F494052

General Info

Members Datasets Scaffolds Average Seq Length
1449 1022 2898 428

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306091|2551725600
Length 464
Sequence ISTSVLDAENASRRDALTRDYESLGDRLARRGIDIDAVKAKVAAYGVAVPSWGVGTGGTRFARFPGPGEPRNIFDKLEDCAVIQQLTRATPAVSLHIPWDKVSDLGALKEKGSALGLSFDAMNSNTFSDAPGQAHSYKFGSLSHTDSATRRQAIEHNLECVEIGKALGSKALTVWVGDGSNFPGQSNFTRAFERYLDSMKAVYAALPDDWRIFTEHKMFEPAFYSTVVQDWGTNYLIAQELGPKAFCLVDLGHHAPNVNIEMIVARLIQFKKLGGFHFNDSKYGDDDLDTGSIDPYRLFLVFNELVDAETRAANGFDPAHMLDQSHNVTDPIESLMTSAMEVGRAYAQALIVDRKALAGYQEENDALMASETLKTAFRTDVEPILATARLENDGAIAPVAAYRASXFLRTRTVESRGSGAEGIPRSKIQRATKLPSISFRNMVYPLLPIQREGDSWALKAFWYS

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
100 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
101 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
102 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
131 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
134 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
137 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
138 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
139 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
146 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
208 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
209 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
222 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
223 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
227 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
230 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
238 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
249 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
250 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
251 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
262 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
270 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
271 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
272 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
273 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
274 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
285 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
286 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
296 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
297 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
307 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
320 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
323 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
340 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
346 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
347 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
348 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
349 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
360 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
367 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
368 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
369 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
370 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
371 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
372 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
373 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
374 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
375 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
376 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
379 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
380 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
381 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
382 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
383 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
384 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
385 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
388 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
389 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
390 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
391 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
392 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
393 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
394 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
395 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
396 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
399 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
400 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
401 2508501050 Microvirga lupini Lut6 Isolate Nodule
402 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
403 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
404 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
405 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
406 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
407 2509276019 Ensifer aridi TW10 Isolate Nodule
408 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
409 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
410 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
411 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
412 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
413 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
414 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
415 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
416 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
417 2512875024
418 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
419 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
420 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
421 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
422 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
423 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
424 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
425 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
426 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
427 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
428 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
429 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
430 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
431 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
432 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
433 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
434 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
435 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
436 2516143018 Ensifer sp. BR816 Isolate Nodule
437 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
438 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
439 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
440 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
441 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
442 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
443 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
444 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
445 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
446 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
447 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
448 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
449 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
450 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
451 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
452 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
453 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
454 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
455 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
456 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
457 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
458 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
459 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
460 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
461 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
462 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
463 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
464 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
465 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
466 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
467 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
468 2643221557 Ensifer sp. Root558 Isolate Unclassified
469 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
470 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
471 2643221580 Devosia sp. Root635 Isolate Unclassified
472 2643221591 Devosia sp. Root685 Isolate Unclassified
473 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
474 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
475 2643221599 Rhizobium sp. Root708 Isolate Unclassified
476 2643221607 Rhizobium sp. Root73 Isolate Unclassified
477 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
478 2643221610 Ensifer sp. Root74 Isolate Unclassified
479 2643221618 Ensifer sp. Root231 Isolate Unclassified
480 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
481 2643221626 Ensifer sp. Root31 Isolate Unclassified
482 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
483 2643221629 Devosia sp. Root105 Isolate Unclassified
484 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
485 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
486 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
487 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
488 2643221655 Ensifer sp. Root1252 Isolate Unclassified
489 2643221659 Ensifer sp. Root127 Isolate Unclassified
490 2643221662 Devosia sp. Root413D1 Isolate Unclassified
491 2643221668 Ensifer sp. Root423 Isolate Unclassified
492 2643221674 Devosia sp. Root436 Isolate Unclassified
493 2643221675 Ensifer sp. Root1298 Isolate Unclassified
494 2643221680 Ensifer sp. Root1312 Isolate Unclassified
495 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
496 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
497 2643221698 Ensifer sp. Root142 Isolate Unclassified
498 2643221712 Ensifer sp. Root258 Isolate Unclassified
499 2643221723 Ensifer sp. Root278 Isolate Unclassified
500 2643221726 Ensifer sp. Root954 Isolate Unclassified
501 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
502 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
503 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
504 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
505 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
506 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
507 2718217882 Rhizobium sp. N741 Isolate Nodule
508 2718218009 Rhizobium sp. N561 Isolate Nodule
509 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
510 2718218363 Rhizobium sp. N113 Isolate Nodule
511 2718218365 Rhizobium sp. N731 Isolate Nodule
512 2718218366 Rhizobium sp. N621 Isolate Nodule
513 2721755514 Rhizobium sp. N6212 Isolate Nodule
514 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
515 2721755810 Rhizobium sp. N871 Isolate Nodule
516 2728369365 Rhizobium sp. N1341 Isolate Nodule
517 2728369397 Rhizobium sp. N1314 Isolate Nodule
518 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
519 2738543024 Aminobacter sp. AP02 Isolate Unclassified
520 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
521 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
522 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
523 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
524 2773857925 Microvirga vignae BR3299 Isolate Unclassified
525 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
526 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
527 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
528 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
529 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
530 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
531 2791355256 Rhizobium sp. M10 Isolate Nodule
532 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
533 2791355260 Rhizobium sp. L9 Isolate Nodule
534 2791355261 Rhizobium sp. J15 Isolate Nodule
535 2791355262 Rhizobium sp. M1 Isolate Nodule
536 2791355263 Rhizobium chutanense C5 Isolate Nodule
537 2791355264 Rhizobium sp. S9 Isolate Nodule
538 2791355265 Rhizobium sp. H4 Isolate Nodule
539 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
540 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
541 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
542 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
543 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
544 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
545 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
546 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
547 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
548 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
549 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
550 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
551 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
552 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
553 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
554 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
555 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
556 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
557 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
558 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
559 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
560 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
561 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
562 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
563 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
564 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
565 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
566 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
567 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
568 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
569 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
570 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
571 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
572 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
573 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
574 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
575 2844163670 Ensifer sp. 1H6 Isolate Unclassified
576 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
577 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
578 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
579 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
580 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
581 2854911287 Brucella lupini LUP21 Isolate Unclassified
582 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
583 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
584 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
585 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
586 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
587 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
588 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
589 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
590 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
591 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
592 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
593 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
594 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
595 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
596 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
597 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
598 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
599 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
600 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
601 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
602 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
603 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
604 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
605 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
606 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
607 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
608 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
609 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
610 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
611 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
612 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
613 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
614 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
615 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
616 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
617 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
618 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
619 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
620 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
621 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
622 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
623 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
624 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
625 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
626 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
627 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
628 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
629 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
630 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
631 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
632 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
633 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
634 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
635 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
636 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
637 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
638 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
639 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
640 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
641 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
642 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
643 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
644 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
645 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
646 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
647 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
648 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
649 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
650 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
651 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
652 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
653 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
654 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
655 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
656 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
657 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
658 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
659 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
660 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
661 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
662 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
663 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
664 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
665 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
666 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
667 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
668 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
669 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
670 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
671 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
672 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
673 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
674 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
675 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
676 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
677 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
678 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
679 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
680 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
681 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
682 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
683 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
684 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
685 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
686 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
687 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
688 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
689 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
690 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
691 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
692 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
693 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
694 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
695 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
696 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
697 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
698 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
699 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
700 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
701 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
702 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
703 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
704 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
705 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
706 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
707 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
708 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
709 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
710 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
711 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
712 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
713 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
714 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
715 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
716 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
717 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
718 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
719 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
720 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
721 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
722 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
723 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
724 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
725 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
726 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
727 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
728 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
729 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
730 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
731 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
732 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
733 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
734 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
735 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
736 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
737 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
738 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
739 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
740 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
741 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
742 2932401849 Devosia sp. 2618 Isolate Rhizosphere
743 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
744 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
745 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
746 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
747 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
748 2936381700 Rhizobium chutanense C16 Isolate Unclassified
749 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
750 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
751 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
752 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
753 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
754 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
755 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
756 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
757 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
758 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
759 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
760 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
761 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
762 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
763 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
764 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
765 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
766 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
767 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
768 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
769 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
770 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
771 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
772 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
773 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
774 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
775 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
776 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
777 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
778 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
779 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
780 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
781 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
782 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
783 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
784 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
785 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
786 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
787 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
788 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
789 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
790 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
791 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
792 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
793 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
794 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
795 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
796 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
797 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
798 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
799 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
800 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
801 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
802 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
803 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
804 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
805 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
806 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
807 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
808 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
809 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
810 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
811 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
812 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
813 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
814 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
815 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
816 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
817 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
818 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
819 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
820 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
821 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
822 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
823 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
824 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
825 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
826 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
827 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
828 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
829 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
830 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
831 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
832 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
833 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
834 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
835 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
836 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
837 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
838 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
839 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
840 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
841 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
842 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
843 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
844 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
845 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
846 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
847 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
848 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
849 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
850 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
851 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
852 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
853 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
854 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
855 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
856 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
857 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
858 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
859 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
860 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
861 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
862 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
863 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
864 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
865 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
866 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
867 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
868 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
869 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
870 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
871 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
872 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
873 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
874 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
875 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
876 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
877 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
878 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
879 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
880 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
881 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
882 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
883 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
884 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
885 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
886 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
887 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
888 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
889 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
890 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
891 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
892 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
893 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
894 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
895 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
896 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
897 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
898 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
899 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
900 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
901 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
902 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
903 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
904 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
905 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
906 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
907 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
908 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
909 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
910 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
911 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
912 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
913 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
914 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
915 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
916 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
917 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
918 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
919 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
920 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
921 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
922 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
923 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
924 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
925 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
926 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
927 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
928 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
929 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
930 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
931 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
932 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
933 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
934 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
935 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
936 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
937 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
938 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
939 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
940 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
941 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
942 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
943 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
944 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
945 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
946 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
947 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
948 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
949 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
950 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
951 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
952 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
953 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
954 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
955 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
956 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
957 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
958 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
959 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
960 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
961 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
962 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
963 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
964 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
965 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
966 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
967 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
968 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
969 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
970 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
971 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
972 2996893221 Rhizobium sp. R635 Isolate Nodule
973 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
974 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
975 3004167301 Mesorhizobium loti 582 Isolate Unclassified
976 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
977 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
978 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
979 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
980 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
981 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
982 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
983 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
984 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
985 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
986 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
987 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
988 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
989 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
990 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
991 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
992 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
993 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
994 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
995 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
996 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
997 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
998 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
999 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1000 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1001 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1002 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1003 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1004 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1005 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1006 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1007 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1008 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1009 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1010 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1011 8005382845 Rhizobium sp. R634 Isolate Nodule
1012 8005395548 Rhizobium sp. R339 Isolate Nodule
1013 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1014 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1015 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1016 8024501048 Rhizobium sp. H4 Isolate Nodule
1017 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1018 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1019 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1020 8056382006 Rhizobium croatiense 13T Isolate Nodule
1021 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1022 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 56.8
Metatranscriptomes 0
Isolates 43.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.42
Nodule 36.09
Rhizoplane 1.79
Rhizosphere 42.17
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000012 3300002074 Bacteria 152599
2 JGI24034J26672_10000003 3300002239 Bacteria 501747
3 JGI24751J29686_10000931 3300002459 Bacteria 6560
4 JGI25157J39369_1001297 3300002741 Bacteria 10014
5 JGI25152J39213_1002620 3300002773 Bacteria 6697
6 JGI25152J39213_1003646 3300002773 Bacteria 5189
7 JGI25159J45721_1000003 3300002987 Bacteria 274069
8 JGI25151J46595_10011278 3300003187 Bacteria 4116
9 JGI25406J46586_10010437 3300003203 Bacteria 4121
10 JGI25165J46597_1000037 3300003214 Bacteria 285722
11 JGI25165J46597_1001939 3300003214 Bacteria 8155
12 JGI25153J46596_10021365 3300003215 Bacteria 2414
13 JGI25160J50197_1000003 3300003354 Bacteria 482719
14 JGI25161J50226_1001593 3300003374 Bacteria 6618
15 Ga0055542_1000403 3300003762 Bacteria 42485
16 Ga0055526_1002818 3300003771 Bacteria 11506
17 Ga0055526_1012650 3300003771 Bacteria 3657
18 Ga0055524_1000061 3300003775 Bacteria 135241
19 Ga0055524_1000789 3300003775 Bacteria 21114
20 Ga0055524_1006013 3300003775 Bacteria 5328
21 Ga0055536_1002760 3300003781 Bacteria 9721
22 Ga0055530_10002372 3300003791 Bacteria 12207
23 Ga0055540_1000026 3300003792 Bacteria 189071
24 Ga0055531_10027659 3300003794 Bacteria 1982
25 Ga0055543_1000158 3300004625 Bacteria 56811
26 Ga0065165_1000084 3300005262 Bacteria 154822
27 Ga0065165_1003834 3300005262 Bacteria 10014
28 Ga0065704_10101196 3300005289 Bacteria 2246
29 Ga0065712_10077146 3300005290 Bacteria 3542
30 Ga0065715_10002994 3300005293 Bacteria 4324
31 Ga0065707_10004904 3300005295 Bacteria 3272
32 Ga0065707_10114068 3300005295 Bacteria 2300
33 Ga0070690_100003582 3300005330 Bacteria 8531
34 Ga0070690_100009128 3300005330 Bacteria 5738
35 Ga0070670_100000001 3300005331 Bacteria 728788
36 Ga0070670_100000095 3300005331 Bacteria 83302
37 Ga0070670_100011486 3300005331 Bacteria 7577
38 Ga0070670_100058327 3300005331 Bacteria 3314
39 Ga0070670_100128254 3300005331 Bacteria 2189
40 Ga0070670_100232100 3300005331 Bacteria 1606
41 Ga0070677_10052188 3300005333 Bacteria 1658
42 Ga0070677_10066304 3300005333 Bacteria 1505
43 Ga0070666_10008240 3300005335 Bacteria 6461
44 Ga0070666_10008433 3300005335 Bacteria 6400
45 Ga0070666_10022918 3300005335 Bacteria 4061
46 Ga0070680_100036315 3300005336 Bacteria 3981
47 Ga0070680_100124089 3300005336 Bacteria 2157
48 Ga0070680_100129635 3300005336 Bacteria 2109
49 Ga0070680_100260627 3300005336 Bacteria 1467
50 Ga0068868_100025316 3300005338 Bacteria 4512
51 Ga0070660_100007853 3300005339 Bacteria 7440
52 Ga0070689_100017803 3300005340 Bacteria 5223
53 Ga0070689_100027792 3300005340 Bacteria 4268
54 Ga0070687_100103610 3300005343 Bacteria 1598
55 Ga0070668_100077261 3300005347 Bacteria 2602
56 Ga0070668_100077888 3300005347 Bacteria 2592
57 Ga0070669_100003348 3300005353 Bacteria 11524
58 Ga0070669_100005889 3300005353 Bacteria 8845
59 Ga0070675_100017449 3300005354 Bacteria 5703
60 Ga0070675_100019228 3300005354 Bacteria 5441
61 Ga0070675_100032654 3300005354 Bacteria 4214
62 Ga0070671_100000008 3300005355 Bacteria 207831
63 Ga0070671_100036107 3300005355 Bacteria 4098
64 Ga0070674_100034401 3300005356 Bacteria 3384
65 Ga0070673_100011286 3300005364 Bacteria 6092
66 Ga0070688_100014320 3300005365 Bacteria 4490
67 Ga0070688_100050573 3300005365 Bacteria 2590
68 Ga0070667_100000023 3300005367 Bacteria 199687
69 Ga0070667_100000116 3300005367 Bacteria 102137
70 Ga0070667_100043273 3300005367 Bacteria 3779
71 Ga0070667_100084988 3300005367 Bacteria 2713
72 Ga0070667_100247865 3300005367 Bacteria 1592
73 Ga0070710_10001104 3300005437 Bacteria 12775
74 Ga0070701_10074240 3300005438 Bacteria 1826
75 Ga0070705_100031594 3300005440 Bacteria 2933
76 Ga0070705_100040575 3300005440 Bacteria 2648
77 Ga0070708_100052938 3300005445 Bacteria 3600
78 Ga0070678_100031951 3300005456 Bacteria 3637
79 Ga0070678_100036939 3300005456 Bacteria 3424
80 Ga0070678_100115763 3300005456 Bacteria 2105
81 Ga0070681_10000808 3300005458 Bacteria 26152
82 Ga0070681_10025626 3300005458 Bacteria 5932
83 Ga0068867_100041560 3300005459 Bacteria 3360
84 Ga0070685_10000007 3300005466 Bacteria 180539
85 Ga0070685_10068977 3300005466 Bacteria 2090
86 Ga0070706_100009688 3300005467 Bacteria 8953
87 Ga0070706_100015675 3300005467 Bacteria 7001
88 Ga0070706_100216805 3300005467 Bacteria 1786
89 Ga0070707_100002461 3300005468 Bacteria 17647
90 Ga0070707_100006029 3300005468 Bacteria 11312
91 Ga0070707_100060644 3300005468 Bacteria 3628
92 Ga0070698_100001987 3300005471 Bacteria 22694
93 Ga0070698_100004345 3300005471 Bacteria 15581
94 Ga0070699_100002830 3300005518 Bacteria 15479
95 Ga0070699_100039132 3300005518 Bacteria 4106
96 Ga0070699_100195352 3300005518 Bacteria 1798
97 Ga0070699_100202437 3300005518 Bacteria 1766
98 Ga0070684_100076965 3300005535 Bacteria 2946
99 Ga0070697_100006577 3300005536 Bacteria 9007
100 Ga0068853_100002303 3300005539 Bacteria 14278
101 Ga0068853_100025799 3300005539 Bacteria 4933
102 Ga0068853_100238424 3300005539 Bacteria 1666
103 Ga0070672_100012851 3300005543 Bacteria 5897
104 Ga0070672_100230904 3300005543 Bacteria 1554
105 Ga0070672_100271197 3300005543 Bacteria 1433
106 Ga0070686_100095608 3300005544 Bacteria 1996
107 Ga0070686_100168088 3300005544 Bacteria 1549
108 Ga0070695_100004821 3300005545 Bacteria 7939
109 Ga0070696_100020844 3300005546 Bacteria 4442
110 Ga0070665_100007908 3300005548 Bacteria 10785
111 Ga0070665_100017258 3300005548 Bacteria 7244
112 Ga0070665_100107192 3300005548 Bacteria 2796
113 Ga0070665_100238851 3300005548 Bacteria 1818
114 Ga0070704_100044646 3300005549 Bacteria 3081
115 Ga0068855_100013608 3300005563 Bacteria 9810
116 Ga0068855_100035817 3300005563 Bacteria 5910
117 Ga0068855_100095697 3300005563 Bacteria 3422
118 Ga0070664_100022513 3300005564 Bacteria 5197
119 Ga0070664_100033055 3300005564 Bacteria 4329
120 Ga0070664_100037216 3300005564 Bacteria 4090
121 Ga0068857_100034814 3300005577 Bacteria 4456
122 Ga0068854_100020014 3300005578 Bacteria 4518
123 Ga0068854_100037222 3300005578 Bacteria 3414
124 Ga0068856_100030133 3300005614 Bacteria 5304
125 Ga0070702_100002988 3300005615 Bacteria 7473
126 Ga0068852_100002040 3300005616 Bacteria 13758
127 Ga0068852_100069392 3300005616 Bacteria 3089
128 Ga0068859_100000668 3300005617 Bacteria 34291
129 Ga0068859_100006383 3300005617 Bacteria 11961
130 Ga0068859_100017106 3300005617 Bacteria 7281
131 Ga0068859_100017495 3300005617 Bacteria 7205
132 Ga0068859_100051193 3300005617 Bacteria 4150
133 Ga0068859_100063413 3300005617 Bacteria 3726
134 Ga0068859_100074880 3300005617 Bacteria 3425
135 Ga0068859_100238140 3300005617 Bacteria 1909
136 Ga0068864_100000012 3300005618 Bacteria 335070
137 Ga0068864_100005239 3300005618 Bacteria 10628
138 Ga0068864_100014954 3300005618 Bacteria 6450
139 Ga0068864_100028391 3300005618 Bacteria 4728
140 Ga0068864_100081545 3300005618 Bacteria 2836
141 Ga0068861_100007061 3300005719 Bacteria 7679
142 Ga0068861_100025828 3300005719 Bacteria 4265
143 Ga0068861_100164950 3300005719 Bacteria 1831
144 Ga0068851_10031070 3300005834 Bacteria 2651
145 Ga0068870_10002937 3300005840 Bacteria 7181
146 Ga0068863_100008263 3300005841 Bacteria 10167
147 Ga0068863_100037293 3300005841 Bacteria 4628
148 Ga0068863_100041004 3300005841 Bacteria 4401
149 Ga0068863_100089215 3300005841 Bacteria 2923
150 Ga0068863_100252924 3300005841 Bacteria 1702
151 Ga0068858_100000277 3300005842 Bacteria 55193
152 Ga0068858_100020349 3300005842 Bacteria 6206
153 Ga0068858_100026415 3300005842 Bacteria 5395
154 Ga0068858_100041035 3300005842 Bacteria 4292
155 Ga0068858_100049389 3300005842 Bacteria 3897
156 Ga0068858_100183098 3300005842 Bacteria 1978
157 Ga0068858_100185801 3300005842 Bacteria 1963
158 Ga0068858_100262419 3300005842 Bacteria 1642
159 Ga0068858_100325902 3300005842 Bacteria 1469
160 Ga0068860_100000179 3300005843 Bacteria 102844
161 Ga0068860_100000928 3300005843 Bacteria 32413
162 Ga0068860_100001934 3300005843 Bacteria 21903
163 Ga0068860_100004331 3300005843 Bacteria 14508
164 Ga0068860_100032404 3300005843 Bacteria 5021
165 Ga0068860_100064120 3300005843 Bacteria 3490
166 Ga0068860_100090703 3300005843 Bacteria 2911
167 Ga0068862_100000023 3300005844 Bacteria 203389
168 Ga0068862_100020342 3300005844 Bacteria 5544
169 Ga0068862_100024291 3300005844 Bacteria 5084
170 Ga0068862_100076106 3300005844 Bacteria 2904
171 Ga0068862_100115327 3300005844 Bacteria 2362
172 Ga0068862_100125365 3300005844 Bacteria 2267
173 Ga0081455_10003635 3300005937 Bacteria 17668
174 Ga0081538_10009289 3300005981 Bacteria 8228
175 Ga0081540_1008024 3300005983 Bacteria 7427
176 Ga0081540_1042137 3300005983 Bacteria 2358
177 Ga0081539_10005442 3300005985 Bacteria 12996
178 Ga0075365_10055948 3300006038 Bacteria 2621
179 Ga0075365_10087006 3300006038 Bacteria 2124
180 Ga0075368_10059850 3300006042 Bacteria 1524
181 Ga0075363_100073249 3300006048 Bacteria 1864
182 Ga0075364_10029947 3300006051 Bacteria 3492
183 Ga0075367_10048240 3300006178 Bacteria 2508
184 Ga0075367_10101414 3300006178 Bacteria 1760
185 Ga0075366_10053164 3300006195 Bacteria 2406
186 Ga0075366_10062662 3300006195 Bacteria 2210
187 Ga0075366_10078689 3300006195 Bacteria 1968
188 Ga0075366_10111357 3300006195 Bacteria 1646
189 Ga0097621_100008990 3300006237 Bacteria 7228
190 Ga0097621_100026654 3300006237 Bacteria 4537
191 Ga0097621_100044981 3300006237 Bacteria 3564
192 Ga0097621_100154976 3300006237 Bacteria 1966
193 Ga0075370_10026675 3300006353 Bacteria 3201
194 Ga0068871_100025223 3300006358 Bacteria 4622
195 Ga0068871_100040634 3300006358 Bacteria 3726
196 Ga0068871_100048649 3300006358 Bacteria 3424
197 Ga0068871_100121143 3300006358 Bacteria 2209
198 Ga0075428_100000060 3300006844 Bacteria 88550
199 Ga0075433_10085443 3300006852 Bacteria 2785
200 Ga0075433_10206822 3300006852 Bacteria 1745
201 Ga0075434_100129087 3300006871 Bacteria 2546
202 Ga0075434_100325279 3300006871 Bacteria 1558
203 Ga0068865_100055560 3300006881 Unclassified 2755
204 Ga0075436_100000008 3300006914 Bacteria 279288
205 Ga0097620_100000668 3300006931 Bacteria 34291
206 Ga0097620_100006383 3300006931 Bacteria 11961
207 Ga0097620_100017106 3300006931 Bacteria 7281
208 Ga0097620_100017496 3300006931 Bacteria 7205
209 Ga0097620_100051192 3300006931 Bacteria 4150
210 Ga0097620_100063413 3300006931 Bacteria 3726
211 Ga0097620_100074883 3300006931 Bacteria 3425
212 Ga0097620_100238152 3300006931 Bacteria 1909
213 Ga0099825_1022929 3300006941 Bacteria 3921
214 Ga0099824_1025812 3300006942 Bacteria 3145
215 Ga0099822_1007677 3300006943 Bacteria 13908
216 Ga0079104_1000093 3300006946 Bacteria 130633
217 Ga0079104_1002731 3300006946 Bacteria 9004
218 Ga0079104_1005856 3300006946 Bacteria 4797
219 Ga0099794_10000291 3300007265 Bacteria 17263
220 Ga0105240_10010945 3300009093 Bacteria 12709
221 Ga0105240_10136790 3300009093 Bacteria 2934
222 Ga0111539_10000002 3300009094 Bacteria 983359
223 Ga0111539_10000050 3300009094 Bacteria 118845
224 Ga0111539_10004626 3300009094 Bacteria 17967
225 Ga0111539_10102811 3300009094 Bacteria 3353
226 Ga0111539_10109105 3300009094 Unclassified 3248
227 Ga0111539_10155248 3300009094 Bacteria 2678
228 Ga0105245_10012954 3300009098 Bacteria 7270
229 Ga0105247_10000003 3300009101 Bacteria 694517
230 Ga0105247_10007589 3300009101 Bacteria 6645
231 Ga0105247_10015183 3300009101 Bacteria 4617
232 Ga0105247_10025927 3300009101 Bacteria 3538
233 Ga0114129_10038907 3300009147 Bacteria 6704
234 Ga0114129_10049278 3300009147 Bacteria 5918
235 Ga0114129_10062012 3300009147 Bacteria 5224
236 Ga0114129_10092285 3300009147 Bacteria 4195
237 Ga0114129_10099497 3300009147 Bacteria 4025
238 Ga0114129_10270891 3300009147 Bacteria 2271
239 Ga0114129_10282551 3300009147 Bacteria 2217
240 Ga0105243_10101570 3300009148 Bacteria 2388
241 Ga0105241_10064936 3300009174 Bacteria 2819
242 Ga0105241_10086598 3300009174 Bacteria 2464
243 Ga0105241_10108804 3300009174 Bacteria 2216
244 Ga0105241_10280166 3300009174 Bacteria 1423
245 Ga0105242_10009081 3300009176 Bacteria 7635
246 Ga0105242_10014725 3300009176 Bacteria 6057
247 Ga0105242_10037035 3300009176 Bacteria 3917
248 Ga0105248_10045650 3300009177 Bacteria 4913
249 Ga0105248_10300329 3300009177 Bacteria 1808
250 Ga0105237_10000659 3300009545 Bacteria 47952
251 Ga0105237_10003125 3300009545 Bacteria 19928
252 Ga0105237_10007526 3300009545 Bacteria 11906
253 Ga0105237_10063666 3300009545 Bacteria 3686
254 Ga0105237_10071599 3300009545 Bacteria 3461
255 Ga0105237_10085691 3300009545 Unclassified 3140
256 Ga0105237_10161736 3300009545 Bacteria 2237
257 Ga0105237_10205210 3300009545 Bacteria 1971
258 Ga0105238_10013092 3300009551 Bacteria 8369
259 Ga0105238_10015087 3300009551 Bacteria 7824
260 Ga0105249_10000004 3300009553 Bacteria 368014
261 Ga0105249_10011832 3300009553 Bacteria 7670
262 Ga0105249_10017322 3300009553 Bacteria 6397
263 Ga0105249_10094769 3300009553 Bacteria 2798
264 Ga0105249_10140229 3300009553 Bacteria 2317
265 Ga0105249_10189362 3300009553 Bacteria 2007
266 Ga0105239_10041756 3300010375 Bacteria 5026
267 Ga0105239_10043547 3300010375 Bacteria 4921
268 Ga0105239_10048669 3300010375 Bacteria 4648
269 Ga0105239_10090435 3300010375 Bacteria 3377
270 Ga0105239_10115790 3300010375 Bacteria 2974
271 Ga0105239_10119301 3300010375 Bacteria 2928
272 Ga0105239_10248527 3300010375 Bacteria 1998
273 Ga0105246_10000071 3300011119 Bacteria 42029
274 Ga0157373_10002597 3300013100 Bacteria 13723
275 Ga0157373_10010988 3300013100 Bacteria 6666
276 Ga0157373_10055873 3300013100 Bacteria 2804
277 Ga0157369_10085402 3300013105 Bacteria 3373
278 Ga0157369_10107931 3300013105 Bacteria 2961
279 Ga0171463_1001 3300013249 Bacteria 1406070
280 Ga0157374_10031258 3300013296 Bacteria 4838
281 Ga0157374_10103653 3300013296 Bacteria 2730
282 Ga0157378_10023318 3300013297 Bacteria 5447
283 Ga0163162_10009664 3300013306 Bacteria 9381
284 Ga0163162_10135162 3300013306 Bacteria 2576
285 Ga0157372_10308227 3300013307 Bacteria 1842
286 Ga0157375_10006167 3300013308 Bacteria 10446
287 Ga0157375_10081203 3300013308 Bacteria 3282
288 Ga0157375_10084021 3300013308 Bacteria 3231
289 Ga0157375_10296498 3300013308 Bacteria 1780
290 Ga0163163_10000026 3300014325 Bacteria 179198
291 Ga0163163_10000436 3300014325 Bacteria 38165
292 Ga0163163_10015631 3300014325 Bacteria 7023
293 Ga0163163_10018136 3300014325 Bacteria 6579
294 Ga0163163_10020521 3300014325 Bacteria 6224
295 Ga0163163_10033994 3300014325 Bacteria 4935
296 Ga0163163_10063306 3300014325 Bacteria 3667
297 Ga0163163_10087176 3300014325 Bacteria 3132
298 Ga0163163_10173783 3300014325 Bacteria 2201
299 Ga0163163_10204098 3300014325 Bacteria 2025
300 Ga0157380_10000514 3300014326 Bacteria 23717
301 Ga0157380_10006982 3300014326 Bacteria 7992
302 Ga0157380_10008405 3300014326 Bacteria 7366
303 Ga0157380_10010159 3300014326 Bacteria 6765
304 Ga0157380_10013232 3300014326 Bacteria 6009
305 Ga0157380_10024587 3300014326 Bacteria 4560
306 Ga0157380_10028179 3300014326 Bacteria 4279
307 Ga0157380_10101542 3300014326 Bacteria 2397
308 Ga0157380_10162018 3300014326 Bacteria 1945
309 Ga0182008_10015167 3300014497 Bacteria 4026
310 Ga0157379_10031766 3300014968 Bacteria 4704
311 Ga0157379_10043503 3300014968 Bacteria 4010
312 Ga0183365_10137 3300015684 Bacteria 1916
313 Ga0183363_1032 3300015690 Bacteria 48614
314 Ga0163161_10044606 3300017792 Bacteria 3194
315 Ga0214542_1000011 3300021321 Bacteria 238260
316 Ga0214542_1008060 3300021321 Bacteria 17792
317 Ga0214543_1000004 3300021327 Bacteria 527190
318 Ga0214543_1000259 3300021327 Bacteria 81880
319 Ga0213876_10002813 3300021384 Bacteria 10124
320 Ga0213871_10004950 3300021441 Bacteria 2712
321 Ga0228711_1000019 3300022739 Bacteria 111795
322 Ga0228710_1000022 3300022740 Bacteria 111795
323 Ga0207672_1000445 3300025223 Bacteria 5261
324 Ga0209563_103701 3300025230 Bacteria 3098
325 Ga0207425_1000736 3300025245 Bacteria 17202
326 Ga0209026_1000013 3300025250 Bacteria 415633
327 Ga0209677_100643 3300025253 Bacteria 18518
328 Ga0209677_103007 3300025253 Bacteria 5832
329 Ga0209148_1000266 3300025254 Bacteria 82141
330 Ga0209148_1000474 3300025254 Bacteria 42596
331 Ga0209148_1009957 3300025254 Bacteria 1824
332 Ga0209148_1011910 3300025254 Bacteria 1604
333 Ga0209759_1000149 3300025256 Bacteria 120932
334 Ga0209129_1000113 3300025258 Bacteria 145178
335 Ga0209129_1002521 3300025258 Bacteria 8925
336 Ga0209233_1000102 3300025261 Bacteria 285774
337 Ga0209233_1000201 3300025261 Bacteria 123566
338 Ga0209233_1003536 3300025261 Bacteria 5494
339 Ga0209233_1003653 3300025261 Bacteria 5385
340 Ga0209455_1000234 3300025272 Bacteria 70076
341 Ga0209455_1001414 3300025272 Bacteria 10881
342 Ga0209455_1004746 3300025272 Bacteria 4360
343 Ga0209673_1003797 3300025273 Bacteria 8576
344 Ga0209130_1000005 3300025284 Bacteria 599620
345 Ga0209676_1000097 3300025292 Bacteria 237203
346 Ga0209676_1008514 3300025292 Bacteria 4563
347 Ga0209025_1000044 3300025294 Bacteria 349480
348 Ga0209025_1000295 3300025294 Bacteria 111489
349 Ga0209564_1000093 3300025295 Bacteria 245793
350 Ga0209564_1000186 3300025295 Bacteria 147120
351 Ga0209758_1000172 3300025297 Bacteria 147763
352 Ga0209758_1003660 3300025297 Bacteria 13697
353 Ga0209758_1015042 3300025297 Bacteria 4044
354 Ga0209050_1000228 3300025298 Bacteria 123537
355 Ga0209050_1000489 3300025298 Bacteria 68506
356 Ga0209050_1004684 3300025298 Bacteria 9085
357 Ga0209256_1000027 3300025299 Bacteria 423283
358 Ga0209256_1000030 3300025299 Bacteria 414828
359 Ga0209256_1002044 3300025299 Bacteria 17914
360 Ga0207426_1000015 3300025302 Bacteria 599316
361 Ga0209051_1000004 3300025303 Bacteria 1155596
362 Ga0209051_1025463 3300025303 Bacteria 2406
363 Ga0209257_1000423 3300025304 Bacteria 81354
364 Ga0209257_1010078 3300025304 Bacteria 4884
365 Ga0207682_10008562 3300025893 Bacteria 4044
366 Ga0207682_10054532 3300025893 Bacteria 1661
367 Ga0207682_10059892 3300025893 Bacteria 1592
368 Ga0207692_10054139 3300025898 Bacteria 2047
369 Ga0207710_10000001 3300025900 Bacteria 1797433
370 Ga0207710_10010227 3300025900 Bacteria 3945
371 Ga0207710_10015559 3300025900 Bacteria 3217
372 Ga0207710_10027279 3300025900 Bacteria 2472
373 Ga0207688_10054327 3300025901 Bacteria 2247
374 Ga0207699_10074917 3300025906 Bacteria 2080
375 Ga0207645_10066238 3300025907 Bacteria 2309
376 Ga0207645_10131458 3300025907 Bacteria 1629
377 Ga0207643_10004683 3300025908 Bacteria 7339
378 Ga0207643_10039937 3300025908 Bacteria 2640
379 Ga0207705_10148970 3300025909 Bacteria 1752
380 Ga0207684_10045941 3300025910 Bacteria 3705
381 Ga0207684_10094752 3300025910 Bacteria 2546
382 Ga0207654_10046135 3300025911 Bacteria 2484
383 Ga0207654_10073132 3300025911 Bacteria 2042
384 Ga0207707_10006417 3300025912 Bacteria 10271
385 Ga0207707_10023883 3300025912 Bacteria 5346
386 Ga0207695_10000008 3300025913 Bacteria 1058268
387 Ga0207695_10113346 3300025913 Bacteria 2688
388 Ga0207671_10001797 3300025914 Bacteria 23996
389 Ga0207671_10062949 3300025914 Bacteria 2756
390 Ga0207671_10070889 3300025914 Bacteria 2599
391 Ga0207671_10108418 3300025914 Bacteria 2111
392 Ga0207693_10041585 3300025915 Bacteria 3619
393 Ga0207663_10069960 3300025916 Bacteria 2260
394 Ga0207660_10096169 3300025917 Bacteria 2205
395 Ga0207662_10003226 3300025918 Bacteria 8351
396 Ga0207646_10000897 3300025922 Bacteria 38370
397 Ga0207681_10001769 3300025923 Bacteria 13881
398 Ga0207681_10002874 3300025923 Bacteria 10883
399 Ga0207694_10003165 3300025924 Bacteria 13139
400 Ga0207694_10168470 3300025924 Bacteria 1772
401 Ga0207650_10000002 3300025925 Bacteria 1439222
402 Ga0207650_10000006 3300025925 Bacteria 544730
403 Ga0207650_10093386 3300025925 Bacteria 2303
404 Ga0207659_10185954 3300025926 Bacteria 1650
405 Ga0207664_10028123 3300025929 Bacteria 4270
406 Ga0207644_10000019 3300025931 Bacteria 170919
407 Ga0207644_10005864 3300025931 Bacteria 8006
408 Ga0207644_10044518 3300025931 Bacteria 3153
409 Ga0207706_10001920 3300025933 Bacteria 20417
410 Ga0207706_10087741 3300025933 Bacteria 2736
411 Ga0207706_10147100 3300025933 Bacteria 2072
412 Ga0207686_10015421 3300025934 Bacteria 4272
413 Ga0207670_10004621 3300025936 Bacteria 7452
414 Ga0207704_10023768 3300025938 Bacteria 3310
415 Ga0207704_10049131 3300025938 Bacteria 2535
416 Ga0207691_10026129 3300025940 Bacteria 5479
417 Ga0207691_10050920 3300025940 Bacteria 3789
418 Ga0207691_10083656 3300025940 Bacteria 2865
419 Ga0207691_10091002 3300025940 Bacteria 2734
420 Ga0207691_10102332 3300025940 Bacteria 2555
421 Ga0207691_10145852 3300025940 Bacteria 2083
422 Ga0207711_10003845 3300025941 Bacteria 12915
423 Ga0207711_10005157 3300025941 Bacteria 11069
424 Ga0207711_10203326 3300025941 Bacteria 1808
425 Ga0207689_10037772 3300025942 Bacteria 4003
426 Ga0207689_10139500 3300025942 Bacteria 1997
427 Ga0207679_10058560 3300025945 Bacteria 2855
428 Ga0207667_10009181 3300025949 Bacteria 11680
429 Ga0207667_10063348 3300025949 Bacteria 3863
430 Ga0207667_10417946 3300025949 Bacteria 1364
431 Ga0207651_10018310 3300025960 Bacteria 4164
432 Ga0207651_10131574 3300025960 Bacteria 1916
433 Ga0207712_10000008 3300025961 Bacteria 527957
434 Ga0207712_10013011 3300025961 Bacteria 5329
435 Ga0207712_10018934 3300025961 Bacteria 4491
436 Ga0207640_10140741 3300025981 Bacteria 1758
437 Ga0207658_10000001 3300025986 Bacteria 1439333
438 Ga0207658_10000566 3300025986 Bacteria 33572
439 Ga0207658_10020522 3300025986 Bacteria 4575
440 Ga0207658_10293016 3300025986 Bacteria 1399
441 Ga0207703_10000080 3300026035 Bacteria 111786
442 Ga0207703_10049252 3300026035 Bacteria 3405
443 Ga0207703_10096342 3300026035 Bacteria 2498
444 Ga0207703_10139946 3300026035 Bacteria 2099
445 Ga0207703_10168821 3300026035 Bacteria 1923
446 Ga0207639_10002007 3300026041 Bacteria 13718
447 Ga0207639_10025773 3300026041 Bacteria 4265
448 Ga0207639_10111072 3300026041 Bacteria 2234
449 Ga0207708_10027499 3300026075 Bacteria 4306
450 Ga0207708_10063572 3300026075 Bacteria 2820
451 Ga0207708_10083355 3300026075 Bacteria 2458
452 Ga0207641_10010982 3300026088 Bacteria 7423
453 Ga0207641_10034514 3300026088 Bacteria 4209
454 Ga0207641_10062192 3300026088 Bacteria 3185
455 Ga0207641_10070522 3300026088 Bacteria 3003
456 Ga0207641_10072330 3300026088 Bacteria 2969
457 Ga0207641_10290615 3300026088 Bacteria 1540
458 Ga0207648_10010770 3300026089 Bacteria 8640
459 Ga0207648_10089361 3300026089 Bacteria 2691
460 Ga0207648_10273239 3300026089 Bacteria 1510
461 Ga0207676_10000001 3300026095 Bacteria 1439222
462 Ga0207676_10011127 3300026095 Bacteria 6423
463 Ga0207676_10020600 3300026095 Bacteria 4827
464 Ga0207674_10033670 3300026116 Bacteria 5363
465 Ga0207675_100001206 3300026118 Bacteria 25753
466 Ga0207675_100002146 3300026118 Bacteria 19587
467 Ga0207675_100006135 3300026118 Bacteria 11424
468 Ga0207675_100031090 3300026118 Bacteria 4971
469 Ga0207675_100038809 3300026118 Bacteria 4444
470 Ga0207675_100104968 3300026118 Bacteria 2663
471 Ga0207675_100180377 3300026118 Bacteria 2022
472 Ga0207683_10016248 3300026121 Bacteria 6333
473 Ga0207683_10019417 3300026121 Bacteria 5804
474 Ga0207683_10082422 3300026121 Bacteria 2857
475 Ga0207698_10130633 3300026142 Bacteria 2145
476 Ga0209281_1000084 3300027111 Bacteria 254215
477 Ga0209281_1000200 3300027111 Bacteria 135685
478 Ga0209281_1000227 3300027111 Bacteria 119329
479 Ga0209589_1000042 3300027357 Bacteria 122436
480 Ga0209489_100095 3300027361 Bacteria 122436
481 Ga0209700_100095 3300027363 Bacteria 122436
482 Ga0209282_1000042 3300027666 Bacteria 119329
483 Ga0209588_1002309 3300027671 Bacteria 5162
484 Ga0209974_10015904 3300027876 Bacteria 2498
485 Ga0207428_10000026 3300027907 Bacteria 255539
486 Ga0207428_10000937 3300027907 Bacteria 32446
487 Ga0268266_10001081 3300028379 Bacteria 34140
488 Ga0268266_10009418 3300028379 Bacteria 8602
489 Ga0268266_10026439 3300028379 Bacteria 4938
490 Ga0268266_10044635 3300028379 Bacteria 3789
491 Ga0268266_10068908 3300028379 Bacteria 3064
492 Ga0268266_10171582 3300028379 Bacteria 1969
493 Ga0268265_10000035 3300028380 Bacteria 207267
494 Ga0268265_10000436 3300028380 Bacteria 44235
495 Ga0268265_10045156 3300028380 Bacteria 3286
496 Ga0268264_10000061 3300028381 Bacteria 303123
497 Ga0268264_10000153 3300028381 Bacteria 157298
498 Ga0268264_10002586 3300028381 Bacteria 15829
499 Ga0268264_10003066 3300028381 Bacteria 14474
500 Ga0268264_10020209 3300028381 Bacteria 5443
501 Ga0268264_10056606 3300028381 Bacteria 3278
502 Ga0307517_10000115 3300028786 Bacteria 118327
503 Ga0307517_10040568 3300028786 Bacteria 5063
504 Ga0307517_10065943 3300028786 Bacteria 3340
505 Ga0307515_10000123 3300028794 Bacteria 186601
506 Ga0307515_10001309 3300028794 Bacteria 56564
507 Ga0307515_10006687 3300028794 Bacteria 22962
508 Ga0307515_10006795 3300028794 Bacteria 22758
509 Ga0307515_10010448 3300028794 Bacteria 17785
510 Ga0307515_10042388 3300028794 Bacteria 7121
511 Ga0307515_10076789 3300028794 Bacteria 4423
512 Ga0307515_10186638 3300028794 Bacteria 2000
513 Ga0265338_10023127 3300028800 Bacteria 6400
514 Ga0307511_10000541 3300030521 Bacteria 40505
515 Ga0307511_10062089 3300030521 Bacteria 2840
516 Ga0307512_10034667 3300030522 Bacteria 4314
517 Ga0316181_1183610 3300030744 Bacteria 5049
518 Ga0265325_10048230 3300031241 Bacteria 2202
519 Ga0265316_10013079 3300031344 Bacteria 7402
520 Ga0307513_10002506 3300031456 Bacteria 25411
521 Ga0307513_10012786 3300031456 Bacteria 10337
522 Ga0307513_10015322 3300031456 Bacteria 9298
523 Ga0307513_10095926 3300031456 Bacteria 3005
524 Ga0307513_10124414 3300031456 Bacteria 2538
525 Ga0307509_10000333 3300031507 Bacteria 77879
526 Ga0307509_10000539 3300031507 Bacteria 64754
527 Ga0307509_10022078 3300031507 Bacteria 7185
528 Ga0307509_10033967 3300031507 Bacteria 5608
529 Ga0307509_10036877 3300031507 Bacteria 5348
530 Ga0307509_10086071 3300031507 Bacteria 3232
531 Ga0307509_10200130 3300031507 Bacteria 1835
532 Ga0307408_100022215 3300031548 Bacteria 4308
533 Ga0307408_100074110 3300031548 Bacteria 2525
534 Ga0307508_10000640 3300031616 Bacteria 42119
535 Ga0307508_10000727 3300031616 Bacteria 39082
536 Ga0307508_10006268 3300031616 Bacteria 11201
537 Ga0307508_10008420 3300031616 Bacteria 9526
538 Ga0307508_10079883 3300031616 Bacteria 2852
539 Ga0307514_10001271 3300031649 Bacteria 32966
540 Ga0307514_10019042 3300031649 Bacteria 5621
541 Ga0265314_10058516 3300031711 Bacteria 2640
542 Ga0265342_10076793 3300031712 Bacteria 1936
543 Ga0316576_10003425 3300031727 Bacteria 9283
544 Ga0316578_10111996 3300031728 Bacteria 1639
545 Ga0307516_10017736 3300031730 Bacteria 7417
546 Ga0307516_10033117 3300031730 Bacteria 5201
547 Ga0307516_10156730 3300031730 Bacteria 2031
548 Ga0307516_10162414 3300031730 Bacteria 1983
549 Ga0307405_10010158 3300031731 Bacteria 4861
550 Ga0307413_10030431 3300031824 Bacteria 3033
551 Ga0307413_10117523 3300031824 Bacteria 1794
552 Ga0307413_10144382 3300031824 Bacteria 1649
553 Ga0307410_10041291 3300031852 Bacteria 3041
554 Ga0307410_10057438 3300031852 Bacteria 2650
555 Ga0307406_10010677 3300031901 Bacteria 5186
556 Ga0307407_10025776 3300031903 Bacteria 3104
557 Ga0307412_10010376 3300031911 Bacteria 5362
558 Ga0307412_10099922 3300031911 Bacteria 2050
559 Ga0307412_10106108 3300031911 Bacteria 1997
560 Ga0307412_10127381 3300031911 Bacteria 1844
561 Ga0315914_1000009 3300031967 Bacteria 182444
562 Ga0307409_100000814 3300031995 Bacteria 14314
563 Ga0307409_100039573 3300031995 Bacteria 3500
564 Ga0307409_100154027 3300031995 Bacteria 2000
565 Ga0307416_100021865 3300032002 Bacteria 4604
566 Ga0307414_10013742 3300032004 Bacteria 4828
567 Ga0307414_10084921 3300032004 Bacteria 2330
568 Ga0307411_10001811 3300032005 Bacteria 9059
569 Ga0307411_10003000 3300032005 Bacteria 7689
570 Ga0307411_10046706 3300032005 Bacteria 2794
571 Ga0307411_10157309 3300032005 Bacteria 1697
572 Ga0307415_100203445 3300032126 Bacteria 1573
573 Ga0307510_10000023 3300033180 Bacteria 155640
574 Ga0307510_10007145 3300033180 Bacteria 13293
575 Ga0307510_10056415 3300033180 Bacteria 4091
576 Ga0307510_10065641 3300033180 Bacteria 3673
577 Ga0307510_10071237 3300033180 Bacteria 3464
578 Ga0307510_10104077 3300033180 Bacteria 2613
579 Ga0315913_1000015 3300033430 Bacteria 119325
580 Ga0315915_1000013 3300033464 Bacteria 182438
581 Ga0316574_0063443 3300035398 Bacteria 2324
582 Ga0373931_0037306 3300035691 Bacteria 2537
583 Ga0373927_0000141 3300035695 Bacteria 55933
584 Ga0373937_0253682 3300036401 Bacteria 1658
585 Ga0316582_0006931 3300036647 Bacteria 5995
586 Ga0316582_0178748 3300036647 Bacteria 1443
587 Ga0373925_0002260 3300037068 Bacteria 15592
588 Ga0373925_0037538 3300037068 Bacteria 3577
589 Ga0373925_0289752 3300037068 Bacteria 1320
590 Ga0395905_0000091 3300037471 Bacteria 151747
591 Ga0395905_0001489 3300037471 Bacteria 28024
592 Ga0395905_0023190 3300037471 Bacteria 5866
593 Ga0395905_0140917 3300037471 Bacteria 2268
594 Ga0395901_0004559 3300038443 Bacteria 13986
595 Ga0400483_150886 3300039062 Bacteria 6031
596 Ga0436365_0492506 3300039437 Bacteria 6832
597 Ga0436360_1140827 3300039438 Bacteria 4316
598 Ga0436361_0276468 3300039447 Bacteria 5303
599 Ga0439465_0029187 3300041413 Bacteria 1752
600 Ga0451791_1040051 3300041451 Bacteria 5797
601 Ga0451807_0254012 3300041486 Bacteria 3634
602 Ga0439433_0011253 3300041999 Bacteria 1958
603 Ga0439449_0009998 3300042007 Bacteria 3590
604 Ga0439462_0006603 3300042015 Bacteria 2887
605 Ga0450919_000188 3300042121 Bacteria 6676
606 Ga0450896_005054 3300042133 Bacteria 1796
607 Ga0439459_0015402 3300042438 Bacteria 1401
608 Ga0451577_0003794 3300042876 Bacteria 16448
609 Ga0466969_0000198 3300044656 Bacteria 32667
610 Ga0453683_0021967 3300044673 Bacteria 4072
611 Ga0466966_0004454 3300044684 Bacteria 9237
612 Ga0466966_0012023 3300044684 Bacteria 5737
613 Ga0466961_0008979 3300044693 Bacteria 6378
614 Ga0466961_0035887 3300044693 Bacteria 3182
615 Ga0466963_0004084 3300044694 Bacteria 8445
616 Ga0453684_0126776 3300044712 Bacteria 3070
617 Ga0466971_0007674 3300044719 Bacteria 4705
618 Ga0466970_0012562 3300044765 Bacteria 4333
619 Ga0466957_0050523 3300044842 Bacteria 2530
620 Ga0466959_0016963 3300045049 Bacteria 5331
621 Ga0451576_0004545 3300045051 Bacteria 17969
622 Ga0451576_0328538 3300045051 Bacteria 1601
623 Ga0466958_0014422 3300045836 Bacteria 4512
624 Ga0466967_0014366 3300045976 Bacteria 6165
625 Ga0495617_000377 3300046452 Bacteria 24634
626 Ga0495638_0002960 3300046460 Bacteria 13557
627 Ga0495638_0003111 3300046460 Bacteria 13152
628 Ga0495638_0032266 3300046460 Bacteria 3359
629 Ga0495638_0033066 3300046460 Bacteria 3309
630 Ga0495638_0042772 3300046460 Bacteria 2861
631 Ga0495653_0000009 3300046463 Bacteria 304207
632 Ga0495650_0000184 3300046471 Bacteria 136939
633 Ga0495650_0000240 3300046471 Bacteria 109029
634 Ga0495584_0001561 3300046491 Bacteria 13600
635 Ga0495606_0001061 3300046507 Bacteria 39727
636 Ga0495606_0004320 3300046507 Bacteria 14293
637 Ga0495610_0009062 3300046512 Bacteria 6344
638 Ga0495610_0024493 3300046512 Bacteria 3255
639 Ga0495616_0005415 3300046513 Bacteria 7863
640 Ga0495632_0003595 3300046519 Bacteria 10912
641 Ga0495632_0015652 3300046519 Bacteria 4241
642 Ga0495644_0000287 3300046523 Bacteria 23293
643 Ga0495654_0062965 3300046530 Bacteria 1777
644 Ga0495609_0000866 3300046538 Bacteria 22239
645 Ga0495609_0083056 3300046538 Bacteria 1399
646 Ga0495645_0034890 3300046543 Bacteria 3668
647 Ga0495656_0002526 3300046615 Bacteria 6092
648 Ga0495656_0022562 3300046615 Bacteria 2467
649 Ga0495668_0000002 3300046616 Bacteria 763179
650 Ga0495668_0002028 3300046616 Bacteria 17669
651 Ga0495668_0008340 3300046616 Bacteria 6487
652 Ga0495668_0044664 3300046616 Bacteria 2463
653 Ga0495611_0000347 3300046648 Bacteria 30158
654 Ga0495625_0000990 3300046660 Bacteria 37644
655 Ga0495625_0007420 3300046660 Bacteria 9548
656 Ga0495625_0025679 3300046660 Bacteria 4465
657 Ga0495625_0037357 3300046660 Bacteria 3564
658 Ga0495625_0091715 3300046660 Bacteria 2100
659 Ga0495658_0154754 3300046683 Bacteria 1410
660 Ga0495671_0000926 3300046692 Bacteria 20774
661 Ga0495649_0022211 3300046694 Bacteria 3550
662 Ga0495677_0000287 3300047445 Bacteria 22154
663 Ga0495681_0034048 3300047470 Bacteria 2542
664 Ga0495686_0040467 3300047472 Bacteria 2972
665 Ga0495686_0040964 3300047472 Bacteria 2951
666 Ga0496101_0099942 3300048904 Bacteria 2169
667 Ga0496101_0100295 3300048904 Bacteria 2166
668 Ga0496102_0003979 3300048905 Bacteria 12519
669 Ga0496102_0105810 3300048905 Bacteria 2618
670 Ga0496102_0109711 3300048905 Bacteria 2572
671 Ga0496104_0010257 3300048907 Bacteria 8368
672 Ga0496104_0030153 3300048907 Bacteria 5038
673 Ga0496105_0070919 3300048908 Bacteria 2880
674 Ga0496106_0000980 3300048909 Bacteria 20817
675 Ga0496106_0004082 3300048909 Bacteria 10891
676 Ga0496107_0172183 3300048910 Bacteria 1607
677 Ga0496109_0031019 3300048912 Bacteria 4793
678 Ga0496111_0199515 3300048914 Bacteria 1488
679 Ga0496112_0004020 3300048915 Bacteria 12332
680 Ga0496114_0004364 3300048917 Bacteria 10953
681 Ga0496114_0027194 3300048917 Bacteria 4684
682 Ga0496114_0090051 3300048917 Bacteria 2604
683 Ga0496114_0142678 3300048917 Bacteria 2075
684 Ga0496114_0167835 3300048917 Bacteria 1912
685 Ga0496116_0014580 3300048919 Bacteria 6266
686 Ga0496117_0000434 3300048920 Bacteria 69571
687 Ga0496117_0002639 3300048920 Bacteria 22240
688 Ga0496117_0005831 3300048920 Bacteria 12760
689 Ga0496118_0005579 3300048921 Bacteria 14247
690 Ga0496119_0013173 3300048922 Bacteria 6615
691 Ga0496120_0001446 3300048923 Bacteria 28425
692 Ga0496121_0000353 3300048924 Bacteria 95678
693 Ga0496121_0006775 3300048924 Bacteria 14050
694 Ga0496121_0018849 3300048924 Bacteria 6926
695 Ga0496121_0052320 3300048924 Bacteria 3431
696 Ga0496122_0000137 3300048925 Bacteria 170016
697 Ga0496122_0001470 3300048925 Bacteria 37937
698 Ga0496123_0000018 3300048926 Bacteria 404553
699 Ga0496123_0000022 3300048926 Bacteria 361832
700 Ga0496124_0000285 3300048927 Bacteria 95893
701 Ga0496124_0003608 3300048927 Bacteria 18803
702 Ga0496124_0022230 3300048927 Bacteria 5820
703 Ga0496124_0192186 3300048927 Bacteria 1560
704 Ga0496124_0198544 3300048927 Bacteria 1528
705 Ga0496125_0000215 3300048928 Bacteria 118487
706 Ga0496125_0000318 3300048928 Bacteria 93900
707 Ga0496125_0025330 3300048928 Bacteria 5435
708 Ga0496125_0038719 3300048928 Bacteria 4119
709 Ga0496126_0080068 3300048929 Bacteria 2891
710 Ga0496126_0108498 3300048929 Bacteria 2420
711 Ga0495682_0000291 3300049460 Bacteria 38579
712 Ga0495682_0033963 3300049460 Bacteria 1882
713 Ga0501033_0153066 3300049570 Bacteria 1663
714 Ga0501033_0171860 3300049570 Bacteria 1556
715 Ga0501034_0000807 3300049571 Bacteria 46580
716 Ga0501034_0070465 3300049571 Bacteria 3507
717 Ga0501034_0123694 3300049571 Bacteria 2572
718 Ga0501034_0202866 3300049571 Bacteria 1940
719 Ga0501034_0260860 3300049571 Bacteria 1675
720 Ga0501036_0076433 3300049572 Bacteria 2832
721 Ga0501036_0133631 3300049572 Bacteria 2094
722 Ga0501037_0057199 3300049573 Bacteria 2847
723 Ga0501041_0121754 3300049577 Bacteria 1622
724 Ga0501046_0013179 3300049580 Bacteria 7011
725 Ga0501046_0096412 3300049580 Bacteria 2272
726 Ga0501047_0033253 3300049581 Bacteria 4977
727 Ga0501067_0033911 3300049583 Bacteria 2833
728 Ga0501069_0046654 3300049585 Bacteria 2404
729 Ga0501070_0167135 3300049586 Bacteria 1813
730 Ga0501071_0016463 3300049587 Bacteria 5085
731 Ga0501072_0130240 3300049588 Bacteria 2005
732 Ga0501073_0001736 3300049589 Bacteria 16195
733 Ga0501076_0037579 3300049592 Bacteria 3798
734 Ga0501076_0057722 3300049592 Bacteria 3083
735 Ga0501077_0027847 3300049593 Bacteria 3589
736 Ga0501077_0088836 3300049593 Bacteria 1959
737 Ga0501079_0010367 3300049741 Bacteria 7082
738 Ga0501080_0000921 3300049742 Bacteria 24022
739 Ga0501080_0093028 3300049742 Bacteria 2800
740 Ga0501080_0298596 3300049742 Bacteria 1461
741 Ga0501081_0026182 3300049743 Bacteria 3931
742 Ga0501081_0127915 3300049743 Bacteria 1813
743 Ga0501083_0007148 3300049744 Bacteria 7924
744 Ga0501035_0000263 3300049822 Bacteria 62255
745 Ga0501035_0017062 3300049822 Bacteria 6690
746 Ga0501035_0169841 3300049822 Bacteria 1884
747 Ga0501044_0059852 3300049823 Bacteria 3901
748 Ga0501045_0106666 3300049824 Bacteria 2076
749 Ga0501045_0199936 3300049824 Bacteria 1489
750 nmdc:mga03n38_52311_c1 3300050490 Bacteria 1827
751 nmdc:mga00v17_23585_c1 3300050491 Bacteria 3560
752 nmdc:mga0yw44_6756_c1 3300050492 Bacteria 5573
753 nmdc:mga0k408_61113_c1 3300050493 Bacteria 2190
754 nmdc:mga0k408_8011_c1 3300050493 Bacteria 1719
755 nmdc:mga06z11_3482_c1 3300050494 Bacteria 6096
756 nmdc:mga06z11_56445_c1 3300050494 Bacteria 2031
757 nmdc:mga07m45_156856_c1 3300050496 Bacteria 1321
758 nmdc:mga07m45_28522_c1 3300050496 Bacteria 3081
759 nmdc:mga05p37_152813_c1 3300050507 Bacteria 2822
760 nmdc:mga05p37_15503_c1 3300050507 Bacteria 9162
761 nmdc:mga05p37_49098_c1 3300050507 Bacteria 5191
762 nmdc:mga05p37_756_c1 3300050507 Bacteria 35847
763 nmdc:mga06r32_94733_c1 3300050510 Bacteria 2922
764 nmdc:mga08y16_143302_c1 3300050511 Bacteria 2484
765 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
766 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
767 nmdc:mga08y16_39329_c1 3300050511 Unclassified 4963
768 nmdc:mga08y16_53155_c1 3300050511 Bacteria 4237
769 nmdc:mga0n895_128986_c1 3300050512 Bacteria 2553
770 nmdc:mga0n895_377336_c1 3300050512 Bacteria 1435
771 nmdc:mga0rr50_125558_c1 3300050513 Bacteria 2048
772 nmdc:mga0rr50_555_c1 3300050513 Bacteria 20080
773 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
774 nmdc:mga0a205_100102_c1 3300050515 Bacteria 2797
775 nmdc:mga0a205_125077_c1 3300050515 Bacteria 2471
776 nmdc:mga0a205_138747_c1 3300050515 Bacteria 2331
777 nmdc:mga0a205_203908_c1 3300050515 Bacteria 1867
778 nmdc:mga0a205_263127_c1 3300050515 Bacteria 1602
779 nmdc:mga0a205_40160_c1 3300050515 Bacteria 4504
780 nmdc:mga0a205_65705_c1 3300050515 Bacteria 3505
781 Ga0500578_0001295 3300053086 Bacteria 25808
782 Ga0500643_000173 3300053087 Bacteria 63279
783 Ga0500644_0017307 3300053088 Bacteria 2091
784 Ga0500644_0045479 3300053088 Bacteria 1479
785 Ga0500647_0010667 3300053091 Bacteria 4074
786 Ga0500566_0000353 3300053094 Bacteria 24984
787 Ga0500640_000097 3300053095 Bacteria 15377
788 Ga0500555_007872 3300053103 Bacteria 3030
789 Ga0500556_0000447 3300053104 Bacteria 29406
790 Ga0500572_000165 3300053111 Bacteria 22976
791 Ga0500572_000219 3300053111 Bacteria 20348
792 Ga0500592_012512 3300053116 Bacteria 1359
793 Ga0500595_017015 3300053119 Bacteria 2696
794 Ga0500608_000287 3300053122 Bacteria 19708
795 Ga0500608_003613 3300053122 Bacteria 5833
796 Ga0500614_001090 3300053123 Bacteria 6715
797 Ga0500652_000611 3300053131 Bacteria 12307
798 Ga0500559_0000241 3300053136 Bacteria 43480
799 Ga0500559_0003511 3300053136 Bacteria 7681
800 Ga0500559_0004615 3300053136 Bacteria 6508
801 Ga0500568_0001443 3300053139 Bacteria 15328
802 Ga0500577_0002449 3300053142 Bacteria 4749
803 Ga0500603_001328 3300053150 Bacteria 5670
804 Ga0500616_0000554 3300053153 Bacteria 46158
805 Ga0500616_0000902 3300053153 Bacteria 32595
806 Ga0500620_020810 3300053155 Bacteria 1951
807 Ga0500622_0000146 3300053156 Bacteria 74615
808 Ga0500622_0007254 3300053156 Bacteria 6311
809 Ga0500627_0000002 3300053158 Bacteria 235747
810 Ga0500627_0058474 3300053158 Bacteria 1692
811 Ga0500630_001600 3300053159 Bacteria 10834
812 Ga0500634_0003106 3300053161 Bacteria 7288
813 Ga0500638_009701 3300053162 Bacteria 4180
814 Ga0500639_000023 3300053163 Bacteria 85696
815 Ga0500639_005725 3300053163 Bacteria 6383
816 Ga0500636_0029297 3300053177 Bacteria 3251
817 Ga0500636_0029703 3300053177 Bacteria 3231
818 Ga0500637_0036213 3300053178 Bacteria 2770
819 Ga0500596_000750 3300053735 Bacteria 6389
820 Ga0500587_001814 3300053739 Bacteria 3036
821 Ga0501084_0012130 3300054114 Bacteria 7133
822 Ga0501082_0092288 3300060353 Bacteria 2616
823 Ga0466962_0000986 3300061719 Bacteria 12971
824 2551725600 2551306091 Bacteria 7086830
825 2503204654 2503198000 Bacteria 6884444
826 2508729199 2508501050 Bacteria 9633614
827 2509078009 2508501114 Bacteria 7082538
828 2509106951 2508501122 Bacteria 6292184
829 2509117880 2508501123 Bacteria 6283661
830 2509145538 2508501127 Bacteria 7037543
831 2509370175 2509276018 Bacteria 6910194
832 2509375093 2509276019 Bacteria 6802256
833 2509448425 2509276033 Bacteria 7180565
834 2510303561 2510065057 Bacteria 6649661
835 2510319699 2510065059 Bacteria 6847884
836 2511168621 2510917026 Bacteria 7046020
837 2511184475 2510917028 Bacteria 6185411
838 2511199836 2510917030 Bacteria 7460662
839 2511500433 2511231052 Bacteria 6974333
840 2512531893 2512047086 Bacteria 6850303
841 2512934620 2512875016 Bacteria 6529530
842 2512962966 2512875024 Bacteria 7195110
843 2512972778 2512875026 Bacteria 6861065
844 2513585409 2513237086 Bacteria 7265287
845 2513602833 2513237089 Bacteria 6553624
846 2513613549 2513237090 Bacteria 7096802
847 2513616657 2513237091 Bacteria 6900273
848 2513639516 2513237094 Bacteria 8789602
849 2513721414 2513237104 Bacteria 10034502
850 2513885653 2513237140 Bacteria 7076289
851 2513903996 2513237143 Bacteria 6664116
852 2513911468 2513237144 Bacteria 7530820
853 2513986207 2513237156 Bacteria 6402557
854 2513996672 2513237159 Bacteria 6810126
855 2514005085 2513237160 Bacteria 6650282
856 2514039036 2513237164 Bacteria 7563725
857 2514419094 2513237305 Bacteria 7293571
858 2514589385 2513237351 Bacteria 6968952
859 2515607635 2515154107 Bacteria 6795637
860 2515642528 2515154114 Bacteria 7848616
861 2516204428 2516143018 Bacteria 6951533
862 2516891765 2516653046 Bacteria 6989037
863 2517568563 2517487022 Bacteria 7227575
864 2524450620 2524023207 Bacteria 6813453
865 2530644541 2529292951 Bacteria 6916614
866 2551677055 2551306084 Bacteria 8942552
867 2551684021 2551306085 Bacteria 7347181
868 2551704015 2551306087 Bacteria 7351905
869 2551710324 2551306089 Bacteria 7162724
870 2551719191 2551306090 Bacteria 7953713
871 2551736324 2551306092 Bacteria 6992595
872 2551743814 2551306093 Bacteria 7064773
873 2558866197 2558860100 Bacteria 8458965
874 2585164905 2582581283 Bacteria 6030556
875 2585231954 2582581299 Bacteria 6518058
876 2585265283 2582581306 Bacteria 6450535
877 2585278258 2582581308 Bacteria 7413247
878 2585385583 2582581865 Bacteria 6644329
879 2585391999 2582581866 Bacteria 6859583
880 2585532082 2585427527 Bacteria 7273426
881 2587730720 2585428057 Bacteria 6737412
882 2587736984 2585428058 Bacteria 6853932
883 2587758090 2585428062 Bacteria 6842168
884 2588294900 2588253510 Bacteria 6901809
885 2588514232 2588253730 Bacteria 6881675
886 2597816475 2597489875 Bacteria 7010078
887 2599332400 2599185156 Bacteria 5403036
888 2599720767 2599185236 Bacteria 6875203
889 2599935902 2599185301 Bacteria 6161860
890 2600191359 2599185352 Bacteria 7228948
891 2616307776 2615840626 Bacteria 7921970
892 2643771809 2643221550 Bacteria 4619371
893 2643806193 2643221557 Bacteria 7184309
894 2643832745 2643221563 Bacteria 4726935
895 2643839579 2643221564 Bacteria 4193379
896 2643909516 2643221580 Bacteria 3816678
897 2643964347 2643221591 Bacteria 4397626
898 2643967744 2643221592 Bacteria 6608788
899 2643988257 2643221595 Bacteria 6565519
900 2644003454 2643221599 Bacteria 6292121
901 2644047248 2643221607 Bacteria 6314006
902 2644053460 2643221608 Bacteria 4724829
903 2644070203 2643221610 Bacteria 7480339
904 2644103339 2643221618 Bacteria 7717186
905 2644140566 2643221625 Bacteria 6512927
906 2644144278 2643221626 Bacteria 8069654
907 2644156501 2643221627 Bacteria 6761570
908 2644164400 2643221629 Bacteria 5850260
909 2644195554 2643221634 Bacteria 6705461
910 2644199619 2643221636 Bacteria 6583769
911 2644243939 2643221644 Bacteria 6865017
912 2644273533 2643221648 Bacteria 6521465
913 2644306269 2643221655 Bacteria 7722067
914 2644330518 2643221659 Bacteria 7890716
915 2644346329 2643221662 Bacteria 5851492
916 2644377455 2643221668 Bacteria 7306521
917 2644411085 2643221674 Bacteria 3919126
918 2644420965 2643221675 Bacteria 7473456
919 2644454488 2643221680 Bacteria 7473610
920 2644480037 2643221686 Bacteria 6310811
921 2644496850 2643221689 Bacteria 6042950
922 2644542735 2643221698 Bacteria 7756764
923 2644611880 2643221712 Bacteria 7729434
924 2644671871 2643221723 Bacteria 7095460
925 2644692426 2643221726 Bacteria 7455827
926 2657681807 2657244999 Bacteria 5946535
927 2671695376 2671180139 Bacteria 4196045
928 2688601275 2687453392 Bacteria 6880454
929 2692317348 2690316117 Bacteria 6800650
930 2694632389 2693429783 Bacteria 7019804
931 2694640525 2693429784 Bacteria 7241525
932 2719183808 2718217882 Bacteria 6556348
933 2719728249 2718218009 Bacteria 6478651
934 2720611192 2718218232 Bacteria 6720332
935 2721145110 2718218363 Bacteria 6524337
936 2721155847 2718218365 Bacteria 6274507
937 2721167197 2718218366 Bacteria 6425255
938 2722838175 2721755514 Bacteria 6424414
939 2723578448 2721755686 Bacteria 7343952
940 2724042443 2721755810 Bacteria 6479005
941 2730161948 2728369365 Bacteria 6555560
942 2730300954 2728369397 Bacteria 6274511
943 2738945072 2738541317 Bacteria 5340176
944 2739308297 2738543024 Bacteria 5603683
945 2739790981 2739367756 Bacteria 4553612
946 2753461255 2751185821 Bacteria 6189929
947 2756674713 2756170246 Bacteria 7451806
948 2765469047 2765235802 Bacteria 5618596
949 2774871506 2773857925 Bacteria 6472445
950 2776258853 2775506901 Bacteria 9631051
951 2792583012 2791355082 Bacteria 5973319
952 2792623899 2791355091 Bacteria 6135441
953 2792629721 2791355092 Bacteria 6248105
954 2792638055 2791355094 Bacteria 7011481
955 2792746415 2791355123 Bacteria 8049106
956 2793298934 2791355256 Bacteria 6798008
957 2793317169 2791355259 Bacteria 7254731
958 2793324002 2791355260 Bacteria 6598818
959 2793325688 2791355261 Bacteria 6661293
960 2793333113 2791355262 Bacteria 6774204
961 2793340088 2791355263 Bacteria 6872478
962 2793346285 2791355264 Bacteria 6429314
963 2793355502 2791355265 Bacteria 6539969
964 2802720404 2802428858 Bacteria 6636079
965 2802726224 2802428859 Bacteria 6667919
966 2802731612 2802428860 Bacteria 6525526
967 2802739363 2802428861 Bacteria 6534206
968 2802742505 2802428862 Bacteria 6633353
969 2802749210 2802428863 Bacteria 6410669
970 2804750827 2802429268 Bacteria 6094027
971 2805929099 2802429605 Bacteria 6875453
972 2805937200 2802429606 Bacteria 6346811
973 2835312838 2835312727 Bacteria 7413381
974 2838027223 2838022645 Bacteria 6494267
975 2838045913 2838042994 Bacteria 6046894
976 2838075279 2838074704 Bacteria 6785777
977 2838671537 2838668709 Bacteria 6671819
978 2838704196 2838701080 Bacteria 6669771
979 2841735686 2841734538 Bacteria 6784580
980 2842149186 2842146304 Bacteria 5957337
981 2842195303 2842192696 Bacteria 6147454
982 2842203404 2842198810 Bacteria 6608673
983 2842210326 2842205361 Bacteria 6340321
984 2842253647 2842250916 Bacteria 6579627
985 2842270238 2842264693 Bacteria 6472963
986 2842283780 2842278818 Bacteria 6340002
987 2842319046 2842317721 Bacteria 6793725
988 2842434060 2842428310 Bacteria 6767288
989 2842440451 2842434925 Bacteria 6502746
990 2842444024 2842441272 Bacteria 6769273
991 2842468479 2842462802 Bacteria 6588055
992 2842474997 2842469257 Bacteria 6752936
993 2842486981 2842482326 Bacteria 7212537
994 2842491496 2842489311 Bacteria 6620893
995 2842499564 2842495871 Bacteria 6820686
996 2842521602 2842521101 Bacteria 6569494
997 2842922668 2842922631 Bacteria 5824079
998 2844004271 2844002411 Bacteria 7168230
999 2844009936 2844009547 Bacteria 6728125
1000 2844165153 2844163670 Bacteria 7266046
1001 2844319556 2844315083 Bacteria 8138177
1002 2847417584 2847417321 Bacteria 6913799
1003 2847689286 2847686936 Bacteria 6278406
1004 2848992390 2848992105 Bacteria 6810864
1005 2850079887 2850079185 Bacteria 6848280
1006 2854916636 2854911287 Bacteria 5582813
1007 2855828133 2855825444 Bacteria 6785811
1008 2855839905 2855839649 Bacteria 7135830
1009 2855873471 2855872281 Bacteria 6964271
1010 2856314762 2856314179 Bacteria 6477897
1011 2856328245 2856320880 Bacteria 7263508
1012 2856332196 2856328259 Bacteria 6528202
1013 2856338886 2856334872 Bacteria 7037011
1014 2856348670 2856342000 Bacteria 7176905
1015 2856350655 2856349417 Bacteria 6230045
1016 2856367296 2856364286 Bacteria 6939991
1017 2857354185 2857349434 Bacteria 7926032
1018 2857371050 2857367948 Bacteria 6965560
1019 2858803878 2858800743 Bacteria 6603254
1020 2869164677 2869162929 Bacteria 6399702
1021 2869171938 2869169390 Bacteria 6659796
1022 2869236424 2869234852 Bacteria 6654993
1023 2869244021 2869242130 Bacteria 6609239
1024 2869253765 2869249662 Bacteria 6868783
1025 2869257869 2869256925 Bacteria 6981691
1026 2869269506 2869264136 Bacteria 6880765
1027 2869277845 2869271264 Bacteria 6908218
1028 2869282210 2869278585 Bacteria 7077053
1029 2869287579 2869285874 Bacteria 6901219
1030 2871431103 2871429161 Bacteria 6547891
1031 2871436650 2871435913 Bacteria 6880295
1032 2871449899 2871444079 Bacteria 6423508
1033 2871452507 2871451962 Bacteria 7336357
1034 2871465886 2871459585 Bacteria 6866887
1035 2871469612 2871466892 Bacteria 6923287
1036 2871480573 2871474448 Bacteria 6806570
1037 2871485123 2871481445 Bacteria 6700002
1038 2871502066 2871495908 Bacteria 6935695
1039 2874105442 2874102143 Bacteria 6342645
1040 2874109965 2874109183 Bacteria 6517025
1041 2874119028 2874116593 Bacteria 6674494
1042 2874129661 2874123672 Bacteria 7238285
1043 2874136801 2874131515 Bacteria 6820270
1044 2874145532 2874139085 Bacteria 7021506
1045 2874150375 2874146452 Bacteria 7533118
1046 2874157430 2874155637 Bacteria 6724144
1047 2874164565 2874162495 Bacteria 6174670
1048 2874171602 2874168670 Bacteria 8062617
1049 2876363117 2876363079 Bacteria 6544991
1050 2876370747 2876369609 Bacteria 6807521
1051 2876381159 2876377896 Bacteria 6565995
1052 2876392686 2876386047 Bacteria 6698674
1053 2876394220 2876392853 Bacteria 6660880
1054 2876404370 2876399893 Bacteria 6927900
1055 2876416526 2876413966 Bacteria 6831344
1056 2876427484 2876420981 Bacteria 6687741
1057 2878736685 2878730984 Bacteria 6380721
1058 2878740184 2878738818 Bacteria 7136951
1059 2878747716 2878745973 Bacteria 6867388
1060 2878755050 2878753008 Bacteria 6922523
1061 2878765967 2878760144 Bacteria 6823465
1062 2878773189 2878767105 Bacteria 6898628
1063 2878793685 2878788777 Bacteria 6567085
1064 2881158559 2881155292 Bacteria 6461656
1065 2881164235 2881161766 Bacteria 7127907
1066 2881861497 2881861095 Bacteria 7128710
1067 2882459405 2882456835 Bacteria 6863978
1068 2882632919 2882632389 Bacteria 8154593
1069 2885306100 2885305155 Bacteria 7348390
1070 2885314839 2885312484 Bacteria 6415165
1071 2885327995 2885326080 Bacteria 7134805
1072 2885340462 2885334103 Bacteria 7216818
1073 2885343291 2885342637 Bacteria 7011821
1074 2885353625 2885350715 Bacteria 6787678
1075 2888342544 2888337043 Bacteria 6629336
1076 2888350254 2888343758 Bacteria 6611049
1077 2888352120 2888350351 Bacteria 7372807
1078 2889014105 2889010040 Bacteria 6749192
1079 2889021185 2889016732 Bacteria 6700763
1080 2889792856 2889790730 Bacteria 5689708
1081 2889915011 2889914905 Bacteria 5702301
1082 2891376690 2891373044 Bacteria 5202277
1083 2894237114 2894232714 Bacteria 8834183
1084 2894820716 2894817345 Bacteria 4892941
1085 2895883379 2895880812 Bacteria 11255272
1086 2896391647 2896384573 Bacteria 7700774
1087 2903449471 2903448605 Bacteria 7357801
1088 2903498832 2903492973 Bacteria 13473544
1089 2903499464 2903492973 Bacteria 13473544
1090 2903517854 2903513507 Bacteria 6344008
1091 2903525067 2903521522 Bacteria 6525694
1092 2903531514 2903528002 Bacteria 6586099
1093 2903546949 2903540706 Bacteria 7062119
1094 2903734493 2903727486 Bacteria 8281579
1095 2904660936 2904659560 Bacteria 6685615
1096 2906310117 2906308376 Bacteria 6841989
1097 2906322989 2906321335 Bacteria 6579571
1098 2906329059 2906328253 Bacteria 6585166
1099 2906355469 2906354277 Bacteria 6991324
1100 2906367746 2906363423 Bacteria 6856682
1101 2906372477 2906370794 Bacteria 6881062
1102 2906384089 2906378014 Bacteria 6911440
1103 2906392454 2906386501 Bacteria 5977019
1104 2906395155 2906393657 Bacteria 6790866
1105 2906406875 2906401398 Bacteria 6693206
1106 2906411472 2906408224 Bacteria 6162342
1107 2906414951 2906414383 Bacteria 6580790
1108 2906435715 2906427513 Bacteria 6375796
1109 2906609288 2906602504 Bacteria 8295279
1110 2913298083 2913295892 Bacteria 6333755
1111 2913309698 2913308742 Bacteria 5350706
1112 2915652492 2915650412 Bacteria 4288180
1113 2915980693 2915980308 Bacteria 6624279
1114 2915990567 2915986958 Bacteria 6739310
1115 2915998210 2915993759 Bacteria 7016183
1116 2916001014 2916000859 Bacteria 6865702
1117 2916011095 2916007675 Bacteria 6898660
1118 2916015515 2916014648 Bacteria 6946486
1119 2916025438 2916021584 Bacteria 6854472
1120 2916031124 2916028427 Bacteria 6748433
1121 2916036421 2916035215 Bacteria 6755766
1122 2916045662 2916041962 Bacteria 6820487
1123 2916053733 2916048683 Bacteria 6543552
1124 2916057312 2916055098 Bacteria 6758838
1125 2916063740 2916061851 Bacteria 6737736
1126 2916068687 2916068649 Bacteria 6943657
1127 2916082169 2916076590 Bacteria 6596108
1128 2917558091 2917554339 Bacteria 4987857
1129 2920763487 2920760137 Bacteria 7427611
1130 2920823277 2920822456 Bacteria 6897201
1131 2921207032 2921201388 Bacteria 6926299
1132 2921212228 2921208531 Bacteria 6745326
1133 2921242014 2921237296 Bacteria 6876710
1134 2921248910 2921244191 Bacteria 6568419
1135 2921257249 2921250672 Bacteria 6677771
1136 2921260928 2921257292 Bacteria 6808382
1137 2921266387 2921263974 Bacteria 6864552
1138 2921288504 2921282425 Bacteria 6826397
1139 2921294443 2921289301 Bacteria 7316391
1140 2921302837 2921296804 Bacteria 7176999
1141 2922137066 2922130491 Bacteria 7173936
1142 2922156953 2922151315 Bacteria 6902399
1143 2922161052 2922158528 Bacteria 6573167
1144 2922175223 2922172374 Bacteria 6167644
1145 2922183997 2922178524 Bacteria 6025201
1146 2922187164 2922185730 Bacteria 7113964
1147 2924149818 2924144063 Bacteria 6883928
1148 2924156595 2924150972 Bacteria 7169444
1149 2924163403 2924158325 Bacteria 7188855
1150 2924170423 2924165586 Bacteria 7260590
1151 2924177706 2924172951 Bacteria 6749356
1152 2924183560 2924179722 Bacteria 6843264
1153 2924190796 2924186466 Bacteria 6876637
1154 2924199067 2924193448 Bacteria 6955718
1155 2924205599 2924200457 Bacteria 6757188
1156 2924209141 2924207177 Bacteria 6917007
1157 2924216527 2924214083 Bacteria 7080103
1158 2924228339 2924221636 Bacteria 7113495
1159 2924232827 2924228884 Bacteria 6633132
1160 2924722953 2924718760 Bacteria 6331356
1161 2924738104 2924733363 Bacteria 7574837
1162 2924744348 2924741084 Bacteria 6661321
1163 2924749445 2924748358 Bacteria 6154725
1164 2924762734 2924754689 Bacteria 6774424
1165 2924768377 2924762789 Bacteria 6561353
1166 2924777784 2924776078 Bacteria 7492003
1167 2924791269 2924784321 Bacteria 7416538
1168 2932404247 2932401849 Bacteria 4262978
1169 2932795551 2932794094 Bacteria 7915132
1170 2932807853 2932801729 Bacteria 7987968
1171 2935886030 2935883170 Bacteria 7964738
1172 2936370237 2936367885 Bacteria 7324495
1173 2936377909 2936375103 Bacteria 6652732
1174 2936384104 2936381700 Bacteria 7006523
1175 2936997840 2936996657 Bacteria 6298727
1176 2937007629 2937002841 Bacteria 6934057
1177 2937014877 2937009748 Bacteria 6746052
1178 2937022379 2937016420 Bacteria 6782579
1179 2937023297 2937023124 Bacteria 6815156
1180 2937034619 2937029754 Bacteria 6424026
1181 2937041220 2937036028 Bacteria 6846469
1182 2937045973 2937042894 Bacteria 6741576
1183 2937051814 2937049772 Bacteria 6757901
1184 2937062655 2937056579 Bacteria 7107896
1185 2937068355 2937063883 Bacteria 7199456
1186 2937074828 2937071275 Bacteria 6984483
1187 2937078831 2937078374 Bacteria 6610289
1188 2937086625 2937084907 Bacteria 6618516
1189 2937095221 2937091812 Bacteria 6979387
1190 2937104411 2937098957 Bacteria 7249374
1191 2937112423 2937106411 Bacteria 6947143
1192 2937119551 2937113482 Bacteria 6505872
1193 2937126111 2937119839 Bacteria 6597547
1194 2937131534 2937126314 Bacteria 6771275
1195 2937815403 2937813078 Bacteria 7783518
1196 2937825862 2937822353 Bacteria 7290551
1197 2937837117 2937836603 Bacteria 6811263
1198 2937845985 2937843397 Bacteria 5256375
1199 2937851090 2937848649 Bacteria 6983481
1200 2937867466 2937861824 Bacteria 6660327
1201 2937874306 2937868953 Bacteria 6639878
1202 2937881591 2937877337 Bacteria 7246526
1203 2937892944 2937891427 Bacteria 6357007
1204 2937976826 2937972304 Bacteria 7532020
1205 2937986413 2937980651 Bacteria 6517427
1206 2938000500 2937994558 Bacteria 7036190
1207 2941500811 2941499720 Bacteria 7599444
1208 2941534932 2941531003 Bacteria 7653939
1209 2957382147 2957375807 Bacteria 6425588
1210 2957388597 2957382221 Bacteria 6737050
1211 2957393976 2957388812 Bacteria 6778072
1212 2957399094 2957395598 Bacteria 6822399
1213 2957403355 2957402308 Bacteria 6741770
1214 2957412023 2957408893 Bacteria 6558585
1215 2957418125 2957415311 Bacteria 6991633
1216 2957434082 2957430029 Bacteria 7022557
1217 2957442548 2957437181 Bacteria 6568994
1218 2957447218 2957443900 Bacteria 6869977
1219 2957455251 2957450854 Bacteria 6765715
1220 2957462732 2957457609 Bacteria 6967680
1221 2957466224 2957464669 Bacteria 6568877
1222 2957472155 2957471148 Bacteria 6797643
1223 2957479693 2957478035 Bacteria 6756658
1224 2957484910 2957484790 Bacteria 6703082
1225 2957496125 2957491536 Bacteria 6695180
1226 2957500588 2957498199 Bacteria 7126688
1227 2957508204 2957505466 Bacteria 7253085
1228 2958037984 2958034702 Bacteria 6989922
1229 2958042166 2958041894 Bacteria 13082850
1230 2958049298 2958041894 Bacteria 13082850
1231 2958066576 2958064165 Bacteria 7158582
1232 2958076460 2958071322 Bacteria 6815895
1233 2958088721 2958084443 Bacteria 7312792
1234 2958095319 2958092219 Bacteria 6861151
1235 2958102419 2958100919 Bacteria 6800575
1236 2958113560 2958108152 Bacteria 6681128
1237 2958119824 2958115193 Bacteria 6923548
1238 2958125137 2958122699 Bacteria 7280457
1239 2958131981 2958130278 Bacteria 6897202
1240 2958141906 2958137437 Bacteria 6050276
1241 2958151069 2958144490 Bacteria 6677056
1242 2958171157 2958165035 Bacteria 6906348
1243 2958174945 2958172287 Bacteria 6716688
1244 2958181784 2958179912 Bacteria 6874908
1245 2960589364 2960584000 Bacteria 6864594
1246 2960594676 2960591022 Bacteria 6622873
1247 2960603471 2960597568 Bacteria 6550735
1248 2960608780 2960603979 Bacteria 6898737
1249 2960614395 2960610863 Bacteria 6691244
1250 2960621606 2960617483 Bacteria 6727748
1251 2960628900 2960624210 Bacteria 6875384
1252 2960637547 2960631154 Bacteria 6732508
1253 2960645030 2960637947 Bacteria 7296468
1254 2960648006 2960645483 Bacteria 7211087
1255 2960658383 2960652885 Bacteria 7083688
1256 2960660502 2960660292 Bacteria 7041660
1257 2960672263 2960667422 Bacteria 6763020
1258 2960677211 2960674078 Bacteria 6609048
1259 2960686521 2960680706 Bacteria 6624464
1260 2960690376 2960687367 Bacteria 6535474
1261 2960698914 2960693952 Bacteria 6749742
1262 2961079628 2961077736 Bacteria 7079850
1263 2961120600 2961114664 Bacteria 6680456
1264 2961136265 2961127735 Bacteria 7196641
1265 2961140506 2961136820 Bacteria 6775228
1266 2961169586 2961163497 Bacteria 6901077
1267 2961176908 2961170736 Bacteria 7072258
1268 2961187900 2961183825 Bacteria 6688536
1269 2963650996 2963644680 Bacteria 6530403
1270 2964610199 2964607997 Bacteria 7101408
1271 2964618927 2964615318 Bacteria 6809089
1272 2964627982 2964621998 Bacteria 6834995
1273 2964632714 2964628898 Bacteria 7083044
1274 2964639036 2964636051 Bacteria 7091832
1275 2964649304 2964643177 Bacteria 6820887
1276 2964650241 2964649959 Bacteria 6675118
1277 2964661157 2964656573 Bacteria 7100150
1278 2964668172 2964663802 Bacteria 7019362
1279 2964677324 2964670856 Bacteria 6851364
1280 2964683382 2964678106 Bacteria 6792020
1281 2964690611 2964685014 Bacteria 6839111
1282 2964694700 2964691889 Bacteria 6802758
1283 2964700570 2964698721 Bacteria 6765331
1284 2964709885 2964705432 Bacteria 7114648
1285 2964717307 2964712639 Bacteria 6695970
1286 2964722969 2964719344 Bacteria 7286602
1287 2965024074 2965018300 Bacteria 6883036
1288 2965029003 2965025482 Bacteria 6532201
1289 2965035758 2965032056 Bacteria 6887443
1290 2965050288 2965047637 Bacteria 6623551
1291 2965067683 2965062239 Bacteria 7412989
1292 2965095730 2965089291 Bacteria 6866420
1293 2967671509 2967664464 Bacteria 6948836
1294 2967675357 2967671571 Bacteria 7021409
1295 2967684794 2967678726 Bacteria 7264382
1296 2967691435 2967686174 Bacteria 6678622
1297 2967694979 2967693043 Bacteria 6804451
1298 2967704130 2967699805 Bacteria 6854538
1299 2967712160 2967706974 Bacteria 7186053
1300 2967714573 2967714385 Bacteria 7000047
1301 2967722552 2967721400 Bacteria 7073753
1302 2967730468 2967728569 Bacteria 6641507
1303 2967739323 2967735183 Bacteria 6827012
1304 2967745641 2967742019 Bacteria 6794534
1305 2967754962 2967748971 Bacteria 6733771
1306 2967759328 2967755722 Bacteria 6814706
1307 2967766480 2967762386 Bacteria 6923502
1308 2967774642 2967769361 Bacteria 6587838
1309 2967782554 2967775926 Bacteria 6738189
1310 2968000989 2967996073 Bacteria 6787468
1311 2968007042 2968003550 Bacteria 6929263
1312 2968021470 2968016561 Bacteria 7022047
1313 2968085712 2968083720 Bacteria 7351627
1314 2968093078 2968091066 Bacteria 6052692
1315 2968102716 2968097103 Bacteria 6107094
1316 2968111909 2968110612 Bacteria 6814636
1317 2968120257 2968117919 Bacteria 6536078
1318 2968130450 2968128360 Bacteria 6270294
1319 2968177990 2968171901 Bacteria 6894245
1320 2970022866 2970019648 Bacteria 7072033
1321 2970030489 2970026789 Bacteria 6785236
1322 2970037035 2970033650 Bacteria 7118744
1323 2970041190 2970040964 Bacteria 6731123
1324 2970052810 2970047711 Bacteria 7088379
1325 2970056767 2970054988 Bacteria 6611507
1326 2970067896 2970061556 Bacteria 7099761
1327 2970073931 2970068827 Bacteria 7123112
1328 2970081698 2970076120 Bacteria 6697332
1329 2970088460 2970082768 Bacteria 6183754
1330 2970091377 2970088815 Bacteria 6933825
1331 2970101995 2970095765 Bacteria 6936963
1332 2970105908 2970102677 Bacteria 6812532
1333 2970115681 2970109326 Bacteria 6863976
1334 2970117547 2970116247 Bacteria 6501857
1335 2970124301 2970122695 Bacteria 6625855
1336 2970131477 2970129317 Bacteria 6806560
1337 2970136684 2970136068 Bacteria 7207982
1338 2970147676 2970143518 Bacteria 6446480
1339 2970151795 2970149975 Bacteria 6779706
1340 2970163349 2970156795 Bacteria 7168044
1341 2970170027 2970164137 Bacteria 6861252
1342 2970175749 2970170962 Bacteria 6876229
1343 2970181989 2970177841 Bacteria 6768001
1344 2970189218 2970184632 Bacteria 7054431
1345 2970196635 2970191845 Bacteria 7032787
1346 2970476574 2970469710 Bacteria 6969209
1347 2970494309 2970489779 Bacteria 6517260
1348 2970509580 2970503327 Bacteria 7099517
1349 2970513466 2970510686 Bacteria 7006402
1350 2970525365 2970524798 Bacteria 6840927
1351 2970538960 2970532167 Bacteria 6553173
1352 2970549931 2970547951 Bacteria 6931819
1353 2970560822 2970554993 Bacteria 6814252
1354 2970596817 2970593180 Bacteria 7073582
1355 2970620417 2970619444 Bacteria 6986144
1356 2970632161 2970627176 Bacteria 6680862
1357 2977519998 2977516862 Bacteria 6940108
1358 2977528403 2977523885 Bacteria 6960446
1359 2977535771 2977530762 Bacteria 6951399
1360 2977543876 2977537788 Bacteria 6929320
1361 2977549555 2977544691 Bacteria 6875412
1362 2977553587 2977551784 Bacteria 7125765
1363 2977564805 2977558990 Bacteria 6863948
1364 2977571811 2977565890 Bacteria 6901543
1365 2977574602 2977572785 Bacteria 6763888
1366 2977584514 2977579622 Bacteria 6772100
1367 2977824190 2977821940 Bacteria 6906439
1368 2977834425 2977828996 Bacteria 7007971
1369 2977846631 2977843712 Bacteria 6753583
1370 2977857549 2977851361 Bacteria 6694324
1371 2977868487 2977864932 Bacteria 7534097
1372 2977878531 2977872689 Bacteria 7270173
1373 2977900011 2977898635 Bacteria 6675551
1374 2977911605 2977907340 Bacteria 6577984
1375 2977916070 2977915119 Bacteria 6829656
1376 2977923428 2977922695 Bacteria 6956781
1377 2977940060 2977935797 Bacteria 6252826
1378 2977949663 2977942078 Bacteria 7570577
1379 2977959933 2977957713 Bacteria 6877875
1380 2977980260 2977971508 Bacteria 7472917
1381 2977992332 2977986579 Bacteria 6581278
1382 2979713811 2979710463 Bacteria 6785254
1383 2979748952 2979742915 Bacteria 7301278
1384 2979774507 2979772303 Bacteria 6618277
1385 2979780980 2979779861 Bacteria 6219781
1386 2979798757 2979793036 Bacteria 6808957
1387 2979814368 2979808191 Bacteria 7179355
1388 2987642405 2987636660 Bacteria 8088555
1389 2987653732 2987652177 Bacteria 6969023
1390 2987665727 2987659509 Bacteria 6966464
1391 2987668010 2987666974 Bacteria 6509233
1392 2987674074 2987673487 Bacteria 6884027
1393 2989351505 2989349275 Bacteria 6349068
1394 2989772697 2989771324 Bacteria 5605128
1395 2996315912 2996310559 Bacteria 6357320
1396 2996347001 2996341866 Bacteria 6643098
1397 2996356297 2996348954 Bacteria 7239054
1398 2996390861 2996386984 Bacteria 6978667
1399 2996896920 2996893221 Bacteria 5823108
1400 3000138012 3000135777 Bacteria 6891109
1401 3003931856 3003930520 Bacteria 5667563
1402 3004172383 3004167301 Bacteria 8330599
1403 3004194776 3004188549 Bacteria 6952365
1404 3004200122 3004195979 Bacteria 6776956
1405 3004210487 3004203850 Bacteria 7307914
1406 3004212732 3004211236 Bacteria 7417683
1407 3004221422 3004218560 Bacteria 7421728
1408 3004238258 3004232784 Bacteria 6662140
1409 3004250832 3004248173 Bacteria 6563236
1410 3004271993 3004268573 Bacteria 7043476
1411 3004282601 3004275668 Bacteria 7114440
1412 3004295462 3004289098 Bacteria 6135450
1413 3004338232 3004334049 Bacteria 8449246
1414 3005416795 3005416602 Bacteria 7064308
1415 3005451363 3005445848 Bacteria 6906074
1416 637077794 637000159 Bacteria 7596297
1417 643824450 643692032 Bacteria 6891900
1418 648738526 648276728 Bacteria 6968865
1419 649875705 649633066 Bacteria 6690028
1420 8002287281 8002285264 Bacteria 6717907
1421 8003992357 8003992118 Bacteria 7266902
1422 8003999686 8003999396 Bacteria 7063185
1423 8004303725 8004300914 Bacteria 6132239
1424 8004320168 8004312739 Bacteria 7444653
1425 8004368446 8004361976 Bacteria 6858373
1426 8004376629 8004374579 Bacteria 6898112
1427 8004390315 8004387939 Bacteria 7049250
1428 8004396193 8004395343 Bacteria 6620908
1429 8004446200 8004445564 Bacteria 6322258
1430 8004635683 8004633249 Bacteria 6723080
1431 8004647078 8004640170 Bacteria 6723001
1432 8004707408 8004703790 Bacteria 8006957
1433 8004716379 8004714634 Bacteria 6776161
1434 8004734887 8004727605 Bacteria 6643904
1435 8005289268 8005289223 Bacteria 6634003
1436 8005320558 8005314921 Bacteria 7072929
1437 8005381918 8005376324 Bacteria 6590079
1438 8005388793 8005382845 Bacteria 6732062
1439 8005397595 8005395548 Bacteria 6806915
1440 8005689485 8005688590 Bacteria 6610080
1441 8018130402 8018127388 Bacteria 7351159
1442 8019659183 8019648815 Bacteria 10014479
1443 8024505629 8024501048 Bacteria 6427847
1444 8049293383 8049293176 Bacteria 6128433
1445 8054562324 8054558443 Bacteria 5204801
1446 8055624679 8055617313 Bacteria 7548464
1447 8056383565 8056382006 Bacteria 6408074
1448 8056968549 8056967851 Bacteria 9038162
1449 8057136108 8057132660 Bacteria 4061191
1450 JGI24748J21848_1000012
1451 JGI24034J26672_10000003
1452 JGI24751J29686_10000931
1453 JGI25157J39369_1001297
1454 JGI25152J39213_1002620
1455 JGI25152J39213_1003646
1456 JGI25159J45721_1000003
1457 JGI25151J46595_10011278
1458 JGI25406J46586_10010437
1459 JGI25165J46597_1000037
1460 JGI25165J46597_1001939
1461 JGI25153J46596_10021365
1462 JGI25160J50197_1000003
1463 JGI25161J50226_1001593
1464 Ga0055542_1000403
1465 Ga0055526_1002818
1466 Ga0055526_1012650
1467 Ga0055524_1000061
1468 Ga0055524_1000789
1469 Ga0055524_1006013
1470 Ga0055536_1002760
1471 Ga0055530_10002372
1472 Ga0055540_1000026
1473 Ga0055531_10027659
1474 Ga0055543_1000158
1475 Ga0065165_1000084
1476 Ga0065165_1003834
1477 Ga0065704_10101196
1478 Ga0065712_10077146
1479 Ga0065715_10002994
1480 Ga0065707_10004904
1481 Ga0065707_10114068
1482 Ga0070690_100003582
1483 Ga0070690_100009128
1484 Ga0070670_100000001
1485 Ga0070670_100000095
1486 Ga0070670_100011486
1487 Ga0070670_100058327
1488 Ga0070670_100128254
1489 Ga0070670_100232100
1490 Ga0070677_10052188
1491 Ga0070677_10066304
1492 Ga0070666_10008240
1493 Ga0070666_10008433
1494 Ga0070666_10022918
1495 Ga0070680_100036315
1496 Ga0070680_100124089
1497 Ga0070680_100129635
1498 Ga0070680_100260627
1499 Ga0068868_100025316
1500 Ga0070660_100007853
1501 Ga0070689_100017803
1502 Ga0070689_100027792
1503 Ga0070687_100103610
1504 Ga0070668_100077261
1505 Ga0070668_100077888
1506 Ga0070669_100003348
1507 Ga0070669_100005889
1508 Ga0070675_100017449
1509 Ga0070675_100019228
1510 Ga0070675_100032654
1511 Ga0070671_100000008
1512 Ga0070671_100036107
1513 Ga0070674_100034401
1514 Ga0070673_100011286
1515 Ga0070688_100014320
1516 Ga0070688_100050573
1517 Ga0070667_100000023
1518 Ga0070667_100000116
1519 Ga0070667_100043273
1520 Ga0070667_100084988
1521 Ga0070667_100247865
1522 Ga0070710_10001104
1523 Ga0070701_10074240
1524 Ga0070705_100031594
1525 Ga0070705_100040575
1526 Ga0070708_100052938
1527 Ga0070678_100031951
1528 Ga0070678_100036939
1529 Ga0070678_100115763
1530 Ga0070681_10000808
1531 Ga0070681_10025626
1532 Ga0068867_100041560
1533 Ga0070685_10000007
1534 Ga0070685_10068977
1535 Ga0070706_100009688
1536 Ga0070706_100015675
1537 Ga0070706_100216805
1538 Ga0070707_100002461
1539 Ga0070707_100006029
1540 Ga0070707_100060644
1541 Ga0070698_100001987
1542 Ga0070698_100004345
1543 Ga0070699_100002830
1544 Ga0070699_100039132
1545 Ga0070699_100195352
1546 Ga0070699_100202437
1547 Ga0070684_100076965
1548 Ga0070697_100006577
1549 Ga0068853_100002303
1550 Ga0068853_100025799
1551 Ga0068853_100238424
1552 Ga0070672_100012851
1553 Ga0070672_100230904
1554 Ga0070672_100271197
1555 Ga0070686_100095608
1556 Ga0070686_100168088
1557 Ga0070695_100004821
1558 Ga0070696_100020844
1559 Ga0070665_100007908
1560 Ga0070665_100017258
1561 Ga0070665_100107192
1562 Ga0070665_100238851
1563 Ga0070704_100044646
1564 Ga0068855_100013608
1565 Ga0068855_100035817
1566 Ga0068855_100095697
1567 Ga0070664_100022513
1568 Ga0070664_100033055
1569 Ga0070664_100037216
1570 Ga0068857_100034814
1571 Ga0068854_100020014
1572 Ga0068854_100037222
1573 Ga0068856_100030133
1574 Ga0070702_100002988
1575 Ga0068852_100002040
1576 Ga0068852_100069392
1577 Ga0068859_100000668
1578 Ga0068859_100006383
1579 Ga0068859_100017106
1580 Ga0068859_100017495
1581 Ga0068859_100051193
1582 Ga0068859_100063413
1583 Ga0068859_100074880
1584 Ga0068859_100238140
1585 Ga0068864_100000012
1586 Ga0068864_100005239
1587 Ga0068864_100014954
1588 Ga0068864_100028391
1589 Ga0068864_100081545
1590 Ga0068861_100007061
1591 Ga0068861_100025828
1592 Ga0068861_100164950
1593 Ga0068851_10031070
1594 Ga0068870_10002937
1595 Ga0068863_100008263
1596 Ga0068863_100037293
1597 Ga0068863_100041004
1598 Ga0068863_100089215
1599 Ga0068863_100252924
1600 Ga0068858_100000277
1601 Ga0068858_100020349
1602 Ga0068858_100026415
1603 Ga0068858_100041035
1604 Ga0068858_100049389
1605 Ga0068858_100183098
1606 Ga0068858_100185801
1607 Ga0068858_100262419
1608 Ga0068858_100325902
1609 Ga0068860_100000179
1610 Ga0068860_100000928
1611 Ga0068860_100001934
1612 Ga0068860_100004331
1613 Ga0068860_100032404
1614 Ga0068860_100064120
1615 Ga0068860_100090703
1616 Ga0068862_100000023
1617 Ga0068862_100020342
1618 Ga0068862_100024291
1619 Ga0068862_100076106
1620 Ga0068862_100115327
1621 Ga0068862_100125365
1622 Ga0081455_10003635
1623 Ga0081538_10009289
1624 Ga0081540_1008024
1625 Ga0081540_1042137
1626 Ga0081539_10005442
1627 Ga0075365_10055948
1628 Ga0075365_10087006
1629 Ga0075368_10059850
1630 Ga0075363_100073249
1631 Ga0075364_10029947
1632 Ga0075367_10048240
1633 Ga0075367_10101414
1634 Ga0075366_10053164
1635 Ga0075366_10062662
1636 Ga0075366_10078689
1637 Ga0075366_10111357
1638 Ga0097621_100008990
1639 Ga0097621_100026654
1640 Ga0097621_100044981
1641 Ga0097621_100154976
1642 Ga0075370_10026675
1643 Ga0068871_100025223
1644 Ga0068871_100040634
1645 Ga0068871_100048649
1646 Ga0068871_100121143
1647 Ga0075428_100000060
1648 Ga0075433_10085443
1649 Ga0075433_10206822
1650 Ga0075434_100129087
1651 Ga0075434_100325279
1652 Ga0068865_100055560
1653 Ga0075436_100000008
1654 Ga0097620_100000668
1655 Ga0097620_100006383
1656 Ga0097620_100017106
1657 Ga0097620_100017496
1658 Ga0097620_100051192
1659 Ga0097620_100063413
1660 Ga0097620_100074883
1661 Ga0097620_100238152
1662 Ga0099825_1022929
1663 Ga0099824_1025812
1664 Ga0099822_1007677
1665 Ga0079104_1000093
1666 Ga0079104_1002731
1667 Ga0079104_1005856
1668 Ga0099794_10000291
1669 Ga0105240_10010945
1670 Ga0105240_10136790
1671 Ga0111539_10000002
1672 Ga0111539_10000050
1673 Ga0111539_10004626
1674 Ga0111539_10102811
1675 Ga0111539_10109105
1676 Ga0111539_10155248
1677 Ga0105245_10012954
1678 Ga0105247_10000003
1679 Ga0105247_10007589
1680 Ga0105247_10015183
1681 Ga0105247_10025927
1682 Ga0114129_10038907
1683 Ga0114129_10049278
1684 Ga0114129_10062012
1685 Ga0114129_10092285
1686 Ga0114129_10099497
1687 Ga0114129_10270891
1688 Ga0114129_10282551
1689 Ga0105243_10101570
1690 Ga0105241_10064936
1691 Ga0105241_10086598
1692 Ga0105241_10108804
1693 Ga0105241_10280166
1694 Ga0105242_10009081
1695 Ga0105242_10014725
1696 Ga0105242_10037035
1697 Ga0105248_10045650
1698 Ga0105248_10300329
1699 Ga0105237_10000659
1700 Ga0105237_10003125
1701 Ga0105237_10007526
1702 Ga0105237_10063666
1703 Ga0105237_10071599
1704 Ga0105237_10085691
1705 Ga0105237_10161736
1706 Ga0105237_10205210
1707 Ga0105238_10013092
1708 Ga0105238_10015087
1709 Ga0105249_10000004
1710 Ga0105249_10011832
1711 Ga0105249_10017322
1712 Ga0105249_10094769
1713 Ga0105249_10140229
1714 Ga0105249_10189362
1715 Ga0105239_10041756
1716 Ga0105239_10043547
1717 Ga0105239_10048669
1718 Ga0105239_10090435
1719 Ga0105239_10115790
1720 Ga0105239_10119301
1721 Ga0105239_10248527
1722 Ga0105246_10000071
1723 Ga0157373_10002597
1724 Ga0157373_10010988
1725 Ga0157373_10055873
1726 Ga0157369_10085402
1727 Ga0157369_10107931
1728 Ga0171463_1001
1729 Ga0157374_10031258
1730 Ga0157374_10103653
1731 Ga0157378_10023318
1732 Ga0163162_10009664
1733 Ga0163162_10135162
1734 Ga0157372_10308227
1735 Ga0157375_10006167
1736 Ga0157375_10081203
1737 Ga0157375_10084021
1738 Ga0157375_10296498
1739 Ga0163163_10000026
1740 Ga0163163_10000436
1741 Ga0163163_10015631
1742 Ga0163163_10018136
1743 Ga0163163_10020521
1744 Ga0163163_10033994
1745 Ga0163163_10063306
1746 Ga0163163_10087176
1747 Ga0163163_10173783
1748 Ga0163163_10204098
1749 Ga0157380_10000514
1750 Ga0157380_10006982
1751 Ga0157380_10008405
1752 Ga0157380_10010159
1753 Ga0157380_10013232
1754 Ga0157380_10024587
1755 Ga0157380_10028179
1756 Ga0157380_10101542
1757 Ga0157380_10162018
1758 Ga0182008_10015167
1759 Ga0157379_10031766
1760 Ga0157379_10043503
1761 Ga0183365_10137
1762 Ga0183363_1032
1763 Ga0163161_10044606
1764 Ga0214542_1000011
1765 Ga0214542_1008060
1766 Ga0214543_1000004
1767 Ga0214543_1000259
1768 Ga0213876_10002813
1769 Ga0213871_10004950
1770 Ga0228711_1000019
1771 Ga0228710_1000022
1772 Ga0207672_1000445
1773 Ga0209563_103701
1774 Ga0207425_1000736
1775 Ga0209026_1000013
1776 Ga0209677_100643
1777 Ga0209677_103007
1778 Ga0209148_1000266
1779 Ga0209148_1000474
1780 Ga0209148_1009957
1781 Ga0209148_1011910
1782 Ga0209759_1000149
1783 Ga0209129_1000113
1784 Ga0209129_1002521
1785 Ga0209233_1000102
1786 Ga0209233_1000201
1787 Ga0209233_1003536
1788 Ga0209233_1003653
1789 Ga0209455_1000234
1790 Ga0209455_1001414
1791 Ga0209455_1004746
1792 Ga0209673_1003797
1793 Ga0209130_1000005
1794 Ga0209676_1000097
1795 Ga0209676_1008514
1796 Ga0209025_1000044
1797 Ga0209025_1000295
1798 Ga0209564_1000093
1799 Ga0209564_1000186
1800 Ga0209758_1000172
1801 Ga0209758_1003660
1802 Ga0209758_1015042
1803 Ga0209050_1000228
1804 Ga0209050_1000489
1805 Ga0209050_1004684
1806 Ga0209256_1000027
1807 Ga0209256_1000030
1808 Ga0209256_1002044
1809 Ga0207426_1000015
1810 Ga0209051_1000004
1811 Ga0209051_1025463
1812 Ga0209257_1000423
1813 Ga0209257_1010078
1814 Ga0207682_10008562
1815 Ga0207682_10054532
1816 Ga0207682_10059892
1817 Ga0207692_10054139
1818 Ga0207710_10000001
1819 Ga0207710_10010227
1820 Ga0207710_10015559
1821 Ga0207710_10027279
1822 Ga0207688_10054327
1823 Ga0207699_10074917
1824 Ga0207645_10066238
1825 Ga0207645_10131458
1826 Ga0207643_10004683
1827 Ga0207643_10039937
1828 Ga0207705_10148970
1829 Ga0207684_10045941
1830 Ga0207684_10094752
1831 Ga0207654_10046135
1832 Ga0207654_10073132
1833 Ga0207707_10006417
1834 Ga0207707_10023883
1835 Ga0207695_10000008
1836 Ga0207695_10113346
1837 Ga0207671_10001797
1838 Ga0207671_10062949
1839 Ga0207671_10070889
1840 Ga0207671_10108418
1841 Ga0207693_10041585
1842 Ga0207663_10069960
1843 Ga0207660_10096169
1844 Ga0207662_10003226
1845 Ga0207646_10000897
1846 Ga0207681_10001769
1847 Ga0207681_10002874
1848 Ga0207694_10003165
1849 Ga0207694_10168470
1850 Ga0207650_10000002
1851 Ga0207650_10000006
1852 Ga0207650_10093386
1853 Ga0207659_10185954
1854 Ga0207664_10028123
1855 Ga0207644_10000019
1856 Ga0207644_10005864
1857 Ga0207644_10044518
1858 Ga0207706_10001920
1859 Ga0207706_10087741
1860 Ga0207706_10147100
1861 Ga0207686_10015421
1862 Ga0207670_10004621
1863 Ga0207704_10023768
1864 Ga0207704_10049131
1865 Ga0207691_10026129
1866 Ga0207691_10050920
1867 Ga0207691_10083656
1868 Ga0207691_10091002
1869 Ga0207691_10102332
1870 Ga0207691_10145852
1871 Ga0207711_10003845
1872 Ga0207711_10005157
1873 Ga0207711_10203326
1874 Ga0207689_10037772
1875 Ga0207689_10139500
1876 Ga0207679_10058560
1877 Ga0207667_10009181
1878 Ga0207667_10063348
1879 Ga0207667_10417946
1880 Ga0207651_10018310
1881 Ga0207651_10131574
1882 Ga0207712_10000008
1883 Ga0207712_10013011
1884 Ga0207712_10018934
1885 Ga0207640_10140741
1886 Ga0207658_10000001
1887 Ga0207658_10000566
1888 Ga0207658_10020522
1889 Ga0207658_10293016
1890 Ga0207703_10000080
1891 Ga0207703_10049252
1892 Ga0207703_10096342
1893 Ga0207703_10139946
1894 Ga0207703_10168821
1895 Ga0207639_10002007
1896 Ga0207639_10025773
1897 Ga0207639_10111072
1898 Ga0207708_10027499
1899 Ga0207708_10063572
1900 Ga0207708_10083355
1901 Ga0207641_10010982
1902 Ga0207641_10034514
1903 Ga0207641_10062192
1904 Ga0207641_10070522
1905 Ga0207641_10072330
1906 Ga0207641_10290615
1907 Ga0207648_10010770
1908 Ga0207648_10089361
1909 Ga0207648_10273239
1910 Ga0207676_10000001
1911 Ga0207676_10011127
1912 Ga0207676_10020600
1913 Ga0207674_10033670
1914 Ga0207675_100001206
1915 Ga0207675_100002146
1916 Ga0207675_100006135
1917 Ga0207675_100031090
1918 Ga0207675_100038809
1919 Ga0207675_100104968
1920 Ga0207675_100180377
1921 Ga0207683_10016248
1922 Ga0207683_10019417
1923 Ga0207683_10082422
1924 Ga0207698_10130633
1925 Ga0209281_1000084
1926 Ga0209281_1000200
1927 Ga0209281_1000227
1928 Ga0209589_1000042
1929 Ga0209489_100095
1930 Ga0209700_100095
1931 Ga0209282_1000042
1932 Ga0209588_1002309
1933 Ga0209974_10015904
1934 Ga0207428_10000026
1935 Ga0207428_10000937
1936 Ga0268266_10001081
1937 Ga0268266_10009418
1938 Ga0268266_10026439
1939 Ga0268266_10044635
1940 Ga0268266_10068908
1941 Ga0268266_10171582
1942 Ga0268265_10000035
1943 Ga0268265_10000436
1944 Ga0268265_10045156
1945 Ga0268264_10000061
1946 Ga0268264_10000153
1947 Ga0268264_10002586
1948 Ga0268264_10003066
1949 Ga0268264_10020209
1950 Ga0268264_10056606
1951 Ga0307517_10000115
1952 Ga0307517_10040568
1953 Ga0307517_10065943
1954 Ga0307515_10000123
1955 Ga0307515_10001309
1956 Ga0307515_10006687
1957 Ga0307515_10006795
1958 Ga0307515_10010448
1959 Ga0307515_10042388
1960 Ga0307515_10076789
1961 Ga0307515_10186638
1962 Ga0265338_10023127
1963 Ga0307511_10000541
1964 Ga0307511_10062089
1965 Ga0307512_10034667
1966 Ga0316181_1183610
1967 Ga0265325_10048230
1968 Ga0265316_10013079
1969 Ga0307513_10002506
1970 Ga0307513_10012786
1971 Ga0307513_10015322
1972 Ga0307513_10095926
1973 Ga0307513_10124414
1974 Ga0307509_10000333
1975 Ga0307509_10000539
1976 Ga0307509_10022078
1977 Ga0307509_10033967
1978 Ga0307509_10036877
1979 Ga0307509_10086071
1980 Ga0307509_10200130
1981 Ga0307408_100022215
1982 Ga0307408_100074110
1983 Ga0307508_10000640
1984 Ga0307508_10000727
1985 Ga0307508_10006268
1986 Ga0307508_10008420
1987 Ga0307508_10079883
1988 Ga0307514_10001271
1989 Ga0307514_10019042
1990 Ga0265314_10058516
1991 Ga0265342_10076793
1992 Ga0316576_10003425
1993 Ga0316578_10111996
1994 Ga0307516_10017736
1995 Ga0307516_10033117
1996 Ga0307516_10156730
1997 Ga0307516_10162414
1998 Ga0307405_10010158
1999 Ga0307413_10030431
2000 Ga0307413_10117523
2001 Ga0307413_10144382
2002 Ga0307410_10041291
2003 Ga0307410_10057438
2004 Ga0307406_10010677
2005 Ga0307407_10025776
2006 Ga0307412_10010376
2007 Ga0307412_10099922
2008 Ga0307412_10106108
2009 Ga0307412_10127381
2010 Ga0315914_1000009
2011 Ga0307409_100000814
2012 Ga0307409_100039573
2013 Ga0307409_100154027
2014 Ga0307416_100021865
2015 Ga0307414_10013742
2016 Ga0307414_10084921
2017 Ga0307411_10001811
2018 Ga0307411_10003000
2019 Ga0307411_10046706
2020 Ga0307411_10157309
2021 Ga0307415_100203445
2022 Ga0307510_10000023
2023 Ga0307510_10007145
2024 Ga0307510_10056415
2025 Ga0307510_10065641
2026 Ga0307510_10071237
2027 Ga0307510_10104077
2028 Ga0315913_1000015
2029 Ga0315915_1000013
2030 Ga0316574_0063443
2031 Ga0373931_0037306
2032 Ga0373927_0000141
2033 Ga0373937_0253682
2034 Ga0316582_0006931
2035 Ga0316582_0178748
2036 Ga0373925_0002260
2037 Ga0373925_0037538
2038 Ga0373925_0289752
2039 Ga0395905_0000091
2040 Ga0395905_0001489
2041 Ga0395905_0023190
2042 Ga0395905_0140917
2043 Ga0395901_0004559
2044 Ga0400483_150886
2045 Ga0436365_0492506
2046 Ga0436360_1140827
2047 Ga0436361_0276468
2048 Ga0439465_0029187
2049 Ga0451791_1040051
2050 Ga0451807_0254012
2051 Ga0439433_0011253
2052 Ga0439449_0009998
2053 Ga0439462_0006603
2054 Ga0450919_000188
2055 Ga0450896_005054
2056 Ga0439459_0015402
2057 Ga0451577_0003794
2058 Ga0466969_0000198
2059 Ga0453683_0021967
2060 Ga0466966_0004454
2061 Ga0466966_0012023
2062 Ga0466961_0008979
2063 Ga0466961_0035887
2064 Ga0466963_0004084
2065 Ga0453684_0126776
2066 Ga0466971_0007674
2067 Ga0466970_0012562
2068 Ga0466957_0050523
2069 Ga0466959_0016963
2070 Ga0451576_0004545
2071 Ga0451576_0328538
2072 Ga0466958_0014422
2073 Ga0466967_0014366
2074 Ga0495617_000377
2075 Ga0495638_0002960
2076 Ga0495638_0003111
2077 Ga0495638_0032266
2078 Ga0495638_0033066
2079 Ga0495638_0042772
2080 Ga0495653_0000009
2081 Ga0495650_0000184
2082 Ga0495650_0000240
2083 Ga0495584_0001561
2084 Ga0495606_0001061
2085 Ga0495606_0004320
2086 Ga0495610_0009062
2087 Ga0495610_0024493
2088 Ga0495616_0005415
2089 Ga0495632_0003595
2090 Ga0495632_0015652
2091 Ga0495644_0000287
2092 Ga0495654_0062965
2093 Ga0495609_0000866
2094 Ga0495609_0083056
2095 Ga0495645_0034890
2096 Ga0495656_0002526
2097 Ga0495656_0022562
2098 Ga0495668_0000002
2099 Ga0495668_0002028
2100 Ga0495668_0008340
2101 Ga0495668_0044664
2102 Ga0495611_0000347
2103 Ga0495625_0000990
2104 Ga0495625_0007420
2105 Ga0495625_0025679
2106 Ga0495625_0037357
2107 Ga0495625_0091715
2108 Ga0495658_0154754
2109 Ga0495671_0000926
2110 Ga0495649_0022211
2111 Ga0495677_0000287
2112 Ga0495681_0034048
2113 Ga0495686_0040467
2114 Ga0495686_0040964
2115 Ga0496101_0099942
2116 Ga0496101_0100295
2117 Ga0496102_0003979
2118 Ga0496102_0105810
2119 Ga0496102_0109711
2120 Ga0496104_0010257
2121 Ga0496104_0030153
2122 Ga0496105_0070919
2123 Ga0496106_0000980
2124 Ga0496106_0004082
2125 Ga0496107_0172183
2126 Ga0496109_0031019
2127 Ga0496111_0199515
2128 Ga0496112_0004020
2129 Ga0496114_0004364
2130 Ga0496114_0027194
2131 Ga0496114_0090051
2132 Ga0496114_0142678
2133 Ga0496114_0167835
2134 Ga0496116_0014580
2135 Ga0496117_0000434
2136 Ga0496117_0002639
2137 Ga0496117_0005831
2138 Ga0496118_0005579
2139 Ga0496119_0013173
2140 Ga0496120_0001446
2141 Ga0496121_0000353
2142 Ga0496121_0006775
2143 Ga0496121_0018849
2144 Ga0496121_0052320
2145 Ga0496122_0000137
2146 Ga0496122_0001470
2147 Ga0496123_0000018
2148 Ga0496123_0000022
2149 Ga0496124_0000285
2150 Ga0496124_0003608
2151 Ga0496124_0022230
2152 Ga0496124_0192186
2153 Ga0496124_0198544
2154 Ga0496125_0000215
2155 Ga0496125_0000318
2156 Ga0496125_0025330
2157 Ga0496125_0038719
2158 Ga0496126_0080068
2159 Ga0496126_0108498
2160 Ga0495682_0000291
2161 Ga0495682_0033963
2162 Ga0501033_0153066
2163 Ga0501033_0171860
2164 Ga0501034_0000807
2165 Ga0501034_0070465
2166 Ga0501034_0123694
2167 Ga0501034_0202866
2168 Ga0501034_0260860
2169 Ga0501036_0076433
2170 Ga0501036_0133631
2171 Ga0501037_0057199
2172 Ga0501041_0121754
2173 Ga0501046_0013179
2174 Ga0501046_0096412
2175 Ga0501047_0033253
2176 Ga0501067_0033911
2177 Ga0501069_0046654
2178 Ga0501070_0167135
2179 Ga0501071_0016463
2180 Ga0501072_0130240
2181 Ga0501073_0001736
2182 Ga0501076_0037579
2183 Ga0501076_0057722
2184 Ga0501077_0027847
2185 Ga0501077_0088836
2186 Ga0501079_0010367
2187 Ga0501080_0000921
2188 Ga0501080_0093028
2189 Ga0501080_0298596
2190 Ga0501081_0026182
2191 Ga0501081_0127915
2192 Ga0501083_0007148
2193 Ga0501035_0000263
2194 Ga0501035_0017062
2195 Ga0501035_0169841
2196 Ga0501044_0059852
2197 Ga0501045_0106666
2198 Ga0501045_0199936
2199 nmdc:mga03n38_52311_c1
2200 nmdc:mga00v17_23585_c1
2201 nmdc:mga0yw44_6756_c1
2202 nmdc:mga0k408_61113_c1
2203 nmdc:mga0k408_8011_c1
2204 nmdc:mga06z11_3482_c1
2205 nmdc:mga06z11_56445_c1
2206 nmdc:mga07m45_156856_c1
2207 nmdc:mga07m45_28522_c1
2208 nmdc:mga05p37_152813_c1
2209 nmdc:mga05p37_15503_c1
2210 nmdc:mga05p37_49098_c1
2211 nmdc:mga05p37_756_c1
2212 nmdc:mga06r32_94733_c1
2213 nmdc:mga08y16_143302_c1
2214 nmdc:mga08y16_2_c1
2215 nmdc:mga08y16_33_c1
2216 nmdc:mga08y16_39329_c1
2217 nmdc:mga08y16_53155_c1
2218 nmdc:mga0n895_128986_c1
2219 nmdc:mga0n895_377336_c1
2220 nmdc:mga0rr50_125558_c1
2221 nmdc:mga0rr50_555_c1
2222 nmdc:mga08x19_16_c1
2223 nmdc:mga0a205_100102_c1
2224 nmdc:mga0a205_125077_c1
2225 nmdc:mga0a205_138747_c1
2226 nmdc:mga0a205_203908_c1
2227 nmdc:mga0a205_263127_c1
2228 nmdc:mga0a205_40160_c1
2229 nmdc:mga0a205_65705_c1
2230 Ga0500578_0001295
2231 Ga0500643_000173
2232 Ga0500644_0017307
2233 Ga0500644_0045479
2234 Ga0500647_0010667
2235 Ga0500566_0000353
2236 Ga0500640_000097
2237 Ga0500555_007872
2238 Ga0500556_0000447
2239 Ga0500572_000165
2240 Ga0500572_000219
2241 Ga0500592_012512
2242 Ga0500595_017015
2243 Ga0500608_000287
2244 Ga0500608_003613
2245 Ga0500614_001090
2246 Ga0500652_000611
2247 Ga0500559_0000241
2248 Ga0500559_0003511
2249 Ga0500559_0004615
2250 Ga0500568_0001443
2251 Ga0500577_0002449
2252 Ga0500603_001328
2253 Ga0500616_0000554
2254 Ga0500616_0000902
2255 Ga0500620_020810
2256 Ga0500622_0000146
2257 Ga0500622_0007254
2258 Ga0500627_0000002
2259 Ga0500627_0058474
2260 Ga0500630_001600
2261 Ga0500634_0003106
2262 Ga0500638_009701
2263 Ga0500639_000023
2264 Ga0500639_005725
2265 Ga0500636_0029297
2266 Ga0500636_0029703
2267 Ga0500637_0036213
2268 Ga0500596_000750
2269 Ga0500587_001814
2270 Ga0501084_0012130
2271 Ga0501082_0092288
2272 Ga0466962_0000986
2273 2551725600
2274 2503204654
2275 2508729199
2276 2509078009
2277 2509106951
2278 2509117880
2279 2509145538
2280 2509370175
2281 2509375093
2282 2509448425
2283 2510303561
2284 2510319699
2285 2511168621
2286 2511184475
2287 2511199836
2288 2511500433
2289 2512531893
2290 2512934620
2291 2512962966
2292 2512972778
2293 2513585409
2294 2513602833
2295 2513613549
2296 2513616657
2297 2513639516
2298 2513721414
2299 2513885653
2300 2513903996
2301 2513911468
2302 2513986207
2303 2513996672
2304 2514005085
2305 2514039036
2306 2514419094
2307 2514589385
2308 2515607635
2309 2515642528
2310 2516204428
2311 2516891765
2312 2517568563
2313 2524450620
2314 2530644541
2315 2551677055
2316 2551684021
2317 2551704015
2318 2551710324
2319 2551719191
2320 2551736324
2321 2551743814
2322 2558866197
2323 2585164905
2324 2585231954
2325 2585265283
2326 2585278258
2327 2585385583
2328 2585391999
2329 2585532082
2330 2587730720
2331 2587736984
2332 2587758090
2333 2588294900
2334 2588514232
2335 2597816475
2336 2599332400
2337 2599720767
2338 2599935902
2339 2600191359
2340 2616307776
2341 2643771809
2342 2643806193
2343 2643832745
2344 2643839579
2345 2643909516
2346 2643964347
2347 2643967744
2348 2643988257
2349 2644003454
2350 2644047248
2351 2644053460
2352 2644070203
2353 2644103339
2354 2644140566
2355 2644144278
2356 2644156501
2357 2644164400
2358 2644195554
2359 2644199619
2360 2644243939
2361 2644273533
2362 2644306269
2363 2644330518
2364 2644346329
2365 2644377455
2366 2644411085
2367 2644420965
2368 2644454488
2369 2644480037
2370 2644496850
2371 2644542735
2372 2644611880
2373 2644671871
2374 2644692426
2375 2657681807
2376 2671695376
2377 2688601275
2378 2692317348
2379 2694632389
2380 2694640525
2381 2719183808
2382 2719728249
2383 2720611192
2384 2721145110
2385 2721155847
2386 2721167197
2387 2722838175
2388 2723578448
2389 2724042443
2390 2730161948
2391 2730300954
2392 2738945072
2393 2739308297
2394 2739790981
2395 2753461255
2396 2756674713
2397 2765469047
2398 2774871506
2399 2776258853
2400 2792583012
2401 2792623899
2402 2792629721
2403 2792638055
2404 2792746415
2405 2793298934
2406 2793317169
2407 2793324002
2408 2793325688
2409 2793333113
2410 2793340088
2411 2793346285
2412 2793355502
2413 2802720404
2414 2802726224
2415 2802731612
2416 2802739363
2417 2802742505
2418 2802749210
2419 2804750827
2420 2805929099
2421 2805937200
2422 2835312838
2423 2838027223
2424 2838045913
2425 2838075279
2426 2838671537
2427 2838704196
2428 2841735686
2429 2842149186
2430 2842195303
2431 2842203404
2432 2842210326
2433 2842253647
2434 2842270238
2435 2842283780
2436 2842319046
2437 2842434060
2438 2842440451
2439 2842444024
2440 2842468479
2441 2842474997
2442 2842486981
2443 2842491496
2444 2842499564
2445 2842521602
2446 2842922668
2447 2844004271
2448 2844009936
2449 2844165153
2450 2844319556
2451 2847417584
2452 2847689286
2453 2848992390
2454 2850079887
2455 2854916636
2456 2855828133
2457 2855839905
2458 2855873471
2459 2856314762
2460 2856328245
2461 2856332196
2462 2856338886
2463 2856348670
2464 2856350655
2465 2856367296
2466 2857354185
2467 2857371050
2468 2858803878
2469 2869164677
2470 2869171938
2471 2869236424
2472 2869244021
2473 2869253765
2474 2869257869
2475 2869269506
2476 2869277845
2477 2869282210
2478 2869287579
2479 2871431103
2480 2871436650
2481 2871449899
2482 2871452507
2483 2871465886
2484 2871469612
2485 2871480573
2486 2871485123
2487 2871502066
2488 2874105442
2489 2874109965
2490 2874119028
2491 2874129661
2492 2874136801
2493 2874145532
2494 2874150375
2495 2874157430
2496 2874164565
2497 2874171602
2498 2876363117
2499 2876370747
2500 2876381159
2501 2876392686
2502 2876394220
2503 2876404370
2504 2876416526
2505 2876427484
2506 2878736685
2507 2878740184
2508 2878747716
2509 2878755050
2510 2878765967
2511 2878773189
2512 2878793685
2513 2881158559
2514 2881164235
2515 2881861497
2516 2882459405
2517 2882632919
2518 2885306100
2519 2885314839
2520 2885327995
2521 2885340462
2522 2885343291
2523 2885353625
2524 2888342544
2525 2888350254
2526 2888352120
2527 2889014105
2528 2889021185
2529 2889792856
2530 2889915011
2531 2891376690
2532 2894237114
2533 2894820716
2534 2895883379
2535 2896391647
2536 2903449471
2537 2903498832
2538 2903499464
2539 2903517854
2540 2903525067
2541 2903531514
2542 2903546949
2543 2903734493
2544 2904660936
2545 2906310117
2546 2906322989
2547 2906329059
2548 2906355469
2549 2906367746
2550 2906372477
2551 2906384089
2552 2906392454
2553 2906395155
2554 2906406875
2555 2906411472
2556 2906414951
2557 2906435715
2558 2906609288
2559 2913298083
2560 2913309698
2561 2915652492
2562 2915980693
2563 2915990567
2564 2915998210
2565 2916001014
2566 2916011095
2567 2916015515
2568 2916025438
2569 2916031124
2570 2916036421
2571 2916045662
2572 2916053733
2573 2916057312
2574 2916063740
2575 2916068687
2576 2916082169
2577 2917558091
2578 2920763487
2579 2920823277
2580 2921207032
2581 2921212228
2582 2921242014
2583 2921248910
2584 2921257249
2585 2921260928
2586 2921266387
2587 2921288504
2588 2921294443
2589 2921302837
2590 2922137066
2591 2922156953
2592 2922161052
2593 2922175223
2594 2922183997
2595 2922187164
2596 2924149818
2597 2924156595
2598 2924163403
2599 2924170423
2600 2924177706
2601 2924183560
2602 2924190796
2603 2924199067
2604 2924205599
2605 2924209141
2606 2924216527
2607 2924228339
2608 2924232827
2609 2924722953
2610 2924738104
2611 2924744348
2612 2924749445
2613 2924762734
2614 2924768377
2615 2924777784
2616 2924791269
2617 2932404247
2618 2932795551
2619 2932807853
2620 2935886030
2621 2936370237
2622 2936377909
2623 2936384104
2624 2936997840
2625 2937007629
2626 2937014877
2627 2937022379
2628 2937023297
2629 2937034619
2630 2937041220
2631 2937045973
2632 2937051814
2633 2937062655
2634 2937068355
2635 2937074828
2636 2937078831
2637 2937086625
2638 2937095221
2639 2937104411
2640 2937112423
2641 2937119551
2642 2937126111
2643 2937131534
2644 2937815403
2645 2937825862
2646 2937837117
2647 2937845985
2648 2937851090
2649 2937867466
2650 2937874306
2651 2937881591
2652 2937892944
2653 2937976826
2654 2937986413
2655 2938000500
2656 2941500811
2657 2941534932
2658 2957382147
2659 2957388597
2660 2957393976
2661 2957399094
2662 2957403355
2663 2957412023
2664 2957418125
2665 2957434082
2666 2957442548
2667 2957447218
2668 2957455251
2669 2957462732
2670 2957466224
2671 2957472155
2672 2957479693
2673 2957484910
2674 2957496125
2675 2957500588
2676 2957508204
2677 2958037984
2678 2958042166
2679 2958049298
2680 2958066576
2681 2958076460
2682 2958088721
2683 2958095319
2684 2958102419
2685 2958113560
2686 2958119824
2687 2958125137
2688 2958131981
2689 2958141906
2690 2958151069
2691 2958171157
2692 2958174945
2693 2958181784
2694 2960589364
2695 2960594676
2696 2960603471
2697 2960608780
2698 2960614395
2699 2960621606
2700 2960628900
2701 2960637547
2702 2960645030
2703 2960648006
2704 2960658383
2705 2960660502
2706 2960672263
2707 2960677211
2708 2960686521
2709 2960690376
2710 2960698914
2711 2961079628
2712 2961120600
2713 2961136265
2714 2961140506
2715 2961169586
2716 2961176908
2717 2961187900
2718 2963650996
2719 2964610199
2720 2964618927
2721 2964627982
2722 2964632714
2723 2964639036
2724 2964649304
2725 2964650241
2726 2964661157
2727 2964668172
2728 2964677324
2729 2964683382
2730 2964690611
2731 2964694700
2732 2964700570
2733 2964709885
2734 2964717307
2735 2964722969
2736 2965024074
2737 2965029003
2738 2965035758
2739 2965050288
2740 2965067683
2741 2965095730
2742 2967671509
2743 2967675357
2744 2967684794
2745 2967691435
2746 2967694979
2747 2967704130
2748 2967712160
2749 2967714573
2750 2967722552
2751 2967730468
2752 2967739323
2753 2967745641
2754 2967754962
2755 2967759328
2756 2967766480
2757 2967774642
2758 2967782554
2759 2968000989
2760 2968007042
2761 2968021470
2762 2968085712
2763 2968093078
2764 2968102716
2765 2968111909
2766 2968120257
2767 2968130450
2768 2968177990
2769 2970022866
2770 2970030489
2771 2970037035
2772 2970041190
2773 2970052810
2774 2970056767
2775 2970067896
2776 2970073931
2777 2970081698
2778 2970088460
2779 2970091377
2780 2970101995
2781 2970105908
2782 2970115681
2783 2970117547
2784 2970124301
2785 2970131477
2786 2970136684
2787 2970147676
2788 2970151795
2789 2970163349
2790 2970170027
2791 2970175749
2792 2970181989
2793 2970189218
2794 2970196635
2795 2970476574
2796 2970494309
2797 2970509580
2798 2970513466
2799 2970525365
2800 2970538960
2801 2970549931
2802 2970560822
2803 2970596817
2804 2970620417
2805 2970632161
2806 2977519998
2807 2977528403
2808 2977535771
2809 2977543876
2810 2977549555
2811 2977553587
2812 2977564805
2813 2977571811
2814 2977574602
2815 2977584514
2816 2977824190
2817 2977834425
2818 2977846631
2819 2977857549
2820 2977868487
2821 2977878531
2822 2977900011
2823 2977911605
2824 2977916070
2825 2977923428
2826 2977940060
2827 2977949663
2828 2977959933
2829 2977980260
2830 2977992332
2831 2979713811
2832 2979748952
2833 2979774507
2834 2979780980
2835 2979798757
2836 2979814368
2837 2987642405
2838 2987653732
2839 2987665727
2840 2987668010
2841 2987674074
2842 2989351505
2843 2989772697
2844 2996315912
2845 2996347001
2846 2996356297
2847 2996390861
2848 2996896920
2849 3000138012
2850 3003931856
2851 3004172383
2852 3004194776
2853 3004200122
2854 3004210487
2855 3004212732
2856 3004221422
2857 3004238258
2858 3004250832
2859 3004271993
2860 3004282601
2861 3004295462
2862 3004338232
2863 3005416795
2864 3005451363
2865 637077794
2866 643824450
2867 648738526
2868 649875705
2869 8002287281
2870 8003992357
2871 8003999686
2872 8004303725
2873 8004320168
2874 8004368446
2875 8004376629
2876 8004390315
2877 8004396193
2878 8004446200
2879 8004635683
2880 8004647078
2881 8004707408
2882 8004716379
2883 8004734887
2884 8005289268
2885 8005320558
2886 8005381918
2887 8005388793
2888 8005397595
2889 8005689485
2890 8018130402
2891 8019659183
2892 8024505629
2893 8049293383
2894 8054562324
2895 8055624679
2896 8056383565
2897 8056968549
2898 8057136108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

80

305

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gjj-assembly1.cif.gz_B crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose 0.9706 5 426
3m0v-assembly1.cif.gz_C crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329l in complex with l-rhamnose 0.97 4 424
3m0y-assembly1.cif.gz_D crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant s329a in complex with l-rhamnose 0.97 4 423
3iud-assembly1.cif.gz_C cu2+-bound form of pseudomonas stutzeri l-rhamnose isomerase 0.97 4 424
4gjj-assembly1.cif.gz_B crystal structure of pseudomonas stutzeri l-rhamnose isomerase mutant h101n in complex with d-allopyranose 0.9684 5 426
ID Description Score Start End Superfamily
3m0vD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9694 4 424 3.20.20.150
3m0vD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9473 4 424 3.20.20.150
3ktcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8666 51 387 3.20.20.150
3ktcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8444 51 387 3.20.20.150
3uvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8102 26 421 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A529HK39-F1-model_v4 deleted 0.9826 75 226
AF-A0A3S2EWE7-F1-model_v4 deleted 0.9796 7 284
AF-A0A1I7M7X5-F1-model_v4 L-rhamnose isomerase / sugar isomerase 0.9794 7 283 GO:0016853
AF-A0A529L4P3-F1-model_v4 Sugar isomerase 0.9792 71 269 GO:0016853
AF-A0A3S1SYS7-F1-model_v4 Sugar isomerase 0.9786 7 206 GO:0016853

Map