F493872

General Info

Members Datasets Scaffolds Average Seq Length
1426 416 1426 189

Family's Representative Sequence

Representative Sequence 3300042147|Ga0450910_033343|Ga0450910_033343_138_779
Length 213
Sequence MAPRQARHPPSRIPHVEPLGNVAPSMAEIVNTNQFRNGMHIEHRGAVWRIVEFQHVKPGKGGAFVRTKLKNLESGAVVEDTFRAGEKFPRVHTEVKSVQFLYDDGTEAHFMDEETYEQFGLPRGDIADELAYMLPSSTVQMLQVNGKPSGLQMPASVELAVADTEPGVKGDTVSNVTKPATLETGAVVQVPLFVNVGDRVKVDPKEKRYISRA

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
88 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
125 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
224 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
225 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
226 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
229 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
232 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
233 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
251 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
252 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
253 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
254 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
255 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
256 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
257 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
258 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
259 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
268 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
269 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
270 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
271 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
272 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
273 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
274 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
277 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
278 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
279 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
287 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
288 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
289 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
306 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
309 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
310 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
375 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
379 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
380 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
381 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
382 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
383 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
384 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
385 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
397 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
400 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
401 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
402 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
403 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
404 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
405 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
406 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
407 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
408 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
409 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
410 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
411 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
412 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
413 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
414 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
415 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
416 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 12.69
Rhizosphere 83.87
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c002843 3300000041 Bacteria 1572
2 ARcpr5yngRDRAFT_c010898 3300000043 Bacteria 770
3 ARSoilOldRDRAFT_c002105 3300000044 Bacteria 1793
4 ARCol0yngRDRAFT_1001987 3300000652 Bacteria 1584
5 JGI24747J21853_1001097 3300001978 Bacteria 1946
6 JGI24740J21852_10134112 3300001979 Bacteria 617
7 JGI24737J22298_10112048 3300001990 Bacteria 807
8 JGI24737J22298_10142090 3300001990 Bacteria 709
9 JGI24743J22301_10010021 3300001991 Bacteria 1686
10 JGI24743J22301_10049873 3300001991 Bacteria 851
11 JGI24743J22301_10071941 3300001991 Bacteria 722
12 JGI24738J21930_10004651 3300002075 Bacteria 3347
13 JGI24744J21845_10002173 3300002077 Bacteria 3985
14 JGI24744J21845_10060325 3300002077 Bacteria 694
15 JGI24742J22300_10052144 3300002244 Bacteria 742
16 JGI24742J22300_10068346 3300002244 Bacteria 660
17 JGI24751J29686_10092430 3300002459 Bacteria 630
18 JGI25406J46586_10018416 3300003203 Bacteria 2870
19 JGI25406J46586_10051888 3300003203 Bacteria 1369
20 Ga0065712_10366413 3300005290 Bacteria 768
21 Ga0070658_10007247 3300005327 Bacteria 8953
22 Ga0070658_10088423 3300005327 Bacteria 2551
23 Ga0070658_10483693 3300005327 Bacteria 1068
24 Ga0070658_10874779 3300005327 Bacteria 781
25 Ga0070683_100013927 3300005329 Bacteria 7025
26 Ga0070683_100052558 3300005329 Bacteria 3775
27 Ga0070683_100113560 3300005329 Bacteria 2557
28 Ga0070683_100120146 3300005329 Bacteria 2482
29 Ga0070683_100172441 3300005329 Bacteria 2053
30 Ga0070683_100498870 3300005329 Bacteria 1163
31 Ga0070683_100730174 3300005329 Bacteria 949
32 Ga0070690_100530572 3300005330 Bacteria 885
33 Ga0070670_100181271 3300005331 Bacteria 1829
34 Ga0070677_10404200 3300005333 Bacteria 720
35 Ga0068869_100301551 3300005334 Bacteria 1294
36 Ga0068869_100672862 3300005334 Bacteria 880
37 Ga0070666_10015279 3300005335 Bacteria 4896
38 Ga0070680_100018983 3300005336 Bacteria 5442
39 Ga0070680_100027145 3300005336 Bacteria 4585
40 Ga0070680_100305404 3300005336 Bacteria 1349
41 Ga0070682_100001388 3300005337 Bacteria 13651
42 Ga0070682_100018622 3300005337 Bacteria 4064
43 Ga0070682_100018788 3300005337 Bacteria 4047
44 Ga0068868_100038305 3300005338 Bacteria 3721
45 Ga0068868_100199015 3300005338 Bacteria 1669
46 Ga0068868_100623659 3300005338 Bacteria 957
47 Ga0068868_101287251 3300005338 Bacteria 679
48 Ga0070660_100005200 3300005339 Bacteria 8995
49 Ga0070660_100035909 3300005339 Bacteria 3752
50 Ga0070660_100191463 3300005339 Bacteria 1657
51 Ga0070660_100236032 3300005339 Bacteria 1488
52 Ga0070689_100006612 3300005340 Bacteria 8049
53 Ga0070689_100303439 3300005340 Bacteria 1329
54 Ga0070691_10139643 3300005341 Bacteria 1234
55 Ga0070661_100339348 3300005344 Bacteria 1177
56 Ga0070661_100519919 3300005344 Bacteria 954
57 Ga0070692_10008587 3300005345 Bacteria 4562
58 Ga0070692_10014142 3300005345 Bacteria 3738
59 Ga0070668_100094275 3300005347 Bacteria 2363
60 Ga0070668_100155004 3300005347 Bacteria 1855
61 Ga0070669_100153755 3300005353 Bacteria 1782
62 Ga0070669_100206514 3300005353 Bacteria 1548
63 Ga0070675_100061740 3300005354 Bacteria 3095
64 Ga0070671_100075911 3300005355 Bacteria 2808
65 Ga0070671_100170802 3300005355 Bacteria 1839
66 Ga0070674_100005543 3300005356 Bacteria 7299
67 Ga0070674_100006683 3300005356 Bacteria 6745
68 Ga0070674_100037431 3300005356 Bacteria 3263
69 Ga0070674_100116719 3300005356 Bacteria 1969
70 Ga0070674_100155300 3300005356 Bacteria 1731
71 Ga0070673_100061235 3300005364 Bacteria 2985
72 Ga0070673_100816146 3300005364 Bacteria 862
73 Ga0070688_100001187 3300005365 Bacteria 12943
74 Ga0070688_100022194 3300005365 Bacteria 3715
75 Ga0070659_100004839 3300005366 Bacteria 9619
76 Ga0070659_100038832 3300005366 Bacteria 3715
77 Ga0070659_100068782 3300005366 Bacteria 2809
78 Ga0070659_100272083 3300005366 Bacteria 1408
79 Ga0070667_100114171 3300005367 Bacteria 2345
80 Ga0070703_10001288 3300005406 Bacteria 7606
81 Ga0070703_10012583 3300005406 Bacteria 2398
82 Ga0070703_10061411 3300005406 Bacteria 1231
83 Ga0070709_10220034 3300005434 Bacteria 1354
84 Ga0070714_100012340 3300005435 Bacteria 6820
85 Ga0070714_100055707 3300005435 Bacteria 3380
86 Ga0070714_100128103 3300005435 Bacteria 2266
87 Ga0070714_100141709 3300005435 Bacteria 2159
88 Ga0070713_100070871 3300005436 Bacteria 2944
89 Ga0070713_100506399 3300005436 Bacteria 1140
90 Ga0070710_10000963 3300005437 Bacteria 13656
91 Ga0070710_10143921 3300005437 Bacteria 1464
92 Ga0070701_10001607 3300005438 Bacteria 8422
93 Ga0070701_10009820 3300005438 Bacteria 4207
94 Ga0070711_100004508 3300005439 Bacteria 8230
95 Ga0070711_100019504 3300005439 Bacteria 4350
96 Ga0070711_100178110 3300005439 Bacteria 1626
97 Ga0070705_100003381 3300005440 Bacteria 7827
98 Ga0070705_100011091 3300005440 Bacteria 4533
99 Ga0070705_100051162 3300005440 Bacteria 2407
100 Ga0070705_100290540 3300005440 Bacteria 1167
101 Ga0070705_100446089 3300005440 Bacteria 969
102 Ga0070700_100001369 3300005441 Bacteria 12104
103 Ga0070700_100044949 3300005441 Bacteria 2722
104 Ga0070700_100847703 3300005441 Bacteria 740
105 Ga0070694_100017291 3300005444 Bacteria 4555
106 Ga0070694_100156937 3300005444 Bacteria 1666
107 Ga0070694_100202444 3300005444 Bacteria 1480
108 Ga0070708_100010950 3300005445 Bacteria 7369
109 Ga0070708_100025940 3300005445 Bacteria 5012
110 Ga0070708_100271306 3300005445 Bacteria 1596
111 Ga0070708_100291399 3300005445 Bacteria 1537
112 Ga0070708_100340812 3300005445 Bacteria 1413
113 Ga0070663_100007717 3300005455 Bacteria 6570
114 Ga0070663_100084608 3300005455 Bacteria 2338
115 Ga0070663_100173768 3300005455 Bacteria 1667
116 Ga0070663_100421531 3300005455 Bacteria 1095
117 Ga0070678_100000764 3300005456 Bacteria 16129
118 Ga0070678_100012136 3300005456 Bacteria 5342
119 Ga0070678_100037531 3300005456 Bacteria 3403
120 Ga0070678_100038328 3300005456 Bacteria 3373
121 Ga0070678_100225251 3300005456 Bacteria 1560
122 Ga0070678_100989096 3300005456 Bacteria 773
123 Ga0070662_100045032 3300005457 Bacteria 3164
124 Ga0070662_100406972 3300005457 Bacteria 1124
125 Ga0070681_10151288 3300005458 Bacteria 2247
126 Ga0070681_10174996 3300005458 Bacteria 2068
127 Ga0068867_100001204 3300005459 Bacteria 17759
128 Ga0068867_100067722 3300005459 Bacteria 2663
129 Ga0068867_100092459 3300005459 Bacteria 2297
130 Ga0068867_100208398 3300005459 Bacteria 1569
131 Ga0068867_100705238 3300005459 Bacteria 891
132 Ga0070685_10001661 3300005466 Bacteria 11699
133 Ga0070685_10012424 3300005466 Bacteria 4473
134 Ga0070685_10090658 3300005466 Bacteria 1850
135 Ga0070685_10276430 3300005466 Bacteria 1123
136 Ga0070706_100002089 3300005467 Bacteria 20346
137 Ga0070706_100024255 3300005467 Bacteria 5583
138 Ga0070706_100281928 3300005467 Bacteria 1551
139 Ga0070706_100301272 3300005467 Bacteria 1496
140 Ga0070706_100340792 3300005467 Bacteria 1398
141 Ga0070706_100507754 3300005467 Bacteria 1121
142 Ga0070706_100690744 3300005467 Bacteria 947
143 Ga0070707_100000736 3300005468 Bacteria 32520
144 Ga0070707_100004087 3300005468 Bacteria 13701
145 Ga0070707_100018978 3300005468 Bacteria 6477
146 Ga0070707_100174645 3300005468 Bacteria 2094
147 Ga0070707_100350414 3300005468 Bacteria 1434
148 Ga0070698_100016163 3300005471 Bacteria 7880
149 Ga0070698_100080261 3300005471 Bacteria 3257
150 Ga0070698_100084514 3300005471 Bacteria 3162
151 Ga0070698_100252903 3300005471 Bacteria 1694
152 Ga0070699_100028631 3300005518 Bacteria 4804
153 Ga0070699_101057266 3300005518 Bacteria 745
154 Ga0070679_100004961 3300005530 Bacteria 12284
155 Ga0070679_100006535 3300005530 Bacteria 10864
156 Ga0070679_100011507 3300005530 Bacteria 8433
157 Ga0070679_100572938 3300005530 Bacteria 1072
158 Ga0070684_100000304 3300005535 Bacteria 34144
159 Ga0070684_100027493 3300005535 Bacteria 4802
160 Ga0070684_100029326 3300005535 Bacteria 4662
161 Ga0070684_100225839 3300005535 Bacteria 1709
162 Ga0070684_100254909 3300005535 Bacteria 1604
163 Ga0070684_100319145 3300005535 Bacteria 1427
164 Ga0070684_100512504 3300005535 Bacteria 1111
165 Ga0070684_100789067 3300005535 Bacteria 888
166 Ga0070697_100189479 3300005536 Bacteria 1745
167 Ga0070697_100245303 3300005536 Bacteria 1530
168 Ga0070697_100325234 3300005536 Bacteria 1325
169 Ga0068853_100022964 3300005539 Bacteria 5216
170 Ga0068853_100184538 3300005539 Bacteria 1893
171 Ga0070672_100013952 3300005543 Bacteria 5685
172 Ga0070672_100098201 3300005543 Bacteria 2372
173 Ga0070672_100110386 3300005543 Bacteria 2241
174 Ga0070672_100112715 3300005543 Bacteria 2219
175 Ga0070686_100003823 3300005544 Bacteria 8286
176 Ga0070686_100082006 3300005544 Bacteria 2138
177 Ga0070686_100086293 3300005544 Bacteria 2089
178 Ga0070695_100150561 3300005545 Bacteria 1623
179 Ga0070695_100274647 3300005545 Bacteria 1236
180 Ga0070696_100001718 3300005546 Bacteria 14352
181 Ga0070696_100211489 3300005546 Bacteria 1452
182 Ga0070693_100016619 3300005547 Bacteria 3812
183 Ga0070693_100118829 3300005547 Bacteria 1637
184 Ga0070693_100440729 3300005547 Bacteria 912
185 Ga0070665_100078080 3300005548 Bacteria 3317
186 Ga0070665_100100098 3300005548 Bacteria 2903
187 Ga0070665_100472327 3300005548 Bacteria 1265
188 Ga0070704_100003463 3300005549 Bacteria 9053
189 Ga0070704_100011824 3300005549 Bacteria 5369
190 Ga0070704_100045776 3300005549 Bacteria 3046
191 Ga0070704_100223728 3300005549 Bacteria 1531
192 Ga0070704_100495748 3300005549 Bacteria 1059
193 Ga0068855_100057412 3300005563 Bacteria 4563
194 Ga0068855_100065923 3300005563 Bacteria 4221
195 Ga0068855_100130426 3300005563 Bacteria 2871
196 Ga0068855_100217587 3300005563 Bacteria 2144
197 Ga0068855_100256205 3300005563 Bacteria 1951
198 Ga0070664_100011607 3300005564 Bacteria 7146
199 Ga0068857_100074879 3300005577 Bacteria 3018
200 Ga0068857_100094412 3300005577 Bacteria 2679
201 Ga0068857_100264723 3300005577 Bacteria 1579
202 Ga0068857_100481489 3300005577 Bacteria 1163
203 Ga0068854_100140120 3300005578 Bacteria 1855
204 Ga0068854_100393711 3300005578 Bacteria 1145
205 Ga0068854_100438369 3300005578 Bacteria 1088
206 Ga0068854_100559994 3300005578 Bacteria 971
207 Ga0068856_100013078 3300005614 Bacteria 8038
208 Ga0068856_100071633 3300005614 Bacteria 3431
209 Ga0068856_100082971 3300005614 Bacteria 3182
210 Ga0068856_100199270 3300005614 Bacteria 2017
211 Ga0068856_100654985 3300005614 Bacteria 1071
212 Ga0070702_100005317 3300005615 Bacteria 5981
213 Ga0068852_100022371 3300005616 Bacteria 5069
214 Ga0068852_100522502 3300005616 Bacteria 1184
215 Ga0068859_100067268 3300005617 Bacteria 3617
216 Ga0068859_100140766 3300005617 Bacteria 2486
217 Ga0068859_100253841 3300005617 Bacteria 1849
218 Ga0068864_100070738 3300005618 Bacteria 3036
219 Ga0068866_10000820 3300005718 Bacteria 13818
220 Ga0068866_10039728 3300005718 Bacteria 2325
221 Ga0068866_10075345 3300005718 Bacteria 1796
222 Ga0068866_10404970 3300005718 Bacteria 881
223 Ga0068861_100050692 3300005719 Bacteria 3148
224 Ga0068861_100064978 3300005719 Bacteria 2809
225 Ga0068861_100069310 3300005719 Bacteria 2728
226 Ga0068861_100100151 3300005719 Bacteria 2303
227 Ga0068861_100187376 3300005719 Bacteria 1727
228 Ga0068861_101100016 3300005719 Bacteria 764
229 Ga0068870_10070411 3300005840 Bacteria 1906
230 Ga0068870_10074825 3300005840 Bacteria 1856
231 Ga0068858_100089600 3300005842 Bacteria 2862
232 Ga0068858_100848970 3300005842 Bacteria 892
233 Ga0068860_100150925 3300005843 Bacteria 2238
234 Ga0068860_100679718 3300005843 Bacteria 1038
235 Ga0068860_100757662 3300005843 Bacteria 983
236 Ga0068860_100777954 3300005843 Bacteria 970
237 Ga0068862_100132097 3300005844 Bacteria 2209
238 Ga0068862_100144446 3300005844 Bacteria 2113
239 Ga0081455_10043829 3300005937 Bacteria 3910
240 Ga0081455_10044203 3300005937 Bacteria 3889
241 Ga0081455_10044545 3300005937 Bacteria 3869
242 Ga0081455_10069323 3300005937 Bacteria 2933
243 Ga0081455_10086905 3300005937 Bacteria 2546
244 Ga0081455_10106177 3300005937 Bacteria 2242
245 Ga0081455_10150527 3300005937 Bacteria 1795
246 Ga0081538_10133836 3300005981 Bacteria 1159
247 Ga0081538_10203693 3300005981 Bacteria 809
248 Ga0081539_10000041 3300005985 Bacteria 292660
249 Ga0081539_10000712 3300005985 Bacteria 66647
250 Ga0081539_10026785 3300005985 Bacteria 3666
251 Ga0070717_10090254 3300006028 Bacteria 2585
252 Ga0070717_10118249 3300006028 Bacteria 2268
253 Ga0070717_10373483 3300006028 Bacteria 1278
254 Ga0075365_10009701 3300006038 Bacteria 5556
255 Ga0075365_10253130 3300006038 Bacteria 1238
256 Ga0075365_10615991 3300006038 Bacteria 767
257 Ga0075363_100069190 3300006048 Bacteria 1915
258 Ga0075364_10007819 3300006051 Bacteria 6365
259 Ga0075364_10041700 3300006051 Bacteria 2981
260 Ga0075364_10482960 3300006051 Bacteria 847
261 Ga0075432_10000335 3300006058 Bacteria 13388
262 Ga0075432_10028903 3300006058 Bacteria 1913
263 Ga0070715_10056200 3300006163 Bacteria 1711
264 Ga0070715_10136675 3300006163 Bacteria 1186
265 Ga0070716_100048519 3300006173 Bacteria 2400
266 Ga0070712_100009792 3300006175 Bacteria 6038
267 Ga0070712_100010542 3300006175 Bacteria 5834
268 Ga0070712_100030086 3300006175 Bacteria 3646
269 Ga0070712_100200774 3300006175 Bacteria 1566
270 Ga0070712_100301707 3300006175 Bacteria 1297
271 Ga0070712_100623279 3300006175 Bacteria 915
272 Ga0075362_10295148 3300006177 Bacteria 803
273 Ga0097621_100025644 3300006237 Bacteria 4615
274 Ga0097621_100134872 3300006237 Bacteria 2105
275 Ga0097621_100150363 3300006237 Bacteria 1996
276 Ga0097621_100498256 3300006237 Bacteria 1103
277 Ga0068871_100672786 3300006358 Bacteria 946
278 Ga0075428_100003530 3300006844 Bacteria 17129
279 Ga0075428_100016751 3300006844 Bacteria 8093
280 Ga0075428_100033638 3300006844 Bacteria 5658
281 Ga0075428_100407013 3300006844 Bacteria 1458
282 Ga0075428_100483087 3300006844 Bacteria 1326
283 Ga0075428_100622855 3300006844 Bacteria 1152
284 Ga0075430_100006655 3300006846 Bacteria 9746
285 Ga0075430_100085183 3300006846 Bacteria 2646
286 Ga0075431_100009644 3300006847 Bacteria 9698
287 Ga0075431_100090857 3300006847 Bacteria 3152
288 Ga0075433_10007908 3300006852 Bacteria 8457
289 Ga0075433_10008920 3300006852 Bacteria 8006
290 Ga0075433_10038706 3300006852 Bacteria 4120
291 Ga0075433_10344284 3300006852 Bacteria 1318
292 Ga0075433_10368955 3300006852 Bacteria 1268
293 Ga0075433_10515745 3300006852 Bacteria 1052
294 Ga0075433_10571667 3300006852 Bacteria 993
295 Ga0075433_10944568 3300006852 Bacteria 752
296 Ga0075434_100001094 3300006871 Bacteria 22189
297 Ga0075434_100035968 3300006871 Bacteria 4897
298 Ga0075434_100099390 3300006871 Bacteria 2915
299 Ga0075434_100160126 3300006871 Bacteria 2271
300 Ga0075434_100975439 3300006871 Bacteria 862
301 Ga0075429_100042453 3300006880 Bacteria 3958
302 Ga0075429_100066126 3300006880 Bacteria 3147
303 Ga0075429_100321273 3300006880 Bacteria 1355
304 Ga0068865_100005165 3300006881 Bacteria 7901
305 Ga0068865_100023252 3300006881 Bacteria 4056
306 Ga0068865_100025430 3300006881 Bacteria 3895
307 Ga0068865_100046262 3300006881 Bacteria 2985
308 Ga0068865_100051532 3300006881 Bacteria 2849
309 Ga0068865_100142968 3300006881 Bacteria 1806
310 Ga0075436_100002736 3300006914 Bacteria 12126
311 Ga0075436_100009113 3300006914 Bacteria 6791
312 Ga0075436_100058774 3300006914 Bacteria 2656
313 Ga0075436_100124471 3300006914 Bacteria 1806
314 Ga0075436_100400936 3300006914 Bacteria 994
315 Ga0097620_100067265 3300006931 Bacteria 3617
316 Ga0097620_100140773 3300006931 Bacteria 2486
317 Ga0097620_100253861 3300006931 Bacteria 1849
318 Ga0075435_100000579 3300007076 Bacteria 22387
319 Ga0075435_100016736 3300007076 Bacteria 5532
320 Ga0075435_100162117 3300007076 Bacteria 1884
321 Ga0075435_100180555 3300007076 Bacteria 1783
322 Ga0105251_10321572 3300009011 Bacteria 703
323 Ga0111539_10001928 3300009094 Bacteria 27646
324 Ga0111539_10016007 3300009094 Bacteria 9311
325 Ga0111539_10028632 3300009094 Bacteria 6795
326 Ga0111539_10351946 3300009094 Bacteria 1714
327 Ga0111539_10578466 3300009094 Bacteria 1308
328 Ga0111539_11239979 3300009094 Bacteria 866
329 Ga0111539_11497241 3300009094 Bacteria 783
330 Ga0105245_10006448 3300009098 Bacteria 10329
331 Ga0105245_10008496 3300009098 Bacteria 8958
332 Ga0105245_10128400 3300009098 Bacteria 2375
333 Ga0105245_10135543 3300009098 Bacteria 2314
334 Ga0105245_10175298 3300009098 Bacteria 2045
335 Ga0105245_10189202 3300009098 Bacteria 1971
336 Ga0105245_10222388 3300009098 Bacteria 1822
337 Ga0105245_10249763 3300009098 Bacteria 1723
338 Ga0105245_10309367 3300009098 Bacteria 1553
339 Ga0105245_10313990 3300009098 Bacteria 1542
340 Ga0105245_10518924 3300009098 Bacteria 1210
341 Ga0105247_10016607 3300009101 Bacteria 4413
342 Ga0105247_10115373 3300009101 Bacteria 1733
343 Ga0114129_10001661 3300009147 Bacteria 30289
344 Ga0114129_10002630 3300009147 Bacteria 24990
345 Ga0114129_10009955 3300009147 Bacteria 13553
346 Ga0114129_10099788 3300009147 Bacteria 4018
347 Ga0114129_10109307 3300009147 Bacteria 3817
348 Ga0114129_10195438 3300009147 Bacteria 2744
349 Ga0114129_10208382 3300009147 Bacteria 2644
350 Ga0114129_10284165 3300009147 Bacteria 2210
351 Ga0114129_10320301 3300009147 Bacteria 2061
352 Ga0114129_10404823 3300009147 Bacteria 1798
353 Ga0114129_11424366 3300009147 Bacteria 854
354 Ga0105243_10007792 3300009148 Bacteria 8234
355 Ga0105243_10015740 3300009148 Bacteria 5720
356 Ga0105243_10017414 3300009148 Bacteria 5432
357 Ga0105243_10034285 3300009148 Bacteria 3928
358 Ga0105243_10065076 3300009148 Bacteria 2927
359 Ga0105243_10144632 3300009148 Bacteria 2033
360 Ga0105243_10198408 3300009148 Bacteria 1758
361 Ga0105243_10335077 3300009148 Bacteria 1384
362 Ga0105243_10381506 3300009148 Bacteria 1304
363 Ga0105241_10036463 3300009174 Bacteria 3700
364 Ga0105241_10124596 3300009174 Unclassified 2079
365 Ga0105241_10133209 3300009174 Bacteria 2014
366 Ga0105241_10151868 3300009174 Bacteria 1895
367 Ga0105241_10795374 3300009174 Bacteria 871
368 Ga0105242_10008234 3300009176 Bacteria 8012
369 Ga0105242_10021877 3300009176 Bacteria 5026
370 Ga0105242_10071347 3300009176 Bacteria 2882
371 Ga0105242_10283874 3300009176 Bacteria 1505
372 Ga0105242_10364265 3300009176 Bacteria 1339
373 Ga0105248_10019788 3300009177 Bacteria 7455
374 Ga0105248_10040930 3300009177 Bacteria 5195
375 Ga0105248_10067879 3300009177 Bacteria 4004
376 Ga0105248_11046151 3300009177 Bacteria 922
377 Ga0105248_11262073 3300009177 Bacteria 835
378 Ga0105237_10324588 3300009545 Bacteria 1543
379 Ga0105237_10353526 3300009545 Bacteria 1474
380 Ga0105237_10456525 3300009545 Bacteria 1284
381 Ga0105238_10135742 3300009551 Bacteria 2438
382 Ga0105238_10547657 3300009551 Bacteria 1161
383 Ga0105238_10771531 3300009551 Bacteria 976
384 Ga0105238_11037785 3300009551 Bacteria 841
385 Ga0105249_10001935 3300009553 Bacteria 17994
386 Ga0105249_10220967 3300009553 Bacteria 1864
387 Ga0105249_10357318 3300009553 Bacteria 1481
388 Ga0105249_10476948 3300009553 Bacteria 1290
389 Ga0105249_10824266 3300009553 Bacteria 992
390 Ga0105249_10929501 3300009553 Bacteria 937
391 Ga0105239_10013943 3300010375 Bacteria 8923
392 Ga0105239_10031554 3300010375 Bacteria 5826
393 Ga0105239_10044080 3300010375 Bacteria 4890
394 Ga0105239_10101281 3300010375 Bacteria 3186
395 Ga0105239_10145437 3300010375 Bacteria 2643
396 Ga0105239_11212376 3300010375 Bacteria 870
397 Ga0105239_11512596 3300010375 Bacteria 776
398 Ga0105246_10139055 3300011119 Bacteria 1824
399 Ga0105246_10185520 3300011119 Bacteria 1605
400 Ga0105246_10187716 3300011119 Bacteria 1597
401 Ga0105246_10226658 3300011119 Bacteria 1469
402 Ga0105246_10544650 3300011119 Bacteria 993
403 Ga0105246_10577410 3300011119 Bacteria 968
404 Ga0157342_1016850 3300012507 Bacteria 812
405 Ga0157327_1050286 3300012512 Bacteria 591
406 Ga0157371_10462042 3300013102 Bacteria 934
407 Ga0157370_10012969 3300013104 Bacteria 8614
408 Ga0157370_10552504 3300013104 Bacteria 1055
409 Ga0157370_10808889 3300013104 Bacteria 853
410 Ga0157369_10119579 3300013105 Bacteria 2796
411 Ga0157369_10229524 3300013105 Bacteria 1941
412 Ga0157369_10235225 3300013105 Bacteria 1915
413 Ga0157369_10495185 3300013105 Bacteria 1264
414 Ga0157369_10735868 3300013105 Bacteria 1015
415 Ga0157369_11380100 3300013105 Bacteria 717
416 Ga0157374_10251867 3300013296 Bacteria 1738
417 Ga0157374_10460677 3300013296 Bacteria 1273
418 Ga0157374_10549092 3300013296 Bacteria 1163
419 Ga0157374_10628817 3300013296 Bacteria 1084
420 Ga0157378_10144794 3300013297 Bacteria 2209
421 Ga0157378_10183343 3300013297 Bacteria 1970
422 Ga0163162_10717124 3300013306 Bacteria 1121
423 Ga0157372_10063554 3300013307 Bacteria 4140
424 Ga0157372_10119969 3300013307 Bacteria 3019
425 Ga0157372_10208564 3300013307 Bacteria 2264
426 Ga0157372_10536387 3300013307 Bacteria 1364
427 Ga0157372_10881029 3300013307 Bacteria 1039
428 Ga0157372_11126876 3300013307 Bacteria 907
429 Ga0157372_11402840 3300013307 Bacteria 805
430 Ga0157372_11827491 3300013307 Bacteria 699
431 Ga0157375_10056357 3300013308 Bacteria 3880
432 Ga0157375_10068805 3300013308 Bacteria 3544
433 Ga0157375_10102319 3300013308 Bacteria 2949
434 Ga0157375_10131654 3300013308 Bacteria 2621
435 Ga0157375_10231502 3300013308 Bacteria 2007
436 Ga0157375_10571100 3300013308 Bacteria 1292
437 Ga0163163_10332991 3300014325 Bacteria 1573
438 Ga0163163_10591562 3300014325 Bacteria 1173
439 Ga0163163_10733243 3300014325 Bacteria 1052
440 Ga0163163_10883853 3300014325 Bacteria 957
441 Ga0157380_10026636 3300014326 Bacteria 4391
442 Ga0157380_10040555 3300014326 Bacteria 3627
443 Ga0157380_10072712 3300014326 Bacteria 2786
444 Ga0157380_10380401 3300014326 Bacteria 1332
445 Ga0157377_10048517 3300014745 Bacteria 2383
446 Ga0157377_10088266 3300014745 Bacteria 1826
447 Ga0157377_10097145 3300014745 Bacteria 1749
448 Ga0157377_10113138 3300014745 Bacteria 1634
449 Ga0157377_10389315 3300014745 Bacteria 946
450 Ga0157379_10023210 3300014968 Bacteria 5503
451 Ga0157379_10032572 3300014968 Bacteria 4647
452 Ga0157379_10375348 3300014968 Bacteria 1304
453 Ga0157376_10016118 3300014969 Bacteria 5665
454 Ga0157376_10209702 3300014969 Bacteria 1798
455 Ga0157376_10297148 3300014969 Bacteria 1527
456 Ga0157376_10705411 3300014969 Bacteria 1014
457 Ga0163161_10059251 3300017792 Bacteria 2784
458 Ga0206353_11257401 3300020082 Bacteria 17170
459 Ga0206353_11358304 3300020082 Bacteria 1102
460 Ga0224712_10290042 3300022467 Unclassified 763
461 Ga0207653_10000444 3300025885 Bacteria 16893
462 Ga0207653_10046334 3300025885 Bacteria 1437
463 Ga0207653_10059711 3300025885 Bacteria 1283
464 Ga0207682_10140630 3300025893 Bacteria 1083
465 Ga0207682_10159586 3300025893 Bacteria 1021
466 Ga0207642_10000928 3300025899 Bacteria 9189
467 Ga0207642_10017825 3300025899 Bacteria 2710
468 Ga0207642_10108569 3300025899 Bacteria 1408
469 Ga0207642_10170611 3300025899 Bacteria 1177
470 Ga0207710_10216525 3300025900 Bacteria 950
471 Ga0207688_10003668 3300025901 Bacteria 8385
472 Ga0207688_10014126 3300025901 Bacteria 4343
473 Ga0207688_10042430 3300025901 Bacteria 2533
474 Ga0207688_10058918 3300025901 Bacteria 2162
475 Ga0207688_10066758 3300025901 Bacteria 2035
476 Ga0207680_10002629 3300025903 Bacteria 8389
477 Ga0207680_10083771 3300025903 Bacteria 2011
478 Ga0207680_10459348 3300025903 Bacteria 904
479 Ga0207647_10465729 3300025904 Bacteria 707
480 Ga0207685_10011937 3300025905 Bacteria 2634
481 Ga0207699_10011099 3300025906 Bacteria 4541
482 Ga0207699_10024973 3300025906 Bacteria 3275
483 Ga0207699_10056000 3300025906 Bacteria 2348
484 Ga0207699_10078484 3300025906 Bacteria 2039
485 Ga0207699_10361924 3300025906 Bacteria 1026
486 Ga0207645_10168947 3300025907 Bacteria 1433
487 Ga0207645_10392531 3300025907 Bacteria 932
488 Ga0207643_10031279 3300025908 Bacteria 2966
489 Ga0207643_10121253 3300025908 Bacteria 1549
490 Ga0207643_10571297 3300025908 Bacteria 726
491 Ga0207705_10055413 3300025909 Bacteria 2858
492 Ga0207705_10087735 3300025909 Bacteria 2275
493 Ga0207705_10266302 3300025909 Bacteria 1309
494 Ga0207684_10004837 3300025910 Bacteria 12604
495 Ga0207684_10123330 3300025910 Bacteria 2222
496 Ga0207684_10232756 3300025910 Bacteria 1590
497 Ga0207684_10272156 3300025910 Bacteria 1461
498 Ga0207684_10336681 3300025910 Bacteria 1300
499 Ga0207684_10966768 3300025910 Bacteria 714
500 Ga0207654_10064730 3300025911 Bacteria 2150
501 Ga0207654_10089573 3300025911 Unclassified 1872
502 Ga0207654_10166458 3300025911 Bacteria 1428
503 Ga0207654_10169873 3300025911 Bacteria 1415
504 Ga0207707_10072834 3300025912 Bacteria 2995
505 Ga0207707_10134242 3300025912 Bacteria 2164
506 Ga0207707_10224435 3300025912 Bacteria 1635
507 Ga0207707_10227625 3300025912 Bacteria 1622
508 Ga0207695_10377005 3300025913 Bacteria 1304
509 Ga0207671_10238074 3300025914 Bacteria 1429
510 Ga0207671_10261783 3300025914 Bacteria 1361
511 Ga0207693_10000319 3300025915 Bacteria 44749
512 Ga0207693_10000873 3300025915 Bacteria 26975
513 Ga0207693_10004832 3300025915 Bacteria 11336
514 Ga0207693_10009671 3300025915 Bacteria 7850
515 Ga0207693_10076145 3300025915 Bacteria 2628
516 Ga0207693_10129352 3300025915 Bacteria 1985
517 Ga0207693_10164394 3300025915 Bacteria 1747
518 Ga0207693_10218521 3300025915 Bacteria 1497
519 Ga0207693_10430225 3300025915 Bacteria 1032
520 Ga0207663_10001986 3300025916 Bacteria 9704
521 Ga0207663_10020051 3300025916 Bacteria 3781
522 Ga0207663_10045499 3300025916 Bacteria 2700
523 Ga0207663_10050517 3300025916 Bacteria 2584
524 Ga0207660_10071347 3300025917 Bacteria 2527
525 Ga0207660_10085331 3300025917 Bacteria 2329
526 Ga0207660_10114248 3300025917 Bacteria 2036
527 Ga0207660_10265854 3300025917 Bacteria 1358
528 Ga0207660_10326260 3300025917 Bacteria 1227
529 Ga0207662_10071187 3300025918 Bacteria 2105
530 Ga0207662_10143930 3300025918 Bacteria 1512
531 Ga0207662_10151143 3300025918 Bacteria 1477
532 Ga0207657_10009090 3300025919 Bacteria 10027
533 Ga0207657_10011352 3300025919 Bacteria 8848
534 Ga0207657_10031190 3300025919 Bacteria 4831
535 Ga0207657_10089309 3300025919 Bacteria 2574
536 Ga0207657_10160334 3300025919 Bacteria 1827
537 Ga0207657_10720477 3300025919 Bacteria 774
538 Ga0207649_10107493 3300025920 Bacteria 1858
539 Ga0207649_10277022 3300025920 Bacteria 1218
540 Ga0207652_10001804 3300025921 Bacteria 18558
541 Ga0207652_10021369 3300025921 Bacteria 5342
542 Ga0207652_10229557 3300025921 Bacteria 1673
543 Ga0207646_10002219 3300025922 Bacteria 23119
544 Ga0207646_10004521 3300025922 Bacteria 15061
545 Ga0207646_10089943 3300025922 Bacteria 2748
546 Ga0207646_10164774 3300025922 Bacteria 2001
547 Ga0207646_11000142 3300025922 Bacteria 739
548 Ga0207681_10111346 3300025923 Bacteria 1992
549 Ga0207694_10086977 3300025924 Bacteria 2461
550 Ga0207694_10301737 3300025924 Bacteria 1319
551 Ga0207694_10617829 3300025924 Bacteria 912
552 Ga0207694_10632920 3300025924 Bacteria 901
553 Ga0207650_10200451 3300025925 Bacteria 1598
554 Ga0207650_10326002 3300025925 Bacteria 1259
555 Ga0207659_10222122 3300025926 Bacteria 1519
556 Ga0207659_10265005 3300025926 Bacteria 1399
557 Ga0207659_10522888 3300025926 Bacteria 1006
558 Ga0207659_10603190 3300025926 Bacteria 936
559 Ga0207659_10689202 3300025926 Bacteria 875
560 Ga0207687_10013673 3300025927 Bacteria 5300
561 Ga0207687_10014181 3300025927 Bacteria 5214
562 Ga0207687_10014768 3300025927 Bacteria 5114
563 Ga0207687_10041910 3300025927 Bacteria 3147
564 Ga0207687_10122994 3300025927 Bacteria 1943
565 Ga0207687_10228738 3300025927 Bacteria 1468
566 Ga0207687_10356001 3300025927 Bacteria 1194
567 Ga0207687_10357668 3300025927 Bacteria 1191
568 Ga0207687_10599966 3300025927 Bacteria 928
569 Ga0207687_11040189 3300025927 Bacteria 703
570 Ga0207687_11381314 3300025927 Bacteria 605
571 Ga0207700_10000006 3300025928 Bacteria 348187
572 Ga0207700_10179135 3300025928 Bacteria 1773
573 Ga0207700_10240254 3300025928 Bacteria 1543
574 Ga0207700_11130458 3300025928 Bacteria 700
575 Ga0207664_10019640 3300025929 Bacteria 4998
576 Ga0207664_10038527 3300025929 Bacteria 3708
577 Ga0207664_10071711 3300025929 Bacteria 2791
578 Ga0207664_10452860 3300025929 Bacteria 1146
579 Ga0207644_10083981 3300025931 Bacteria 2360
580 Ga0207644_10276872 3300025931 Bacteria 1346
581 Ga0207690_10080353 3300025932 Bacteria 2275
582 Ga0207690_10163491 3300025932 Bacteria 1661
583 Ga0207690_10417779 3300025932 Bacteria 1072
584 Ga0207690_10984473 3300025932 Bacteria 701
585 Ga0207706_10054740 3300025933 Bacteria 3520
586 Ga0207706_10092820 3300025933 Bacteria 2654
587 Ga0207706_10197043 3300025933 Bacteria 1767
588 Ga0207706_10291953 3300025933 Bacteria 1421
589 Ga0207686_10006420 3300025934 Bacteria 6330
590 Ga0207686_10049845 3300025934 Bacteria 2601
591 Ga0207686_10263327 3300025934 Bacteria 1265
592 Ga0207686_10359712 3300025934 Bacteria 1098
593 Ga0207686_10548927 3300025934 Bacteria 903
594 Ga0207686_10773519 3300025934 Bacteria 768
595 Ga0207686_10849897 3300025934 Bacteria 734
596 Ga0207709_10002442 3300025935 Bacteria 11670
597 Ga0207709_10068243 3300025935 Bacteria 2247
598 Ga0207709_10127069 3300025935 Bacteria 1731
599 Ga0207709_10160199 3300025935 Bacteria 1568
600 Ga0207709_10530852 3300025935 Bacteria 923
601 Ga0207670_10001639 3300025936 Bacteria 11686
602 Ga0207670_10041638 3300025936 Bacteria 3022
603 Ga0207670_10706752 3300025936 Bacteria 835
604 Ga0207669_10000741 3300025937 Bacteria 14156
605 Ga0207669_10027786 3300025937 Bacteria 3104
606 Ga0207669_10296503 3300025937 Bacteria 1227
607 Ga0207704_10002587 3300025938 Bacteria 8162
608 Ga0207704_10050650 3300025938 Bacteria 2506
609 Ga0207704_10517006 3300025938 Bacteria 965
610 Ga0207704_10553056 3300025938 Bacteria 935
611 Ga0207665_10005142 3300025939 Bacteria 8735
612 Ga0207665_10015530 3300025939 Bacteria 4997
613 Ga0207691_10011328 3300025940 Bacteria 8557
614 Ga0207691_10033253 3300025940 Bacteria 4801
615 Ga0207691_10054784 3300025940 Bacteria 3637
616 Ga0207691_10062587 3300025940 Bacteria 3376
617 Ga0207711_10074831 3300025941 Bacteria 2946
618 Ga0207711_10134936 3300025941 Bacteria 2216
619 Ga0207689_10045354 3300025942 Bacteria 3635
620 Ga0207661_10011131 3300025944 Bacteria 6504
621 Ga0207661_10017405 3300025944 Bacteria 5318
622 Ga0207661_10059653 3300025944 Bacteria 3075
623 Ga0207661_10066971 3300025944 Bacteria 2919
624 Ga0207661_10411731 3300025944 Bacteria 1227
625 Ga0207661_10866439 3300025944 Bacteria 832
626 Ga0207679_10012817 3300025945 Bacteria 5480
627 Ga0207679_10050441 3300025945 Bacteria 3041
628 Ga0207667_10074151 3300025949 Bacteria 3535
629 Ga0207667_10109046 3300025949 Bacteria 2856
630 Ga0207667_10165399 3300025949 Bacteria 2274
631 Ga0207651_10080764 3300025960 Bacteria 2342
632 Ga0207651_10151180 3300025960 Bacteria 1807
633 Ga0207651_10430784 3300025960 Bacteria 1128
634 Ga0207712_10031826 3300025961 Bacteria 3556
635 Ga0207668_10012328 3300025972 Bacteria 5230
636 Ga0207668_10731806 3300025972 Bacteria 871
637 Ga0207640_10068660 3300025981 Bacteria 2376
638 Ga0207640_10141661 3300025981 Bacteria 1753
639 Ga0207640_10212092 3300025981 Bacteria 1476
640 Ga0207640_10248507 3300025981 Bacteria 1379
641 Ga0207677_10485673 3300026023 Bacteria 1065
642 Ga0207703_10260880 3300026035 Bacteria 1566
643 Ga0207703_10306965 3300026035 Bacteria 1449
644 Ga0207639_10023531 3300026041 Bacteria 4450
645 Ga0207639_10080751 3300026041 Bacteria 2574
646 Ga0207639_10321879 3300026041 Bacteria 1373
647 Ga0207639_11513438 3300026041 Bacteria 630
648 Ga0207678_10000556 3300026067 Bacteria 34074
649 Ga0207678_10073869 3300026067 Bacteria 2922
650 Ga0207678_10182507 3300026067 Bacteria 1792
651 Ga0207678_10244431 3300026067 Bacteria 1537
652 Ga0207678_10584880 3300026067 Bacteria 978
653 Ga0207678_10746871 3300026067 Bacteria 862
654 Ga0207708_10000361 3300026075 Bacteria 35671
655 Ga0207708_10067661 3300026075 Bacteria 2733
656 Ga0207708_10095806 3300026075 Bacteria 2292
657 Ga0207708_10118851 3300026075 Bacteria 2058
658 Ga0207708_10326703 3300026075 Bacteria 1253
659 Ga0207702_10012490 3300026078 Bacteria 7065
660 Ga0207702_10026829 3300026078 Bacteria 4783
661 Ga0207702_10068739 3300026078 Bacteria 3044
662 Ga0207702_10217059 3300026078 Bacteria 1781
663 Ga0207702_10893998 3300026078 Bacteria 880
664 Ga0207641_11154320 3300026088 Bacteria 774
665 Ga0207641_11185448 3300026088 Bacteria 763
666 Ga0207648_10000504 3300026089 Bacteria 43569
667 Ga0207648_10074382 3300026089 Bacteria 2961
668 Ga0207648_10124642 3300026089 Bacteria 2266
669 Ga0207648_11288370 3300026089 Bacteria 687
670 Ga0207674_10028439 3300026116 Bacteria 5900
671 Ga0207674_10307267 3300026116 Bacteria 1535
672 Ga0207674_11002177 3300026116 Bacteria 804
673 Ga0207675_100004186 3300026118 Bacteria 13960
674 Ga0207675_100030270 3300026118 Bacteria 5042
675 Ga0207675_100178965 3300026118 Bacteria 2030
676 Ga0207675_100183784 3300026118 Bacteria 2003
677 Ga0207683_10002033 3300026121 Bacteria 17887
678 Ga0207683_10012118 3300026121 Bacteria 7361
679 Ga0207683_10022334 3300026121 Bacteria 5430
680 Ga0207683_10187410 3300026121 Bacteria 1877
681 Ga0207683_10423257 3300026121 Bacteria 1227
682 Ga0207683_10514411 3300026121 Bacteria 1106
683 Ga0207698_10112514 3300026142 Bacteria 2285
684 Ga0207698_10478819 3300026142 Bacteria 1207
685 Ga0207698_11568605 3300026142 Bacteria 674
686 Ga0209966_1004720 3300027695 Bacteria 2319
687 Ga0209966_1013057 3300027695 Bacteria 1532
688 Ga0207428_10004165 3300027907 Bacteria 13855
689 Ga0207428_10011417 3300027907 Bacteria 7851
690 Ga0207428_10143327 3300027907 Bacteria 1822
691 Ga0207428_10172623 3300027907 Bacteria 1637
692 Ga0207428_10193203 3300027907 Bacteria 1534
693 Ga0207428_10252897 3300027907 Bacteria 1314
694 Ga0268266_10000160 3300028379 Bacteria 125999
695 Ga0268266_10054431 3300028379 Bacteria 3438
696 Ga0268266_10117873 3300028379 Bacteria 2360
697 Ga0268266_10164021 3300028379 Bacteria 2012
698 Ga0268266_10413810 3300028379 Bacteria 1277
699 Ga0268265_10071356 3300028380 Bacteria 2705
700 Ga0268265_10459037 3300028380 Bacteria 1192
701 Ga0268265_11265464 3300028380 Bacteria 737
702 Ga0268264_10094962 3300028381 Bacteria 2579
703 Ga0268264_10132388 3300028381 Bacteria 2213
704 Ga0268264_10428503 3300028381 Bacteria 1277
705 Ga0265338_10020881 3300028800 Bacteria 6861
706 Ga0307408_100010668 3300031548 Bacteria 6059
707 Ga0307405_10490565 3300031731 Bacteria 982
708 Ga0307413_10274393 3300031824 Bacteria 1264
709 Ga0307413_10655923 3300031824 Bacteria 866
710 Ga0307410_10056381 3300031852 Bacteria 2672
711 Ga0307410_10096286 3300031852 Bacteria 2112
712 Ga0307406_10100497 3300031901 Bacteria 1969
713 Ga0307406_10415677 3300031901 Bacteria 1070
714 Ga0307407_10094640 3300031903 Bacteria 1839
715 Ga0307412_10038702 3300031911 Bacteria 3074
716 Ga0307409_100325883 3300031995 Bacteria 1439
717 Ga0307409_100801328 3300031995 Bacteria 949
718 Ga0307416_100040916 3300032002 Bacteria 3606
719 Ga0307416_100378917 3300032002 Bacteria 1444
720 Ga0307416_100611858 3300032002 Bacteria 1170
721 Ga0307414_10232365 3300032004 Bacteria 1521
722 Ga0307411_10054523 3300032005 Bacteria 2626
723 Ga0307411_10574505 3300032005 Bacteria 965
724 Ga0307415_100043503 3300032126 Bacteria 2997
725 Ga0307415_101019636 3300032126 Bacteria 770
726 Ga0373948_0000745 3300034817 Bacteria 4248
727 Ga0373948_0041000 3300034817 Bacteria 968
728 Ga0373950_0007319 3300034818 Bacteria 1710
729 Ga0373958_0009964 3300034819 Bacteria 1575
730 Ga0373958_0047429 3300034819 Bacteria 898
731 Ga0373959_0004609 3300034820 Bacteria 2228
732 Ga0373959_0082028 3300034820 Bacteria 744
733 Ga0373938_0029360 3300034957 Bacteria 1167
734 Ga0373928_0000817 3300035084 Bacteria 6077
735 Ga0373929_0004194 3300035085 Bacteria 2585
736 Ga0373940_0003794 3300035088 Bacteria 3126
737 Ga0373951_0083733 3300035091 Bacteria 828
738 Ga0373952_0041025 3300035092 Bacteria 1069
739 Ga0373952_0064783 3300035092 Bacteria 902
740 Ga0373932_0021380 3300035112 Bacteria 1707
741 Ga0373936_0118204 3300035113 Bacteria 1130
742 Ga0373936_0203648 3300035113 Bacteria 874
743 Ga0373939_0008627 3300035114 Bacteria 2503
744 Ga0373941_0005496 3300035115 Bacteria 2987
745 Ga0373941_0090706 3300035115 Bacteria 1048
746 Ga0373945_0154895 3300035116 Bacteria 931
747 Ga0373946_0186470 3300035171 Bacteria 987
748 Ga0373961_0027685 3300035241 Bacteria 1558
749 Ga0373962_0041506 3300035242 Bacteria 1297
750 Ga0373931_0022823 3300035691 Bacteria 3152
751 Ga0373931_0180591 3300035691 Bacteria 1249
752 Ga0373935_0113993 3300035692 Bacteria 1798
753 Ga0373935_0810639 3300035692 Bacteria 691
754 Ga0373925_0454488 3300037068 Bacteria 1049
755 Ga0395899_0002677 3300037312 Bacteria 14365
756 Ga0395899_0005165 3300037312 Bacteria 10157
757 Ga0395899_0010950 3300037312 Bacteria 6949
758 Ga0395899_0014775 3300037312 Bacteria 5959
759 Ga0395899_0030116 3300037312 Bacteria 4083
760 Ga0395899_0031719 3300037312 Bacteria 3970
761 Ga0395899_0064709 3300037312 Bacteria 2688
762 Ga0395899_0066602 3300037312 Bacteria 2644
763 Ga0395899_0096867 3300037312 Bacteria 2133
764 Ga0395899_0129842 3300037312 Bacteria 1800
765 Ga0395899_0156632 3300037312 Bacteria 1611
766 Ga0395899_0243965 3300037312 Bacteria 1235
767 Ga0395899_0250776 3300037312 Bacteria 1215
768 Ga0395900_0002314 3300037418 Bacteria 21122
769 Ga0395900_0005017 3300037418 Bacteria 13883
770 Ga0395900_0005056 3300037418 Bacteria 13836
771 Ga0395900_0008595 3300037418 Bacteria 10492
772 Ga0395900_0011172 3300037418 Bacteria 9180
773 Ga0395900_0015616 3300037418 Bacteria 7740
774 Ga0395900_0019876 3300037418 Bacteria 6846
775 Ga0395900_0035486 3300037418 Bacteria 5136
776 Ga0395900_0036755 3300037418 Bacteria 5048
777 Ga0395900_0137581 3300037418 Bacteria 2502
778 Ga0395900_0370752 3300037418 Bacteria 1401
779 Ga0395900_0575383 3300037418 Bacteria 1069
780 Ga0395900_0610069 3300037418 Bacteria 1031
781 Ga0395900_0610507 3300037418 Bacteria 1030
782 Ga0395900_0638970 3300037418 Bacteria 1002
783 Ga0395900_0776076 3300037418 Bacteria 887
784 Ga0395900_1145273 3300037418 Bacteria 694
785 Ga0395898_0008878 3300037466 Bacteria 10587
786 Ga0395898_0011934 3300037466 Bacteria 8999
787 Ga0395898_0015021 3300037466 Bacteria 7948
788 Ga0395898_0019771 3300037466 Bacteria 6848
789 Ga0395898_0066696 3300037466 Bacteria 3486
790 Ga0395898_0078458 3300037466 Bacteria 3186
791 Ga0395898_0081279 3300037466 Bacteria 3125
792 Ga0395898_0131451 3300037466 Bacteria 2397
793 Ga0395898_0135856 3300037466 Bacteria 2354
794 Ga0395898_0135982 3300037466 Bacteria 2353
795 Ga0395898_0213089 3300037466 Bacteria 1842
796 Ga0395898_0234888 3300037466 Bacteria 1748
797 Ga0395898_0248244 3300037466 Bacteria 1697
798 Ga0395898_0269104 3300037466 Bacteria 1625
799 Ga0395898_0279242 3300037466 Bacteria 1593
800 Ga0395898_0713759 3300037466 Bacteria 944
801 Ga0395905_0002930 3300037471 Bacteria 18574
802 Ga0395905_0005651 3300037471 Bacteria 12721
803 Ga0395905_0011779 3300037471 Bacteria 8443
804 Ga0395905_0021746 3300037471 Bacteria 6068
805 Ga0395905_0030326 3300037471 Bacteria 5097
806 Ga0395905_0072577 3300037471 Bacteria 3227
807 Ga0395905_0072817 3300037471 Bacteria 3221
808 Ga0395905_0090921 3300037471 Bacteria 2861
809 Ga0395905_0117045 3300037471 Bacteria 2504
810 Ga0395905_0148506 3300037471 Bacteria 2205
811 Ga0395905_0169840 3300037471 Bacteria 2048
812 Ga0395905_0326521 3300037471 Bacteria 1424
813 Ga0395905_0360590 3300037471 Bacteria 1346
814 Ga0395905_0626309 3300037471 Bacteria 978
815 Ga0395905_0665916 3300037471 Bacteria 943
816 Ga0395901_0004146 3300038443 Bacteria 14623
817 Ga0395901_0012936 3300038443 Bacteria 8467
818 Ga0395901_0019251 3300038443 Bacteria 6978
819 Ga0395901_0019880 3300038443 Bacteria 6870
820 Ga0395901_0034280 3300038443 Bacteria 5242
821 Ga0395901_0034750 3300038443 Bacteria 5207
822 Ga0395901_0053432 3300038443 Bacteria 4197
823 Ga0395901_0055432 3300038443 Bacteria 4122
824 Ga0395901_0073693 3300038443 Bacteria 3561
825 Ga0395901_0078250 3300038443 Bacteria 3453
826 Ga0395901_0104352 3300038443 Bacteria 2975
827 Ga0395901_0122685 3300038443 Bacteria 2730
828 Ga0395901_0138147 3300038443 Bacteria 2561
829 Ga0395901_0186992 3300038443 Bacteria 2172
830 Ga0395901_0254041 3300038443 Bacteria 1831
831 Ga0395901_0264641 3300038443 Bacteria 1789
832 Ga0395901_0287160 3300038443 Bacteria 1708
833 Ga0395901_0399939 3300038443 Bacteria 1411
834 Ga0395901_0449581 3300038443 Bacteria 1318
835 Ga0395901_0695528 3300038443 Bacteria 1015
836 Ga0395901_1089829 3300038443 Bacteria 770
837 Ga0436365_0993863 3300039437 Bacteria 1090
838 Ga0439439_0001480 3300041406 Bacteria 4699
839 Ga0439453_0018373 3300041408 Bacteria 1236
840 Ga0451795_1315107 3300041456 Bacteria 892
841 Ga0451804_1123069 3300041463 Bacteria 2306
842 Ga0451807_0653312 3300041486 Bacteria 2189
843 Ga0451807_0684468 3300041486 Bacteria 876
844 Ga0451835_0606000 3300041492 Bacteria 2949
845 Ga0451837_1085010 3300041494 Bacteria 980
846 Ga0451839_1101083 3300041496 Bacteria 1096
847 Ga0451847_0040919 3300041503 Bacteria 2954
848 Ga0451849_0345776 3300041505 Bacteria 1994
849 Ga0451849_1263986 3300041505 Bacteria 1020
850 Ga0451843_1553555 3300041509 Bacteria 1899
851 Ga0451855_0267913 3300041511 Bacteria 2655
852 Ga0451853_0842571 3300041512 Bacteria 2503
853 Ga0451853_2193972 3300041512 Bacteria 1925
854 Ga0439433_0069045 3300041999 Bacteria 850
855 Ga0439445_0138921 3300042004 Bacteria 704
856 Ga0439448_0086437 3300042005 Bacteria 1057
857 Ga0439449_0273915 3300042007 Bacteria 636
858 Ga0439451_002906 3300042009 Bacteria 3478
859 Ga0439454_035700 3300042011 Bacteria 797
860 Ga0439462_0002251 3300042015 Bacteria 4456
861 Ga0450915_001392 3300042119 Bacteria 1122
862 Ga0450920_017633 3300042122 Bacteria 1366
863 Ga0450920_052807 3300042122 Bacteria 816
864 Ga0450923_004598 3300042125 Bacteria 2172
865 Ga0450906_042517 3300042145 Bacteria 803
866 Ga0450910_033343 3300042147 Bacteria 814
867 Ga0450908_028668 3300042184 Bacteria 969
868 Ga0439434_0009198 3300042435 Bacteria 2905
869 Ga0439459_0046857 3300042438 Bacteria 937
870 Ga0439460_0072152 3300042461 Bacteria 1071
871 Ga0450918_016030 3300042531 Bacteria 1302
872 Ga0466965_0132724 3300044683 Bacteria 1292
873 Ga0466963_0260417 3300044694 Bacteria 1218
874 Ga0466964_0003859 3300044706 Bacteria 5500
875 Ga0466968_0018648 3300044735 Bacteria 2785
876 Ga0466960_0006156 3300044901 Bacteria 4802
877 Ga0466960_0340504 3300044901 Bacteria 853
878 Ga0466967_0009871 3300045976 Bacteria 7119
879 Ga0466967_0039679 3300045976 Bacteria 4050
880 Ga0466967_0142929 3300045976 Bacteria 2230
881 Ga0466967_0703834 3300045976 Bacteria 1001
882 Ga0466967_0744985 3300045976 Bacteria 971
883 Ga0495627_134364 3300046453 Bacteria 695
884 Ga0495592_0549596 3300046454 Bacteria 710
885 Ga0495603_0004496 3300046455 Bacteria 8320
886 Ga0495603_0042094 3300046455 Bacteria 2731
887 Ga0495603_0382978 3300046455 Bacteria 806
888 Ga0495629_0040269 3300046459 Bacteria 3287
889 Ga0495629_0355051 3300046459 Bacteria 999
890 Ga0495641_0086636 3300046461 Bacteria 1401
891 Ga0495651_0089605 3300046462 Bacteria 2309
892 Ga0495651_0264203 3300046462 Bacteria 1170
893 Ga0495651_0274401 3300046462 Bacteria 1142
894 Ga0495653_0302486 3300046463 Bacteria 1043
895 Ga0495653_0375351 3300046463 Bacteria 909
896 Ga0495582_0007896 3300046473 Bacteria 5881
897 Ga0495582_0145163 3300046473 Bacteria 1346
898 Ga0495582_0351402 3300046473 Bacteria 849
899 Ga0495662_0120499 3300046476 Bacteria 1288
900 Ga0495664_0156844 3300046477 Bacteria 1381
901 Ga0495584_0447700 3300046491 Bacteria 657
902 Ga0495585_0526403 3300046492 Bacteria 560
903 Ga0495594_0081817 3300046499 Bacteria 1803
904 Ga0495596_0063673 3300046500 Bacteria 1435
905 Ga0495596_0071639 3300046500 Bacteria 1346
906 Ga0495596_0093492 3300046500 Bacteria 1167
907 Ga0495596_0105982 3300046500 Bacteria 1092
908 Ga0495608_0246451 3300046511 Bacteria 1115
909 Ga0495618_0642179 3300046514 Bacteria 628
910 Ga0495628_0335579 3300046516 Bacteria 1113
911 Ga0495628_0360688 3300046516 Bacteria 1067
912 Ga0495630_0010267 3300046517 Bacteria 6756
913 Ga0495630_0520203 3300046517 Bacteria 912
914 Ga0495631_0157956 3300046518 Bacteria 973
915 Ga0495644_0187887 3300046523 Bacteria 795
916 Ga0495652_0042658 3300046529 Bacteria 3911
917 Ga0495665_0032457 3300046531 Bacteria 2793
918 Ga0495640_0018186 3300046533 Bacteria 5222
919 Ga0495640_0187699 3300046533 Bacteria 1315
920 Ga0495640_0348653 3300046533 Bacteria 914
921 Ga0495586_0177345 3300046535 Bacteria 1205
922 Ga0495587_0428365 3300046536 Bacteria 734
923 Ga0495645_0227411 3300046543 Bacteria 1251
924 Ga0495667_0105642 3300046559 Bacteria 1820
925 Ga0495656_0054065 3300046615 Bacteria 1727
926 Ga0495656_0187247 3300046615 Bacteria 1020
927 Ga0495656_0225093 3300046615 Bacteria 939
928 Ga0495656_0403543 3300046615 Bacteria 715
929 Ga0495668_0458522 3300046616 Bacteria 702
930 Ga0495634_0028348 3300046642 Bacteria 3888
931 Ga0495634_0109877 3300046642 Bacteria 1774
932 Ga0495635_0014022 3300046663 Bacteria 5609
933 Ga0495635_0176203 3300046663 Bacteria 1454
934 Ga0495657_0093077 3300046675 Bacteria 1930
935 Ga0495657_0164004 3300046675 Bacteria 1373
936 Ga0495646_0213416 3300046680 Bacteria 1046
937 Ga0495647_0038008 3300046681 Bacteria 1819
938 Ga0495647_0131592 3300046681 Bacteria 1060
939 Ga0495647_0234579 3300046681 Bacteria 813
940 Ga0495658_0088857 3300046683 Bacteria 1827
941 Ga0495658_0268469 3300046683 Bacteria 1075
942 Ga0495669_0215828 3300046684 Bacteria 919
943 Ga0495613_0000032 3300046689 Bacteria 139806
944 Ga0495613_0086792 3300046689 Bacteria 2268
945 Ga0495613_0343115 3300046689 Bacteria 1027
946 Ga0495613_0395390 3300046689 Bacteria 943
947 Ga0495624_0026354 3300046690 Bacteria 3811
948 Ga0495624_0038278 3300046690 Bacteria 3082
949 Ga0495624_0670949 3300046690 Bacteria 616
950 Ga0495589_0152763 3300046794 Bacteria 1102
951 Ga0495600_0300725 3300046809 Bacteria 1012
952 Ga0495600_0330727 3300046809 Bacteria 957
953 Ga0495581_0000297 3300047315 Bacteria 24170
954 Ga0495581_0014396 3300047315 Bacteria 4588
955 Ga0495581_0222101 3300047315 Bacteria 1105
956 Ga0495604_0180723 3300047317 Bacteria 1476
957 Ga0495674_0000010 3300047319 Bacteria 285794
958 Ga0495674_0023797 3300047319 Bacteria 5638
959 Ga0495674_0066981 3300047319 Bacteria 3113
960 Ga0495674_0256024 3300047319 Bacteria 1439
961 Ga0495674_0410278 3300047319 Bacteria 1092
962 Ga0495674_0941122 3300047319 Bacteria 665
963 Ga0495676_0058599 3300047321 Bacteria 3029
964 Ga0495676_0063592 3300047321 Bacteria 2875
965 Ga0495676_0074715 3300047321 Bacteria 2594
966 Ga0495680_0010847 3300047322 Bacteria 8106
967 Ga0495680_0353917 3300047322 Bacteria 1022
968 Ga0495675_0020709 3300047444 Bacteria 4185
969 Ga0495681_0272188 3300047470 Bacteria 663
970 Ga0495684_0010925 3300047471 Bacteria 7019
971 Ga0495684_0033550 3300047471 Bacteria 3937
972 Ga0495684_0416767 3300047471 Bacteria 940
973 Ga0495615_0118441 3300048090 Bacteria 764
974 Ga0496100_0001414 3300048903 Bacteria 11740
975 Ga0496100_0003404 3300048903 Bacteria 8289
976 Ga0496100_0015443 3300048903 Bacteria 4459
977 Ga0496100_0127863 3300048903 Bacteria 1786
978 Ga0496100_0132165 3300048903 Bacteria 1759
979 Ga0496100_0193046 3300048903 Bacteria 1480
980 Ga0496100_0485822 3300048903 Bacteria 950
981 Ga0496100_1077272 3300048903 Bacteria 633
982 Ga0496101_0004381 3300048904 Bacteria 8872
983 Ga0496101_0005067 3300048904 Bacteria 8378
984 Ga0496101_0006719 3300048904 Bacteria 7418
985 Ga0496101_0023061 3300048904 Bacteria 4295
986 Ga0496101_0077921 3300048904 Bacteria 2443
987 Ga0496101_0300246 3300048904 Bacteria 1258
988 Ga0496101_0335814 3300048904 Bacteria 1186
989 Ga0496101_0371018 3300048904 Bacteria 1125
990 Ga0496101_0430951 3300048904 Bacteria 1040
991 Ga0496101_0633409 3300048904 Bacteria 845
992 Ga0496102_0001710 3300048905 Bacteria 19219
993 Ga0496102_0015176 3300048905 Bacteria 6706
994 Ga0496102_0025349 3300048905 Bacteria 5278
995 Ga0496102_0086577 3300048905 Bacteria 2894
996 Ga0496102_0088006 3300048905 Bacteria 2870
997 Ga0496102_0130613 3300048905 Bacteria 2351
998 Ga0496102_0194510 3300048905 Bacteria 1911
999 Ga0496102_0198298 3300048905 Bacteria 1892
1000 Ga0496102_0310757 3300048905 Bacteria 1485
1001 Ga0496102_0321995 3300048905 Bacteria 1456
1002 Ga0496102_0421532 3300048905 Bacteria 1254
1003 Ga0496102_0707894 3300048905 Bacteria 930
1004 Ga0496102_1520707 3300048905 Bacteria 588
1005 Ga0496103_0004681 3300048906 Bacteria 8281
1006 Ga0496103_0011908 3300048906 Bacteria 5163
1007 Ga0496103_0029170 3300048906 Bacteria 3352
1008 Ga0496103_0043810 3300048906 Bacteria 2756
1009 Ga0496103_0215247 3300048906 Bacteria 1235
1010 Ga0496103_0305311 3300048906 Bacteria 1024
1011 Ga0496103_0305556 3300048906 Bacteria 1023
1012 Ga0496103_0512469 3300048906 Bacteria 767
1013 Ga0496103_0597419 3300048906 Bacteria 703
1014 Ga0496104_0000699 3300048907 Bacteria 28859
1015 Ga0496104_0027991 3300048907 Bacteria 5220
1016 Ga0496104_0030362 3300048907 Bacteria 5022
1017 Ga0496104_0037255 3300048907 Bacteria 4549
1018 Ga0496104_0059948 3300048907 Bacteria 3604
1019 Ga0496104_0070896 3300048907 Bacteria 3314
1020 Ga0496104_0072253 3300048907 Bacteria 3280
1021 Ga0496104_0087321 3300048907 Bacteria 2978
1022 Ga0496104_0093758 3300048907 Bacteria 2872
1023 Ga0496104_0150938 3300048907 Bacteria 2230
1024 Ga0496104_0163857 3300048907 Bacteria 2132
1025 Ga0496104_0282736 3300048907 Bacteria 1572
1026 Ga0496104_0298100 3300048907 Bacteria 1524
1027 Ga0496104_0708917 3300048907 Bacteria 914
1028 Ga0496104_0712356 3300048907 Bacteria 911
1029 Ga0496104_1250000 3300048907 Bacteria 646
1030 Ga0496105_0000148 3300048908 Bacteria 46239
1031 Ga0496105_0006474 3300048908 Bacteria 9001
1032 Ga0496105_0012336 3300048908 Bacteria 6767
1033 Ga0496105_0018289 3300048908 Bacteria 5629
1034 Ga0496105_0029387 3300048908 Bacteria 4499
1035 Ga0496105_0064058 3300048908 Bacteria 3033
1036 Ga0496105_0138585 3300048908 Bacteria 2003
1037 Ga0496105_0143617 3300048908 Bacteria 1964
1038 Ga0496105_0350970 3300048908 Bacteria 1178
1039 Ga0496105_0448366 3300048908 Bacteria 1019
1040 Ga0496106_0005655 3300048909 Bacteria 9248
1041 Ga0496106_0012691 3300048909 Bacteria 6224
1042 Ga0496106_0031163 3300048909 Bacteria 3973
1043 Ga0496106_0074430 3300048909 Bacteria 2600
1044 Ga0496106_0125755 3300048909 Bacteria 2007
1045 Ga0496106_0169838 3300048909 Bacteria 1728
1046 Ga0496106_0205136 3300048909 Bacteria 1570
1047 Ga0496106_0342386 3300048909 Bacteria 1201
1048 Ga0496106_0814146 3300048909 Bacteria 740
1049 Ga0496106_1170776 3300048909 Bacteria 600
1050 Ga0496107_0011632 3300048910 Bacteria 6133
1051 Ga0496107_0019629 3300048910 Bacteria 4768
1052 Ga0496107_0070977 3300048910 Bacteria 2530
1053 Ga0496107_0261338 3300048910 Bacteria 1288
1054 Ga0496107_0784534 3300048910 Bacteria 698
1055 Ga0496107_0971516 3300048910 Bacteria 617
1056 Ga0496108_0000473 3300048911 Bacteria 32225
1057 Ga0496108_0001586 3300048911 Bacteria 18012
1058 Ga0496108_0007122 3300048911 Bacteria 9061
1059 Ga0496108_0009678 3300048911 Bacteria 7811
1060 Ga0496108_0010037 3300048911 Bacteria 7679
1061 Ga0496108_0130450 3300048911 Bacteria 2161
1062 Ga0496108_0144813 3300048911 Bacteria 2048
1063 Ga0496108_0247369 3300048911 Bacteria 1551
1064 Ga0496108_0261714 3300048911 Bacteria 1505
1065 Ga0496108_0262987 3300048911 Bacteria 1501
1066 Ga0496108_0393411 3300048911 Bacteria 1210
1067 Ga0496109_0005032 3300048912 Bacteria 11043
1068 Ga0496109_0005657 3300048912 Bacteria 10455
1069 Ga0496109_0011181 3300048912 Bacteria 7703
1070 Ga0496109_0012604 3300048912 Bacteria 7300
1071 Ga0496109_0019754 3300048912 Bacteria 5944
1072 Ga0496109_0035866 3300048912 Bacteria 4477
1073 Ga0496109_0044447 3300048912 Bacteria 4030
1074 Ga0496109_0086054 3300048912 Bacteria 2903
1075 Ga0496109_0106073 3300048912 Bacteria 2610
1076 Ga0496109_0236780 3300048912 Bacteria 1717
1077 Ga0496109_0264568 3300048912 Bacteria 1620
1078 Ga0496109_0291911 3300048912 Bacteria 1537
1079 Ga0496109_0528664 3300048912 Bacteria 1113
1080 Ga0496109_0570146 3300048912 Bacteria 1067
1081 Ga0496109_0933575 3300048912 Bacteria 806
1082 Ga0496110_0000707 3300048913 Bacteria 23061
1083 Ga0496110_0001277 3300048913 Bacteria 18022
1084 Ga0496110_0007330 3300048913 Bacteria 8802
1085 Ga0496110_0007405 3300048913 Bacteria 8762
1086 Ga0496110_0016856 3300048913 Bacteria 6104
1087 Ga0496110_0018310 3300048913 Bacteria 5873
1088 Ga0496110_0019310 3300048913 Bacteria 5733
1089 Ga0496110_0038868 3300048913 Bacteria 4142
1090 Ga0496110_0088198 3300048913 Bacteria 2771
1091 Ga0496110_0099775 3300048913 Bacteria 2603
1092 Ga0496110_0157002 3300048913 Bacteria 2061
1093 Ga0496110_0217134 3300048913 Bacteria 1739
1094 Ga0496110_0274193 3300048913 Bacteria 1536
1095 Ga0496110_0446714 3300048913 Bacteria 1178
1096 Ga0496110_0510108 3300048913 Bacteria 1094
1097 Ga0496110_0579359 3300048913 Bacteria 1019
1098 Ga0496111_0003548 3300048914 Bacteria 9659
1099 Ga0496111_0005116 3300048914 Bacteria 8350
1100 Ga0496111_0013548 3300048914 Bacteria 5554
1101 Ga0496111_0034814 3300048914 Bacteria 3597
1102 Ga0496111_0038623 3300048914 Bacteria 3421
1103 Ga0496111_0085826 3300048914 Bacteria 2302
1104 Ga0496111_0154537 3300048914 Bacteria 1702
1105 Ga0496111_0188168 3300048914 Bacteria 1535
1106 Ga0496111_0201795 3300048914 Bacteria 1478
1107 Ga0496111_0216114 3300048914 Bacteria 1424
1108 Ga0496111_0221778 3300048914 Bacteria 1405
1109 Ga0496111_0232861 3300048914 Bacteria 1368
1110 Ga0496111_0317966 3300048914 Bacteria 1153
1111 Ga0496111_0584824 3300048914 Bacteria 818
1112 Ga0496111_0675651 3300048914 Bacteria 752
1113 Ga0496112_0001515 3300048915 Bacteria 17883
1114 Ga0496112_0003614 3300048915 Bacteria 12876
1115 Ga0496112_0029708 3300048915 Bacteria 5288
1116 Ga0496112_0049016 3300048915 Bacteria 4139
1117 Ga0496112_0061172 3300048915 Bacteria 3712
1118 Ga0496112_0067348 3300048915 Bacteria 3534
1119 Ga0496112_0249964 3300048915 Bacteria 1724
1120 Ga0496112_1153244 3300048915 Bacteria 692
1121 Ga0496113_0003455 3300048916 Bacteria 9459
1122 Ga0496113_0014450 3300048916 Bacteria 5386
1123 Ga0496113_0024379 3300048916 Bacteria 4300
1124 Ga0496113_0057619 3300048916 Bacteria 2920
1125 Ga0496113_0101088 3300048916 Bacteria 2235
1126 Ga0496113_0194419 3300048916 Bacteria 1611
1127 Ga0496113_0207366 3300048916 Bacteria 1559
1128 Ga0496113_0592642 3300048916 Bacteria 888
1129 Ga0496113_0968070 3300048916 Bacteria 671
1130 Ga0496113_0994118 3300048916 Bacteria 661
1131 Ga0496114_0002235 3300048917 Bacteria 14749
1132 Ga0496114_0005309 3300048917 Bacteria 10069
1133 Ga0496114_0009487 3300048917 Bacteria 7726
1134 Ga0496114_0012323 3300048917 Bacteria 6841
1135 Ga0496114_0022727 3300048917 Bacteria 5111
1136 Ga0496114_0058632 3300048917 Bacteria 3215
1137 Ga0496114_0063757 3300048917 Bacteria 3085
1138 Ga0496114_0113482 3300048917 Bacteria 2323
1139 Ga0496114_0125150 3300048917 Bacteria 2215
1140 Ga0496114_0147165 3300048917 Bacteria 2042
1141 Ga0496114_0170411 3300048917 Bacteria 1897
1142 Ga0496114_0174045 3300048917 Bacteria 1877
1143 Ga0496114_0199171 3300048917 Bacteria 1754
1144 Ga0496114_0221568 3300048917 Bacteria 1661
1145 Ga0496114_0667394 3300048917 Bacteria 913
1146 Ga0496114_0866935 3300048917 Bacteria 783
1147 Ga0496115_0004633 3300048918 Bacteria 9949
1148 Ga0496115_0007806 3300048918 Bacteria 7889
1149 Ga0496115_0012826 3300048918 Bacteria 6318
1150 Ga0496115_0773400 3300048918 Bacteria 749
1151 Ga0496116_0000367 3300048919 Bacteria 69349
1152 Ga0496117_0009719 3300048920 Bacteria 8887
1153 Ga0496118_0000790 3300048921 Bacteria 50676
1154 Ga0496118_0037330 3300048921 Bacteria 3912
1155 Ga0496118_0137242 3300048921 Bacteria 1558
1156 Ga0496119_0002341 3300048922 Bacteria 20874
1157 Ga0496119_0004056 3300048922 Bacteria 14778
1158 Ga0496120_0027702 3300048923 Bacteria 3480
1159 Ga0496121_0007546 3300048924 Bacteria 13107
1160 Ga0496121_0016650 3300048924 Bacteria 7571
1161 Ga0496124_0070429 3300048927 Bacteria 2901
1162 Ga0496126_0027031 3300048929 Bacteria 5490
1163 Ga0496126_0045339 3300048929 Bacteria 4042
1164 Ga0496126_0067915 3300048929 Bacteria 3184
1165 Ga0496126_0163742 3300048929 Bacteria 1899
1166 Ga0501031_0000147 3300049568 Bacteria 39718
1167 Ga0501031_0010809 3300049568 Bacteria 5944
1168 Ga0501031_0025727 3300049568 Bacteria 3839
1169 Ga0501032_0000328 3300049569 Bacteria 39724
1170 Ga0501032_0047331 3300049569 Bacteria 2904
1171 Ga0501032_0126717 3300049569 Bacteria 1686
1172 Ga0501033_0000261 3300049570 Bacteria 50442
1173 Ga0501033_0033546 3300049570 Bacteria 3854
1174 Ga0501033_0317149 3300049570 Bacteria 1095
1175 Ga0501033_0484002 3300049570 Bacteria 857
1176 Ga0501034_0198328 3300049571 Bacteria 1966
1177 Ga0501034_0408473 3300049571 Bacteria 1280
1178 Ga0501036_0013236 3300049572 Bacteria 6848
1179 Ga0501036_0027313 3300049572 Bacteria 4822
1180 Ga0501036_0142807 3300049572 Bacteria 2020
1181 Ga0501036_0355852 3300049572 Bacteria 1222
1182 Ga0501036_1749535 3300049572 Bacteria 501
1183 Ga0501037_0000221 3300049573 Bacteria 49689
1184 Ga0501037_0014363 3300049573 Bacteria 5831
1185 Ga0501037_0039858 3300049573 Bacteria 3457
1186 Ga0501037_0522442 3300049573 Bacteria 803
1187 Ga0501038_0000101 3300049574 Bacteria 72459
1188 Ga0501038_0007223 3300049574 Bacteria 10262
1189 Ga0501038_0025650 3300049574 Bacteria 5251
1190 Ga0501038_0037049 3300049574 Bacteria 4279
1191 Ga0501038_0164775 3300049574 Bacteria 1799
1192 Ga0501039_0038047 3300049575 Bacteria 3716
1193 Ga0501039_0042515 3300049575 Bacteria 3510
1194 Ga0501039_0081577 3300049575 Bacteria 2518
1195 Ga0501039_0114668 3300049575 Bacteria 2108
1196 Ga0501039_0138622 3300049575 Bacteria 1910
1197 Ga0501039_0488107 3300049575 Bacteria 967
1198 Ga0501040_0009583 3300049576 Bacteria 6317
1199 Ga0501040_0028090 3300049576 Bacteria 3791
1200 Ga0501040_0071669 3300049576 Bacteria 2392
1201 Ga0501040_0101469 3300049576 Bacteria 2007
1202 Ga0501040_1077820 3300049576 Bacteria 583
1203 Ga0501041_0033432 3300049577 Bacteria 3111
1204 Ga0501041_0049103 3300049577 Bacteria 2570
1205 Ga0501041_0051886 3300049577 Bacteria 2500
1206 Ga0501041_0067953 3300049577 Bacteria 2184
1207 Ga0501042_0015582 3300049578 Bacteria 5207
1208 Ga0501042_0039423 3300049578 Bacteria 3357
1209 Ga0501042_0042800 3300049578 Bacteria 3224
1210 Ga0501042_0045345 3300049578 Bacteria 3133
1211 Ga0501042_0107456 3300049578 Bacteria 2009
1212 Ga0501042_0598256 3300049578 Bacteria 802
1213 Ga0501042_0620371 3300049578 Bacteria 786
1214 Ga0501043_0000237 3300049579 Bacteria 49809
1215 Ga0501043_0050524 3300049579 Bacteria 3268
1216 Ga0501043_0112186 3300049579 Bacteria 2141
1217 Ga0501043_0157458 3300049579 Bacteria 1776
1218 Ga0501043_0248116 3300049579 Bacteria 1372
1219 Ga0501043_0265644 3300049579 Bacteria 1318
1220 Ga0501046_0000608 3300049580 Bacteria 35208
1221 Ga0501046_0014807 3300049580 Bacteria 6566
1222 Ga0501046_0021842 3300049580 Bacteria 5276
1223 Ga0501046_0039989 3300049580 Bacteria 3750
1224 Ga0501046_0074463 3300049580 Bacteria 2634
1225 Ga0501047_0000376 3300049581 Bacteria 50385
1226 Ga0501047_0359052 3300049581 Bacteria 1293
1227 Ga0501048_0002386 3300049582 Bacteria 14347
1228 Ga0501048_0009728 3300049582 Bacteria 7210
1229 Ga0501048_0039456 3300049582 Bacteria 3387
1230 Ga0501048_0084418 3300049582 Bacteria 2239
1231 Ga0501067_0002463 3300049583 Bacteria 10212
1232 Ga0501067_0028662 3300049583 Bacteria 3085
1233 Ga0501067_0037343 3300049583 Bacteria 2698
1234 Ga0501067_0112316 3300049583 Bacteria 1515
1235 Ga0501067_0374018 3300049583 Bacteria 794
1236 Ga0501068_0003202 3300049584 Bacteria 8769
1237 Ga0501068_0011394 3300049584 Bacteria 5021
1238 Ga0501068_0019186 3300049584 Bacteria 3967
1239 Ga0501068_0026977 3300049584 Bacteria 3389
1240 Ga0501068_0245060 3300049584 Bacteria 1141
1241 Ga0501068_0264031 3300049584 Bacteria 1098
1242 Ga0501068_0283290 3300049584 Bacteria 1059
1243 Ga0501069_0002285 3300049585 Bacteria 9681
1244 Ga0501069_0021031 3300049585 Bacteria 3539
1245 Ga0501069_0034366 3300049585 Bacteria 2792
1246 Ga0501069_0067198 3300049585 Bacteria 2005
1247 Ga0501069_0095330 3300049585 Bacteria 1685
1248 Ga0501069_0321065 3300049585 Bacteria 910
1249 Ga0501070_0000178 3300049586 Bacteria 59157
1250 Ga0501070_0028914 3300049586 Bacteria 4647
1251 Ga0501070_0031027 3300049586 Bacteria 4477
1252 Ga0501070_0047946 3300049586 Bacteria 3550
1253 Ga0501070_0118020 3300049586 Bacteria 2192
1254 Ga0501070_0135429 3300049586 Bacteria 2034
1255 Ga0501070_0185810 3300049586 Bacteria 1709
1256 Ga0501071_0006552 3300049587 Bacteria 7560
1257 Ga0501071_0008171 3300049587 Bacteria 6904
1258 Ga0501071_0016603 3300049587 Bacteria 5065
1259 Ga0501071_0019463 3300049587 Bacteria 4710
1260 Ga0501071_0034047 3300049587 Bacteria 3622
1261 Ga0501071_0297037 3300049587 Bacteria 1224
1262 Ga0501071_1223421 3300049587 Bacteria 580
1263 Ga0501072_0007798 3300049588 Bacteria 8131
1264 Ga0501072_0030995 3300049588 Bacteria 4183
1265 Ga0501072_0032382 3300049588 Bacteria 4094
1266 Ga0501072_0051648 3300049588 Bacteria 3237
1267 Ga0501072_0147135 3300049588 Bacteria 1878
1268 Ga0501072_0347930 3300049588 Bacteria 1177
1269 Ga0501073_0000255 3300049589 Bacteria 35173
1270 Ga0501073_0526913 3300049589 Bacteria 817
1271 Ga0501073_0731805 3300049589 Bacteria 682
1272 Ga0501074_0009081 3300049590 Bacteria 7221
1273 Ga0501074_0009861 3300049590 Bacteria 6937
1274 Ga0501074_0013390 3300049590 Bacteria 5963
1275 Ga0501074_0053674 3300049590 Bacteria 2907
1276 Ga0501074_0054458 3300049590 Bacteria 2885
1277 Ga0501074_0057842 3300049590 Bacteria 2793
1278 Ga0501074_0509099 3300049590 Bacteria 853
1279 Ga0501074_0612558 3300049590 Bacteria 770
1280 Ga0501075_0028106 3300049591 Bacteria 4149
1281 Ga0501075_0044046 3300049591 Bacteria 3347
1282 Ga0501075_0116149 3300049591 Bacteria 2034
1283 Ga0501075_0151058 3300049591 Bacteria 1770
1284 Ga0501075_0452568 3300049591 Bacteria 979
1285 Ga0501075_0472136 3300049591 Bacteria 957
1286 Ga0501076_0042310 3300049592 Bacteria 3585
1287 Ga0501076_0093689 3300049592 Bacteria 2417
1288 Ga0501076_0099826 3300049592 Bacteria 2339
1289 Ga0501077_0029871 3300049593 Bacteria 3466
1290 Ga0501077_0050602 3300049593 Bacteria 2640
1291 Ga0501077_0061380 3300049593 Bacteria 2385
1292 Ga0501077_0074790 3300049593 Bacteria 2145
1293 Ga0501077_0085534 3300049593 Bacteria 1999
1294 Ga0501077_0295067 3300049593 Bacteria 1032
1295 Ga0501077_0323808 3300049593 Bacteria 983
1296 Ga0501079_0003618 3300049741 Bacteria 11377
1297 Ga0501079_0007849 3300049741 Bacteria 8081
1298 Ga0501079_0011138 3300049741 Bacteria 6858
1299 Ga0501079_0047549 3300049741 Bacteria 3310
1300 Ga0501079_0071112 3300049741 Bacteria 2687
1301 Ga0501079_0089886 3300049741 Bacteria 2378
1302 Ga0501079_0185699 3300049741 Bacteria 1623
1303 Ga0501080_0028342 3300049742 Bacteria 5209
1304 Ga0501080_0069205 3300049742 Bacteria 3282
1305 Ga0501080_0081718 3300049742 Bacteria 3001
1306 Ga0501080_0205668 3300049742 Bacteria 1805
1307 Ga0501080_0251833 3300049742 Bacteria 1610
1308 Ga0501080_0734353 3300049742 Bacteria 869
1309 Ga0501081_0002490 3300049743 Bacteria 11610
1310 Ga0501081_0017391 3300049743 Bacteria 4758
1311 Ga0501081_0088500 3300049743 Bacteria 2175
1312 Ga0501081_0137823 3300049743 Bacteria 1747
1313 Ga0501081_0346050 3300049743 Bacteria 1095
1314 Ga0501081_0816730 3300049743 Bacteria 702
1315 Ga0501083_0006418 3300049744 Bacteria 8340
1316 Ga0501083_0025765 3300049744 Bacteria 4071
1317 Ga0501035_0000616 3300049822 Bacteria 39216
1318 Ga0501035_0009935 3300049822 Bacteria 8836
1319 Ga0501035_0022728 3300049822 Bacteria 5759
1320 Ga0501035_0955742 3300049822 Bacteria 676
1321 Ga0501035_1080203 3300049822 Bacteria 628
1322 Ga0501044_0000416 3300049823 Bacteria 52684
1323 Ga0501044_0627774 3300049823 Bacteria 965
1324 Ga0501045_0001647 3300049824 Bacteria 14995
1325 Ga0501045_0001860 3300049824 Bacteria 14277
1326 Ga0501045_0024794 3300049824 Bacteria 4308
1327 Ga0501045_0070270 3300049824 Bacteria 2575
1328 Ga0501045_0118294 3300049824 Bacteria 1966
1329 Ga0501045_0317049 3300049824 Bacteria 1160
1330 nmdc:mga03683_195001_c1 3300050489 Bacteria 928
1331 nmdc:mga03n38_79143_c1 3300050490 Bacteria 1540
1332 nmdc:mga00v17_55484_c1 3300050491 Bacteria 2420
1333 nmdc:mga0yw44_112268_c1 3300050492 Bacteria 1748
1334 nmdc:mga0yw44_11585_c1 3300050492 Bacteria 4561
1335 nmdc:mga0yw44_157489_c1 3300050492 Bacteria 1485
1336 nmdc:mga0yw44_363807_c1 3300050492 Bacteria 975
1337 nmdc:mga0yw44_464931_c1 3300050492 Bacteria 857
1338 nmdc:mga0yw44_547204_c1 3300050492 Bacteria 786
1339 nmdc:mga0yw44_560035_c1 3300050492 Bacteria 776
1340 nmdc:mga0yw44_74487_c1 3300050492 Bacteria 2115
1341 nmdc:mga0k408_71830_c1 3300050493 Bacteria 2020
1342 nmdc:mga06z11_574907_c1 3300050494 Bacteria 685
1343 nmdc:mga07m45_181926_c1 3300050496 Bacteria 1222
1344 nmdc:mga05p37_125898_c1 3300050507 Bacteria 3147
1345 nmdc:mga05p37_126646_c1 3300050507 Bacteria 3136
1346 nmdc:mga05p37_1648_c1 3300050507 Bacteria 25906
1347 nmdc:mga05p37_17988_c1 3300050507 Bacteria 8535
1348 nmdc:mga05p37_195526_c1 3300050507 Bacteria 2452
1349 nmdc:mga05p37_312763_c1 3300050507 Bacteria 1861
1350 nmdc:mga05p37_40689_c1 3300050507 Bacteria 5707
1351 nmdc:mga05p37_6927_c1 3300050507 Bacteria 13357
1352 nmdc:mga09592_16687_c1 3300050508 Bacteria 6010
1353 nmdc:mga09592_211174_c1 3300050508 Bacteria 1682
1354 nmdc:mga09592_392309_c1 3300050508 Bacteria 1200
1355 nmdc:mga09592_422150_c1 3300050508 Bacteria 1152
1356 nmdc:mga0qj67_18159_c1 3300050509 Bacteria 5360
1357 nmdc:mga0qj67_31898_c1 3300050509 Bacteria 4107
1358 nmdc:mga0qj67_47530_c1 3300050509 Bacteria 3390
1359 nmdc:mga06r32_10877_c1 3300050510 Bacteria 8194
1360 nmdc:mga06r32_17339_c1 3300050510 Bacteria 6573
1361 nmdc:mga06r32_440431_c1 3300050510 Bacteria 1283
1362 nmdc:mga08y16_1038250_c1 3300050511 Bacteria 798
1363 nmdc:mga08y16_151177_c1 3300050511 Bacteria 2413
1364 nmdc:mga08y16_251122_c1 3300050511 Bacteria 1828
1365 nmdc:mga08y16_27373_c1 3300050511 Bacteria 6007
1366 nmdc:mga08y16_29922_c1 3300050511 Bacteria 5735
1367 nmdc:mga08y16_41702_c1 3300050511 Bacteria 4807
1368 nmdc:mga08y16_494882_c1 3300050511 Bacteria 1243
1369 nmdc:mga0n895_1526566_c1 3300050512 Bacteria 634
1370 nmdc:mga0n895_25792_c1 3300050512 Bacteria 5558
1371 nmdc:mga0n895_278774_c1 3300050512 Bacteria 1695
1372 nmdc:mga0n895_3549_c1 3300050512 Bacteria 12624
1373 nmdc:mga0n895_629419_c1 3300050512 Bacteria 1073
1374 nmdc:mga0n895_89680_c1 3300050512 Bacteria 3076
1375 nmdc:mga0rr50_10115_c1 3300050513 Bacteria 5969
1376 nmdc:mga0rr50_12482_c1 3300050513 Bacteria 5495
1377 nmdc:mga0rr50_181792_c1 3300050513 Bacteria 1719
1378 nmdc:mga0rr50_37190_c1 3300050513 Bacteria 3511
1379 nmdc:mga0rr50_378369_c1 3300050513 Bacteria 1193
1380 nmdc:mga08x19_110281_c1 3300050514 Bacteria 1835
1381 nmdc:mga08x19_292490_c1 3300050514 Bacteria 1130
1382 nmdc:mga08x19_29979_c1 3300050514 Bacteria 3415
1383 nmdc:mga08x19_7780_c1 3300050514 Bacteria 6368
1384 nmdc:mga0a205_114994_c1 3300050515 Bacteria 2589
1385 nmdc:mga0a205_13742_c1 3300050515 Bacteria 7545
1386 nmdc:mga0a205_267040_c1 3300050515 Bacteria 1208
1387 nmdc:mga0a205_321556_c1 3300050515 Bacteria 1418
1388 nmdc:mga0a205_436702_c1 3300050515 Bacteria 1170
1389 nmdc:mga0a205_65345_c1 3300050515 Bacteria 3515
1390 nmdc:mga0a205_69653_c1 3300050515 Bacteria 3396
1391 nmdc:mga0a205_983605_c1 3300050515 Bacteria 691
1392 nmdc:mga0a205_99615_c1 3300050515 Bacteria 2804
1393 Ga0495601_0066263 3300053077 Bacteria 2299
1394 Ga0495601_0073297 3300053077 Bacteria 2188
1395 Ga0495601_0220140 3300053077 Bacteria 1240
1396 Ga0495601_0351596 3300053077 Bacteria 958
1397 Ga0495601_0807346 3300053077 Bacteria 595
1398 Ga0495612_0320396 3300053078 Bacteria 697
1399 Ga0495595_0038785 3300053084 Bacteria 2172
1400 Ga0495595_0076905 3300053084 Bacteria 1585
1401 Ga0495619_0064672 3300053085 Bacteria 2439
1402 Ga0500595_024224 3300053119 Bacteria 2121
1403 Ga0501084_0034170 3300054114 Bacteria 4251
1404 Ga0501084_0036044 3300054114 Bacteria 4133
1405 Ga0501084_0095406 3300054114 Bacteria 2498
1406 Ga0501084_0313797 3300054114 Bacteria 1324
1407 Ga0501084_0447593 3300054114 Bacteria 1092
1408 Ga0501084_0471877 3300054114 Bacteria 1061
1409 Ga0501084_0828857 3300054114 Bacteria 779
1410 Ga0501084_1388174 3300054114 Bacteria 588
1411 Ga0590075_042665 3300059424 Bacteria 1160
1412 Ga0501082_0009118 3300060353 Bacteria 8554
1413 Ga0501082_0017984 3300060353 Bacteria 6087
1414 Ga0501082_0026510 3300060353 Bacteria 4995
1415 Ga0501082_0042063 3300060353 Bacteria 3940
1416 Ga0501082_0105456 3300060353 Bacteria 2438
1417 Ga0501082_0205930 3300060353 Bacteria 1711
1418 Ga0501082_0822213 3300060353 Bacteria 813
1419 Ga0530510_0005142 3300061734 Bacteria 9027
1420 Ga0530510_0019797 3300061734 Bacteria 4782
1421 Ga0530510_0054839 3300061734 Bacteria 2880
1422 Ga0530510_0073493 3300061734 Bacteria 2482
1423 Ga0530510_0150741 3300061734 Bacteria 1717
1424 Ga0530510_0485982 3300061734 Bacteria 935
1425 Ga0530510_0553745 3300061734 Bacteria 873
1426 Ga0530510_0870490 3300061734 Bacteria 688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_1749535 Ga0501036_1749535_10_489 158
2 3300026035 Ga0207703_10306965 Ga0207703_103069652 163
3 3300003203 JGI25406J46586_10051888 JGI25406J46586_100518882 175
4 3300005439 Ga0070711_100178110 Ga0070711_1001781102 175
5 3300005985 Ga0081539_10000041 Ga0081539_10000041161 175
6 3300006914 Ga0075436_100400936 Ga0075436_1004009362 175
7 3300013104 Ga0157370_10012969 Ga0157370_100129698 175
8 3300013105 Ga0157369_10495185 Ga0157369_104951852 175
9 3300025934 Ga0207686_10773519 Ga0207686_107735191 175
10 3300026142 Ga0207698_11568605 Ga0207698_115686051 175
11 3300037418 Ga0395900_0137581 Ga0395900_0137581_10_537 175
12 3300037418 Ga0395900_1145273 Ga0395900_1145273_152_679 175
13 3300041999 Ga0439433_0069045 Ga0439433_0069045_303_830 175
14 3300042004 Ga0439445_0138921 Ga0439445_0138921_158_685 175
15 3300042007 Ga0439449_0273915 Ga0439449_0273915_82_609 175
16 3300045976 Ga0466967_0703834 Ga0466967_0703834_460_987 175
17 3300046462 Ga0495651_0089605 Ga0495651_0089605_14_541 175
18 3300046473 Ga0495582_0351402 Ga0495582_0351402_300_827 175
19 3300046492 Ga0495585_0526403 Ga0495585_0526403_17_544 175
20 3300046690 Ga0495624_0670949 Ga0495624_0670949_21_548 175
21 3300048903 Ga0496100_0127863 Ga0496100_0127863_1008_1535 175
22 3300048904 Ga0496101_0371018 Ga0496101_0371018_74_601 175
23 3300048904 Ga0496101_0633409 Ga0496101_0633409_13_540 175
24 3300048905 Ga0496102_1520707 Ga0496102_1520707_11_538 175
25 3300048906 Ga0496103_0305311 Ga0496103_0305311_469_996 175
26 3300048909 Ga0496106_0342386 Ga0496106_0342386_23_550 175
27 3300048909 Ga0496106_1170776 Ga0496106_1170776_57_584 175
28 3300048910 Ga0496107_0971516 Ga0496107_0971516_33_560 175
29 3300048916 Ga0496113_0968070 Ga0496113_0968070_115_642 175
30 3300049576 Ga0501040_1077820 Ga0501040_1077820_32_559 175
31 3300049579 Ga0501043_0248116 Ga0501043_0248116_19_546 175
32 3300049579 Ga0501043_0265644 Ga0501043_0265644_767_1294 175
33 3300049587 Ga0501071_1223421 Ga0501071_1223421_37_564 175
34 3300049589 Ga0501073_0526913 Ga0501073_0526913_14_541 175
35 3300049741 Ga0501079_0047549 Ga0501079_0047549_26_553 175
36 3300050492 nmdc:mga0yw44_112268_c1 nmdc:mga0yw44_112268_c1_1190_1717 175
37 3300050492 nmdc:mga0yw44_363807_c1 nmdc:mga0yw44_363807_c1_430_957 175
38 3300050512 nmdc:mga0n895_629419_c1 nmdc:mga0n895_629419_c1_19_546 175
39 3300050515 nmdc:mga0a205_436702_c1 nmdc:mga0a205_436702_c1_22_549 175
40 3300053077 Ga0495601_0807346 Ga0495601_0807346_38_565 175
41 3300053078 Ga0495612_0320396 Ga0495612_0320396_33_560 175
42 3300054114 Ga0501084_0828857 Ga0501084_0828857_242_769 175
43 3300054114 Ga0501084_1388174 Ga0501084_1388174_48_575 175
44 3300059424 Ga0590075_042665 Ga0590075_042665_292_819 175
45 3300006175 Ga0070712_100030086 Ga0070712_1000300863 176
46 3300025906 Ga0207699_10011099 Ga0207699_100110993 176
47 3300025915 Ga0207693_10164394 Ga0207693_101643942 176
48 3300032002 Ga0307416_100040916 Ga0307416_1000409162 178
49 3300032002 Ga0307416_100378917 Ga0307416_1003789172 184
50 3300049579 Ga0501043_0112186 Ga0501043_0112186_923_1480 184
51 3300005327 Ga0070658_10874779 Ga0070658_108747791 185
52 3300005435 Ga0070714_100012340 Ga0070714_1000123405 185
53 3300005439 Ga0070711_100004508 Ga0070711_1000045088 185
54 3300005536 Ga0070697_100245303 Ga0070697_1002453032 185
55 3300005543 Ga0070672_100112715 Ga0070672_1001127152 185
56 3300006028 Ga0070717_10090254 Ga0070717_100902542 185
57 3300006163 Ga0070715_10136675 Ga0070715_101366752 185
58 3300006175 Ga0070712_100010542 Ga0070712_1000105423 185
59 3300006175 Ga0070712_100301707 Ga0070712_1003017072 185
60 3300006881 Ga0068865_100142968 Ga0068865_1001429681 185
61 3300009148 Ga0105243_10381506 Ga0105243_103815061 185
62 3300022467 Ga0224712_10290042 Ga0224712_102900421 185
63 3300025915 Ga0207693_10076145 Ga0207693_100761452 185
64 3300025915 Ga0207693_10218521 Ga0207693_102185212 185
65 3300025916 Ga0207663_10001986 Ga0207663_100019865 185
66 3300025928 Ga0207700_11130458 Ga0207700_111304582 185
67 3300025929 Ga0207664_10019640 Ga0207664_100196402 185
68 3300025938 Ga0207704_10050650 Ga0207704_100506502 185
69 3300026067 Ga0207678_10244431 Ga0207678_102444313 185
70 3300031824 Ga0307413_10655923 Ga0307413_106559232 185
71 3300031852 Ga0307410_10056381 Ga0307410_100563812 185
72 3300031901 Ga0307406_10415677 Ga0307406_104156772 185
73 3300031995 Ga0307409_100325883 Ga0307409_1003258832 185
74 3300032004 Ga0307414_10232365 Ga0307414_102323652 185
75 3300032005 Ga0307411_10054523 Ga0307411_100545234 185
76 3300032126 Ga0307415_100043503 Ga0307415_1000435035 185
77 3300046462 Ga0495651_0274401 Ga0495651_0274401_161_718 185
78 3300046500 Ga0495596_0093492 Ga0495596_0093492_45_602 185
79 3300046516 Ga0495628_0360688 Ga0495628_0360688_122_679 185
80 3300048090 Ga0495615_0118441 Ga0495615_0118441_177_734 185
81 3300048903 Ga0496100_0485822 Ga0496100_0485822_66_623 185
82 3300048905 Ga0496102_0198298 Ga0496102_0198298_22_579 185
83 3300048914 Ga0496111_0216114 Ga0496111_0216114_323_880 185
84 3300048918 Ga0496115_0007806 Ga0496115_0007806_2610_3167 185
85 3300049586 Ga0501070_0118020 Ga0501070_0118020_1155_1712 185
86 3300053077 Ga0495601_0351596 Ga0495601_0351596_334_891 185
87 3300001979 JGI24740J21852_10134112 JGI24740J21852_101341121 186
88 3300005329 Ga0070683_100120146 Ga0070683_1001201461 186
89 3300005335 Ga0070666_10015279 Ga0070666_100152794 186
90 3300005367 Ga0070667_100114171 Ga0070667_1001141715 186
91 3300005455 Ga0070663_100007717 Ga0070663_1000077176 186
92 3300005455 Ga0070663_100421531 Ga0070663_1004215312 186
93 3300005530 Ga0070679_100004961 Ga0070679_1000049618 186
94 3300005548 Ga0070665_100078080 Ga0070665_1000780803 186
95 3300005718 Ga0068866_10404970 Ga0068866_104049701 186
96 3300005842 Ga0068858_100848970 Ga0068858_1008489702 186
97 3300009545 Ga0105237_10353526 Ga0105237_103535263 186
98 3300009551 Ga0105238_10771531 Ga0105238_107715312 186
99 3300009551 Ga0105238_11037785 Ga0105238_110377852 186
100 3300009553 Ga0105249_10476948 Ga0105249_104769482 186
101 3300013104 Ga0157370_10808889 Ga0157370_108088891 186
102 3300013105 Ga0157369_11380100 Ga0157369_113801001 186
103 3300014325 Ga0163163_10332991 Ga0163163_103329913 186
104 3300014969 Ga0157376_10705411 Ga0157376_107054112 186
105 3300025903 Ga0207680_10002629 Ga0207680_100026296 186
106 3300025914 Ga0207671_10238074 Ga0207671_102380742 186
107 3300025921 Ga0207652_10001804 Ga0207652_1000180419 186
108 3300025944 Ga0207661_10066971 Ga0207661_100669712 186
109 3300026067 Ga0207678_10000556 Ga0207678_1000055614 186
110 3300028379 Ga0268266_10000160 Ga0268266_1000016039 186
111 3300041494 Ga0451837_1085010 Ga0451837_1085010_115_675 186
112 3300044694 Ga0466963_0260417 Ga0466963_0260417_82_645 186
113 3300046533 Ga0495640_0018186 Ga0495640_0018186_2381_2944 186
114 3300046616 Ga0495668_0458522 Ga0495668_0458522_121_681 186
115 3300046689 Ga0495613_0000032 Ga0495613_0000032_22770_23333 186
116 3300047319 Ga0495674_0000010 Ga0495674_0000010_39408_39971 186
117 3300047444 Ga0495675_0020709 Ga0495675_0020709_959_1522 186
118 3300048905 Ga0496102_0001710 Ga0496102_0001710_4021_4584 186
119 3300048905 Ga0496102_0707894 Ga0496102_0707894_275_838 186
120 3300048906 Ga0496103_0029170 Ga0496103_0029170_1012_1575 186
121 3300048906 Ga0496103_0043810 Ga0496103_0043810_1227_1790 186
122 3300048908 Ga0496105_0012336 Ga0496105_0012336_5245_5808 186
123 3300048909 Ga0496106_0205136 Ga0496106_0205136_105_668 186
124 3300048912 Ga0496109_0106073 Ga0496109_0106073_337_900 186
125 3300048914 Ga0496111_0232861 Ga0496111_0232861_172_735 186
126 3300048917 Ga0496114_0221568 Ga0496114_0221568_934_1497 186
127 3300048917 Ga0496114_0667394 Ga0496114_0667394_238_801 186
128 3300048919 Ga0496116_0000367 Ga0496116_0000367_57567_58130 186
129 3300048920 Ga0496117_0009719 Ga0496117_0009719_7859_8422 186
130 3300048921 Ga0496118_0000790 Ga0496118_0000790_11039_11602 186
131 3300048921 Ga0496118_0037330 Ga0496118_0037330_1087_1650 186
132 3300048921 Ga0496118_0137242 Ga0496118_0137242_476_1039 186
133 3300048922 Ga0496119_0002341 Ga0496119_0002341_15931_16494 186
134 3300048922 Ga0496119_0004056 Ga0496119_0004056_11459_12022 186
135 3300048923 Ga0496120_0027702 Ga0496120_0027702_953_1516 186
136 3300048924 Ga0496121_0007546 Ga0496121_0007546_1077_1640 186
137 3300048924 Ga0496121_0016650 Ga0496121_0016650_2011_2574 186
138 3300048927 Ga0496124_0070429 Ga0496124_0070429_1053_1616 186
139 3300048929 Ga0496126_0027031 Ga0496126_0027031_1808_2371 186
140 3300048929 Ga0496126_0045339 Ga0496126_0045339_1030_1593 186
141 3300048929 Ga0496126_0067915 Ga0496126_0067915_1065_1628 186
142 3300049568 Ga0501031_0000147 Ga0501031_0000147_4857_5420 186
143 3300049569 Ga0501032_0000328 Ga0501032_0000328_34383_34946 186
144 3300049570 Ga0501033_0000261 Ga0501033_0000261_34568_35131 186
145 3300049573 Ga0501037_0000221 Ga0501037_0000221_14811_15374 186
146 3300049574 Ga0501038_0000101 Ga0501038_0000101_34261_34824 186
147 3300049578 Ga0501042_0620371 Ga0501042_0620371_139_702 186
148 3300049579 Ga0501043_0000237 Ga0501043_0000237_34288_34851 186
149 3300049580 Ga0501046_0000608 Ga0501046_0000608_237_800 186
150 3300049581 Ga0501047_0000376 Ga0501047_0000376_34511_35074 186
151 3300049582 Ga0501048_0002386 Ga0501048_0002386_13437_14000 186
152 3300049584 Ga0501068_0283290 Ga0501068_0283290_406_969 186
153 3300049585 Ga0501069_0002285 Ga0501069_0002285_151_714 186
154 3300049586 Ga0501070_0000178 Ga0501070_0000178_16832_17395 186
155 3300049586 Ga0501070_0185810 Ga0501070_0185810_923_1486 186
156 3300049588 Ga0501072_0051648 Ga0501072_0051648_2499_3062 186
157 3300049589 Ga0501073_0000255 Ga0501073_0000255_34272_34835 186
158 3300049590 Ga0501074_0009081 Ga0501074_0009081_399_962 186
159 3300049590 Ga0501074_0013390 Ga0501074_0013390_2230_2793 186
160 3300049741 Ga0501079_0003618 Ga0501079_0003618_384_947 186
161 3300049742 Ga0501080_0251833 Ga0501080_0251833_371_934 186
162 3300049744 Ga0501083_0006418 Ga0501083_0006418_7422_7985 186
163 3300049822 Ga0501035_0000616 Ga0501035_0000616_21822_22385 186
164 3300049823 Ga0501044_0000416 Ga0501044_0000416_15312_15875 186
165 3300049824 Ga0501045_0317049 Ga0501045_0317049_442_1005 186
166 3300053119 Ga0500595_024224 Ga0500595_024224_688_1251 186
167 3300054114 Ga0501084_0095406 Ga0501084_0095406_1763_2326 186
168 3300060353 Ga0501082_0042063 Ga0501082_0042063_3215_3778 186
169 3300005468 Ga0070707_100174645 Ga0070707_1001746451 187
170 3300005563 Ga0068855_100065923 Ga0068855_1000659232 187
171 3300005578 Ga0068854_100140120 Ga0068854_1001401202 187
172 3300013307 Ga0157372_11827491 Ga0157372_118274911 187
173 3300025913 Ga0207695_10377005 Ga0207695_103770052 187
174 3300025949 Ga0207667_10074151 Ga0207667_100741513 187
175 3300026121 Ga0207683_10423257 Ga0207683_104232572 187
176 3300049572 Ga0501036_0142807 Ga0501036_0142807_59_622 187
177 3300000041 ARcpr5oldR_c002843 ARcpr5oldR_0028432 188
178 3300000043 ARcpr5yngRDRAFT_c010898 ARcpr5yngRDRAFT_0108982 188
179 3300000044 ARSoilOldRDRAFT_c002105 ARSoilOldRDRAFT_0021052 188
180 3300000652 ARCol0yngRDRAFT_1001987 ARCol0yngRDRAFT_10019872 188
181 3300001978 JGI24747J21853_1001097 JGI24747J21853_10010972 188
182 3300001990 JGI24737J22298_10112048 JGI24737J22298_101120482 188
183 3300001990 JGI24737J22298_10142090 JGI24737J22298_101420901 188
184 3300001991 JGI24743J22301_10010021 JGI24743J22301_100100212 188
185 3300001991 JGI24743J22301_10049873 JGI24743J22301_100498731 188
186 3300001991 JGI24743J22301_10071941 JGI24743J22301_100719411 188
187 3300002075 JGI24738J21930_10004651 JGI24738J21930_100046511 188
188 3300002077 JGI24744J21845_10002173 JGI24744J21845_100021732 188
189 3300002077 JGI24744J21845_10060325 JGI24744J21845_100603252 188
190 3300002244 JGI24742J22300_10052144 JGI24742J22300_100521441 188
191 3300002244 JGI24742J22300_10068346 JGI24742J22300_100683461 188
192 3300002459 JGI24751J29686_10092430 JGI24751J29686_100924301 188
193 3300003203 JGI25406J46586_10018416 JGI25406J46586_100184162 188
194 3300005290 Ga0065712_10366413 Ga0065712_103664131 188
195 3300005327 Ga0070658_10007247 Ga0070658_100072478 188
196 3300005327 Ga0070658_10088423 Ga0070658_100884234 188
197 3300005327 Ga0070658_10483693 Ga0070658_104836931 188
198 3300005329 Ga0070683_100013927 Ga0070683_1000139278 188
199 3300005329 Ga0070683_100052558 Ga0070683_1000525582 188
200 3300005329 Ga0070683_100113560 Ga0070683_1001135604 188
201 3300005329 Ga0070683_100172441 Ga0070683_1001724413 188
202 3300005329 Ga0070683_100498870 Ga0070683_1004988702 188
203 3300005329 Ga0070683_100730174 Ga0070683_1007301742 188
204 3300005330 Ga0070690_100530572 Ga0070690_1005305722 188
205 3300005331 Ga0070670_100181271 Ga0070670_1001812712 188
206 3300005333 Ga0070677_10404200 Ga0070677_104042001 188
207 3300005334 Ga0068869_100301551 Ga0068869_1003015511 188
208 3300005334 Ga0068869_100672862 Ga0068869_1006728621 188
209 3300005336 Ga0070680_100018983 Ga0070680_1000189835 188
210 3300005336 Ga0070680_100027145 Ga0070680_1000271457 188
211 3300005336 Ga0070680_100305404 Ga0070680_1003054042 188
212 3300005337 Ga0070682_100001388 Ga0070682_1000013889 188
213 3300005337 Ga0070682_100018622 Ga0070682_1000186223 188
214 3300005337 Ga0070682_100018788 Ga0070682_1000187882 188
215 3300005338 Ga0068868_100038305 Ga0068868_1000383055 188
216 3300005338 Ga0068868_100199015 Ga0068868_1001990151 188
217 3300005338 Ga0068868_100623659 Ga0068868_1006236591 188
218 3300005338 Ga0068868_101287251 Ga0068868_1012872511 188
219 3300005339 Ga0070660_100005200 Ga0070660_1000052006 188
220 3300005339 Ga0070660_100035909 Ga0070660_1000359094 188
221 3300005339 Ga0070660_100191463 Ga0070660_1001914632 188
222 3300005339 Ga0070660_100236032 Ga0070660_1002360322 188
223 3300005340 Ga0070689_100006612 Ga0070689_1000066125 188
224 3300005340 Ga0070689_100303439 Ga0070689_1003034392 188
225 3300005341 Ga0070691_10139643 Ga0070691_101396432 188
226 3300005344 Ga0070661_100339348 Ga0070661_1003393481 188
227 3300005344 Ga0070661_100519919 Ga0070661_1005199191 188
228 3300005345 Ga0070692_10008587 Ga0070692_100085874 188
229 3300005345 Ga0070692_10014142 Ga0070692_100141424 188
230 3300005347 Ga0070668_100094275 Ga0070668_1000942752 188
231 3300005347 Ga0070668_100155004 Ga0070668_1001550042 188
232 3300005353 Ga0070669_100153755 Ga0070669_1001537552 188
233 3300005353 Ga0070669_100206514 Ga0070669_1002065142 188
234 3300005354 Ga0070675_100061740 Ga0070675_1000617402 188
235 3300005355 Ga0070671_100075911 Ga0070671_1000759112 188
236 3300005355 Ga0070671_100170802 Ga0070671_1001708022 188
237 3300005356 Ga0070674_100005543 Ga0070674_1000055436 188
238 3300005356 Ga0070674_100006683 Ga0070674_1000066832 188
239 3300005356 Ga0070674_100037431 Ga0070674_1000374314 188
240 3300005356 Ga0070674_100116719 Ga0070674_1001167192 188
241 3300005356 Ga0070674_100155300 Ga0070674_1001553002 188
242 3300005364 Ga0070673_100061235 Ga0070673_1000612352 188
243 3300005364 Ga0070673_100816146 Ga0070673_1008161462 188
244 3300005365 Ga0070688_100001187 Ga0070688_1000011876 188
245 3300005365 Ga0070688_100022194 Ga0070688_1000221942 188
246 3300005366 Ga0070659_100004839 Ga0070659_1000048395 188
247 3300005366 Ga0070659_100038832 Ga0070659_1000388323 188
248 3300005366 Ga0070659_100068782 Ga0070659_1000687823 188
249 3300005366 Ga0070659_100272083 Ga0070659_1002720832 188
250 3300005406 Ga0070703_10001288 Ga0070703_100012889 188
251 3300005406 Ga0070703_10012583 Ga0070703_100125833 188
252 3300005406 Ga0070703_10061411 Ga0070703_100614111 188
253 3300005434 Ga0070709_10220034 Ga0070709_102200342 188
254 3300005435 Ga0070714_100055707 Ga0070714_1000557074 188
255 3300005435 Ga0070714_100128103 Ga0070714_1001281032 188
256 3300005435 Ga0070714_100141709 Ga0070714_1001417092 188
257 3300005436 Ga0070713_100070871 Ga0070713_1000708713 188
258 3300005436 Ga0070713_100506399 Ga0070713_1005063992 188
259 3300005437 Ga0070710_10000963 Ga0070710_1000096312 188
260 3300005437 Ga0070710_10143921 Ga0070710_101439211 188
261 3300005438 Ga0070701_10001607 Ga0070701_100016071 188
262 3300005438 Ga0070701_10009820 Ga0070701_100098202 188
263 3300005439 Ga0070711_100019504 Ga0070711_1000195044 188
264 3300005440 Ga0070705_100003381 Ga0070705_1000033812 188
265 3300005440 Ga0070705_100011091 Ga0070705_1000110915 188
266 3300005440 Ga0070705_100051162 Ga0070705_1000511622 188
267 3300005440 Ga0070705_100290540 Ga0070705_1002905403 188
268 3300005440 Ga0070705_100446089 Ga0070705_1004460891 188
269 3300005441 Ga0070700_100001369 Ga0070700_1000013693 188
270 3300005441 Ga0070700_100044949 Ga0070700_1000449492 188
271 3300005441 Ga0070700_100847703 Ga0070700_1008477031 188
272 3300005444 Ga0070694_100017291 Ga0070694_1000172915 188
273 3300005444 Ga0070694_100156937 Ga0070694_1001569371 188
274 3300005444 Ga0070694_100202444 Ga0070694_1002024442 188
275 3300005445 Ga0070708_100010950 Ga0070708_1000109505 188
276 3300005445 Ga0070708_100025940 Ga0070708_1000259403 188
277 3300005445 Ga0070708_100271306 Ga0070708_1002713062 188
278 3300005445 Ga0070708_100291399 Ga0070708_1002913991 188
279 3300005445 Ga0070708_100340812 Ga0070708_1003408122 188
280 3300005455 Ga0070663_100084608 Ga0070663_1000846082 188
281 3300005455 Ga0070663_100173768 Ga0070663_1001737682 188
282 3300005456 Ga0070678_100000764 Ga0070678_1000007647 188
283 3300005456 Ga0070678_100012136 Ga0070678_1000121365 188
284 3300005456 Ga0070678_100037531 Ga0070678_1000375312 188
285 3300005456 Ga0070678_100038328 Ga0070678_1000383282 188
286 3300005456 Ga0070678_100225251 Ga0070678_1002252513 188
287 3300005456 Ga0070678_100989096 Ga0070678_1009890962 188
288 3300005457 Ga0070662_100045032 Ga0070662_1000450323 188
289 3300005457 Ga0070662_100406972 Ga0070662_1004069721 188
290 3300005458 Ga0070681_10151288 Ga0070681_101512882 188
291 3300005458 Ga0070681_10174996 Ga0070681_101749962 188
292 3300005459 Ga0068867_100001204 Ga0068867_10000120412 188
293 3300005459 Ga0068867_100067722 Ga0068867_1000677222 188
294 3300005459 Ga0068867_100092459 Ga0068867_1000924592 188
295 3300005459 Ga0068867_100208398 Ga0068867_1002083982 188
296 3300005459 Ga0068867_100705238 Ga0068867_1007052381 188
297 3300005466 Ga0070685_10001661 Ga0070685_100016616 188
298 3300005466 Ga0070685_10012424 Ga0070685_100124242 188
299 3300005466 Ga0070685_10090658 Ga0070685_100906582 188
300 3300005466 Ga0070685_10276430 Ga0070685_102764302 188
301 3300005467 Ga0070706_100002089 Ga0070706_10000208912 188
302 3300005467 Ga0070706_100024255 Ga0070706_1000242556 188
303 3300005467 Ga0070706_100281928 Ga0070706_1002819282 188
304 3300005467 Ga0070706_100301272 Ga0070706_1003012722 188
305 3300005467 Ga0070706_100340792 Ga0070706_1003407922 188
306 3300005467 Ga0070706_100507754 Ga0070706_1005077542 188
307 3300005467 Ga0070706_100690744 Ga0070706_1006907442 188
308 3300005468 Ga0070707_100000736 Ga0070707_1000007367 188
309 3300005468 Ga0070707_100004087 Ga0070707_1000040872 188
310 3300005468 Ga0070707_100018978 Ga0070707_1000189787 188
311 3300005468 Ga0070707_100350414 Ga0070707_1003504142 188
312 3300005471 Ga0070698_100016163 Ga0070698_1000161638 188
313 3300005471 Ga0070698_100080261 Ga0070698_1000802613 188
314 3300005471 Ga0070698_100084514 Ga0070698_1000845144 188
315 3300005471 Ga0070698_100252903 Ga0070698_1002529032 188
316 3300005518 Ga0070699_100028631 Ga0070699_1000286315 188
317 3300005518 Ga0070699_101057266 Ga0070699_1010572661 188
318 3300005530 Ga0070679_100006535 Ga0070679_1000065354 188
319 3300005530 Ga0070679_100011507 Ga0070679_1000115077 188
320 3300005530 Ga0070679_100572938 Ga0070679_1005729382 188
321 3300005535 Ga0070684_100000304 Ga0070684_10000030429 188
322 3300005535 Ga0070684_100027493 Ga0070684_1000274931 188
323 3300005535 Ga0070684_100029326 Ga0070684_1000293262 188
324 3300005535 Ga0070684_100225839 Ga0070684_1002258394 188
325 3300005535 Ga0070684_100254909 Ga0070684_1002549093 188
326 3300005535 Ga0070684_100319145 Ga0070684_1003191453 188
327 3300005535 Ga0070684_100512504 Ga0070684_1005125042 188
328 3300005535 Ga0070684_100789067 Ga0070684_1007890672 188
329 3300005536 Ga0070697_100189479 Ga0070697_1001894792 188
330 3300005536 Ga0070697_100325234 Ga0070697_1003252341 188
331 3300005539 Ga0068853_100022964 Ga0068853_1000229643 188
332 3300005539 Ga0068853_100184538 Ga0068853_1001845382 188
333 3300005543 Ga0070672_100013952 Ga0070672_1000139525 188
334 3300005543 Ga0070672_100098201 Ga0070672_1000982011 188
335 3300005543 Ga0070672_100110386 Ga0070672_1001103862 188
336 3300005544 Ga0070686_100003823 Ga0070686_1000038232 188
337 3300005544 Ga0070686_100082006 Ga0070686_1000820062 188
338 3300005544 Ga0070686_100086293 Ga0070686_1000862932 188
339 3300005545 Ga0070695_100150561 Ga0070695_1001505612 188
340 3300005545 Ga0070695_100274647 Ga0070695_1002746472 188
341 3300005546 Ga0070696_100001718 Ga0070696_10000171810 188
342 3300005546 Ga0070696_100211489 Ga0070696_1002114892 188
343 3300005547 Ga0070693_100016619 Ga0070693_1000166192 188
344 3300005547 Ga0070693_100118829 Ga0070693_1001188291 188
345 3300005547 Ga0070693_100440729 Ga0070693_1004407291 188
346 3300005548 Ga0070665_100100098 Ga0070665_1001000982 188
347 3300005548 Ga0070665_100472327 Ga0070665_1004723272 188
348 3300005549 Ga0070704_100003463 Ga0070704_1000034631 188
349 3300005549 Ga0070704_100011824 Ga0070704_1000118245 188
350 3300005549 Ga0070704_100045776 Ga0070704_1000457762 188
351 3300005549 Ga0070704_100223728 Ga0070704_1002237281 188
352 3300005549 Ga0070704_100495748 Ga0070704_1004957481 188
353 3300005563 Ga0068855_100057412 Ga0068855_1000574122 188
354 3300005563 Ga0068855_100130426 Ga0068855_1001304263 188
355 3300005563 Ga0068855_100217587 Ga0068855_1002175871 188
356 3300005563 Ga0068855_100256205 Ga0068855_1002562052 188
357 3300005564 Ga0070664_100011607 Ga0070664_1000116073 188
358 3300005577 Ga0068857_100074879 Ga0068857_1000748792 188
359 3300005577 Ga0068857_100094412 Ga0068857_1000944122 188
360 3300005577 Ga0068857_100264723 Ga0068857_1002647232 188
361 3300005577 Ga0068857_100481489 Ga0068857_1004814892 188
362 3300005578 Ga0068854_100393711 Ga0068854_1003937112 188
363 3300005578 Ga0068854_100438369 Ga0068854_1004383692 188
364 3300005578 Ga0068854_100559994 Ga0068854_1005599942 188
365 3300005614 Ga0068856_100013078 Ga0068856_1000130782 188
366 3300005614 Ga0068856_100071633 Ga0068856_1000716333 188
367 3300005614 Ga0068856_100082971 Ga0068856_1000829711 188
368 3300005614 Ga0068856_100199270 Ga0068856_1001992702 188
369 3300005614 Ga0068856_100654985 Ga0068856_1006549852 188
370 3300005615 Ga0070702_100005317 Ga0070702_1000053173 188
371 3300005616 Ga0068852_100022371 Ga0068852_1000223714 188
372 3300005616 Ga0068852_100522502 Ga0068852_1005225022 188
373 3300005617 Ga0068859_100067268 Ga0068859_1000672682 188
374 3300005617 Ga0068859_100140766 Ga0068859_1001407662 188
375 3300005617 Ga0068859_100253841 Ga0068859_1002538412 188
376 3300005618 Ga0068864_100070738 Ga0068864_1000707382 188
377 3300005718 Ga0068866_10000820 Ga0068866_100008206 188
378 3300005718 Ga0068866_10039728 Ga0068866_100397282 188
379 3300005718 Ga0068866_10075345 Ga0068866_100753451 188
380 3300005719 Ga0068861_100050692 Ga0068861_1000506922 188
381 3300005719 Ga0068861_100064978 Ga0068861_1000649781 188
382 3300005719 Ga0068861_100069310 Ga0068861_1000693102 188
383 3300005719 Ga0068861_100100151 Ga0068861_1001001512 188
384 3300005719 Ga0068861_100187376 Ga0068861_1001873762 188
385 3300005719 Ga0068861_101100016 Ga0068861_1011000161 188
386 3300005840 Ga0068870_10070411 Ga0068870_100704112 188
387 3300005840 Ga0068870_10074825 Ga0068870_100748252 188
388 3300005842 Ga0068858_100089600 Ga0068858_1000896001 188
389 3300005843 Ga0068860_100150925 Ga0068860_1001509252 188
390 3300005843 Ga0068860_100679718 Ga0068860_1006797182 188
391 3300005843 Ga0068860_100757662 Ga0068860_1007576622 188
392 3300005843 Ga0068860_100777954 Ga0068860_1007779542 188
393 3300005844 Ga0068862_100132097 Ga0068862_1001320972 188
394 3300005844 Ga0068862_100144446 Ga0068862_1001444462 188
395 3300005937 Ga0081455_10043829 Ga0081455_100438294 188
396 3300005937 Ga0081455_10044203 Ga0081455_100442034 188
397 3300005937 Ga0081455_10044545 Ga0081455_100445453 188
398 3300005937 Ga0081455_10069323 Ga0081455_100693232 188
399 3300005937 Ga0081455_10086905 Ga0081455_100869053 188
400 3300005937 Ga0081455_10106177 Ga0081455_101061772 188
401 3300005937 Ga0081455_10150527 Ga0081455_101505272 188
402 3300005981 Ga0081538_10133836 Ga0081538_101338362 188
403 3300005981 Ga0081538_10203693 Ga0081538_102036931 188
404 3300005985 Ga0081539_10000712 Ga0081539_1000071278 188
405 3300005985 Ga0081539_10026785 Ga0081539_100267853 188
406 3300006028 Ga0070717_10118249 Ga0070717_101182494 188
407 3300006028 Ga0070717_10373483 Ga0070717_103734832 188
408 3300006038 Ga0075365_10009701 Ga0075365_100097012 188
409 3300006038 Ga0075365_10253130 Ga0075365_102531302 188
410 3300006038 Ga0075365_10615991 Ga0075365_106159912 188
411 3300006048 Ga0075363_100069190 Ga0075363_1000691902 188
412 3300006051 Ga0075364_10007819 Ga0075364_100078194 188
413 3300006051 Ga0075364_10041700 Ga0075364_100417002 188
414 3300006051 Ga0075364_10482960 Ga0075364_104829602 188
415 3300006058 Ga0075432_10000335 Ga0075432_100003358 188
416 3300006058 Ga0075432_10028903 Ga0075432_100289032 188
417 3300006163 Ga0070715_10056200 Ga0070715_100562002 188
418 3300006173 Ga0070716_100048519 Ga0070716_1000485192 188
419 3300006175 Ga0070712_100009792 Ga0070712_1000097923 188
420 3300006175 Ga0070712_100200774 Ga0070712_1002007742 188
421 3300006175 Ga0070712_100623279 Ga0070712_1006232792 188
422 3300006177 Ga0075362_10295148 Ga0075362_102951482 188
423 3300006237 Ga0097621_100025644 Ga0097621_1000256445 188
424 3300006237 Ga0097621_100134872 Ga0097621_1001348721 188
425 3300006237 Ga0097621_100150363 Ga0097621_1001503632 188
426 3300006237 Ga0097621_100498256 Ga0097621_1004982562 188
427 3300006358 Ga0068871_100672786 Ga0068871_1006727862 188
428 3300006844 Ga0075428_100003530 Ga0075428_10000353015 188
429 3300006844 Ga0075428_100016751 Ga0075428_1000167517 188
430 3300006844 Ga0075428_100033638 Ga0075428_1000336382 188
431 3300006844 Ga0075428_100407013 Ga0075428_1004070132 188
432 3300006844 Ga0075428_100483087 Ga0075428_1004830872 188
433 3300006844 Ga0075428_100622855 Ga0075428_1006228552 188
434 3300006846 Ga0075430_100006655 Ga0075430_10000665510 188
435 3300006846 Ga0075430_100085183 Ga0075430_1000851832 188
436 3300006847 Ga0075431_100009644 Ga0075431_1000096444 188
437 3300006847 Ga0075431_100090857 Ga0075431_1000908573 188
438 3300006852 Ga0075433_10007908 Ga0075433_100079089 188
439 3300006852 Ga0075433_10008920 Ga0075433_100089206 188
440 3300006852 Ga0075433_10038706 Ga0075433_100387062 188
441 3300006852 Ga0075433_10344284 Ga0075433_103442842 188
442 3300006852 Ga0075433_10368955 Ga0075433_103689553 188
443 3300006852 Ga0075433_10515745 Ga0075433_105157452 188
444 3300006852 Ga0075433_10571667 Ga0075433_105716672 188
445 3300006852 Ga0075433_10944568 Ga0075433_109445682 188
446 3300006871 Ga0075434_100001094 Ga0075434_10000109411 188
447 3300006871 Ga0075434_100035968 Ga0075434_1000359683 188
448 3300006871 Ga0075434_100099390 Ga0075434_1000993902 188
449 3300006871 Ga0075434_100160126 Ga0075434_1001601264 188
450 3300006871 Ga0075434_100975439 Ga0075434_1009754392 188
451 3300006880 Ga0075429_100042453 Ga0075429_1000424532 188
452 3300006880 Ga0075429_100066126 Ga0075429_1000661264 188
453 3300006880 Ga0075429_100321273 Ga0075429_1003212732 188
454 3300006881 Ga0068865_100005165 Ga0068865_1000051658 188
455 3300006881 Ga0068865_100023252 Ga0068865_1000232522 188
456 3300006881 Ga0068865_100025430 Ga0068865_1000254302 188
457 3300006881 Ga0068865_100046262 Ga0068865_1000462622 188
458 3300006881 Ga0068865_100051532 Ga0068865_1000515322 188
459 3300006914 Ga0075436_100002736 Ga0075436_1000027365 188
460 3300006914 Ga0075436_100009113 Ga0075436_1000091137 188
461 3300006914 Ga0075436_100058774 Ga0075436_1000587743 188
462 3300006914 Ga0075436_100124471 Ga0075436_1001244712 188
463 3300006931 Ga0097620_100067265 Ga0097620_1000672652 188
464 3300006931 Ga0097620_100140773 Ga0097620_1001407732 188
465 3300006931 Ga0097620_100253861 Ga0097620_1002538612 188
466 3300007076 Ga0075435_100000579 Ga0075435_10000057920 188
467 3300007076 Ga0075435_100016736 Ga0075435_1000167367 188
468 3300007076 Ga0075435_100162117 Ga0075435_1001621172 188
469 3300007076 Ga0075435_100180555 Ga0075435_1001805552 188
470 3300009011 Ga0105251_10321572 Ga0105251_103215721 188
471 3300009094 Ga0111539_10001928 Ga0111539_1000192813 188
472 3300009094 Ga0111539_10016007 Ga0111539_100160074 188
473 3300009094 Ga0111539_10028632 Ga0111539_100286323 188
474 3300009094 Ga0111539_10351946 Ga0111539_103519462 188
475 3300009094 Ga0111539_10578466 Ga0111539_105784662 188
476 3300009094 Ga0111539_11239979 Ga0111539_112399792 188
477 3300009094 Ga0111539_11497241 Ga0111539_114972412 188
478 3300009098 Ga0105245_10006448 Ga0105245_100064488 188
479 3300009098 Ga0105245_10008496 Ga0105245_100084967 188
480 3300009098 Ga0105245_10128400 Ga0105245_101284003 188
481 3300009098 Ga0105245_10135543 Ga0105245_101355432 188
482 3300009098 Ga0105245_10175298 Ga0105245_101752982 188
483 3300009098 Ga0105245_10189202 Ga0105245_101892022 188
484 3300009098 Ga0105245_10222388 Ga0105245_102223882 188
485 3300009098 Ga0105245_10249763 Ga0105245_102497632 188
486 3300009098 Ga0105245_10309367 Ga0105245_103093672 188
487 3300009098 Ga0105245_10313990 Ga0105245_103139902 188
488 3300009098 Ga0105245_10518924 Ga0105245_105189241 188
489 3300009101 Ga0105247_10016607 Ga0105247_100166072 188
490 3300009101 Ga0105247_10115373 Ga0105247_101153732 188
491 3300009147 Ga0114129_10001661 Ga0114129_1000166114 188
492 3300009147 Ga0114129_10002630 Ga0114129_1000263025 188
493 3300009147 Ga0114129_10009955 Ga0114129_100099559 188
494 3300009147 Ga0114129_10099788 Ga0114129_100997883 188
495 3300009147 Ga0114129_10109307 Ga0114129_101093074 188
496 3300009147 Ga0114129_10195438 Ga0114129_101954383 188
497 3300009147 Ga0114129_10208382 Ga0114129_102083822 188
498 3300009147 Ga0114129_10284165 Ga0114129_102841652 188
499 3300009147 Ga0114129_10320301 Ga0114129_103203012 188
500 3300009147 Ga0114129_10404823 Ga0114129_104048232 188
501 3300009147 Ga0114129_11424366 Ga0114129_114243662 188
502 3300009148 Ga0105243_10007792 Ga0105243_100077929 188
503 3300009148 Ga0105243_10015740 Ga0105243_100157403 188
504 3300009148 Ga0105243_10017414 Ga0105243_100174144 188
505 3300009148 Ga0105243_10034285 Ga0105243_100342852 188
506 3300009148 Ga0105243_10065076 Ga0105243_100650762 188
507 3300009148 Ga0105243_10144632 Ga0105243_101446322 188
508 3300009148 Ga0105243_10198408 Ga0105243_101984083 188
509 3300009148 Ga0105243_10335077 Ga0105243_103350772 188
510 3300009174 Ga0105241_10036463 Ga0105241_100364634 188
511 3300009174 Ga0105241_10124596 Ga0105241_101245962 188
512 3300009174 Ga0105241_10133209 Ga0105241_101332092 188
513 3300009174 Ga0105241_10151868 Ga0105241_101518682 188
514 3300009174 Ga0105241_10795374 Ga0105241_107953741 188
515 3300009176 Ga0105242_10008234 Ga0105242_100082342 188
516 3300009176 Ga0105242_10021877 Ga0105242_100218773 188
517 3300009176 Ga0105242_10071347 Ga0105242_100713472 188
518 3300009176 Ga0105242_10283874 Ga0105242_102838742 188
519 3300009176 Ga0105242_10364265 Ga0105242_103642652 188
520 3300009177 Ga0105248_10019788 Ga0105248_100197883 188
521 3300009177 Ga0105248_10040930 Ga0105248_100409304 188
522 3300009177 Ga0105248_10067879 Ga0105248_100678792 188
523 3300009177 Ga0105248_11046151 Ga0105248_110461512 188
524 3300009177 Ga0105248_11262073 Ga0105248_112620732 188
525 3300009545 Ga0105237_10324588 Ga0105237_103245882 188
526 3300009545 Ga0105237_10456525 Ga0105237_104565252 188
527 3300009551 Ga0105238_10135742 Ga0105238_101357421 188
528 3300009551 Ga0105238_10547657 Ga0105238_105476572 188
529 3300009553 Ga0105249_10001935 Ga0105249_1000193513 188
530 3300009553 Ga0105249_10220967 Ga0105249_102209671 188
531 3300009553 Ga0105249_10357318 Ga0105249_103573182 188
532 3300009553 Ga0105249_10824266 Ga0105249_108242662 188
533 3300009553 Ga0105249_10929501 Ga0105249_109295012 188
534 3300010375 Ga0105239_10013943 Ga0105239_100139432 188
535 3300010375 Ga0105239_10031554 Ga0105239_100315542 188
536 3300010375 Ga0105239_10044080 Ga0105239_100440803 188
537 3300010375 Ga0105239_10101281 Ga0105239_101012812 188
538 3300010375 Ga0105239_10145437 Ga0105239_101454374 188
539 3300010375 Ga0105239_11212376 Ga0105239_112123762 188
540 3300010375 Ga0105239_11512596 Ga0105239_115125962 188
541 3300011119 Ga0105246_10139055 Ga0105246_101390552 188
542 3300011119 Ga0105246_10185520 Ga0105246_101855202 188
543 3300011119 Ga0105246_10187716 Ga0105246_101877162 188
544 3300011119 Ga0105246_10226658 Ga0105246_102266582 188
545 3300011119 Ga0105246_10544650 Ga0105246_105446501 188
546 3300011119 Ga0105246_10577410 Ga0105246_105774102 188
547 3300012507 Ga0157342_1016850 Ga0157342_10168501 188
548 3300012512 Ga0157327_1050286 Ga0157327_10502861 188
549 3300013102 Ga0157371_10462042 Ga0157371_104620422 188
550 3300013104 Ga0157370_10552504 Ga0157370_105525042 188
551 3300013105 Ga0157369_10119579 Ga0157369_101195795 188
552 3300013105 Ga0157369_10229524 Ga0157369_102295242 188
553 3300013105 Ga0157369_10235225 Ga0157369_102352252 188
554 3300013105 Ga0157369_10735868 Ga0157369_107358682 188
555 3300013296 Ga0157374_10251867 Ga0157374_102518672 188
556 3300013296 Ga0157374_10460677 Ga0157374_104606772 188
557 3300013296 Ga0157374_10549092 Ga0157374_105490922 188
558 3300013296 Ga0157374_10628817 Ga0157374_106288172 188
559 3300013297 Ga0157378_10144794 Ga0157378_101447942 188
560 3300013297 Ga0157378_10183343 Ga0157378_101833431 188
561 3300013306 Ga0163162_10717124 Ga0163162_107171242 188
562 3300013307 Ga0157372_10063554 Ga0157372_100635542 188
563 3300013307 Ga0157372_10119969 Ga0157372_101199692 188
564 3300013307 Ga0157372_10208564 Ga0157372_102085643 188
565 3300013307 Ga0157372_10536387 Ga0157372_105363872 188
566 3300013307 Ga0157372_10881029 Ga0157372_108810291 188
567 3300013307 Ga0157372_11126876 Ga0157372_111268761 188
568 3300013307 Ga0157372_11402840 Ga0157372_114028402 188
569 3300013308 Ga0157375_10056357 Ga0157375_100563574 188
570 3300013308 Ga0157375_10068805 Ga0157375_100688052 188
571 3300013308 Ga0157375_10102319 Ga0157375_101023192 188
572 3300013308 Ga0157375_10131654 Ga0157375_101316542 188
573 3300013308 Ga0157375_10231502 Ga0157375_102315021 188
574 3300013308 Ga0157375_10571100 Ga0157375_105711002 188
575 3300014325 Ga0163163_10591562 Ga0163163_105915622 188
576 3300014325 Ga0163163_10733243 Ga0163163_107332431 188
577 3300014325 Ga0163163_10883853 Ga0163163_108838532 188
578 3300014326 Ga0157380_10026636 Ga0157380_100266365 188
579 3300014326 Ga0157380_10040555 Ga0157380_100405552 188
580 3300014326 Ga0157380_10072712 Ga0157380_100727122 188
581 3300014326 Ga0157380_10380401 Ga0157380_103804012 188
582 3300014745 Ga0157377_10048517 Ga0157377_100485172 188
583 3300014745 Ga0157377_10088266 Ga0157377_100882662 188
584 3300014745 Ga0157377_10097145 Ga0157377_100971453 188
585 3300014745 Ga0157377_10113138 Ga0157377_101131382 188
586 3300014745 Ga0157377_10389315 Ga0157377_103893151 188
587 3300014968 Ga0157379_10023210 Ga0157379_100232107 188
588 3300014968 Ga0157379_10032572 Ga0157379_100325721 188
589 3300014968 Ga0157379_10375348 Ga0157379_103753481 188
590 3300014969 Ga0157376_10016118 Ga0157376_100161182 188
591 3300014969 Ga0157376_10209702 Ga0157376_102097022 188
592 3300014969 Ga0157376_10297148 Ga0157376_102971482 188
593 3300017792 Ga0163161_10059251 Ga0163161_100592512 188
594 3300020082 Ga0206353_11257401 Ga0206353_112574019 188
595 3300020082 Ga0206353_11358304 Ga0206353_113583042 188
596 3300025885 Ga0207653_10000444 Ga0207653_100004449 188
597 3300025885 Ga0207653_10046334 Ga0207653_100463342 188
598 3300025885 Ga0207653_10059711 Ga0207653_100597112 188
599 3300025893 Ga0207682_10140630 Ga0207682_101406301 188
600 3300025893 Ga0207682_10159586 Ga0207682_101595862 188
601 3300025899 Ga0207642_10000928 Ga0207642_100009282 188
602 3300025899 Ga0207642_10017825 Ga0207642_100178254 188
603 3300025899 Ga0207642_10108569 Ga0207642_101085692 188
604 3300025899 Ga0207642_10170611 Ga0207642_101706111 188
605 3300025900 Ga0207710_10216525 Ga0207710_102165251 188
606 3300025901 Ga0207688_10003668 Ga0207688_100036682 188
607 3300025901 Ga0207688_10014126 Ga0207688_100141263 188
608 3300025901 Ga0207688_10042430 Ga0207688_100424302 188
609 3300025901 Ga0207688_10058918 Ga0207688_100589182 188
610 3300025901 Ga0207688_10066758 Ga0207688_100667582 188
611 3300025903 Ga0207680_10083771 Ga0207680_100837712 188
612 3300025903 Ga0207680_10459348 Ga0207680_104593481 188
613 3300025904 Ga0207647_10465729 Ga0207647_104657291 188
614 3300025905 Ga0207685_10011937 Ga0207685_100119374 188
615 3300025906 Ga0207699_10024973 Ga0207699_100249734 188
616 3300025906 Ga0207699_10056000 Ga0207699_100560002 188
617 3300025906 Ga0207699_10078484 Ga0207699_100784842 188
618 3300025906 Ga0207699_10361924 Ga0207699_103619242 188
619 3300025907 Ga0207645_10168947 Ga0207645_101689471 188
620 3300025907 Ga0207645_10392531 Ga0207645_103925312 188
621 3300025908 Ga0207643_10031279 Ga0207643_100312793 188
622 3300025908 Ga0207643_10121253 Ga0207643_101212532 188
623 3300025908 Ga0207643_10571297 Ga0207643_105712971 188
624 3300025909 Ga0207705_10055413 Ga0207705_100554132 188
625 3300025909 Ga0207705_10087735 Ga0207705_100877352 188
626 3300025909 Ga0207705_10266302 Ga0207705_102663022 188
627 3300025910 Ga0207684_10004837 Ga0207684_100048377 188
628 3300025910 Ga0207684_10123330 Ga0207684_101233302 188
629 3300025910 Ga0207684_10232756 Ga0207684_102327561 188
630 3300025910 Ga0207684_10272156 Ga0207684_102721562 188
631 3300025910 Ga0207684_10336681 Ga0207684_103366812 188
632 3300025910 Ga0207684_10966768 Ga0207684_109667681 188
633 3300025911 Ga0207654_10064730 Ga0207654_100647302 188
634 3300025911 Ga0207654_10089573 Ga0207654_100895732 188
635 3300025911 Ga0207654_10166458 Ga0207654_101664582 188
636 3300025911 Ga0207654_10169873 Ga0207654_101698731 188
637 3300025912 Ga0207707_10072834 Ga0207707_100728342 188
638 3300025912 Ga0207707_10134242 Ga0207707_101342421 188
639 3300025912 Ga0207707_10224435 Ga0207707_102244351 188
640 3300025912 Ga0207707_10227625 Ga0207707_102276252 188
641 3300025914 Ga0207671_10261783 Ga0207671_102617832 188
642 3300025915 Ga0207693_10000319 Ga0207693_1000031917 188
643 3300025915 Ga0207693_10000873 Ga0207693_1000087310 188
644 3300025915 Ga0207693_10004832 Ga0207693_100048324 188
645 3300025915 Ga0207693_10009671 Ga0207693_100096715 188
646 3300025915 Ga0207693_10129352 Ga0207693_101293523 188
647 3300025915 Ga0207693_10430225 Ga0207693_104302252 188
648 3300025916 Ga0207663_10020051 Ga0207663_100200514 188
649 3300025916 Ga0207663_10045499 Ga0207663_100454992 188
650 3300025916 Ga0207663_10050517 Ga0207663_100505172 188
651 3300025917 Ga0207660_10071347 Ga0207660_100713474 188
652 3300025917 Ga0207660_10085331 Ga0207660_100853313 188
653 3300025917 Ga0207660_10114248 Ga0207660_101142482 188
654 3300025917 Ga0207660_10265854 Ga0207660_102658543 188
655 3300025917 Ga0207660_10326260 Ga0207660_103262602 188
656 3300025918 Ga0207662_10071187 Ga0207662_100711873 188
657 3300025918 Ga0207662_10143930 Ga0207662_101439302 188
658 3300025918 Ga0207662_10151143 Ga0207662_101511432 188
659 3300025919 Ga0207657_10009090 Ga0207657_100090904 188
660 3300025919 Ga0207657_10011352 Ga0207657_1001135210 188
661 3300025919 Ga0207657_10031190 Ga0207657_100311904 188
662 3300025919 Ga0207657_10089309 Ga0207657_100893093 188
663 3300025919 Ga0207657_10160334 Ga0207657_101603342 188
664 3300025919 Ga0207657_10720477 Ga0207657_107204771 188
665 3300025920 Ga0207649_10107493 Ga0207649_101074932 188
666 3300025920 Ga0207649_10277022 Ga0207649_102770222 188
667 3300025921 Ga0207652_10021369 Ga0207652_100213696 188
668 3300025921 Ga0207652_10229557 Ga0207652_102295572 188
669 3300025922 Ga0207646_10002219 Ga0207646_1000221913 188
670 3300025922 Ga0207646_10004521 Ga0207646_100045217 188
671 3300025922 Ga0207646_10089943 Ga0207646_100899432 188
672 3300025922 Ga0207646_10164774 Ga0207646_101647743 188
673 3300025922 Ga0207646_11000142 Ga0207646_110001421 188
674 3300025923 Ga0207681_10111346 Ga0207681_101113462 188
675 3300025924 Ga0207694_10086977 Ga0207694_100869774 188
676 3300025924 Ga0207694_10301737 Ga0207694_103017371 188
677 3300025924 Ga0207694_10617829 Ga0207694_106178291 188
678 3300025924 Ga0207694_10632920 Ga0207694_106329201 188
679 3300025925 Ga0207650_10200451 Ga0207650_102004511 188
680 3300025925 Ga0207650_10326002 Ga0207650_103260022 188
681 3300025926 Ga0207659_10222122 Ga0207659_102221222 188
682 3300025926 Ga0207659_10265005 Ga0207659_102650051 188
683 3300025926 Ga0207659_10522888 Ga0207659_105228881 188
684 3300025926 Ga0207659_10603190 Ga0207659_106031901 188
685 3300025926 Ga0207659_10689202 Ga0207659_106892022 188
686 3300025927 Ga0207687_10013673 Ga0207687_100136732 188
687 3300025927 Ga0207687_10014181 Ga0207687_100141812 188
688 3300025927 Ga0207687_10014768 Ga0207687_100147683 188
689 3300025927 Ga0207687_10041910 Ga0207687_100419102 188
690 3300025927 Ga0207687_10122994 Ga0207687_101229942 188
691 3300025927 Ga0207687_10228738 Ga0207687_102287382 188
692 3300025927 Ga0207687_10356001 Ga0207687_103560012 188
693 3300025927 Ga0207687_10357668 Ga0207687_103576681 188
694 3300025927 Ga0207687_10599966 Ga0207687_105999662 188
695 3300025927 Ga0207687_11040189 Ga0207687_110401891 188
696 3300025927 Ga0207687_11381314 Ga0207687_113813141 188
697 3300025928 Ga0207700_10000006 Ga0207700_1000000619 188
698 3300025928 Ga0207700_10179135 Ga0207700_101791352 188
699 3300025928 Ga0207700_10240254 Ga0207700_102402541 188
700 3300025929 Ga0207664_10038527 Ga0207664_100385275 188
701 3300025929 Ga0207664_10071711 Ga0207664_100717112 188
702 3300025929 Ga0207664_10452860 Ga0207664_104528601 188
703 3300025931 Ga0207644_10083981 Ga0207644_100839812 188
704 3300025931 Ga0207644_10276872 Ga0207644_102768722 188
705 3300025932 Ga0207690_10080353 Ga0207690_100803531 188
706 3300025932 Ga0207690_10163491 Ga0207690_101634912 188
707 3300025932 Ga0207690_10417779 Ga0207690_104177792 188
708 3300025932 Ga0207690_10984473 Ga0207690_109844731 188
709 3300025933 Ga0207706_10054740 Ga0207706_100547402 188
710 3300025933 Ga0207706_10092820 Ga0207706_100928204 188
711 3300025933 Ga0207706_10197043 Ga0207706_101970432 188
712 3300025933 Ga0207706_10291953 Ga0207706_102919531 188
713 3300025934 Ga0207686_10006420 Ga0207686_100064206 188
714 3300025934 Ga0207686_10049845 Ga0207686_100498454 188
715 3300025934 Ga0207686_10263327 Ga0207686_102633272 188
716 3300025934 Ga0207686_10359712 Ga0207686_103597121 188
717 3300025934 Ga0207686_10548927 Ga0207686_105489271 188
718 3300025934 Ga0207686_10849897 Ga0207686_108498972 188
719 3300025935 Ga0207709_10002442 Ga0207709_100024422 188
720 3300025935 Ga0207709_10068243 Ga0207709_100682433 188
721 3300025935 Ga0207709_10127069 Ga0207709_101270692 188
722 3300025935 Ga0207709_10160199 Ga0207709_101601992 188
723 3300025935 Ga0207709_10530852 Ga0207709_105308522 188
724 3300025936 Ga0207670_10001639 Ga0207670_100016396 188
725 3300025936 Ga0207670_10041638 Ga0207670_100416384 188
726 3300025936 Ga0207670_10706752 Ga0207670_107067521 188
727 3300025937 Ga0207669_10000741 Ga0207669_100007416 188
728 3300025937 Ga0207669_10027786 Ga0207669_100277863 188
729 3300025937 Ga0207669_10296503 Ga0207669_102965032 188
730 3300025938 Ga0207704_10002587 Ga0207704_100025876 188
731 3300025938 Ga0207704_10517006 Ga0207704_105170062 188
732 3300025938 Ga0207704_10553056 Ga0207704_105530561 188
733 3300025939 Ga0207665_10005142 Ga0207665_100051429 188
734 3300025939 Ga0207665_10015530 Ga0207665_100155305 188
735 3300025940 Ga0207691_10011328 Ga0207691_100113288 188
736 3300025940 Ga0207691_10033253 Ga0207691_100332532 188
737 3300025940 Ga0207691_10054784 Ga0207691_100547844 188
738 3300025940 Ga0207691_10062587 Ga0207691_100625872 188
739 3300025941 Ga0207711_10074831 Ga0207711_100748312 188
740 3300025941 Ga0207711_10134936 Ga0207711_101349362 188
741 3300025942 Ga0207689_10045354 Ga0207689_100453544 188
742 3300025944 Ga0207661_10011131 Ga0207661_100111317 188
743 3300025944 Ga0207661_10017405 Ga0207661_100174055 188
744 3300025944 Ga0207661_10059653 Ga0207661_100596534 188
745 3300025944 Ga0207661_10411731 Ga0207661_104117311 188
746 3300025944 Ga0207661_10866439 Ga0207661_108664391 188
747 3300025945 Ga0207679_10012817 Ga0207679_100128176 188
748 3300025945 Ga0207679_10050441 Ga0207679_100504414 188
749 3300025949 Ga0207667_10109046 Ga0207667_101090464 188
750 3300025949 Ga0207667_10165399 Ga0207667_101653992 188
751 3300025960 Ga0207651_10080764 Ga0207651_100807641 188
752 3300025960 Ga0207651_10151180 Ga0207651_101511802 188
753 3300025960 Ga0207651_10430784 Ga0207651_104307842 188
754 3300025961 Ga0207712_10031826 Ga0207712_100318264 188
755 3300025972 Ga0207668_10012328 Ga0207668_100123284 188
756 3300025972 Ga0207668_10731806 Ga0207668_107318062 188
757 3300025981 Ga0207640_10068660 Ga0207640_100686604 188
758 3300025981 Ga0207640_10141661 Ga0207640_101416611 188
759 3300025981 Ga0207640_10212092 Ga0207640_102120922 188
760 3300025981 Ga0207640_10248507 Ga0207640_102485072 188
761 3300026023 Ga0207677_10485673 Ga0207677_104856732 188
762 3300026035 Ga0207703_10260880 Ga0207703_102608802 188
763 3300026041 Ga0207639_10023531 Ga0207639_100235314 188
764 3300026041 Ga0207639_10080751 Ga0207639_100807512 188
765 3300026041 Ga0207639_10321879 Ga0207639_103218792 188
766 3300026041 Ga0207639_11513438 Ga0207639_115134381 188
767 3300026067 Ga0207678_10073869 Ga0207678_100738692 188
768 3300026067 Ga0207678_10182507 Ga0207678_101825072 188
769 3300026067 Ga0207678_10584880 Ga0207678_105848802 188
770 3300026067 Ga0207678_10746871 Ga0207678_107468712 188
771 3300026075 Ga0207708_10000361 Ga0207708_1000036119 188
772 3300026075 Ga0207708_10067661 Ga0207708_100676612 188
773 3300026075 Ga0207708_10095806 Ga0207708_100958062 188
774 3300026075 Ga0207708_10118851 Ga0207708_101188512 188
775 3300026075 Ga0207708_10326703 Ga0207708_103267032 188
776 3300026078 Ga0207702_10012490 Ga0207702_100124903 188
777 3300026078 Ga0207702_10026829 Ga0207702_100268295 188
778 3300026078 Ga0207702_10068739 Ga0207702_100687394 188
779 3300026078 Ga0207702_10217059 Ga0207702_102170593 188
780 3300026078 Ga0207702_10893998 Ga0207702_108939982 188
781 3300026088 Ga0207641_11154320 Ga0207641_111543202 188
782 3300026088 Ga0207641_11185448 Ga0207641_111854482 188
783 3300026089 Ga0207648_10000504 Ga0207648_1000050433 188
784 3300026089 Ga0207648_10074382 Ga0207648_100743822 188
785 3300026089 Ga0207648_10124642 Ga0207648_101246422 188
786 3300026089 Ga0207648_11288370 Ga0207648_112883701 188
787 3300026116 Ga0207674_10028439 Ga0207674_100284395 188
788 3300026116 Ga0207674_10307267 Ga0207674_103072672 188
789 3300026116 Ga0207674_11002177 Ga0207674_110021772 188
790 3300026118 Ga0207675_100004186 Ga0207675_10000418612 188
791 3300026118 Ga0207675_100030270 Ga0207675_1000302702 188
792 3300026118 Ga0207675_100178965 Ga0207675_1001789652 188
793 3300026118 Ga0207675_100183784 Ga0207675_1001837842 188
794 3300026121 Ga0207683_10002033 Ga0207683_100020337 188
795 3300026121 Ga0207683_10012118 Ga0207683_1001211813 188
796 3300026121 Ga0207683_10022334 Ga0207683_100223346 188
797 3300026121 Ga0207683_10187410 Ga0207683_101874101 188
798 3300026121 Ga0207683_10514411 Ga0207683_105144112 188
799 3300026142 Ga0207698_10112514 Ga0207698_101125142 188
800 3300026142 Ga0207698_10478819 Ga0207698_104788191 188
801 3300027695 Ga0209966_1004720 Ga0209966_10047202 188
802 3300027695 Ga0209966_1013057 Ga0209966_10130572 188
803 3300027907 Ga0207428_10004165 Ga0207428_100041659 188
804 3300027907 Ga0207428_10011417 Ga0207428_100114177 188
805 3300027907 Ga0207428_10143327 Ga0207428_101433272 188
806 3300027907 Ga0207428_10172623 Ga0207428_101726231 188
807 3300027907 Ga0207428_10193203 Ga0207428_101932032 188
808 3300027907 Ga0207428_10252897 Ga0207428_102528972 188
809 3300028379 Ga0268266_10054431 Ga0268266_100544312 188
810 3300028379 Ga0268266_10117873 Ga0268266_101178732 188
811 3300028379 Ga0268266_10164021 Ga0268266_101640213 188
812 3300028379 Ga0268266_10413810 Ga0268266_104138102 188
813 3300028380 Ga0268265_10071356 Ga0268265_100713561 188
814 3300028380 Ga0268265_10459037 Ga0268265_104590372 188
815 3300028380 Ga0268265_11265464 Ga0268265_112654641 188
816 3300028381 Ga0268264_10094962 Ga0268264_100949622 188
817 3300028381 Ga0268264_10132388 Ga0268264_101323882 188
818 3300028381 Ga0268264_10428503 Ga0268264_104285032 188
819 3300028800 Ga0265338_10020881 Ga0265338_100208814 188
820 3300031548 Ga0307408_100010668 Ga0307408_1000106685 188
821 3300031731 Ga0307405_10490565 Ga0307405_104905652 188
822 3300031824 Ga0307413_10274393 Ga0307413_102743932 188
823 3300031852 Ga0307410_10096286 Ga0307410_100962863 188
824 3300031901 Ga0307406_10100497 Ga0307406_101004972 188
825 3300031903 Ga0307407_10094640 Ga0307407_100946402 188
826 3300031911 Ga0307412_10038702 Ga0307412_100387025 188
827 3300031995 Ga0307409_100801328 Ga0307409_1008013282 188
828 3300032002 Ga0307416_100611858 Ga0307416_1006118582 188
829 3300032005 Ga0307411_10574505 Ga0307411_105745052 188
830 3300032126 Ga0307415_101019636 Ga0307415_1010196361 188
831 3300034817 Ga0373948_0000745 Ga0373948_0000745_1246_1812 188
832 3300034817 Ga0373948_0041000 Ga0373948_0041000_309_875 188
833 3300034818 Ga0373950_0007319 Ga0373950_0007319_751_1317 188
834 3300034819 Ga0373958_0009964 Ga0373958_0009964_423_989 188
835 3300034819 Ga0373958_0047429 Ga0373958_0047429_152_721 188
836 3300034820 Ga0373959_0004609 Ga0373959_0004609_867_1433 188
837 3300034820 Ga0373959_0082028 Ga0373959_0082028_109_675 188
838 3300034957 Ga0373938_0029360 Ga0373938_0029360_114_680 188
839 3300035084 Ga0373928_0000817 Ga0373928_0000817_989_1555 188
840 3300035085 Ga0373929_0004194 Ga0373929_0004194_121_687 188
841 3300035088 Ga0373940_0003794 Ga0373940_0003794_636_1202 188
842 3300035091 Ga0373951_0083733 Ga0373951_0083733_113_679 188
843 3300035092 Ga0373952_0041025 Ga0373952_0041025_179_745 188
844 3300035092 Ga0373952_0064783 Ga0373952_0064783_107_673 188
845 3300035112 Ga0373932_0021380 Ga0373932_0021380_922_1488 188
846 3300035113 Ga0373936_0118204 Ga0373936_0118204_500_1066 188
847 3300035113 Ga0373936_0203648 Ga0373936_0203648_291_857 188
848 3300035114 Ga0373939_0008627 Ga0373939_0008627_544_1110 188
849 3300035115 Ga0373941_0005496 Ga0373941_0005496_550_1116 188
850 3300035115 Ga0373941_0090706 Ga0373941_0090706_390_956 188
851 3300035116 Ga0373945_0154895 Ga0373945_0154895_333_908 188
852 3300035171 Ga0373946_0186470 Ga0373946_0186470_223_789 188
853 3300035241 Ga0373961_0027685 Ga0373961_0027685_848_1414 188
854 3300035242 Ga0373962_0041506 Ga0373962_0041506_100_666 188
855 3300035691 Ga0373931_0022823 Ga0373931_0022823_1855_2421 188
856 3300035691 Ga0373931_0180591 Ga0373931_0180591_110_676 188
857 3300035692 Ga0373935_0113993 Ga0373935_0113993_388_954 188
858 3300035692 Ga0373935_0810639 Ga0373935_0810639_94_660 188
859 3300037068 Ga0373925_0454488 Ga0373925_0454488_194_760 188
860 3300037312 Ga0395899_0002677 Ga0395899_0002677_10018_10584 188
861 3300037312 Ga0395899_0005165 Ga0395899_0005165_9216_9782 188
862 3300037312 Ga0395899_0010950 Ga0395899_0010950_868_1434 188
863 3300037312 Ga0395899_0014775 Ga0395899_0014775_4862_5428 188
864 3300037312 Ga0395899_0030116 Ga0395899_0030116_2274_2840 188
865 3300037312 Ga0395899_0031719 Ga0395899_0031719_2407_2973 188
866 3300037312 Ga0395899_0064709 Ga0395899_0064709_762_1328 188
867 3300037312 Ga0395899_0066602 Ga0395899_0066602_651_1217 188
868 3300037312 Ga0395899_0096867 Ga0395899_0096867_373_939 188
869 3300037312 Ga0395899_0129842 Ga0395899_0129842_521_1087 188
870 3300037312 Ga0395899_0156632 Ga0395899_0156632_989_1555 188
871 3300037312 Ga0395899_0243965 Ga0395899_0243965_632_1198 188
872 3300037312 Ga0395899_0250776 Ga0395899_0250776_311_877 188
873 3300037418 Ga0395900_0002314 Ga0395900_0002314_2080_2646 188
874 3300037418 Ga0395900_0005017 Ga0395900_0005017_9406_9972 188
875 3300037418 Ga0395900_0005056 Ga0395900_0005056_5877_6443 188
876 3300037418 Ga0395900_0008595 Ga0395900_0008595_6083_6649 188
877 3300037418 Ga0395900_0011172 Ga0395900_0011172_649_1215 188
878 3300037418 Ga0395900_0015616 Ga0395900_0015616_6854_7420 188
879 3300037418 Ga0395900_0019876 Ga0395900_0019876_69_635 188
880 3300037418 Ga0395900_0035486 Ga0395900_0035486_1100_1666 188
881 3300037418 Ga0395900_0036755 Ga0395900_0036755_1754_2320 188
882 3300037418 Ga0395900_0370752 Ga0395900_0370752_156_722 188
883 3300037418 Ga0395900_0575383 Ga0395900_0575383_448_1014 188
884 3300037418 Ga0395900_0610069 Ga0395900_0610069_39_605 188
885 3300037418 Ga0395900_0610507 Ga0395900_0610507_162_728 188
886 3300037418 Ga0395900_0638970 Ga0395900_0638970_187_753 188
887 3300037418 Ga0395900_0776076 Ga0395900_0776076_234_800 188
888 3300037466 Ga0395898_0008878 Ga0395898_0008878_3071_3637 188
889 3300037466 Ga0395898_0011934 Ga0395898_0011934_8386_8952 188
890 3300037466 Ga0395898_0015021 Ga0395898_0015021_5182_5748 188
891 3300037466 Ga0395898_0019771 Ga0395898_0019771_5734_6300 188
892 3300037466 Ga0395898_0066696 Ga0395898_0066696_2195_2761 188
893 3300037466 Ga0395898_0078458 Ga0395898_0078458_554_1120 188
894 3300037466 Ga0395898_0081279 Ga0395898_0081279_2519_3085 188
895 3300037466 Ga0395898_0131451 Ga0395898_0131451_1440_2006 188
896 3300037466 Ga0395898_0135856 Ga0395898_0135856_69_635 188
897 3300037466 Ga0395898_0135982 Ga0395898_0135982_1267_1833 188
898 3300037466 Ga0395898_0213089 Ga0395898_0213089_1189_1755 188
899 3300037466 Ga0395898_0234888 Ga0395898_0234888_92_658 188
900 3300037466 Ga0395898_0248244 Ga0395898_0248244_192_758 188
901 3300037466 Ga0395898_0269104 Ga0395898_0269104_961_1527 188
902 3300037466 Ga0395898_0279242 Ga0395898_0279242_322_888 188
903 3300037466 Ga0395898_0713759 Ga0395898_0713759_275_841 188
904 3300037471 Ga0395905_0002930 Ga0395905_0002930_1636_2202 188
905 3300037471 Ga0395905_0005651 Ga0395905_0005651_663_1229 188
906 3300037471 Ga0395905_0011779 Ga0395905_0011779_3200_3766 188
907 3300037471 Ga0395905_0021746 Ga0395905_0021746_738_1304 188
908 3300037471 Ga0395905_0030326 Ga0395905_0030326_1788_2354 188
909 3300037471 Ga0395905_0072577 Ga0395905_0072577_897_1463 188
910 3300037471 Ga0395905_0072817 Ga0395905_0072817_850_1416 188
911 3300037471 Ga0395905_0090921 Ga0395905_0090921_2227_2793 188
912 3300037471 Ga0395905_0117045 Ga0395905_0117045_1635_2201 188
913 3300037471 Ga0395905_0148506 Ga0395905_0148506_1184_1750 188
914 3300037471 Ga0395905_0169840 Ga0395905_0169840_1163_1729 188
915 3300037471 Ga0395905_0326521 Ga0395905_0326521_275_841 188
916 3300037471 Ga0395905_0360590 Ga0395905_0360590_170_736 188
917 3300037471 Ga0395905_0626309 Ga0395905_0626309_44_610 188
918 3300037471 Ga0395905_0665916 Ga0395905_0665916_31_597 188
919 3300038443 Ga0395901_0004146 Ga0395901_0004146_6445_7011 188
920 3300038443 Ga0395901_0012936 Ga0395901_0012936_7226_7792 188
921 3300038443 Ga0395901_0019251 Ga0395901_0019251_4740_5306 188
922 3300038443 Ga0395901_0019880 Ga0395901_0019880_664_1230 188
923 3300038443 Ga0395901_0034280 Ga0395901_0034280_4429_4995 188
924 3300038443 Ga0395901_0034750 Ga0395901_0034750_4041_4607 188
925 3300038443 Ga0395901_0053432 Ga0395901_0053432_751_1317 188
926 3300038443 Ga0395901_0055432 Ga0395901_0055432_3380_3946 188
927 3300038443 Ga0395901_0073693 Ga0395901_0073693_2901_3527 188
928 3300038443 Ga0395901_0078250 Ga0395901_0078250_132_698 188
929 3300038443 Ga0395901_0104352 Ga0395901_0104352_314_880 188
930 3300038443 Ga0395901_0122685 Ga0395901_0122685_2096_2662 188
931 3300038443 Ga0395901_0138147 Ga0395901_0138147_1948_2514 188
932 3300038443 Ga0395901_0186992 Ga0395901_0186992_554_1120 188
933 3300038443 Ga0395901_0254041 Ga0395901_0254041_318_884 188
934 3300038443 Ga0395901_0264641 Ga0395901_0264641_655_1221 188
935 3300038443 Ga0395901_0287160 Ga0395901_0287160_614_1180 188
936 3300038443 Ga0395901_0399939 Ga0395901_0399939_390_956 188
937 3300038443 Ga0395901_0449581 Ga0395901_0449581_616_1182 188
938 3300038443 Ga0395901_0695528 Ga0395901_0695528_62_628 188
939 3300038443 Ga0395901_1089829 Ga0395901_1089829_79_645 188
940 3300039437 Ga0436365_0993863 Ga0436365_0993863_123_689 188
941 3300041406 Ga0439439_0001480 Ga0439439_0001480_948_1514 188
942 3300041408 Ga0439453_0018373 Ga0439453_0018373_250_816 188
943 3300041456 Ga0451795_1315107 Ga0451795_1315107_286_852 188
944 3300041463 Ga0451804_1123069 Ga0451804_1123069_1525_2091 188
945 3300041486 Ga0451807_0653312 Ga0451807_0653312_812_1378 188
946 3300041486 Ga0451807_0684468 Ga0451807_0684468_58_624 188
947 3300041492 Ga0451835_0606000 Ga0451835_0606000_2300_2866 188
948 3300041496 Ga0451839_1101083 Ga0451839_1101083_272_838 188
949 3300041503 Ga0451847_0040919 Ga0451847_0040919_2187_2753 188
950 3300041505 Ga0451849_0345776 Ga0451849_0345776_260_826 188
951 3300041505 Ga0451849_1263986 Ga0451849_1263986_23_589 188
952 3300041509 Ga0451843_1553555 Ga0451843_1553555_1029_1595 188
953 3300041511 Ga0451855_0267913 Ga0451855_0267913_71_637 188
954 3300041512 Ga0451853_0842571 Ga0451853_0842571_1506_2072 188
955 3300041512 Ga0451853_2193972 Ga0451853_2193972_769_1335 188
956 3300042005 Ga0439448_0086437 Ga0439448_0086437_87_653 188
957 3300042009 Ga0439451_002906 Ga0439451_002906_637_1203 188
958 3300042011 Ga0439454_035700 Ga0439454_035700_186_752 188
959 3300042015 Ga0439462_0002251 Ga0439462_0002251_2006_2572 188
960 3300042119 Ga0450915_001392 Ga0450915_001392_26_592 188
961 3300042122 Ga0450920_017633 Ga0450920_017633_207_773 188
962 3300042122 Ga0450920_052807 Ga0450920_052807_237_803 188
963 3300042125 Ga0450923_004598 Ga0450923_004598_565_1131 188
964 3300042145 Ga0450906_042517 Ga0450906_042517_103_669 188
965 3300042147 Ga0450910_033343 Ga0450910_033343_138_779 188
966 3300042184 Ga0450908_028668 Ga0450908_028668_111_677 188
967 3300042435 Ga0439434_0009198 Ga0439434_0009198_1442_2008 188
968 3300042438 Ga0439459_0046857 Ga0439459_0046857_45_611 188
969 3300042461 Ga0439460_0072152 Ga0439460_0072152_473_1039 188
970 3300042531 Ga0450918_016030 Ga0450918_016030_85_651 188
971 3300044683 Ga0466965_0132724 Ga0466965_0132724_127_693 188
972 3300044706 Ga0466964_0003859 Ga0466964_0003859_1673_2239 188
973 3300044735 Ga0466968_0018648 Ga0466968_0018648_1385_1951 188
974 3300044901 Ga0466960_0006156 Ga0466960_0006156_1231_1797 188
975 3300044901 Ga0466960_0340504 Ga0466960_0340504_240_806 188
976 3300045976 Ga0466967_0009871 Ga0466967_0009871_3058_3624 188
977 3300045976 Ga0466967_0039679 Ga0466967_0039679_163_729 188
978 3300045976 Ga0466967_0142929 Ga0466967_0142929_1049_1615 188
979 3300045976 Ga0466967_0744985 Ga0466967_0744985_177_743 188
980 3300046453 Ga0495627_134364 Ga0495627_134364_95_661 188
981 3300046454 Ga0495592_0549596 Ga0495592_0549596_122_694 188
982 3300046455 Ga0495603_0004496 Ga0495603_0004496_1052_1618 188
983 3300046455 Ga0495603_0042094 Ga0495603_0042094_1627_2193 188
984 3300046455 Ga0495603_0382978 Ga0495603_0382978_79_645 188
985 3300046459 Ga0495629_0040269 Ga0495629_0040269_655_1221 188
986 3300046459 Ga0495629_0355051 Ga0495629_0355051_41_607 188
987 3300046461 Ga0495641_0086636 Ga0495641_0086636_548_1114 188
988 3300046462 Ga0495651_0264203 Ga0495651_0264203_199_765 188
989 3300046463 Ga0495653_0302486 Ga0495653_0302486_349_915 188
990 3300046463 Ga0495653_0375351 Ga0495653_0375351_181_822 188
991 3300046473 Ga0495582_0007896 Ga0495582_0007896_1230_1796 188
992 3300046473 Ga0495582_0145163 Ga0495582_0145163_397_963 188
993 3300046476 Ga0495662_0120499 Ga0495662_0120499_408_1049 188
994 3300046477 Ga0495664_0156844 Ga0495664_0156844_299_865 188
995 3300046491 Ga0495584_0447700 Ga0495584_0447700_60_626 188
996 3300046499 Ga0495594_0081817 Ga0495594_0081817_803_1369 188
997 3300046500 Ga0495596_0063673 Ga0495596_0063673_174_740 188
998 3300046500 Ga0495596_0071639 Ga0495596_0071639_699_1265 188
999 3300046500 Ga0495596_0105982 Ga0495596_0105982_21_587 188
1000 3300046511 Ga0495608_0246451 Ga0495608_0246451_165_731 188
1001 3300046514 Ga0495618_0642179 Ga0495618_0642179_10_582 188
1002 3300046516 Ga0495628_0335579 Ga0495628_0335579_116_682 188
1003 3300046517 Ga0495630_0010267 Ga0495630_0010267_1035_1601 188
1004 3300046517 Ga0495630_0520203 Ga0495630_0520203_20_586 188
1005 3300046518 Ga0495631_0157956 Ga0495631_0157956_29_595 188
1006 3300046523 Ga0495644_0187887 Ga0495644_0187887_204_770 188
1007 3300046529 Ga0495652_0042658 Ga0495652_0042658_2910_3476 188
1008 3300046531 Ga0495665_0032457 Ga0495665_0032457_194_760 188
1009 3300046533 Ga0495640_0187699 Ga0495640_0187699_699_1265 188
1010 3300046533 Ga0495640_0348653 Ga0495640_0348653_248_814 188
1011 3300046535 Ga0495586_0177345 Ga0495586_0177345_452_1018 188
1012 3300046536 Ga0495587_0428365 Ga0495587_0428365_74_640 188
1013 3300046543 Ga0495645_0227411 Ga0495645_0227411_402_968 188
1014 3300046559 Ga0495667_0105642 Ga0495667_0105642_781_1422 188
1015 3300046615 Ga0495656_0054065 Ga0495656_0054065_778_1344 188
1016 3300046615 Ga0495656_0187247 Ga0495656_0187247_379_945 188
1017 3300046615 Ga0495656_0225093 Ga0495656_0225093_223_789 188
1018 3300046615 Ga0495656_0403543 Ga0495656_0403543_57_623 188
1019 3300046642 Ga0495634_0028348 Ga0495634_0028348_1504_2145 188
1020 3300046642 Ga0495634_0109877 Ga0495634_0109877_226_792 188
1021 3300046663 Ga0495635_0014022 Ga0495635_0014022_1354_1995 188
1022 3300046663 Ga0495635_0176203 Ga0495635_0176203_448_1014 188
1023 3300046675 Ga0495657_0093077 Ga0495657_0093077_1223_1789 188
1024 3300046675 Ga0495657_0164004 Ga0495657_0164004_725_1297 188
1025 3300046680 Ga0495646_0213416 Ga0495646_0213416_208_774 188
1026 3300046681 Ga0495647_0038008 Ga0495647_0038008_953_1519 188
1027 3300046681 Ga0495647_0131592 Ga0495647_0131592_456_1022 188
1028 3300046681 Ga0495647_0234579 Ga0495647_0234579_48_623 188
1029 3300046683 Ga0495658_0088857 Ga0495658_0088857_25_591 188
1030 3300046683 Ga0495658_0268469 Ga0495658_0268469_352_918 188
1031 3300046684 Ga0495669_0215828 Ga0495669_0215828_28_603 188
1032 3300046689 Ga0495613_0086792 Ga0495613_0086792_696_1262 188
1033 3300046689 Ga0495613_0343115 Ga0495613_0343115_362_928 188
1034 3300046689 Ga0495613_0395390 Ga0495613_0395390_263_829 188
1035 3300046690 Ga0495624_0026354 Ga0495624_0026354_1610_2251 188
1036 3300046690 Ga0495624_0038278 Ga0495624_0038278_182_748 188
1037 3300046794 Ga0495589_0152763 Ga0495589_0152763_387_953 188
1038 3300046809 Ga0495600_0300725 Ga0495600_0300725_160_726 188
1039 3300046809 Ga0495600_0330727 Ga0495600_0330727_233_799 188
1040 3300047315 Ga0495581_0000297 Ga0495581_0000297_15655_16221 188
1041 3300047315 Ga0495581_0014396 Ga0495581_0014396_2394_2960 188
1042 3300047315 Ga0495581_0222101 Ga0495581_0222101_187_828 188
1043 3300047317 Ga0495604_0180723 Ga0495604_0180723_21_587 188
1044 3300047319 Ga0495674_0023797 Ga0495674_0023797_82_723 188
1045 3300047319 Ga0495674_0066981 Ga0495674_0066981_2449_3015 188
1046 3300047319 Ga0495674_0256024 Ga0495674_0256024_251_817 188
1047 3300047319 Ga0495674_0410278 Ga0495674_0410278_109_675 188
1048 3300047319 Ga0495674_0941122 Ga0495674_0941122_15_581 188
1049 3300047321 Ga0495676_0058599 Ga0495676_0058599_1731_2297 188
1050 3300047321 Ga0495676_0063592 Ga0495676_0063592_209_775 188
1051 3300047321 Ga0495676_0074715 Ga0495676_0074715_1515_2081 188
1052 3300047322 Ga0495680_0010847 Ga0495680_0010847_3647_4288 188
1053 3300047322 Ga0495680_0353917 Ga0495680_0353917_371_937 188
1054 3300047470 Ga0495681_0272188 Ga0495681_0272188_25_591 188
1055 3300047471 Ga0495684_0010925 Ga0495684_0010925_3733_4299 188
1056 3300047471 Ga0495684_0033550 Ga0495684_0033550_1108_1749 188
1057 3300047471 Ga0495684_0416767 Ga0495684_0416767_118_684 188
1058 3300048903 Ga0496100_0001414 Ga0496100_0001414_1908_2474 188
1059 3300048903 Ga0496100_0003404 Ga0496100_0003404_1332_1898 188
1060 3300048903 Ga0496100_0015443 Ga0496100_0015443_752_1357 188
1061 3300048903 Ga0496100_0132165 Ga0496100_0132165_813_1379 188
1062 3300048903 Ga0496100_0193046 Ga0496100_0193046_365_931 188
1063 3300048903 Ga0496100_1077272 Ga0496100_1077272_46_612 188
1064 3300048904 Ga0496101_0004381 Ga0496101_0004381_2765_3370 188
1065 3300048904 Ga0496101_0005067 Ga0496101_0005067_6517_7083 188
1066 3300048904 Ga0496101_0006719 Ga0496101_0006719_108_674 188
1067 3300048904 Ga0496101_0023061 Ga0496101_0023061_1811_2377 188
1068 3300048904 Ga0496101_0077921 Ga0496101_0077921_333_899 188
1069 3300048904 Ga0496101_0300246 Ga0496101_0300246_553_1119 188
1070 3300048904 Ga0496101_0335814 Ga0496101_0335814_143_709 188
1071 3300048904 Ga0496101_0430951 Ga0496101_0430951_74_640 188
1072 3300048905 Ga0496102_0015176 Ga0496102_0015176_806_1372 188
1073 3300048905 Ga0496102_0025349 Ga0496102_0025349_625_1230 188
1074 3300048905 Ga0496102_0086577 Ga0496102_0086577_896_1462 188
1075 3300048905 Ga0496102_0088006 Ga0496102_0088006_2162_2728 188
1076 3300048905 Ga0496102_0130613 Ga0496102_0130613_1108_1674 188
1077 3300048905 Ga0496102_0194510 Ga0496102_0194510_403_969 188
1078 3300048905 Ga0496102_0310757 Ga0496102_0310757_527_1093 188
1079 3300048905 Ga0496102_0321995 Ga0496102_0321995_457_1023 188
1080 3300048905 Ga0496102_0421532 Ga0496102_0421532_26_592 188
1081 3300048906 Ga0496103_0004681 Ga0496103_0004681_2557_3162 188
1082 3300048906 Ga0496103_0011908 Ga0496103_0011908_4120_4686 188
1083 3300048906 Ga0496103_0215247 Ga0496103_0215247_506_1072 188
1084 3300048906 Ga0496103_0305556 Ga0496103_0305556_306_872 188
1085 3300048906 Ga0496103_0512469 Ga0496103_0512469_100_666 188
1086 3300048906 Ga0496103_0597419 Ga0496103_0597419_52_618 188
1087 3300048907 Ga0496104_0000699 Ga0496104_0000699_11831_12397 188
1088 3300048907 Ga0496104_0027991 Ga0496104_0027991_727_1293 188
1089 3300048907 Ga0496104_0030362 Ga0496104_0030362_1942_2508 188
1090 3300048907 Ga0496104_0037255 Ga0496104_0037255_899_1465 188
1091 3300048907 Ga0496104_0059948 Ga0496104_0059948_1033_1599 188
1092 3300048907 Ga0496104_0070896 Ga0496104_0070896_125_691 188
1093 3300048907 Ga0496104_0072253 Ga0496104_0072253_2657_3223 188
1094 3300048907 Ga0496104_0087321 Ga0496104_0087321_108_674 188
1095 3300048907 Ga0496104_0093758 Ga0496104_0093758_1135_1701 188
1096 3300048907 Ga0496104_0150938 Ga0496104_0150938_1477_2043 188
1097 3300048907 Ga0496104_0163857 Ga0496104_0163857_1253_1819 188
1098 3300048907 Ga0496104_0282736 Ga0496104_0282736_80_646 188
1099 3300048907 Ga0496104_0298100 Ga0496104_0298100_297_863 188
1100 3300048907 Ga0496104_0708917 Ga0496104_0708917_298_864 188
1101 3300048907 Ga0496104_0712356 Ga0496104_0712356_104_670 188
1102 3300048907 Ga0496104_1250000 Ga0496104_1250000_31_597 188
1103 3300048908 Ga0496105_0000148 Ga0496105_0000148_30100_30666 188
1104 3300048908 Ga0496105_0006474 Ga0496105_0006474_1195_1761 188
1105 3300048908 Ga0496105_0018289 Ga0496105_0018289_2350_2916 188
1106 3300048908 Ga0496105_0029387 Ga0496105_0029387_3826_4392 188
1107 3300048908 Ga0496105_0064058 Ga0496105_0064058_1459_2025 188
1108 3300048908 Ga0496105_0138585 Ga0496105_0138585_737_1303 188
1109 3300048908 Ga0496105_0143617 Ga0496105_0143617_904_1470 188
1110 3300048908 Ga0496105_0350970 Ga0496105_0350970_63_629 188
1111 3300048908 Ga0496105_0448366 Ga0496105_0448366_114_680 188
1112 3300048909 Ga0496106_0005655 Ga0496106_0005655_921_1526 188
1113 3300048909 Ga0496106_0012691 Ga0496106_0012691_4845_5411 188
1114 3300048909 Ga0496106_0031163 Ga0496106_0031163_2884_3450 188
1115 3300048909 Ga0496106_0074430 Ga0496106_0074430_1400_1966 188
1116 3300048909 Ga0496106_0125755 Ga0496106_0125755_1136_1702 188
1117 3300048909 Ga0496106_0169838 Ga0496106_0169838_980_1546 188
1118 3300048909 Ga0496106_0814146 Ga0496106_0814146_84_650 188
1119 3300048910 Ga0496107_0011632 Ga0496107_0011632_2629_3195 188
1120 3300048910 Ga0496107_0019629 Ga0496107_0019629_3301_3906 188
1121 3300048910 Ga0496107_0070977 Ga0496107_0070977_638_1204 188
1122 3300048910 Ga0496107_0261338 Ga0496107_0261338_702_1268 188
1123 3300048910 Ga0496107_0784534 Ga0496107_0784534_20_586 188
1124 3300048911 Ga0496108_0000473 Ga0496108_0000473_2941_3507 188
1125 3300048911 Ga0496108_0001586 Ga0496108_0001586_12899_13465 188
1126 3300048911 Ga0496108_0007122 Ga0496108_0007122_6103_6669 188
1127 3300048911 Ga0496108_0009678 Ga0496108_0009678_759_1325 188
1128 3300048911 Ga0496108_0010037 Ga0496108_0010037_1747_2313 188
1129 3300048911 Ga0496108_0130450 Ga0496108_0130450_1288_1854 188
1130 3300048911 Ga0496108_0144813 Ga0496108_0144813_553_1119 188
1131 3300048911 Ga0496108_0247369 Ga0496108_0247369_701_1267 188
1132 3300048911 Ga0496108_0261714 Ga0496108_0261714_509_1075 188
1133 3300048911 Ga0496108_0262987 Ga0496108_0262987_667_1233 188
1134 3300048911 Ga0496108_0393411 Ga0496108_0393411_486_1052 188
1135 3300048912 Ga0496109_0005032 Ga0496109_0005032_3315_3881 188
1136 3300048912 Ga0496109_0005657 Ga0496109_0005657_8221_8787 188
1137 3300048912 Ga0496109_0011181 Ga0496109_0011181_566_1132 188
1138 3300048912 Ga0496109_0012604 Ga0496109_0012604_302_868 188
1139 3300048912 Ga0496109_0019754 Ga0496109_0019754_2208_2774 188
1140 3300048912 Ga0496109_0035866 Ga0496109_0035866_35_601 188
1141 3300048912 Ga0496109_0044447 Ga0496109_0044447_2079_2645 188
1142 3300048912 Ga0496109_0086054 Ga0496109_0086054_2326_2892 188
1143 3300048912 Ga0496109_0236780 Ga0496109_0236780_44_610 188
1144 3300048912 Ga0496109_0264568 Ga0496109_0264568_399_965 188
1145 3300048912 Ga0496109_0291911 Ga0496109_0291911_686_1252 188
1146 3300048912 Ga0496109_0528664 Ga0496109_0528664_144_710 188
1147 3300048912 Ga0496109_0570146 Ga0496109_0570146_70_636 188
1148 3300048912 Ga0496109_0933575 Ga0496109_0933575_151_717 188
1149 3300048913 Ga0496110_0000707 Ga0496110_0000707_7558_8124 188
1150 3300048913 Ga0496110_0001277 Ga0496110_0001277_8668_9234 188
1151 3300048913 Ga0496110_0007330 Ga0496110_0007330_6589_7155 188
1152 3300048913 Ga0496110_0007405 Ga0496110_0007405_6471_7037 188
1153 3300048913 Ga0496110_0016856 Ga0496110_0016856_1381_1947 188
1154 3300048913 Ga0496110_0018310 Ga0496110_0018310_3197_3763 188
1155 3300048913 Ga0496110_0019310 Ga0496110_0019310_4647_5213 188
1156 3300048913 Ga0496110_0038868 Ga0496110_0038868_1510_2076 188
1157 3300048913 Ga0496110_0088198 Ga0496110_0088198_2068_2634 188
1158 3300048913 Ga0496110_0099775 Ga0496110_0099775_543_1109 188
1159 3300048913 Ga0496110_0157002 Ga0496110_0157002_1323_1889 188
1160 3300048913 Ga0496110_0217134 Ga0496110_0217134_626_1198 188
1161 3300048913 Ga0496110_0274193 Ga0496110_0274193_584_1150 188
1162 3300048913 Ga0496110_0446714 Ga0496110_0446714_469_1035 188
1163 3300048913 Ga0496110_0510108 Ga0496110_0510108_302_868 188
1164 3300048913 Ga0496110_0579359 Ga0496110_0579359_104_670 188
1165 3300048914 Ga0496111_0003548 Ga0496111_0003548_23_589 188
1166 3300048914 Ga0496111_0005116 Ga0496111_0005116_7009_7575 188
1167 3300048914 Ga0496111_0013548 Ga0496111_0013548_1011_1577 188
1168 3300048914 Ga0496111_0034814 Ga0496111_0034814_2877_3443 188
1169 3300048914 Ga0496111_0038623 Ga0496111_0038623_937_1503 188
1170 3300048914 Ga0496111_0085826 Ga0496111_0085826_1123_1689 188
1171 3300048914 Ga0496111_0154537 Ga0496111_0154537_29_595 188
1172 3300048914 Ga0496111_0188168 Ga0496111_0188168_318_890 188
1173 3300048914 Ga0496111_0201795 Ga0496111_0201795_902_1468 188
1174 3300048914 Ga0496111_0221778 Ga0496111_0221778_337_903 188
1175 3300048914 Ga0496111_0317966 Ga0496111_0317966_217_783 188
1176 3300048914 Ga0496111_0584824 Ga0496111_0584824_166_732 188
1177 3300048914 Ga0496111_0675651 Ga0496111_0675651_157_723 188
1178 3300048915 Ga0496112_0001515 Ga0496112_0001515_4822_5388 188
1179 3300048915 Ga0496112_0003614 Ga0496112_0003614_5618_6184 188
1180 3300048915 Ga0496112_0029708 Ga0496112_0029708_1478_2044 188
1181 3300048915 Ga0496112_0049016 Ga0496112_0049016_3061_3627 188
1182 3300048915 Ga0496112_0061172 Ga0496112_0061172_2612_3178 188
1183 3300048915 Ga0496112_0067348 Ga0496112_0067348_351_917 188
1184 3300048915 Ga0496112_0249964 Ga0496112_0249964_885_1451 188
1185 3300048915 Ga0496112_1153244 Ga0496112_1153244_23_589 188
1186 3300048916 Ga0496113_0003455 Ga0496113_0003455_7189_7755 188
1187 3300048916 Ga0496113_0014450 Ga0496113_0014450_3008_3574 188
1188 3300048916 Ga0496113_0024379 Ga0496113_0024379_417_983 188
1189 3300048916 Ga0496113_0057619 Ga0496113_0057619_210_776 188
1190 3300048916 Ga0496113_0101088 Ga0496113_0101088_1574_2140 188
1191 3300048916 Ga0496113_0194419 Ga0496113_0194419_916_1482 188
1192 3300048916 Ga0496113_0207366 Ga0496113_0207366_713_1318 188
1193 3300048916 Ga0496113_0592642 Ga0496113_0592642_117_683 188
1194 3300048916 Ga0496113_0994118 Ga0496113_0994118_49_615 188
1195 3300048917 Ga0496114_0002235 Ga0496114_0002235_12436_13002 188
1196 3300048917 Ga0496114_0005309 Ga0496114_0005309_7266_7832 188
1197 3300048917 Ga0496114_0009487 Ga0496114_0009487_590_1156 188
1198 3300048917 Ga0496114_0012323 Ga0496114_0012323_745_1350 188
1199 3300048917 Ga0496114_0022727 Ga0496114_0022727_1585_2151 188
1200 3300048917 Ga0496114_0058632 Ga0496114_0058632_2529_3095 188
1201 3300048917 Ga0496114_0063757 Ga0496114_0063757_902_1468 188
1202 3300048917 Ga0496114_0113482 Ga0496114_0113482_847_1413 188
1203 3300048917 Ga0496114_0125150 Ga0496114_0125150_760_1326 188
1204 3300048917 Ga0496114_0147165 Ga0496114_0147165_343_909 188
1205 3300048917 Ga0496114_0170411 Ga0496114_0170411_670_1242 188
1206 3300048917 Ga0496114_0174045 Ga0496114_0174045_507_1073 188
1207 3300048917 Ga0496114_0199171 Ga0496114_0199171_190_756 188
1208 3300048917 Ga0496114_0866935 Ga0496114_0866935_128_694 188
1209 3300048918 Ga0496115_0004633 Ga0496115_0004633_4530_5096 188
1210 3300048918 Ga0496115_0012826 Ga0496115_0012826_4908_5513 188
1211 3300048918 Ga0496115_0773400 Ga0496115_0773400_137_703 188
1212 3300048929 Ga0496126_0163742 Ga0496126_0163742_279_845 188
1213 3300049568 Ga0501031_0010809 Ga0501031_0010809_1794_2360 188
1214 3300049568 Ga0501031_0025727 Ga0501031_0025727_1111_1677 188
1215 3300049569 Ga0501032_0047331 Ga0501032_0047331_971_1549 188
1216 3300049569 Ga0501032_0126717 Ga0501032_0126717_61_627 188
1217 3300049570 Ga0501033_0033546 Ga0501033_0033546_647_1225 188
1218 3300049570 Ga0501033_0317149 Ga0501033_0317149_276_842 188
1219 3300049570 Ga0501033_0484002 Ga0501033_0484002_170_739 188
1220 3300049571 Ga0501034_0198328 Ga0501034_0198328_1169_1738 188
1221 3300049571 Ga0501034_0408473 Ga0501034_0408473_366_944 188
1222 3300049572 Ga0501036_0013236 Ga0501036_0013236_2633_3199 188
1223 3300049572 Ga0501036_0027313 Ga0501036_0027313_2679_3257 188
1224 3300049572 Ga0501036_0355852 Ga0501036_0355852_78_644 188
1225 3300049573 Ga0501037_0014363 Ga0501037_0014363_1737_2303 188
1226 3300049573 Ga0501037_0039858 Ga0501037_0039858_2361_2939 188
1227 3300049573 Ga0501037_0522442 Ga0501037_0522442_213_779 188
1228 3300049574 Ga0501038_0007223 Ga0501038_0007223_4000_4578 188
1229 3300049574 Ga0501038_0025650 Ga0501038_0025650_2645_3211 188
1230 3300049574 Ga0501038_0037049 Ga0501038_0037049_2038_2604 188
1231 3300049574 Ga0501038_0164775 Ga0501038_0164775_689_1255 188
1232 3300049575 Ga0501039_0038047 Ga0501039_0038047_714_1280 188
1233 3300049575 Ga0501039_0042515 Ga0501039_0042515_2226_2792 188
1234 3300049575 Ga0501039_0081577 Ga0501039_0081577_648_1214 188
1235 3300049575 Ga0501039_0114668 Ga0501039_0114668_1409_1987 188
1236 3300049575 Ga0501039_0138622 Ga0501039_0138622_111_677 188
1237 3300049575 Ga0501039_0488107 Ga0501039_0488107_125_691 188
1238 3300049576 Ga0501040_0009583 Ga0501040_0009583_3134_3712 188
1239 3300049576 Ga0501040_0028090 Ga0501040_0028090_2074_2640 188
1240 3300049576 Ga0501040_0071669 Ga0501040_0071669_132_698 188
1241 3300049576 Ga0501040_0101469 Ga0501040_0101469_293_859 188
1242 3300049577 Ga0501041_0033432 Ga0501041_0033432_1909_2475 188
1243 3300049577 Ga0501041_0049103 Ga0501041_0049103_899_1465 188
1244 3300049577 Ga0501041_0051886 Ga0501041_0051886_1026_1592 188
1245 3300049577 Ga0501041_0067953 Ga0501041_0067953_1427_2005 188
1246 3300049578 Ga0501042_0015582 Ga0501042_0015582_1214_1780 188
1247 3300049578 Ga0501042_0039423 Ga0501042_0039423_2234_2800 188
1248 3300049578 Ga0501042_0042800 Ga0501042_0042800_1795_2361 188
1249 3300049578 Ga0501042_0045345 Ga0501042_0045345_1446_2024 188
1250 3300049578 Ga0501042_0107456 Ga0501042_0107456_1409_1975 188
1251 3300049578 Ga0501042_0598256 Ga0501042_0598256_154_720 188
1252 3300049579 Ga0501043_0050524 Ga0501043_0050524_2572_3138 188
1253 3300049579 Ga0501043_0157458 Ga0501043_0157458_1180_1746 188
1254 3300049580 Ga0501046_0014807 Ga0501046_0014807_1536_2114 188
1255 3300049580 Ga0501046_0021842 Ga0501046_0021842_3231_3797 188
1256 3300049580 Ga0501046_0039989 Ga0501046_0039989_3146_3712 188
1257 3300049580 Ga0501046_0074463 Ga0501046_0074463_1623_2189 188
1258 3300049581 Ga0501047_0359052 Ga0501047_0359052_246_824 188
1259 3300049582 Ga0501048_0009728 Ga0501048_0009728_5789_6367 188
1260 3300049582 Ga0501048_0039456 Ga0501048_0039456_2558_3124 188
1261 3300049582 Ga0501048_0084418 Ga0501048_0084418_1050_1616 188
1262 3300049583 Ga0501067_0002463 Ga0501067_0002463_3309_3875 188
1263 3300049583 Ga0501067_0028662 Ga0501067_0028662_766_1332 188
1264 3300049583 Ga0501067_0037343 Ga0501067_0037343_1514_2080 188
1265 3300049583 Ga0501067_0112316 Ga0501067_0112316_173_739 188
1266 3300049583 Ga0501067_0374018 Ga0501067_0374018_20_586 188
1267 3300049584 Ga0501068_0003202 Ga0501068_0003202_5595_6164 188
1268 3300049584 Ga0501068_0011394 Ga0501068_0011394_1550_2116 188
1269 3300049584 Ga0501068_0019186 Ga0501068_0019186_450_1028 188
1270 3300049584 Ga0501068_0026977 Ga0501068_0026977_196_762 188
1271 3300049584 Ga0501068_0245060 Ga0501068_0245060_445_1014 188
1272 3300049584 Ga0501068_0264031 Ga0501068_0264031_401_967 188
1273 3300049585 Ga0501069_0021031 Ga0501069_0021031_414_992 188
1274 3300049585 Ga0501069_0034366 Ga0501069_0034366_391_957 188
1275 3300049585 Ga0501069_0067198 Ga0501069_0067198_249_815 188
1276 3300049585 Ga0501069_0095330 Ga0501069_0095330_941_1507 188
1277 3300049585 Ga0501069_0321065 Ga0501069_0321065_162_728 188
1278 3300049586 Ga0501070_0028914 Ga0501070_0028914_2470_3048 188
1279 3300049586 Ga0501070_0031027 Ga0501070_0031027_942_1508 188
1280 3300049586 Ga0501070_0047946 Ga0501070_0047946_2706_3272 188
1281 3300049586 Ga0501070_0135429 Ga0501070_0135429_78_644 188
1282 3300049587 Ga0501071_0006552 Ga0501071_0006552_2296_2862 188
1283 3300049587 Ga0501071_0008171 Ga0501071_0008171_1098_1664 188
1284 3300049587 Ga0501071_0016603 Ga0501071_0016603_4119_4685 188
1285 3300049587 Ga0501071_0019463 Ga0501071_0019463_2391_2969 188
1286 3300049587 Ga0501071_0034047 Ga0501071_0034047_827_1393 188
1287 3300049587 Ga0501071_0297037 Ga0501071_0297037_554_1120 188
1288 3300049588 Ga0501072_0007798 Ga0501072_0007798_3778_4344 188
1289 3300049588 Ga0501072_0030995 Ga0501072_0030995_3452_4018 188
1290 3300049588 Ga0501072_0032382 Ga0501072_0032382_1589_2167 188
1291 3300049588 Ga0501072_0147135 Ga0501072_0147135_881_1447 188
1292 3300049588 Ga0501072_0347930 Ga0501072_0347930_135_701 188
1293 3300049589 Ga0501073_0731805 Ga0501073_0731805_45_611 188
1294 3300049590 Ga0501074_0009861 Ga0501074_0009861_3334_3912 188
1295 3300049590 Ga0501074_0053674 Ga0501074_0053674_532_1098 188
1296 3300049590 Ga0501074_0054458 Ga0501074_0054458_31_597 188
1297 3300049590 Ga0501074_0057842 Ga0501074_0057842_2067_2633 188
1298 3300049590 Ga0501074_0509099 Ga0501074_0509099_263_829 188
1299 3300049590 Ga0501074_0612558 Ga0501074_0612558_56_622 188
1300 3300049591 Ga0501075_0028106 Ga0501075_0028106_3323_3901 188
1301 3300049591 Ga0501075_0044046 Ga0501075_0044046_2478_3044 188
1302 3300049591 Ga0501075_0116149 Ga0501075_0116149_1125_1691 188
1303 3300049591 Ga0501075_0151058 Ga0501075_0151058_53_619 188
1304 3300049591 Ga0501075_0452568 Ga0501075_0452568_97_663 188
1305 3300049591 Ga0501075_0472136 Ga0501075_0472136_246_812 188
1306 3300049592 Ga0501076_0042310 Ga0501076_0042310_2957_3523 188
1307 3300049592 Ga0501076_0093689 Ga0501076_0093689_1590_2168 188
1308 3300049592 Ga0501076_0099826 Ga0501076_0099826_779_1345 188
1309 3300049593 Ga0501077_0029871 Ga0501077_0029871_111_677 188
1310 3300049593 Ga0501077_0050602 Ga0501077_0050602_409_975 188
1311 3300049593 Ga0501077_0061380 Ga0501077_0061380_1551_2117 188
1312 3300049593 Ga0501077_0074790 Ga0501077_0074790_559_1137 188
1313 3300049593 Ga0501077_0085534 Ga0501077_0085534_1207_1773 188
1314 3300049593 Ga0501077_0295067 Ga0501077_0295067_324_890 188
1315 3300049593 Ga0501077_0323808 Ga0501077_0323808_331_897 188
1316 3300049741 Ga0501079_0007849 Ga0501079_0007849_5194_5772 188
1317 3300049741 Ga0501079_0011138 Ga0501079_0011138_6064_6630 188
1318 3300049741 Ga0501079_0071112 Ga0501079_0071112_1644_2210 188
1319 3300049741 Ga0501079_0089886 Ga0501079_0089886_940_1506 188
1320 3300049741 Ga0501079_0185699 Ga0501079_0185699_441_1007 188
1321 3300049742 Ga0501080_0028342 Ga0501080_0028342_3075_3641 188
1322 3300049742 Ga0501080_0069205 Ga0501080_0069205_1907_2485 188
1323 3300049742 Ga0501080_0081718 Ga0501080_0081718_285_851 188
1324 3300049742 Ga0501080_0205668 Ga0501080_0205668_766_1332 188
1325 3300049742 Ga0501080_0734353 Ga0501080_0734353_40_606 188
1326 3300049743 Ga0501081_0002490 Ga0501081_0002490_10784_11362 188
1327 3300049743 Ga0501081_0017391 Ga0501081_0017391_3956_4522 188
1328 3300049743 Ga0501081_0088500 Ga0501081_0088500_458_1024 188
1329 3300049743 Ga0501081_0137823 Ga0501081_0137823_264_830 188
1330 3300049743 Ga0501081_0346050 Ga0501081_0346050_267_833 188
1331 3300049743 Ga0501081_0816730 Ga0501081_0816730_57_623 188
1332 3300049744 Ga0501083_0025765 Ga0501083_0025765_3379_3957 188
1333 3300049822 Ga0501035_0009935 Ga0501035_0009935_2533_3111 188
1334 3300049822 Ga0501035_0022728 Ga0501035_0022728_288_854 188
1335 3300049822 Ga0501035_0955742 Ga0501035_0955742_14_580 188
1336 3300049822 Ga0501035_1080203 Ga0501035_1080203_46_612 188
1337 3300049823 Ga0501044_0627774 Ga0501044_0627774_208_774 188
1338 3300049824 Ga0501045_0001647 Ga0501045_0001647_6220_6786 188
1339 3300049824 Ga0501045_0001860 Ga0501045_0001860_12090_12656 188
1340 3300049824 Ga0501045_0024794 Ga0501045_0024794_1523_2089 188
1341 3300049824 Ga0501045_0070270 Ga0501045_0070270_432_1010 188
1342 3300049824 Ga0501045_0118294 Ga0501045_0118294_225_791 188
1343 3300050489 nmdc:mga03683_195001_c1 nmdc:mga03683_195001_c1_207_773 188
1344 3300050490 nmdc:mga03n38_79143_c1 nmdc:mga03n38_79143_c1_866_1432 188
1345 3300050491 nmdc:mga00v17_55484_c1 nmdc:mga00v17_55484_c1_700_1266 188
1346 3300050492 nmdc:mga0yw44_11585_c1 nmdc:mga0yw44_11585_c1_1441_2007 188
1347 3300050492 nmdc:mga0yw44_157489_c1 nmdc:mga0yw44_157489_c1_487_1053 188
1348 3300050492 nmdc:mga0yw44_464931_c1 nmdc:mga0yw44_464931_c1_237_806 188
1349 3300050492 nmdc:mga0yw44_547204_c1 nmdc:mga0yw44_547204_c1_203_769 188
1350 3300050492 nmdc:mga0yw44_560035_c1 nmdc:mga0yw44_560035_c1_105_671 188
1351 3300050492 nmdc:mga0yw44_74487_c1 nmdc:mga0yw44_74487_c1_65_631 188
1352 3300050493 nmdc:mga0k408_71830_c1 nmdc:mga0k408_71830_c1_1436_2002 188
1353 3300050494 nmdc:mga06z11_574907_c1 nmdc:mga06z11_574907_c1_27_593 188
1354 3300050496 nmdc:mga07m45_181926_c1 nmdc:mga07m45_181926_c1_365_931 188
1355 3300050507 nmdc:mga05p37_125898_c1 nmdc:mga05p37_125898_c1_946_1512 188
1356 3300050507 nmdc:mga05p37_126646_c1 nmdc:mga05p37_126646_c1_923_1489 188
1357 3300050507 nmdc:mga05p37_1648_c1 nmdc:mga05p37_1648_c1_17464_18030 188
1358 3300050507 nmdc:mga05p37_17988_c1 nmdc:mga05p37_17988_c1_1394_1960 188
1359 3300050507 nmdc:mga05p37_195526_c1 nmdc:mga05p37_195526_c1_858_1436 188
1360 3300050507 nmdc:mga05p37_312763_c1 nmdc:mga05p37_312763_c1_595_1161 188
1361 3300050507 nmdc:mga05p37_40689_c1 nmdc:mga05p37_40689_c1_2311_2877 188
1362 3300050507 nmdc:mga05p37_6927_c1 nmdc:mga05p37_6927_c1_12391_12957 188
1363 3300050508 nmdc:mga09592_16687_c1 nmdc:mga09592_16687_c1_3594_4160 188
1364 3300050508 nmdc:mga09592_211174_c1 nmdc:mga09592_211174_c1_946_1512 188
1365 3300050508 nmdc:mga09592_392309_c1 nmdc:mga09592_392309_c1_27_593 188
1366 3300050508 nmdc:mga09592_422150_c1 nmdc:mga09592_422150_c1_110_676 188
1367 3300050509 nmdc:mga0qj67_18159_c1 nmdc:mga0qj67_18159_c1_4608_5174 188
1368 3300050509 nmdc:mga0qj67_31898_c1 nmdc:mga0qj67_31898_c1_1598_2164 188
1369 3300050509 nmdc:mga0qj67_47530_c1 nmdc:mga0qj67_47530_c1_2224_2790 188
1370 3300050510 nmdc:mga06r32_10877_c1 nmdc:mga06r32_10877_c1_5479_6045 188
1371 3300050510 nmdc:mga06r32_17339_c1 nmdc:mga06r32_17339_c1_5533_6099 188
1372 3300050510 nmdc:mga06r32_440431_c1 nmdc:mga06r32_440431_c1_139_705 188
1373 3300050511 nmdc:mga08y16_1038250_c1 nmdc:mga08y16_1038250_c1_210_776 188
1374 3300050511 nmdc:mga08y16_151177_c1 nmdc:mga08y16_151177_c1_676_1242 188
1375 3300050511 nmdc:mga08y16_251122_c1 nmdc:mga08y16_251122_c1_375_941 188
1376 3300050511 nmdc:mga08y16_27373_c1 nmdc:mga08y16_27373_c1_2945_3511 188
1377 3300050511 nmdc:mga08y16_29922_c1 nmdc:mga08y16_29922_c1_1755_2321 188
1378 3300050511 nmdc:mga08y16_41702_c1 nmdc:mga08y16_41702_c1_679_1245 188
1379 3300050511 nmdc:mga08y16_494882_c1 nmdc:mga08y16_494882_c1_305_871 188
1380 3300050512 nmdc:mga0n895_1526566_c1 nmdc:mga0n895_1526566_c1_10_576 188
1381 3300050512 nmdc:mga0n895_25792_c1 nmdc:mga0n895_25792_c1_2751_3317 188
1382 3300050512 nmdc:mga0n895_278774_c1 nmdc:mga0n895_278774_c1_249_815 188
1383 3300050512 nmdc:mga0n895_3549_c1 nmdc:mga0n895_3549_c1_6612_7178 188
1384 3300050512 nmdc:mga0n895_89680_c1 nmdc:mga0n895_89680_c1_1773_2339 188
1385 3300050513 nmdc:mga0rr50_10115_c1 nmdc:mga0rr50_10115_c1_1246_1812 188
1386 3300050513 nmdc:mga0rr50_12482_c1 nmdc:mga0rr50_12482_c1_170_736 188
1387 3300050513 nmdc:mga0rr50_181792_c1 nmdc:mga0rr50_181792_c1_307_873 188
1388 3300050513 nmdc:mga0rr50_37190_c1 nmdc:mga0rr50_37190_c1_1827_2393 188
1389 3300050513 nmdc:mga0rr50_378369_c1 nmdc:mga0rr50_378369_c1_554_1120 188
1390 3300050514 nmdc:mga08x19_110281_c1 nmdc:mga08x19_110281_c1_1131_1697 188
1391 3300050514 nmdc:mga08x19_292490_c1 nmdc:mga08x19_292490_c1_207_773 188
1392 3300050514 nmdc:mga08x19_29979_c1 nmdc:mga08x19_29979_c1_1744_2310 188
1393 3300050514 nmdc:mga08x19_7780_c1 nmdc:mga08x19_7780_c1_4030_4596 188
1394 3300050515 nmdc:mga0a205_114994_c1 nmdc:mga0a205_114994_c1_434_1000 188
1395 3300050515 nmdc:mga0a205_13742_c1 nmdc:mga0a205_13742_c1_4329_4895 188
1396 3300050515 nmdc:mga0a205_267040_c1 nmdc:mga0a205_267040_c1_436_1002 188
1397 3300050515 nmdc:mga0a205_321556_c1 nmdc:mga0a205_321556_c1_244_810 188
1398 3300050515 nmdc:mga0a205_65345_c1 nmdc:mga0a205_65345_c1_2721_3287 188
1399 3300050515 nmdc:mga0a205_69653_c1 nmdc:mga0a205_69653_c1_2688_3254 188
1400 3300050515 nmdc:mga0a205_983605_c1 nmdc:mga0a205_983605_c1_20_586 188
1401 3300050515 nmdc:mga0a205_99615_c1 nmdc:mga0a205_99615_c1_1536_2102 188
1402 3300053077 Ga0495601_0066263 Ga0495601_0066263_425_991 188
1403 3300053077 Ga0495601_0073297 Ga0495601_0073297_909_1475 188
1404 3300053077 Ga0495601_0220140 Ga0495601_0220140_323_964 188
1405 3300053084 Ga0495595_0038785 Ga0495595_0038785_520_1086 188
1406 3300053084 Ga0495595_0076905 Ga0495595_0076905_282_848 188
1407 3300053085 Ga0495619_0064672 Ga0495619_0064672_1109_1675 188
1408 3300054114 Ga0501084_0034170 Ga0501084_0034170_2141_2707 188
1409 3300054114 Ga0501084_0036044 Ga0501084_0036044_1858_2436 188
1410 3300054114 Ga0501084_0313797 Ga0501084_0313797_556_1122 188
1411 3300054114 Ga0501084_0447593 Ga0501084_0447593_400_966 188
1412 3300054114 Ga0501084_0471877 Ga0501084_0471877_385_951 188
1413 3300060353 Ga0501082_0009118 Ga0501082_0009118_378_944 188
1414 3300060353 Ga0501082_0017984 Ga0501082_0017984_2479_3057 188
1415 3300060353 Ga0501082_0026510 Ga0501082_0026510_3527_4093 188
1416 3300060353 Ga0501082_0105456 Ga0501082_0105456_1227_1793 188
1417 3300060353 Ga0501082_0205930 Ga0501082_0205930_427_993 188
1418 3300060353 Ga0501082_0822213 Ga0501082_0822213_185_751 188
1419 3300061734 Ga0530510_0005142 Ga0530510_0005142_6919_7485 188
1420 3300061734 Ga0530510_0019797 Ga0530510_0019797_2434_3012 188
1421 3300061734 Ga0530510_0054839 Ga0530510_0054839_1610_2176 188
1422 3300061734 Ga0530510_0073493 Ga0530510_0073493_810_1376 188
1423 3300061734 Ga0530510_0150741 Ga0530510_0150741_617_1183 188
1424 3300061734 Ga0530510_0485982 Ga0530510_0485982_70_636 188
1425 3300061734 Ga0530510_0553745 Ga0530510_0553745_131_697 188
1426 3300061734 Ga0530510_0870490 Ga0530510_0870490_67_633 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

157

212

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

96

148

0.98

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

31

88

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.9349 5 61
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.9004 5 65
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.8914 5 61
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.8897 5 188
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.8805 5 188
ID Description Score Start End Superfamily
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9756 132 188 2.40.50.140
1ybyB03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9675 132 188 2.40.50.140
5j3bB01 Mainly Beta;Roll;SH3 type barrels.; 0.9639 5 65 2.30.30.30
af_Q2QYK4_39_108_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9592 2 65 2.30.30.30
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9587 5 65 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A6H9YGU9-F1-model_v4 Elongation factor P (EF-P) 0.9487 5 188 GO:0003746
GO:0005737
GO:0043043
AF-A0A0U4H2Q8-F1-model_v4 deleted 0.9441 5 188
AF-A0A164C2T7-F1-model_v4 Elongation factor P (EF-P) 0.9435 5 188 GO:0003746
GO:0005737
GO:0043043
AF-A0A6J4SYK0-F1-model_v4 Elongation factor P (EF-P) 0.9421 2 188 GO:0003746
GO:0005737
GO:0043043
AF-D7AZN1-F1-model_v4 Elongation factor P (EF-P) 0.9395 5 188 GO:0003746
GO:0005737
GO:0043043

Feature Viewer

pLDDT pTM Quality
90.04 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map