105238_10186989 Ga0105238_101869892 137
1312 3300009553 Ga0105249_10299096 Ga0105249_102990962 137
1313 3300011119 Ga0105246_10111539 Ga0105246_101115391 137
1314 3300011119 Ga0105246_10496056 Ga0105246_104960562 137
1315 3300013297 Ga0157378_10922494 Ga0157378_109224942 137
1316 3300013306 Ga0163162_10294551 Ga0163162_102945512 137
1317 3300013306 Ga0163162_10475405 Ga0163162_104754052 137
1318 3300014325 Ga0163163_10531421 Ga0163163_105314212 137
1319 3300014326 Ga0157380_11163320 Ga0157380_111633202 137
1320 3300014745 Ga0157377_10043347 Ga0157377_100433473 137
1321 3300025735 Ga0207713_1138227 Ga0207713_11382272 137
1322 3300025900 Ga0207710_10037926 Ga0207710_100379262 137
1323 3300025904 Ga0207647_10008993 Ga0207647_100089933 137
1324 3300025910 Ga0207684_10001397 Ga0207684_100013973 137
1325 3300025912 Ga0207707_10119473 Ga0207707_101194732 137
1326 3300025918 Ga0207662_10093430 Ga0207662_100934302 137
1327 3300025920 Ga0207649_11265315 Ga0207649_112653152 137
1328 3300025921 Ga0207652_10377793 Ga0207652_103777932 137
1329 3300025922 Ga0207646_10059323 Ga0207646_100593233 137
1330 3300025925 Ga0207650_10242232 Ga0207650_102422322 137
1331 3300025932 Ga0207690_10996144 Ga0207690_109961442 137
1332 3300025936 Ga0207670_10988764 Ga0207670_109887642 137
1333 3300025938 Ga0207704_10350728 Ga0207704_103507282 137
1334 3300025939 Ga0207665_10375075 Ga0207665_103750752 137
1335 3300025940 Ga0207691_10894244 Ga0207691_108942441 137
1336 3300025941 Ga0207711_10030924 Ga0207711_100309243 137
1337 3300025941 Ga0207711_10379958 Ga0207711_103799582 137
1338 3300025942 Ga0207689_10137238 Ga0207689_101372383 137
1339 3300025942 Ga0207689_10432187 Ga0207689_104321872 137
1340 3300025945 Ga0207679_10043677 Ga0207679_100436773 137
1341 3300025960 Ga0207651_10021628 Ga0207651_100216285 137
1342 3300025960 Ga0207651_10425380 Ga0207651_104253802 137
1343 3300025961 Ga0207712_10712932 Ga0207712_107129321 137
1344 3300026035 Ga0207703_10664897 Ga0207703_106648972 137
1345 3300026075 Ga0207708_10078029 Ga0207708_100780292 137
1346 3300026088 Ga0207641_10560445 Ga0207641_105604452 137
1347 3300026088 Ga0207641_10640033 Ga0207641_106400332 137
1348 3300026095 Ga0207676_10165375 Ga0207676_101653753 137
1349 3300026095 Ga0207676_10211303 Ga0207676_102113032 137
1350 3300026095 Ga0207676_10802511 Ga0207676_108025112 137
1351 3300026095 Ga0207676_12182041 Ga0207676_121820411 137
1352 3300026116 Ga0207674_10105958 Ga0207674_101059583 137
1353 3300026116 Ga0207674_10261816 Ga0207674_102618163 137
1354 3300026116 Ga0207674_11345504 Ga0207674_113455041 137
1355 3300026118 Ga0207675_100934623 Ga0207675_1009346232 137
1356 3300026142 Ga0207698_11520085 Ga0207698_115200852 137
1357 3300027907 Ga0207428_10056807 Ga0207428_100568073 137
1358 3300028381 Ga0268264_10069010 Ga0268264_100690102 137
1359 3300028381 Ga0268264_11532590 Ga0268264_115325902 137
1360 3300030733 Ga0314311_1114909 Ga0314311_11149092 137
1361 3300030735 Ga0316178_1161888 Ga0316178_11618881 137
1362 3300031548 Ga0307408_100821536 Ga0307408_1008215361 137
1363 3300031548 Ga0307408_100903675 Ga0307408_1009036752 137
1364 3300031731 Ga0307405_10095164 Ga0307405_100951642 137
1365 3300031852 Ga0307410_10719234 Ga0307410_107192342 137
1366 3300031901 Ga0307406_10132729 Ga0307406_101327292 137
1367 3300031911 Ga0307412_10096546 Ga0307412_100965462 137
1368 3300031995 Ga0307409_100079286 Ga0307409_1000792864 137
1369 3300032002 Ga0307416_100223105 Ga0307416_1002231052 137
1370 3300032004 Ga0307414_11856497 Ga0307414_118564971 137
1371 3300032005 Ga0307411_10007990 Ga0307411_100079906 137
1372 3300032126 Ga0307415_100052879 Ga0307415_1000528793 137
1373 3300037466 Ga0395898_0290153 Ga0395898_0290153_1093_1512 137
1374 3300045051 Ga0451576_0277379 Ga0451576_0277379_908_1324 137
1375 3300046616 Ga0495668_0429507 Ga0495668_0429507_171_584 137
1376 3300046684 Ga0495669_0235404 Ga0495669_0235404_208_627 137
1377 3300048907 Ga0496104_0408960 Ga0496104_0408960_651_1073 137
1378 3300048911 Ga0496108_0301902 Ga0496108_0301902_412_834 137
1379 3300048911 Ga0496108_0676700 Ga0496108_0676700_382_801 137
1380 3300048913 Ga0496110_0095119 Ga0496110_0095119_918_1331 137
1381 3300048913 Ga0496110_0102005 Ga0496110_0102005_304_723 137
1382 3300048914 Ga0496111_0547280 Ga0496111_0547280_31_450 137
1383 3300048915 Ga0496112_0448663 Ga0496112_0448663_199_618 137
1384 3300048915 Ga0496112_0595512 Ga0496112_0595512_598_1014 137
1385 3300049514 Ga0501291_006352 Ga0501291_006352_754_1173 137
1386 3300049515 Ga0501292_007253 Ga0501292_007253_795_1214 137
1387 3300049516 Ga0501293_017014 Ga0501293_017014_48_467 137
1388 3300049652 Ga0501202_001986 Ga0501202_001986_2526_2945 137
1389 3300049660 Ga0501216_009723 Ga0501216_009723_325_744 137
1390 3300049663 Ga0501223_056081 Ga0501223_056081_236_655 137
1391 3300049666 Ga0501228_028509 Ga0501228_028509_170_589 137
1392 3300049668 Ga0501233_038529 Ga0501233_038529_597_1016 137
1393 3300049669 Ga0501235_090230 Ga0501235_090230_302_721 137
1394 3300049673 Ga0501240_028320 Ga0501240_028320_66_485 137
1395 3300049676 Ga0501246_003017 Ga0501246_003017_189_608 137
1396 3300049679 Ga0501249_002082 Ga0501249_002082_1811_2236 137
1397 3300049683 Ga0501253_011050 Ga0501253_011050_540_959 137
1398 3300049683 Ga0501253_022623 Ga0501253_022623_333_749 137
1399 3300049685 Ga0501256_004260 Ga0501256_004260_277_696 137
1400 3300049688 Ga0501259_008242 Ga0501259_008242_11_430 137
1401 3300049689 Ga0501260_013452 Ga0501260_013452_81_500 137
1402 3300049705 Ga0501225_0009765 Ga0501225_0009765_527_946 137
1403 3300049763 Ga0501266_005407 Ga0501266_005407_588_1007 137
1404 3300049769 Ga0501272_005853 Ga0501272_005853_295_714 137
1405 3300049773 Ga0501276_016040 Ga0501276_016040_97_516 137
1406 3300049778 Ga0501282_014522 Ga0501282_014522_75_494 137
1407 3300049779 Ga0501283_002022 Ga0501283_002022_400_819 137
1408 3300050507 nmdc:mga05p37_63790_c1 nmdc:mga05p37_63790_c1_1728_2153 137
1409 3300050507 nmdc:mga05p37_971630_c1 nmdc:mga05p37_971630_c1_407_823 137
1410 3300050509 nmdc:mga0qj67_175556_c1 nmdc:mga0qj67_175556_c1_1197_1613 137
1411 3300050511 nmdc:mga08y16_26078_c1 nmdc:mga08y16_26078_c1_1270_1683 137
1412 3300050512 nmdc:mga0n895_51621_c1 nmdc:mga0n895_51621_c1_2646_3062 137
1413 3300050512 nmdc:mga0n895_583602_c1 nmdc:mga0n895_583602_c1_636_1049 137
1414 3300050513 nmdc:mga0rr50_394800_c1 nmdc:mga0rr50_394800_c1_423_839 137
1415 3300050515 nmdc:mga0a205_64084_c1 nmdc:mga0a205_64084_c1_2475_2891 137
1416 3300050515 nmdc:mga0a205_75414_c1 nmdc:mga0a205_75414_c1_2353_2766 137
1417 3300050515 nmdc:mga0a205_80045_c1 nmdc:mga0a205_80045_c1_220_639 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

23

136

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u8t-assembly2.cif.gz_B crystal structure of chey d13k y106w alone and in complex with a flim peptide 0.9492 14 132
1zy2-assembly1.cif.gz_B crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.9431 14 129
3oo1-assembly2.cif.gz_B structure of e. coli chey mutant a113p in the absence of sulfate 0.9426 14 132
3fft-assembly2.cif.gz_B crystal structure of chey double mutant f14e, e89r complexed with bef3- and mn2+ 0.9417 14 132
1mih-assembly2.cif.gz_B a role for chey glu 89 in chez-mediated dephosphorylation of the e. coli chemotaxis response regulator chey 0.9415 14 132
ID Description Score Start End Superfamily
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9711 12 95 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9663 13 95 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9656 14 95 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9479 12 95 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9465 13 132 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V9URH0-F1-model_v4 Response regulator 0.9799 13 132 GO:0000160
GO:0035438
AF-A0A7L9QCW9-F1-model_v4 DNA-binding response regulator MtrA 0.9647 14 132 GO:0000160
GO:0003677
AF-A0A2E7M9I5-F1-model_v4 Response regulator 0.9641 14 129 GO:0000160
AF-A0A358QTF8-F1-model_v4 Stage 0 sporulation protein A homolog 0.963 14 132 GO:0000160
GO:0006935
AF-A0A7C3JY90-F1-model_v4 Response regulator transcription factor 0.963 12 130 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
89.44 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map