F494065
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1452 | 466 | 2902 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10009508|rootH2_1000950854 |
| Length | 115 |
| Sequence | MKKIEAIIKPFKLEEVKDALADLGIEGMTVSEVKGFGRQKGHTEIYRGSEYTVDFLPKIKIEVVLSDSLLESATAAIVKAAKTGXXXKIGDGKVFVSPVEEAIRIRTDETGEKAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300001456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 99 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 146 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 147 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 148 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 149 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 150 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 151 | 3300025227 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 229 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 231 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 238 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 240 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 241 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 244 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 246 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 248 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 252 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 253 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 254 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 257 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 258 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 259 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 260 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 266 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 267 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 268 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 278 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 279 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 280 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 283 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 284 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 285 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 287 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 288 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 289 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 290 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 292 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 295 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 296 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 297 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 298 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 301 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 302 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 303 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 304 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 305 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 306 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 307 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 308 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 309 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 310 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 311 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 312 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 313 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 314 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 315 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 316 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 317 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 318 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 319 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 320 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 321 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 322 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 323 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 324 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 325 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 326 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 327 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 328 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 329 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 330 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 331 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 332 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 333 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 376 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 377 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 378 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 379 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 384 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 385 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 386 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 387 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 388 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 389 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 390 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 391 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 392 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 393 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 420 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 421 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 426 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 430 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 431 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 432 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 433 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 445 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 448 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 449 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 451 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 452 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 453 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 455 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 466 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.49 |
| Metatranscriptomes | 3.44 |
| Isolates | 0.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.96 |
| Nodule | 0 |
| Rhizoplane | 3.24 |
| Rhizosphere | 89.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10009508 | 3300003320 | Bacteria | 78035 |
| 2 | JGI24033J14998_100040 | 3300001456 | Bacteria | 1518 |
| 3 | JGI24743J22301_10000046 | 3300001991 | Bacteria | 11116 |
| 4 | JGI24033J26618_1000022 | 3300002155 | Bacteria | 24100 |
| 5 | Ga0006767J43181_102738 | 3300002868 | Bacteria | 2693 |
| 6 | Ga0006763J43179_103811 | 3300002870 | Bacteria | 1275 |
| 7 | Ga0006765J45826_107625 | 3300003161 | Bacteria | 840 |
| 8 | Ga0006778J45830_1033904 | 3300003162 | Bacteria | 881 |
| 9 | Ga0006758J48902_1014192 | 3300003300 | Bacteria | 2002 |
| 10 | rootH2_10000766 | 3300003320 | Bacteria | 10458 |
| 11 | rootH2_10087759 | 3300003320 | Bacteria | 9348 |
| 12 | rootH1_10236075 | 3300003323 | Bacteria | 1311 |
| 13 | Ga0032354_1004574 | 3300003693 | Bacteria | 3070 |
| 14 | Ga0055540_1081610 | 3300003792 | Bacteria | 619 |
| 15 | Ga0058859_10017652 | 3300004798 | Bacteria | 742 |
| 16 | Ga0058863_10089126 | 3300004799 | Bacteria | 1875 |
| 17 | Ga0058863_11301227 | 3300004799 | Bacteria | 550 |
| 18 | Ga0058863_11859074 | 3300004799 | Bacteria | 590 |
| 19 | Ga0058861_10043227 | 3300004800 | Bacteria | 838 |
| 20 | Ga0058860_11878483 | 3300004801 | Bacteria | 556 |
| 21 | Ga0058860_12243724 | 3300004801 | Bacteria | 699 |
| 22 | Ga0058862_10016066 | 3300004803 | Bacteria | 924 |
| 23 | Ga0058862_12245081 | 3300004803 | Bacteria | 610 |
| 24 | Ga0058862_12869646 | 3300004803 | Bacteria | 872 |
| 25 | Ga0065704_10200999 | 3300005289 | Bacteria | 1146 |
| 26 | Ga0065704_10735280 | 3300005289 | Bacteria | 548 |
| 27 | Ga0065712_10404380 | 3300005290 | Bacteria | 728 |
| 28 | Ga0065712_10758685 | 3300005290 | Bacteria | 526 |
| 29 | Ga0065715_10435202 | 3300005293 | Bacteria | 842 |
| 30 | Ga0065707_10638827 | 3300005295 | Bacteria | 669 |
| 31 | Ga0070658_10548068 | 3300005327 | Bacteria | 1001 |
| 32 | Ga0070676_10008133 | 3300005328 | Bacteria | 5642 |
| 33 | Ga0070676_10164732 | 3300005328 | Bacteria | 1429 |
| 34 | Ga0070676_10818777 | 3300005328 | Bacteria | 688 |
| 35 | Ga0070683_101093001 | 3300005329 | Bacteria | 766 |
| 36 | Ga0070683_101144020 | 3300005329 | Bacteria | 748 |
| 37 | Ga0070690_100013678 | 3300005330 | Bacteria | 4802 |
| 38 | Ga0070690_100030194 | 3300005330 | Bacteria | 3366 |
| 39 | Ga0070690_100231082 | 3300005330 | Bacteria | 1300 |
| 40 | Ga0070690_100842158 | 3300005330 | Bacteria | 714 |
| 41 | Ga0070690_101084178 | 3300005330 | Bacteria | 634 |
| 42 | Ga0070670_100083169 | 3300005331 | Bacteria | 2751 |
| 43 | Ga0070670_100100107 | 3300005331 | Bacteria | 2495 |
| 44 | Ga0068869_100425265 | 3300005334 | Bacteria | 1097 |
| 45 | Ga0070666_10027445 | 3300005335 | Bacteria | 3729 |
| 46 | Ga0070666_10031114 | 3300005335 | Bacteria | 3522 |
| 47 | Ga0070666_10273089 | 3300005335 | Bacteria | 1200 |
| 48 | Ga0070680_100442456 | 3300005336 | Bacteria | 1110 |
| 49 | Ga0070680_100737881 | 3300005336 | Bacteria | 848 |
| 50 | Ga0070680_101198018 | 3300005336 | Bacteria | 657 |
| 51 | Ga0070682_100903533 | 3300005337 | Bacteria | 726 |
| 52 | Ga0068868_100537999 | 3300005338 | Bacteria | 1028 |
| 53 | Ga0068868_101613712 | 3300005338 | Bacteria | 610 |
| 54 | Ga0070689_100043362 | 3300005340 | Bacteria | 3457 |
| 55 | Ga0070689_100062309 | 3300005340 | Bacteria | 2902 |
| 56 | Ga0070691_10020450 | 3300005341 | Bacteria | 3058 |
| 57 | Ga0070691_10178271 | 3300005341 | Bacteria | 1105 |
| 58 | Ga0070687_100040520 | 3300005343 | Bacteria | 2347 |
| 59 | Ga0070687_100040693 | 3300005343 | Bacteria | 2343 |
| 60 | Ga0070687_100123528 | 3300005343 | Bacteria | 1484 |
| 61 | Ga0070687_100145104 | 3300005343 | Bacteria | 1387 |
| 62 | Ga0070687_100185739 | 3300005343 | Bacteria | 1249 |
| 63 | Ga0070661_100007296 | 3300005344 | Bacteria | 7625 |
| 64 | Ga0070692_10025468 | 3300005345 | Bacteria | 2915 |
| 65 | Ga0070692_10418555 | 3300005345 | Bacteria | 850 |
| 66 | Ga0070668_100012673 | 3300005347 | Bacteria | 6276 |
| 67 | Ga0070668_100596076 | 3300005347 | Bacteria | 966 |
| 68 | Ga0070669_100031851 | 3300005353 | Bacteria | 3808 |
| 69 | Ga0070675_100024404 | 3300005354 | Bacteria | 4843 |
| 70 | Ga0070675_100100099 | 3300005354 | Bacteria | 2441 |
| 71 | Ga0070675_101813484 | 3300005354 | Bacteria | 563 |
| 72 | Ga0070675_102101375 | 3300005354 | Bacteria | 521 |
| 73 | Ga0070671_100050450 | 3300005355 | Bacteria | 3461 |
| 74 | Ga0070671_100086977 | 3300005355 | Bacteria | 2616 |
| 75 | Ga0070674_100164066 | 3300005356 | Bacteria | 1688 |
| 76 | Ga0070674_100238508 | 3300005356 | Bacteria | 1422 |
| 77 | Ga0070674_100586647 | 3300005356 | Bacteria | 940 |
| 78 | Ga0070674_100722096 | 3300005356 | Bacteria | 854 |
| 79 | Ga0070674_100782098 | 3300005356 | Bacteria | 823 |
| 80 | Ga0070673_100006487 | 3300005364 | Bacteria | 7608 |
| 81 | Ga0070673_100191763 | 3300005364 | Bacteria | 1756 |
| 82 | Ga0070673_100247337 | 3300005364 | Bacteria | 1553 |
| 83 | Ga0070673_100249130 | 3300005364 | Bacteria | 1548 |
| 84 | Ga0070673_100345424 | 3300005364 | Bacteria | 1319 |
| 85 | Ga0070673_100408817 | 3300005364 | Bacteria | 1215 |
| 86 | Ga0070688_100107250 | 3300005365 | Bacteria | 1851 |
| 87 | Ga0070688_100435253 | 3300005365 | Bacteria | 977 |
| 88 | Ga0070688_100529926 | 3300005365 | Bacteria | 893 |
| 89 | Ga0070688_100673592 | 3300005365 | Bacteria | 799 |
| 90 | Ga0070659_100044632 | 3300005366 | Bacteria | 3471 |
| 91 | Ga0070659_100173439 | 3300005366 | Bacteria | 1768 |
| 92 | Ga0070659_100263635 | 3300005366 | Bacteria | 1430 |
| 93 | Ga0070659_100633316 | 3300005366 | Bacteria | 921 |
| 94 | Ga0070659_101077065 | 3300005366 | Bacteria | 708 |
| 95 | Ga0070667_100169238 | 3300005367 | Bacteria | 1928 |
| 96 | Ga0070667_100266709 | 3300005367 | Bacteria | 1534 |
| 97 | Ga0070667_100414487 | 3300005367 | Bacteria | 1227 |
| 98 | Ga0070667_100627854 | 3300005367 | Bacteria | 991 |
| 99 | Ga0070667_101018261 | 3300005367 | Bacteria | 773 |
| 100 | Ga0070667_101055686 | 3300005367 | Bacteria | 759 |
| 101 | Ga0070709_10076963 | 3300005434 | Bacteria | 2168 |
| 102 | Ga0070714_100154716 | 3300005435 | Bacteria | 2069 |
| 103 | Ga0070713_100058956 | 3300005436 | Bacteria | 3203 |
| 104 | Ga0070713_100405479 | 3300005436 | Bacteria | 1274 |
| 105 | Ga0070713_100546412 | 3300005436 | Bacteria | 1096 |
| 106 | Ga0070713_101104026 | 3300005436 | Bacteria | 767 |
| 107 | Ga0070710_10034913 | 3300005437 | Bacteria | 2738 |
| 108 | Ga0070710_10119604 | 3300005437 | Bacteria | 1592 |
| 109 | Ga0070710_11176075 | 3300005437 | Bacteria | 566 |
| 110 | Ga0070710_11306267 | 3300005437 | Bacteria | 539 |
| 111 | Ga0070701_10026586 | 3300005438 | Bacteria | 2823 |
| 112 | Ga0070701_10085744 | 3300005438 | Bacteria | 1715 |
| 113 | Ga0070701_10142610 | 3300005438 | Bacteria | 1372 |
| 114 | Ga0070711_100106782 | 3300005439 | Bacteria | 2048 |
| 115 | Ga0070711_100150550 | 3300005439 | Bacteria | 1754 |
| 116 | Ga0070711_100489861 | 3300005439 | Bacteria | 1012 |
| 117 | Ga0070711_100549541 | 3300005439 | Bacteria | 958 |
| 118 | Ga0070711_100719610 | 3300005439 | Bacteria | 842 |
| 119 | Ga0070705_100107580 | 3300005440 | Bacteria | 1775 |
| 120 | Ga0070705_100127856 | 3300005440 | Bacteria | 1652 |
| 121 | Ga0070700_100015700 | 3300005441 | Bacteria | 4300 |
| 122 | Ga0070694_100281997 | 3300005444 | Bacteria | 1267 |
| 123 | Ga0070708_100098299 | 3300005445 | Bacteria | 2676 |
| 124 | Ga0070708_100111862 | 3300005445 | Bacteria | 2511 |
| 125 | Ga0070708_100122017 | 3300005445 | Bacteria | 2405 |
| 126 | Ga0070708_100870280 | 3300005445 | Bacteria | 846 |
| 127 | Ga0070663_100429790 | 3300005455 | Bacteria | 1085 |
| 128 | Ga0070663_101035743 | 3300005455 | Bacteria | 715 |
| 129 | Ga0070678_100343124 | 3300005456 | Bacteria | 1282 |
| 130 | Ga0070678_100419539 | 3300005456 | Bacteria | 1166 |
| 131 | Ga0070678_100880205 | 3300005456 | Bacteria | 818 |
| 132 | Ga0070678_101038601 | 3300005456 | Bacteria | 755 |
| 133 | Ga0070678_101823022 | 3300005456 | Bacteria | 574 |
| 134 | Ga0070662_100300526 | 3300005457 | Bacteria | 1304 |
| 135 | Ga0070662_100308505 | 3300005457 | Bacteria | 1287 |
| 136 | Ga0070662_100681474 | 3300005457 | Bacteria | 869 |
| 137 | Ga0070681_10062942 | 3300005458 | Bacteria | 3682 |
| 138 | Ga0070681_10277019 | 3300005458 | Bacteria | 1589 |
| 139 | Ga0070681_11566054 | 3300005458 | Bacteria | 584 |
| 140 | Ga0068867_100023122 | 3300005459 | Bacteria | 4449 |
| 141 | Ga0068867_100127791 | 3300005459 | Bacteria | 1971 |
| 142 | Ga0068867_100763851 | 3300005459 | Bacteria | 859 |
| 143 | Ga0070685_10067144 | 3300005466 | Bacteria | 2115 |
| 144 | Ga0070685_10189451 | 3300005466 | Bacteria | 1329 |
| 145 | Ga0070685_10255044 | 3300005466 | Bacteria | 1163 |
| 146 | Ga0070685_10319772 | 3300005466 | Bacteria | 1051 |
| 147 | Ga0070685_10555633 | 3300005466 | Bacteria | 820 |
| 148 | Ga0070685_11195342 | 3300005466 | Bacteria | 578 |
| 149 | Ga0070706_100001357 | 3300005467 | Bacteria | 26038 |
| 150 | Ga0070706_100209453 | 3300005467 | Bacteria | 1820 |
| 151 | Ga0070706_100222379 | 3300005467 | Bacteria | 1762 |
| 152 | Ga0070706_100681534 | 3300005467 | Bacteria | 954 |
| 153 | Ga0070706_101168525 | 3300005467 | Bacteria | 707 |
| 154 | Ga0070707_100058669 | 3300005468 | Bacteria | 3691 |
| 155 | Ga0070707_100164467 | 3300005468 | Bacteria | 2162 |
| 156 | Ga0070698_100000876 | 3300005471 | Bacteria | 33074 |
| 157 | Ga0070698_100005165 | 3300005471 | Bacteria | 14274 |
| 158 | Ga0070698_100040114 | 3300005471 | Bacteria | 4814 |
| 159 | Ga0070698_100047454 | 3300005471 | Bacteria | 4390 |
| 160 | Ga0070698_100050679 | 3300005471 | Bacteria | 4231 |
| 161 | Ga0070699_100044930 | 3300005518 | Bacteria | 3824 |
| 162 | Ga0070699_100354791 | 3300005518 | Bacteria | 1321 |
| 163 | Ga0070699_100825658 | 3300005518 | Bacteria | 848 |
| 164 | Ga0070699_101276977 | 3300005518 | Unclassified | 673 |
| 165 | Ga0070679_100073713 | 3300005530 | Bacteria | 3404 |
| 166 | Ga0070684_100570786 | 3300005535 | Bacteria | 1051 |
| 167 | Ga0070684_100933251 | 3300005535 | Bacteria | 813 |
| 168 | Ga0070684_100966346 | 3300005535 | Bacteria | 799 |
| 169 | Ga0070684_101863506 | 3300005535 | Bacteria | 567 |
| 170 | Ga0070697_100069934 | 3300005536 | Bacteria | 2876 |
| 171 | Ga0070697_100130084 | 3300005536 | Bacteria | 2111 |
| 172 | Ga0070697_100278191 | 3300005536 | Bacteria | 1435 |
| 173 | Ga0070697_100563599 | 3300005536 | Bacteria | 999 |
| 174 | Ga0070697_100610921 | 3300005536 | Bacteria | 959 |
| 175 | Ga0070697_100756096 | 3300005536 | Bacteria | 859 |
| 176 | Ga0068853_100192614 | 3300005539 | Bacteria | 1853 |
| 177 | Ga0068853_100204469 | 3300005539 | Bacteria | 1798 |
| 178 | Ga0068853_100751632 | 3300005539 | Bacteria | 932 |
| 179 | Ga0068853_100975898 | 3300005539 | Bacteria | 815 |
| 180 | Ga0068853_101377014 | 3300005539 | Bacteria | 682 |
| 181 | Ga0070672_100016466 | 3300005543 | Bacteria | 5293 |
| 182 | Ga0070672_100334037 | 3300005543 | Bacteria | 1290 |
| 183 | Ga0070672_100450402 | 3300005543 | Bacteria | 1109 |
| 184 | Ga0070672_100815382 | 3300005543 | Bacteria | 822 |
| 185 | Ga0070686_100010762 | 3300005544 | Bacteria | 5172 |
| 186 | Ga0070686_100053860 | 3300005544 | Bacteria | 2571 |
| 187 | Ga0070686_100058785 | 3300005544 | Unclassified | 2475 |
| 188 | Ga0070686_100106937 | 3300005544 | Bacteria | 1899 |
| 189 | Ga0070686_100376312 | 3300005544 | Bacteria | 1074 |
| 190 | Ga0070686_100855265 | 3300005544 | Bacteria | 737 |
| 191 | Ga0070696_101046924 | 3300005546 | Bacteria | 684 |
| 192 | Ga0070693_100506555 | 3300005547 | Bacteria | 857 |
| 193 | Ga0070693_100510972 | 3300005547 | Bacteria | 854 |
| 194 | Ga0070665_100736200 | 3300005548 | Bacteria | 999 |
| 195 | Ga0070665_100779741 | 3300005548 | Bacteria | 969 |
| 196 | Ga0068855_100002380 | 3300005563 | Bacteria | 23184 |
| 197 | Ga0068855_100025181 | 3300005563 | Bacteria | 7124 |
| 198 | Ga0068855_100058765 | 3300005563 | Bacteria | 4501 |
| 199 | Ga0068855_100517297 | 3300005563 | Bacteria | 1295 |
| 200 | Ga0070664_101662120 | 3300005564 | Bacteria | 605 |
| 201 | Ga0068857_100230538 | 3300005577 | Bacteria | 1694 |
| 202 | Ga0068857_100279929 | 3300005577 | Bacteria | 1534 |
| 203 | Ga0068857_101150734 | 3300005577 | Bacteria | 750 |
| 204 | Ga0068857_101547501 | 3300005577 | Bacteria | 647 |
| 205 | Ga0068854_100650572 | 3300005578 | Bacteria | 905 |
| 206 | Ga0068856_100000034 | 3300005614 | Bacteria | 124288 |
| 207 | Ga0068856_100008797 | 3300005614 | Bacteria | 9825 |
| 208 | Ga0068856_100140681 | 3300005614 | Bacteria | 2420 |
| 209 | Ga0068856_100149613 | 3300005614 | Bacteria | 2343 |
| 210 | Ga0068856_100218977 | 3300005614 | Bacteria | 1919 |
| 211 | Ga0068856_100337427 | 3300005614 | Bacteria | 1525 |
| 212 | Ga0070702_100133662 | 3300005615 | Bacteria | 1571 |
| 213 | Ga0070702_100223846 | 3300005615 | Bacteria | 1260 |
| 214 | Ga0070702_100350529 | 3300005615 | Bacteria | 1040 |
| 215 | Ga0070702_100462953 | 3300005615 | Bacteria | 922 |
| 216 | Ga0070702_100548616 | 3300005615 | Bacteria | 858 |
| 217 | Ga0070702_100692048 | 3300005615 | Bacteria | 776 |
| 218 | Ga0070702_101066393 | 3300005615 | Bacteria | 644 |
| 219 | Ga0068852_100096637 | 3300005616 | Bacteria | 2656 |
| 220 | Ga0068852_102121910 | 3300005616 | Bacteria | 584 |
| 221 | Ga0068859_100001788 | 3300005617 | Bacteria | 21889 |
| 222 | Ga0068859_100096940 | 3300005617 | Bacteria | 3001 |
| 223 | Ga0068859_100537309 | 3300005617 | Bacteria | 1264 |
| 224 | Ga0068859_100617739 | 3300005617 | Bacteria | 1177 |
| 225 | Ga0068864_100208362 | 3300005618 | Bacteria | 1799 |
| 226 | Ga0068866_10008221 | 3300005718 | Bacteria | 4387 |
| 227 | Ga0068866_10215792 | 3300005718 | Bacteria | 1154 |
| 228 | Ga0068861_100017078 | 3300005719 | Bacteria | 5147 |
| 229 | Ga0068861_100257834 | 3300005719 | Bacteria | 1491 |
| 230 | Ga0068861_101713826 | 3300005719 | Bacteria | 622 |
| 231 | Ga0068863_100191523 | 3300005841 | Bacteria | 1965 |
| 232 | Ga0068863_100520471 | 3300005841 | Bacteria | 1173 |
| 233 | Ga0068863_100988477 | 3300005841 | Bacteria | 844 |
| 234 | Ga0068858_100043912 | 3300005842 | Bacteria | 4144 |
| 235 | Ga0068858_100233399 | 3300005842 | Bacteria | 1744 |
| 236 | Ga0068858_100367273 | 3300005842 | Bacteria | 1380 |
| 237 | Ga0068858_101325732 | 3300005842 | Bacteria | 708 |
| 238 | Ga0068860_100348643 | 3300005843 | Bacteria | 1457 |
| 239 | Ga0068860_100857988 | 3300005843 | Bacteria | 923 |
| 240 | Ga0068862_100214943 | 3300005844 | Bacteria | 1738 |
| 241 | Ga0068862_100669840 | 3300005844 | Bacteria | 1002 |
| 242 | Ga0068862_101245344 | 3300005844 | Bacteria | 744 |
| 243 | Ga0081455_10069915 | 3300005937 | Bacteria | 2917 |
| 244 | Ga0081455_10109655 | 3300005937 | Bacteria | 2196 |
| 245 | Ga0081455_10121526 | 3300005937 | Bacteria | 2057 |
| 246 | Ga0081455_10197461 | 3300005937 | Bacteria | 1509 |
| 247 | Ga0081455_10924447 | 3300005937 | Bacteria | 542 |
| 248 | Ga0081540_1040002 | 3300005983 | Bacteria | 2449 |
| 249 | Ga0081540_1091687 | 3300005983 | Bacteria | 1335 |
| 250 | Ga0081540_1155738 | 3300005983 | Bacteria | 894 |
| 251 | Ga0070717_10147478 | 3300006028 | Bacteria | 2033 |
| 252 | Ga0070717_11817011 | 3300006028 | Bacteria | 551 |
| 253 | Ga0075363_100031796 | 3300006048 | Bacteria | 2738 |
| 254 | Ga0075363_100274519 | 3300006048 | Bacteria | 974 |
| 255 | Ga0075364_10387748 | 3300006051 | Bacteria | 953 |
| 256 | Ga0070715_10217187 | 3300006163 | Bacteria | 981 |
| 257 | Ga0070716_100037586 | 3300006173 | Bacteria | 2677 |
| 258 | Ga0070712_100811185 | 3300006175 | Bacteria | 803 |
| 259 | Ga0075362_10016318 | 3300006177 | Bacteria | 3039 |
| 260 | Ga0075362_10030032 | 3300006177 | Bacteria | 2346 |
| 261 | Ga0075362_10573166 | 3300006177 | Bacteria | 582 |
| 262 | Ga0075369_10461562 | 3300006186 | Bacteria | 602 |
| 263 | Ga0075366_10027432 | 3300006195 | Bacteria | 3341 |
| 264 | Ga0075366_10033077 | 3300006195 | Bacteria | 3046 |
| 265 | Ga0075366_10459969 | 3300006195 | Bacteria | 785 |
| 266 | Ga0075366_10611606 | 3300006195 | Bacteria | 676 |
| 267 | Ga0097621_100117829 | 3300006237 | Bacteria | 2250 |
| 268 | Ga0097621_100194261 | 3300006237 | Bacteria | 1759 |
| 269 | Ga0097621_100479555 | 3300006237 | Bacteria | 1124 |
| 270 | Ga0097621_100683581 | 3300006237 | Bacteria | 944 |
| 271 | Ga0097621_100698579 | 3300006237 | Bacteria | 934 |
| 272 | Ga0075370_10014773 | 3300006353 | Bacteria | 4168 |
| 273 | Ga0068871_100313458 | 3300006358 | Bacteria | 1379 |
| 274 | Ga0068871_100514088 | 3300006358 | Bacteria | 1081 |
| 275 | Ga0068871_100706500 | 3300006358 | Bacteria | 924 |
| 276 | Ga0068871_100801531 | 3300006358 | Bacteria | 868 |
| 277 | Ga0068871_101147191 | 3300006358 | Bacteria | 728 |
| 278 | Ga0068871_101518087 | 3300006358 | Bacteria | 633 |
| 279 | Ga0075428_100180570 | 3300006844 | Bacteria | 2284 |
| 280 | Ga0075428_101442071 | 3300006844 | Bacteria | 722 |
| 281 | Ga0075430_100006122 | 3300006846 | Bacteria | 10136 |
| 282 | Ga0075430_101413212 | 3300006846 | Bacteria | 572 |
| 283 | Ga0075431_100001910 | 3300006847 | Bacteria | 19792 |
| 284 | Ga0075431_101035980 | 3300006847 | Bacteria | 787 |
| 285 | Ga0075434_100377933 | 3300006871 | Bacteria | 1437 |
| 286 | Ga0075434_101125048 | 3300006871 | Bacteria | 798 |
| 287 | Ga0075434_101820037 | 3300006871 | Bacteria | 615 |
| 288 | Ga0075429_100093338 | 3300006880 | Bacteria | 2625 |
| 289 | Ga0075429_100737722 | 3300006880 | Bacteria | 863 |
| 290 | Ga0075429_101636026 | 3300006880 | Bacteria | 560 |
| 291 | Ga0075429_101748042 | 3300006880 | Bacteria | 540 |
| 292 | Ga0068865_100003577 | 3300006881 | Bacteria | 9336 |
| 293 | Ga0068865_100190591 | 3300006881 | Bacteria | 1585 |
| 294 | Ga0068865_100567651 | 3300006881 | Bacteria | 955 |
| 295 | Ga0068865_100677466 | 3300006881 | Bacteria | 879 |
| 296 | Ga0097620_100001788 | 3300006931 | Bacteria | 21889 |
| 297 | Ga0097620_100096939 | 3300006931 | Bacteria | 3001 |
| 298 | Ga0097620_100537285 | 3300006931 | Bacteria | 1264 |
| 299 | Ga0097620_100617772 | 3300006931 | Bacteria | 1177 |
| 300 | Ga0097620_101233198 | 3300006931 | Bacteria | 824 |
| 301 | Ga0075435_100863079 | 3300007076 | Bacteria | 789 |
| 302 | Ga0099794_10259303 | 3300007265 | Bacteria | 897 |
| 303 | Ga0105240_10072975 | 3300009093 | Bacteria | 4239 |
| 304 | Ga0105240_10094834 | 3300009093 | Bacteria | 3639 |
| 305 | Ga0105240_10144397 | 3300009093 | Bacteria | 2841 |
| 306 | Ga0105240_10616903 | 3300009093 | Bacteria | 1192 |
| 307 | Ga0105240_10758954 | 3300009093 | Bacteria | 1054 |
| 308 | Ga0105240_11307838 | 3300009093 | Bacteria | 764 |
| 309 | Ga0111539_10004360 | 3300009094 | Bacteria | 18533 |
| 310 | Ga0111539_10071139 | 3300009094 | Bacteria | 4105 |
| 311 | Ga0111539_10151426 | 3300009094 | Bacteria | 2715 |
| 312 | Ga0111539_10737832 | 3300009094 | Bacteria | 1146 |
| 313 | Ga0105245_10072219 | 3300009098 | Bacteria | 3134 |
| 314 | Ga0105245_10365918 | 3300009098 | Bacteria | 1432 |
| 315 | Ga0105245_11118502 | 3300009098 | Bacteria | 834 |
| 316 | Ga0105245_11573338 | 3300009098 | Bacteria | 709 |
| 317 | Ga0105245_12435506 | 3300009098 | Bacteria | 577 |
| 318 | Ga0105247_10000590 | 3300009101 | Bacteria | 29497 |
| 319 | Ga0114129_10266953 | 3300009147 | Bacteria | 2291 |
| 320 | Ga0114129_10606398 | 3300009147 | Bacteria | 1418 |
| 321 | Ga0105243_10055115 | 3300009148 | Bacteria | 3158 |
| 322 | Ga0105243_10731056 | 3300009148 | Bacteria | 968 |
| 323 | Ga0105241_10255970 | 3300009174 | Bacteria | 1486 |
| 324 | Ga0105241_10823495 | 3300009174 | Bacteria | 857 |
| 325 | Ga0105242_10248790 | 3300009176 | Bacteria | 1601 |
| 326 | Ga0105242_11300956 | 3300009176 | Bacteria | 751 |
| 327 | Ga0105242_11358261 | 3300009176 | Bacteria | 736 |
| 328 | Ga0105242_12015693 | 3300009176 | Bacteria | 620 |
| 329 | Ga0105242_12042347 | 3300009176 | Bacteria | 616 |
| 330 | Ga0105248_10126121 | 3300009177 | Bacteria | 2888 |
| 331 | Ga0105248_10279060 | 3300009177 | Bacteria | 1881 |
| 332 | Ga0105248_11359649 | 3300009177 | Bacteria | 803 |
| 333 | Ga0105248_11631718 | 3300009177 | Bacteria | 731 |
| 334 | Ga0105248_12647586 | 3300009177 | Bacteria | 572 |
| 335 | Ga0105237_10274327 | 3300009545 | Bacteria | 1689 |
| 336 | Ga0105237_10505112 | 3300009545 | Bacteria | 1216 |
| 337 | Ga0105237_12464750 | 3300009545 | Bacteria | 530 |
| 338 | Ga0105238_10034529 | 3300009551 | Bacteria | 5144 |
| 339 | Ga0105238_11030754 | 3300009551 | Bacteria | 844 |
| 340 | Ga0105249_10368153 | 3300009553 | Bacteria | 1460 |
| 341 | Ga0105249_10394076 | 3300009553 | Bacteria | 1413 |
| 342 | Ga0105249_10628614 | 3300009553 | Bacteria | 1130 |
| 343 | Ga0105249_11148941 | 3300009553 | Bacteria | 847 |
| 344 | Ga0105239_10028406 | 3300010375 | Bacteria | 6153 |
| 345 | Ga0105239_10154764 | 3300010375 | Bacteria | 2560 |
| 346 | Ga0105239_10436599 | 3300010375 | Bacteria | 1484 |
| 347 | Ga0105239_10522178 | 3300010375 | Bacteria | 1351 |
| 348 | Ga0105239_10605720 | 3300010375 | Bacteria | 1250 |
| 349 | Ga0105239_10945482 | 3300010375 | Bacteria | 990 |
| 350 | Ga0105239_13338008 | 3300010375 | Bacteria | 522 |
| 351 | Ga0105246_10351452 | 3300011119 | Bacteria | 1208 |
| 352 | Ga0105246_10499939 | 3300011119 | Bacteria | 1032 |
| 353 | Ga0105246_10968531 | 3300011119 | Bacteria | 768 |
| 354 | Ga0105246_11196104 | 3300011119 | Bacteria | 699 |
| 355 | Ga0105246_11263828 | 3300011119 | Bacteria | 682 |
| 356 | Ga0157373_11387752 | 3300013100 | Bacteria | 534 |
| 357 | Ga0157369_10691266 | 3300013105 | Bacteria | 1051 |
| 358 | Ga0157369_10695868 | 3300013105 | Bacteria | 1047 |
| 359 | Ga0157374_10000476 | 3300013296 | Bacteria | 36354 |
| 360 | Ga0157374_10014770 | 3300013296 | Bacteria | 6838 |
| 361 | Ga0157374_10944328 | 3300013296 | Bacteria | 881 |
| 362 | Ga0157374_11001294 | 3300013296 | Bacteria | 855 |
| 363 | Ga0157374_11146442 | 3300013296 | Bacteria | 798 |
| 364 | Ga0157374_11176428 | 3300013296 | Bacteria | 788 |
| 365 | Ga0157374_11209700 | 3300013296 | Bacteria | 777 |
| 366 | Ga0157374_12491035 | 3300013296 | Bacteria | 545 |
| 367 | Ga0157374_12844696 | 3300013296 | Bacteria | 511 |
| 368 | Ga0157378_10006080 | 3300013297 | Bacteria | 10579 |
| 369 | Ga0157378_10155646 | 3300013297 | Bacteria | 2133 |
| 370 | Ga0157378_10362479 | 3300013297 | Bacteria | 1419 |
| 371 | Ga0157378_10611103 | 3300013297 | Bacteria | 1102 |
| 372 | Ga0157378_12250546 | 3300013297 | Bacteria | 596 |
| 373 | Ga0157378_12303738 | 3300013297 | Bacteria | 590 |
| 374 | Ga0157378_12398023 | 3300013297 | Bacteria | 579 |
| 375 | Ga0163162_10280142 | 3300013306 | Bacteria | 1799 |
| 376 | Ga0163162_10386433 | 3300013306 | Bacteria | 1533 |
| 377 | Ga0163162_10587386 | 3300013306 | Bacteria | 1240 |
| 378 | Ga0163162_11078568 | 3300013306 | Bacteria | 910 |
| 379 | Ga0163162_11087494 | 3300013306 | Bacteria | 906 |
| 380 | Ga0163162_11900160 | 3300013306 | Bacteria | 681 |
| 381 | Ga0163162_12395262 | 3300013306 | Bacteria | 607 |
| 382 | Ga0157372_10867715 | 3300013307 | Bacteria | 1047 |
| 383 | Ga0157372_10907575 | 3300013307 | Bacteria | 1022 |
| 384 | Ga0157372_11323291 | 3300013307 | Bacteria | 831 |
| 385 | Ga0157375_10001065 | 3300013308 | Bacteria | 23722 |
| 386 | Ga0157375_10356481 | 3300013308 | Bacteria | 1629 |
| 387 | Ga0157375_10504949 | 3300013308 | Bacteria | 1373 |
| 388 | Ga0157375_12261829 | 3300013308 | Bacteria | 648 |
| 389 | Ga0163163_10337011 | 3300014325 | Bacteria | 1563 |
| 390 | Ga0163163_10545874 | 3300014325 | Bacteria | 1221 |
| 391 | Ga0163163_10632201 | 3300014325 | Bacteria | 1134 |
| 392 | Ga0163163_10742859 | 3300014325 | Bacteria | 1045 |
| 393 | Ga0163163_10987885 | 3300014325 | Bacteria | 905 |
| 394 | Ga0163163_11026736 | 3300014325 | Bacteria | 888 |
| 395 | Ga0163163_11702931 | 3300014325 | Bacteria | 691 |
| 396 | Ga0163163_12261561 | 3300014325 | Bacteria | 603 |
| 397 | Ga0157380_10294262 | 3300014326 | Bacteria | 1492 |
| 398 | Ga0157380_11398424 | 3300014326 | Bacteria | 750 |
| 399 | Ga0157377_10235855 | 3300014745 | Bacteria | 1178 |
| 400 | Ga0157379_10551871 | 3300014968 | Bacteria | 1072 |
| 401 | Ga0157379_11216972 | 3300014968 | Bacteria | 725 |
| 402 | Ga0157376_10298912 | 3300014969 | Bacteria | 1523 |
| 403 | Ga0157376_10628629 | 3300014969 | Bacteria | 1072 |
| 404 | Ga0157376_10750764 | 3300014969 | Bacteria | 985 |
| 405 | Ga0157376_10874435 | 3300014969 | Bacteria | 915 |
| 406 | Ga0157376_11011883 | 3300014969 | Bacteria | 854 |
| 407 | Ga0157376_11638140 | 3300014969 | Bacteria | 678 |
| 408 | Ga0157376_11658422 | 3300014969 | Bacteria | 674 |
| 409 | Ga0157376_11996883 | 3300014969 | Bacteria | 618 |
| 410 | Ga0163161_10122320 | 3300017792 | Bacteria | 1957 |
| 411 | Ga0163161_10821559 | 3300017792 | Bacteria | 782 |
| 412 | Ga0206356_10010424 | 3300020070 | Bacteria | 1224 |
| 413 | Ga0206356_10602174 | 3300020070 | Bacteria | 515 |
| 414 | Ga0206356_11494082 | 3300020070 | Bacteria | 698 |
| 415 | Ga0206351_10933183 | 3300020077 | Bacteria | 962 |
| 416 | Ga0206352_10724423 | 3300020078 | Bacteria | 842 |
| 417 | Ga0206352_11328313 | 3300020078 | Bacteria | 1391 |
| 418 | Ga0206350_11274299 | 3300020080 | Bacteria | 747 |
| 419 | Ga0154015_1418828 | 3300020610 | Bacteria | 530 |
| 420 | Ga0213873_10113755 | 3300021358 | Bacteria | 789 |
| 421 | Ga0213873_10152581 | 3300021358 | Bacteria | 696 |
| 422 | Ga0213873_10209344 | 3300021358 | Bacteria | 607 |
| 423 | Ga0213872_10000347 | 3300021361 | Bacteria | 39054 |
| 424 | Ga0213872_10019579 | 3300021361 | Bacteria | 3117 |
| 425 | Ga0213872_10036356 | 3300021361 | Bacteria | 2251 |
| 426 | Ga0213872_10143099 | 3300021361 | Bacteria | 1048 |
| 427 | Ga0213872_10170234 | 3300021361 | Bacteria | 944 |
| 428 | Ga0213872_10235976 | 3300021361 | Bacteria | 774 |
| 429 | Ga0213874_10246725 | 3300021377 | Bacteria | 657 |
| 430 | Ga0213876_10000625 | 3300021384 | Bacteria | 25956 |
| 431 | Ga0213876_10020022 | 3300021384 | Bacteria | 3534 |
| 432 | Ga0213876_10022119 | 3300021384 | Bacteria | 3363 |
| 433 | Ga0213876_10046119 | 3300021384 | Bacteria | 2304 |
| 434 | Ga0213876_10080950 | 3300021384 | Bacteria | 1717 |
| 435 | Ga0213876_10157327 | 3300021384 | Bacteria | 1209 |
| 436 | Ga0213876_10241588 | 3300021384 | Bacteria | 960 |
| 437 | Ga0213876_10459308 | 3300021384 | Bacteria | 677 |
| 438 | Ga0213875_10209791 | 3300021388 | Bacteria | 917 |
| 439 | Ga0213875_10338228 | 3300021388 | Bacteria | 714 |
| 440 | Ga0213871_10013545 | 3300021441 | Bacteria | 1918 |
| 441 | Ga0213871_10032464 | 3300021441 | Bacteria | 1368 |
| 442 | Ga0213871_10047268 | 3300021441 | Bacteria | 1170 |
| 443 | Ga0213871_10063925 | 3300021441 | Bacteria | 1029 |
| 444 | Ga0207638_1004678 | 3300025227 | Bacteria | 577 |
| 445 | Ga0209675_1002886 | 3300025291 | Bacteria | 8512 |
| 446 | Ga0209676_1007618 | 3300025292 | Bacteria | 5025 |
| 447 | Ga0209676_1098937 | 3300025292 | Bacteria | 625 |
| 448 | Ga0209025_1000026 | 3300025294 | Bacteria | 519850 |
| 449 | Ga0209050_1019384 | 3300025298 | Bacteria | 2585 |
| 450 | Ga0209051_1013568 | 3300025303 | Bacteria | 3868 |
| 451 | Ga0207697_10060121 | 3300025315 | Bacteria | 1580 |
| 452 | Ga0207697_10157045 | 3300025315 | Bacteria | 991 |
| 453 | Ga0207697_10245407 | 3300025315 | Bacteria | 792 |
| 454 | Ga0207692_10118544 | 3300025898 | Bacteria | 1479 |
| 455 | Ga0207692_10729359 | 3300025898 | Bacteria | 645 |
| 456 | Ga0207692_11167786 | 3300025898 | Bacteria | 511 |
| 457 | Ga0207642_10009878 | 3300025899 | Bacteria | 3339 |
| 458 | Ga0207642_10495476 | 3300025899 | Bacteria | 747 |
| 459 | Ga0207710_10002562 | 3300025900 | Bacteria | 8400 |
| 460 | Ga0207710_10720868 | 3300025900 | Bacteria | 523 |
| 461 | Ga0207688_10299895 | 3300025901 | Bacteria | 982 |
| 462 | Ga0207688_10363132 | 3300025901 | Bacteria | 894 |
| 463 | Ga0207680_10262503 | 3300025903 | Bacteria | 1196 |
| 464 | Ga0207685_10172230 | 3300025905 | Bacteria | 997 |
| 465 | Ga0207699_10065974 | 3300025906 | Bacteria | 2196 |
| 466 | Ga0207699_10923927 | 3300025906 | Unclassified | 644 |
| 467 | Ga0207699_11252521 | 3300025906 | Bacteria | 549 |
| 468 | Ga0207699_11353766 | 3300025906 | Bacteria | 527 |
| 469 | Ga0207645_10000728 | 3300025907 | Bacteria | 27395 |
| 470 | Ga0207645_10169569 | 3300025907 | Bacteria | 1430 |
| 471 | Ga0207645_10359290 | 3300025907 | Bacteria | 975 |
| 472 | Ga0207645_10502135 | 3300025907 | Bacteria | 821 |
| 473 | Ga0207643_10294026 | 3300025908 | Bacteria | 1010 |
| 474 | Ga0207705_11448403 | 3300025909 | Bacteria | 521 |
| 475 | Ga0207684_10002013 | 3300025910 | Bacteria | 20941 |
| 476 | Ga0207684_10127191 | 3300025910 | Bacteria | 2187 |
| 477 | Ga0207684_10259174 | 3300025910 | Bacteria | 1500 |
| 478 | Ga0207684_10456915 | 3300025910 | Bacteria | 1096 |
| 479 | Ga0207684_11099042 | 3300025910 | Bacteria | 662 |
| 480 | Ga0207654_11326221 | 3300025911 | Bacteria | 525 |
| 481 | Ga0207707_10615079 | 3300025912 | Bacteria | 918 |
| 482 | Ga0207707_10841728 | 3300025912 | Bacteria | 762 |
| 483 | Ga0207707_11320105 | 3300025912 | Bacteria | 579 |
| 484 | Ga0207695_10000061 | 3300025913 | Bacteria | 359827 |
| 485 | Ga0207695_10132686 | 3300025913 | Bacteria | 2446 |
| 486 | Ga0207695_10175100 | 3300025913 | Bacteria | 2068 |
| 487 | Ga0207695_10324365 | 3300025913 | Bacteria | 1429 |
| 488 | Ga0207695_10478153 | 3300025913 | Bacteria | 1128 |
| 489 | Ga0207671_10119846 | 3300025914 | Bacteria | 2011 |
| 490 | Ga0207671_10269415 | 3300025914 | Bacteria | 1341 |
| 491 | Ga0207671_10339380 | 3300025914 | Bacteria | 1190 |
| 492 | Ga0207693_10651742 | 3300025915 | Bacteria | 818 |
| 493 | Ga0207693_10658091 | 3300025915 | Bacteria | 813 |
| 494 | Ga0207693_10795636 | 3300025915 | Bacteria | 729 |
| 495 | Ga0207693_10868223 | 3300025915 | Bacteria | 693 |
| 496 | Ga0207663_10048355 | 3300025916 | Bacteria | 2632 |
| 497 | Ga0207663_10130938 | 3300025916 | Bacteria | 1733 |
| 498 | Ga0207663_10274511 | 3300025916 | Bacteria | 1250 |
| 499 | Ga0207663_10577325 | 3300025916 | Bacteria | 881 |
| 500 | Ga0207663_10905079 | 3300025916 | Bacteria | 706 |
| 501 | Ga0207663_11222733 | 3300025916 | Bacteria | 605 |
| 502 | Ga0207660_10308001 | 3300025917 | Bacteria | 1262 |
| 503 | Ga0207662_10074152 | 3300025918 | Bacteria | 2065 |
| 504 | Ga0207662_10104235 | 3300025918 | Bacteria | 1761 |
| 505 | Ga0207662_10171787 | 3300025918 | Bacteria | 1390 |
| 506 | Ga0207657_10085546 | 3300025919 | Bacteria | 2641 |
| 507 | Ga0207657_10195509 | 3300025919 | Bacteria | 1629 |
| 508 | Ga0207649_10000838 | 3300025920 | Bacteria | 19781 |
| 509 | Ga0207649_11611782 | 3300025920 | Bacteria | 514 |
| 510 | Ga0207652_10160801 | 3300025921 | Bacteria | 2013 |
| 511 | Ga0207652_10760992 | 3300025921 | Bacteria | 862 |
| 512 | Ga0207646_10038118 | 3300025922 | Bacteria | 4331 |
| 513 | Ga0207646_10050397 | 3300025922 | Bacteria | 3726 |
| 514 | Ga0207681_10026963 | 3300025923 | Bacteria | 3710 |
| 515 | Ga0207694_10003577 | 3300025924 | Bacteria | 12322 |
| 516 | Ga0207694_10481798 | 3300025924 | Bacteria | 1038 |
| 517 | Ga0207650_10401362 | 3300025925 | Bacteria | 1135 |
| 518 | Ga0207650_10472503 | 3300025925 | Bacteria | 1045 |
| 519 | Ga0207659_10049016 | 3300025926 | Bacteria | 2994 |
| 520 | Ga0207659_10195247 | 3300025926 | Bacteria | 1613 |
| 521 | Ga0207659_10262652 | 3300025926 | Bacteria | 1405 |
| 522 | Ga0207659_10302387 | 3300025926 | Bacteria | 1314 |
| 523 | Ga0207659_10780224 | 3300025926 | Bacteria | 821 |
| 524 | Ga0207687_10041006 | 3300025927 | Bacteria | 3176 |
| 525 | Ga0207687_10523574 | 3300025927 | Bacteria | 992 |
| 526 | Ga0207700_10019741 | 3300025928 | Bacteria | 4558 |
| 527 | Ga0207700_10106933 | 3300025928 | Bacteria | 2244 |
| 528 | Ga0207700_10640169 | 3300025928 | Bacteria | 948 |
| 529 | Ga0207700_11612209 | 3300025928 | Bacteria | 574 |
| 530 | Ga0207664_10493183 | 3300025929 | Bacteria | 1096 |
| 531 | Ga0207644_10055737 | 3300025931 | Bacteria | 2850 |
| 532 | Ga0207644_10364252 | 3300025931 | Bacteria | 1176 |
| 533 | Ga0207644_10458496 | 3300025931 | Bacteria | 1048 |
| 534 | Ga0207690_10076447 | 3300025932 | Bacteria | 2325 |
| 535 | Ga0207690_11063486 | 3300025932 | Bacteria | 674 |
| 536 | Ga0207706_10034212 | 3300025933 | Bacteria | 4521 |
| 537 | Ga0207706_10066355 | 3300025933 | Bacteria | 3176 |
| 538 | Ga0207706_11011891 | 3300025933 | Bacteria | 698 |
| 539 | Ga0207706_11038423 | 3300025933 | Bacteria | 687 |
| 540 | Ga0207686_10144004 | 3300025934 | Bacteria | 1651 |
| 541 | Ga0207686_10886872 | 3300025934 | Bacteria | 719 |
| 542 | Ga0207686_11186516 | 3300025934 | Bacteria | 624 |
| 543 | Ga0207709_11156999 | 3300025935 | Bacteria | 636 |
| 544 | Ga0207670_10005563 | 3300025936 | Bacteria | 6927 |
| 545 | Ga0207670_10016581 | 3300025936 | Bacteria | 4432 |
| 546 | Ga0207670_10021302 | 3300025936 | Bacteria | 3997 |
| 547 | Ga0207670_10033461 | 3300025936 | Bacteria | 3312 |
| 548 | Ga0207670_10042944 | 3300025936 | Bacteria | 2983 |
| 549 | Ga0207670_10262812 | 3300025936 | Unclassified | 1339 |
| 550 | Ga0207670_10686585 | 3300025936 | Bacteria | 847 |
| 551 | Ga0207670_10881485 | 3300025936 | Bacteria | 749 |
| 552 | Ga0207670_10943865 | 3300025936 | Bacteria | 724 |
| 553 | Ga0207670_11191073 | 3300025936 | Bacteria | 645 |
| 554 | Ga0207669_10012954 | 3300025937 | Bacteria | 4122 |
| 555 | Ga0207669_10022419 | 3300025937 | Bacteria | 3355 |
| 556 | Ga0207669_10131760 | 3300025937 | Bacteria | 1719 |
| 557 | Ga0207669_10372883 | 3300025937 | Bacteria | 1109 |
| 558 | Ga0207669_10442314 | 3300025937 | Bacteria | 1028 |
| 559 | Ga0207704_10002756 | 3300025938 | Bacteria | 7929 |
| 560 | Ga0207704_10029724 | 3300025938 | Bacteria | 3052 |
| 561 | Ga0207704_10177326 | 3300025938 | Bacteria | 1536 |
| 562 | Ga0207704_10479434 | 3300025938 | Bacteria | 998 |
| 563 | Ga0207665_10138887 | 3300025939 | Bacteria | 1731 |
| 564 | Ga0207691_10052873 | 3300025940 | Bacteria | 3708 |
| 565 | Ga0207691_10257678 | 3300025940 | Bacteria | 1504 |
| 566 | Ga0207691_10307684 | 3300025940 | Bacteria | 1360 |
| 567 | Ga0207691_10364123 | 3300025940 | Bacteria | 1236 |
| 568 | Ga0207691_10668268 | 3300025940 | Bacteria | 877 |
| 569 | Ga0207691_10737533 | 3300025940 | Bacteria | 830 |
| 570 | Ga0207711_10053329 | 3300025941 | Bacteria | 3468 |
| 571 | Ga0207711_10574550 | 3300025941 | Bacteria | 1051 |
| 572 | Ga0207711_11104317 | 3300025941 | Bacteria | 734 |
| 573 | Ga0207711_11615385 | 3300025941 | Bacteria | 592 |
| 574 | Ga0207711_11814378 | 3300025941 | Bacteria | 553 |
| 575 | Ga0207689_10021711 | 3300025942 | Bacteria | 5399 |
| 576 | Ga0207689_10031998 | 3300025942 | Bacteria | 4375 |
| 577 | Ga0207661_10238366 | 3300025944 | Bacteria | 1613 |
| 578 | Ga0207661_10511164 | 3300025944 | Bacteria | 1098 |
| 579 | Ga0207661_10921126 | 3300025944 | Bacteria | 805 |
| 580 | Ga0207661_10990171 | 3300025944 | Bacteria | 774 |
| 581 | Ga0207667_10107153 | 3300025949 | Bacteria | 2883 |
| 582 | Ga0207667_10122989 | 3300025949 | Bacteria | 2673 |
| 583 | Ga0207667_10408090 | 3300025949 | Bacteria | 1383 |
| 584 | Ga0207667_10708120 | 3300025949 | Bacteria | 1009 |
| 585 | Ga0207651_10102955 | 3300025960 | Bacteria | 2124 |
| 586 | Ga0207651_10127381 | 3300025960 | Bacteria | 1942 |
| 587 | Ga0207651_10217392 | 3300025960 | Bacteria | 1542 |
| 588 | Ga0207651_10546257 | 3300025960 | Bacteria | 1007 |
| 589 | Ga0207651_10787973 | 3300025960 | Bacteria | 842 |
| 590 | Ga0207651_11162062 | 3300025960 | Bacteria | 692 |
| 591 | Ga0207712_10291528 | 3300025961 | Bacteria | 1335 |
| 592 | Ga0207668_10113654 | 3300025972 | Bacteria | 2036 |
| 593 | Ga0207668_10135439 | 3300025972 | Bacteria | 1887 |
| 594 | Ga0207668_10574599 | 3300025972 | Bacteria | 979 |
| 595 | Ga0207658_10138332 | 3300025986 | Bacteria | 1967 |
| 596 | Ga0207658_10181976 | 3300025986 | Bacteria | 1740 |
| 597 | Ga0207658_11221042 | 3300025986 | Bacteria | 687 |
| 598 | Ga0207658_11623548 | 3300025986 | Bacteria | 591 |
| 599 | Ga0207677_10261590 | 3300026023 | Bacteria | 1411 |
| 600 | Ga0207677_10279578 | 3300026023 | Bacteria | 1369 |
| 601 | Ga0207677_10485780 | 3300026023 | Bacteria | 1065 |
| 602 | Ga0207677_10573767 | 3300026023 | Bacteria | 986 |
| 603 | Ga0207677_10612541 | 3300026023 | Bacteria | 957 |
| 604 | Ga0207703_10005872 | 3300026035 | Bacteria | 9832 |
| 605 | Ga0207703_10082836 | 3300026035 | Bacteria | 2679 |
| 606 | Ga0207703_10222118 | 3300026035 | Bacteria | 1690 |
| 607 | Ga0207703_10269954 | 3300026035 | Bacteria | 1541 |
| 608 | Ga0207703_10711853 | 3300026035 | Bacteria | 955 |
| 609 | Ga0207703_11045353 | 3300026035 | Bacteria | 784 |
| 610 | Ga0207703_12010368 | 3300026035 | Bacteria | 554 |
| 611 | Ga0207639_10236408 | 3300026041 | Bacteria | 1586 |
| 612 | Ga0207639_10617932 | 3300026041 | Bacteria | 1000 |
| 613 | Ga0207639_10863396 | 3300026041 | Bacteria | 845 |
| 614 | Ga0207639_11151236 | 3300026041 | Bacteria | 728 |
| 615 | Ga0207639_11177816 | 3300026041 | Bacteria | 719 |
| 616 | Ga0207639_11324974 | 3300026041 | Bacteria | 676 |
| 617 | Ga0207678_10434915 | 3300026067 | Bacteria | 1139 |
| 618 | Ga0207708_10003243 | 3300026075 | Bacteria | 11980 |
| 619 | Ga0207708_10010463 | 3300026075 | Bacteria | 6887 |
| 620 | Ga0207708_11776870 | 3300026075 | Bacteria | 541 |
| 621 | Ga0207702_10002417 | 3300026078 | Bacteria | 17759 |
| 622 | Ga0207702_10005944 | 3300026078 | Bacteria | 10599 |
| 623 | Ga0207702_10185488 | 3300026078 | Bacteria | 1918 |
| 624 | Ga0207702_10652421 | 3300026078 | Unclassified | 1035 |
| 625 | Ga0207702_11019409 | 3300026078 | Bacteria | 821 |
| 626 | Ga0207702_12408616 | 3300026078 | Bacteria | 513 |
| 627 | Ga0207641_10196832 | 3300026088 | Bacteria | 1855 |
| 628 | Ga0207641_10199610 | 3300026088 | Bacteria | 1843 |
| 629 | Ga0207641_10657978 | 3300026088 | Bacteria | 1029 |
| 630 | Ga0207641_11502248 | 3300026088 | Bacteria | 675 |
| 631 | Ga0207641_11842806 | 3300026088 | Bacteria | 607 |
| 632 | Ga0207648_10016763 | 3300026089 | Bacteria | 6683 |
| 633 | Ga0207648_10031685 | 3300026089 | Bacteria | 4673 |
| 634 | Ga0207648_10600952 | 3300026089 | Bacteria | 1014 |
| 635 | Ga0207676_10168259 | 3300026095 | Bacteria | 1907 |
| 636 | Ga0207676_10592493 | 3300026095 | Bacteria | 1064 |
| 637 | Ga0207674_10163375 | 3300026116 | Bacteria | 2181 |
| 638 | Ga0207674_10233428 | 3300026116 | Bacteria | 1787 |
| 639 | Ga0207674_10449031 | 3300026116 | Bacteria | 1246 |
| 640 | Ga0207674_11907965 | 3300026116 | Unclassified | 560 |
| 641 | Ga0207675_100006962 | 3300026118 | Bacteria | 10699 |
| 642 | Ga0207675_100016985 | 3300026118 | Bacteria | 6801 |
| 643 | Ga0207675_100083691 | 3300026118 | Bacteria | 2993 |
| 644 | Ga0207675_101039728 | 3300026118 | Bacteria | 838 |
| 645 | Ga0207675_101492464 | 3300026118 | Bacteria | 697 |
| 646 | Ga0207683_10017435 | 3300026121 | Bacteria | 6120 |
| 647 | Ga0207683_10045829 | 3300026121 | Bacteria | 3824 |
| 648 | Ga0207683_10146235 | 3300026121 | Bacteria | 2131 |
| 649 | Ga0207683_10596257 | 3300026121 | Bacteria | 1022 |
| 650 | Ga0207698_10050458 | 3300026142 | Bacteria | 3174 |
| 651 | Ga0207698_11089511 | 3300026142 | Bacteria | 811 |
| 652 | Ga0207698_12179782 | 3300026142 | Bacteria | 567 |
| 653 | Ga0209983_1040734 | 3300027665 | Bacteria | 1004 |
| 654 | Ga0209588_1140098 | 3300027671 | Bacteria | 769 |
| 655 | Ga0209998_10077241 | 3300027717 | Bacteria | 803 |
| 656 | Ga0209974_10022976 | 3300027876 | Bacteria | 2064 |
| 657 | Ga0209974_10127129 | 3300027876 | Bacteria | 907 |
| 658 | Ga0207428_10012269 | 3300027907 | Bacteria | 7534 |
| 659 | Ga0207428_10037670 | 3300027907 | Bacteria | 3934 |
| 660 | Ga0207428_10111835 | 3300027907 | Bacteria | 2101 |
| 661 | Ga0268266_10454658 | 3300028379 | Bacteria | 1218 |
| 662 | Ga0268266_10720316 | 3300028379 | Bacteria | 962 |
| 663 | Ga0268266_11397925 | 3300028379 | Bacteria | 675 |
| 664 | Ga0268265_10110452 | 3300028380 | Bacteria | 2243 |
| 665 | Ga0268265_10663912 | 3300028380 | Bacteria | 1003 |
| 666 | Ga0268265_11211332 | 3300028380 | Bacteria | 753 |
| 667 | Ga0268265_11420923 | 3300028380 | Bacteria | 696 |
| 668 | Ga0268264_10000241 | 3300028381 | Bacteria | 103608 |
| 669 | Ga0268264_10001424 | 3300028381 | Bacteria | 22372 |
| 670 | Ga0268264_10167723 | 3300028381 | Bacteria | 1983 |
| 671 | Ga0268264_10277451 | 3300028381 | Bacteria | 1568 |
| 672 | Ga0268264_11074583 | 3300028381 | Bacteria | 813 |
| 673 | Ga0265337_1060117 | 3300028556 | Bacteria | 1054 |
| 674 | Ga0265337_1176762 | 3300028556 | Bacteria | 579 |
| 675 | Ga0265326_10040365 | 3300028558 | Bacteria | 1325 |
| 676 | Ga0265319_1001620 | 3300028563 | Bacteria | 13129 |
| 677 | Ga0265319_1031555 | 3300028563 | Bacteria | 1844 |
| 678 | Ga0265319_1140748 | 3300028563 | Bacteria | 749 |
| 679 | Ga0265334_10140820 | 3300028573 | Bacteria | 854 |
| 680 | Ga0265322_10023498 | 3300028654 | Bacteria | 1763 |
| 681 | Ga0265336_10032425 | 3300028666 | Bacteria | 1620 |
| 682 | Ga0265338_10000009 | 3300028800 | Bacteria | 448611 |
| 683 | Ga0265338_10001990 | 3300028800 | Bacteria | 31793 |
| 684 | Ga0265338_10017031 | 3300028800 | Bacteria | 7860 |
| 685 | Ga0265338_10027181 | 3300028800 | Bacteria | 5747 |
| 686 | Ga0265338_10115482 | 3300028800 | Bacteria | 2152 |
| 687 | Ga0265338_10163503 | 3300028800 | Bacteria | 1716 |
| 688 | Ga0265338_10285466 | 3300028800 | Bacteria | 1204 |
| 689 | Ga0265324_10024450 | 3300029957 | Bacteria | 2145 |
| 690 | Ga0265330_10006098 | 3300031235 | Bacteria | 5970 |
| 691 | Ga0265330_10024000 | 3300031235 | Unclassified | 2766 |
| 692 | Ga0265330_10362708 | 3300031235 | Bacteria | 612 |
| 693 | Ga0265332_10218663 | 3300031238 | Bacteria | 790 |
| 694 | Ga0265328_10005804 | 3300031239 | Bacteria | 5267 |
| 695 | Ga0265328_10023332 | 3300031239 | Bacteria | 2349 |
| 696 | Ga0265328_10320851 | 3300031239 | Bacteria | 600 |
| 697 | Ga0265320_10000369 | 3300031240 | Bacteria | 36482 |
| 698 | Ga0265320_10008183 | 3300031240 | Bacteria | 6418 |
| 699 | Ga0265320_10012918 | 3300031240 | Bacteria | 4827 |
| 700 | Ga0265320_10494902 | 3300031240 | Bacteria | 540 |
| 701 | Ga0265325_10079405 | 3300031241 | Bacteria | 1633 |
| 702 | Ga0265325_10096260 | 3300031241 | Bacteria | 1454 |
| 703 | Ga0265329_10002718 | 3300031242 | Bacteria | 7939 |
| 704 | Ga0265329_10092165 | 3300031242 | Bacteria | 962 |
| 705 | Ga0265339_10003100 | 3300031249 | Bacteria | 11696 |
| 706 | Ga0265339_10326923 | 3300031249 | Bacteria | 726 |
| 707 | Ga0265339_10605753 | 3300031249 | Bacteria | 502 |
| 708 | Ga0265331_10212373 | 3300031250 | Bacteria | 870 |
| 709 | Ga0265327_10000041 | 3300031251 | Bacteria | 288506 |
| 710 | Ga0265327_10001257 | 3300031251 | Bacteria | 33614 |
| 711 | Ga0265327_10005146 | 3300031251 | Bacteria | 11096 |
| 712 | Ga0265327_10034602 | 3300031251 | Bacteria | 2801 |
| 713 | Ga0265327_10439375 | 3300031251 | Bacteria | 564 |
| 714 | Ga0265327_10445285 | 3300031251 | Bacteria | 560 |
| 715 | Ga0265316_10003266 | 3300031344 | Bacteria | 16468 |
| 716 | Ga0265316_10034662 | 3300031344 | Bacteria | 4098 |
| 717 | Ga0265316_10202846 | 3300031344 | Bacteria | 1469 |
| 718 | Ga0265316_10269131 | 3300031344 | Bacteria | 1247 |
| 719 | Ga0265316_10333779 | 3300031344 | Bacteria | 1100 |
| 720 | Ga0265316_10888215 | 3300031344 | Bacteria | 623 |
| 721 | Ga0307509_10104457 | 3300031507 | Bacteria | 2858 |
| 722 | Ga0265313_10193778 | 3300031595 | Bacteria | 848 |
| 723 | Ga0265313_10233522 | 3300031595 | Bacteria | 755 |
| 724 | Ga0265313_10257067 | 3300031595 | Bacteria | 711 |
| 725 | Ga0265313_10365564 | 3300031595 | Bacteria | 570 |
| 726 | Ga0316575_10004516 | 3300031665 | Bacteria | 4898 |
| 727 | Ga0316575_10005680 | 3300031665 | Bacteria | 4454 |
| 728 | Ga0316575_10015125 | 3300031665 | Bacteria | 2906 |
| 729 | Ga0316575_10020547 | 3300031665 | Bacteria | 2534 |
| 730 | Ga0316575_10084277 | 3300031665 | Bacteria | 1283 |
| 731 | Ga0316579_10009041 | 3300031691 | Bacteria | 4181 |
| 732 | Ga0316579_10145806 | 3300031691 | Bacteria | 1141 |
| 733 | Ga0316579_10430158 | 3300031691 | Bacteria | 638 |
| 734 | Ga0316579_10599621 | 3300031691 | Bacteria | 533 |
| 735 | Ga0265314_10000148 | 3300031711 | Bacteria | 105207 |
| 736 | Ga0265314_10017491 | 3300031711 | Bacteria | 5626 |
| 737 | Ga0265314_10028511 | 3300031711 | Bacteria | 4162 |
| 738 | Ga0265314_10060329 | 3300031711 | Bacteria | 2589 |
| 739 | Ga0265314_10149754 | 3300031711 | Bacteria | 1432 |
| 740 | Ga0265314_10213728 | 3300031711 | Bacteria | 1131 |
| 741 | Ga0265314_10611379 | 3300031711 | Bacteria | 560 |
| 742 | Ga0265342_10000349 | 3300031712 | Bacteria | 51668 |
| 743 | Ga0265342_10001028 | 3300031712 | Bacteria | 27405 |
| 744 | Ga0265342_10033034 | 3300031712 | Bacteria | 3186 |
| 745 | Ga0265342_10110950 | 3300031712 | Bacteria | 1552 |
| 746 | Ga0316576_10043253 | 3300031727 | Bacteria | 3249 |
| 747 | Ga0316576_10063255 | 3300031727 | Bacteria | 2715 |
| 748 | Ga0316576_10246837 | 3300031727 | Bacteria | 1340 |
| 749 | Ga0316576_10332649 | 3300031727 | Bacteria | 1132 |
| 750 | Ga0316576_11079216 | 3300031727 | Bacteria | 570 |
| 751 | Ga0316578_10006308 | 3300031728 | Bacteria | 5839 |
| 752 | Ga0316578_10006710 | 3300031728 | Bacteria | 5702 |
| 753 | Ga0316578_10016820 | 3300031728 | Bacteria | 3968 |
| 754 | Ga0316578_10042621 | 3300031728 | Bacteria | 2632 |
| 755 | Ga0316578_10061021 | 3300031728 | Bacteria | 2220 |
| 756 | Ga0316578_10178287 | 3300031728 | Bacteria | 1280 |
| 757 | Ga0316578_10269987 | 3300031728 | Bacteria | 1019 |
| 758 | Ga0316578_10375520 | 3300031728 | Bacteria | 844 |
| 759 | Ga0316578_10686774 | 3300031728 | Bacteria | 597 |
| 760 | Ga0316577_10001918 | 3300031733 | Bacteria | 10067 |
| 761 | Ga0316577_10002629 | 3300031733 | Bacteria | 8927 |
| 762 | Ga0316577_10025378 | 3300031733 | Bacteria | 3296 |
| 763 | Ga0316577_10026096 | 3300031733 | Bacteria | 3251 |
| 764 | Ga0307413_11161364 | 3300031824 | Bacteria | 670 |
| 765 | Ga0307413_11860371 | 3300031824 | Bacteria | 540 |
| 766 | Ga0307412_10002918 | 3300031911 | Bacteria | 9484 |
| 767 | Ga0307412_10123518 | 3300031911 | Bacteria | 1868 |
| 768 | Ga0307414_10556360 | 3300032004 | Bacteria | 1023 |
| 769 | Ga0307414_10869105 | 3300032004 | Bacteria | 825 |
| 770 | Ga0316583_10000030 | 3300032133 | Bacteria | 26612 |
| 771 | Ga0316583_10002908 | 3300032133 | Bacteria | 6015 |
| 772 | Ga0316583_10009435 | 3300032133 | Bacteria | 3512 |
| 773 | Ga0316583_10025438 | 3300032133 | Bacteria | 2114 |
| 774 | Ga0316583_10060757 | 3300032133 | Bacteria | 1324 |
| 775 | Ga0316585_10014221 | 3300032137 | Bacteria | 2376 |
| 776 | Ga0316585_10017349 | 3300032137 | Bacteria | 2176 |
| 777 | Ga0316585_10035443 | 3300032137 | Bacteria | 1580 |
| 778 | Ga0316585_10063295 | 3300032137 | Bacteria | 1196 |
| 779 | Ga0316585_10147499 | 3300032137 | Bacteria | 776 |
| 780 | Ga0316580_10005240 | 3300032139 | Bacteria | 3778 |
| 781 | Ga0316580_10018717 | 3300032139 | Bacteria | 2131 |
| 782 | Ga0316580_10031690 | 3300032139 | Bacteria | 1636 |
| 783 | Ga0316580_10044287 | 3300032139 | Bacteria | 1373 |
| 784 | Ga0316593_10005354 | 3300032168 | Bacteria | 3376 |
| 785 | Ga0316593_10267274 | 3300032168 | Bacteria | 642 |
| 786 | Ga0316593_10307580 | 3300032168 | Bacteria | 601 |
| 787 | Ga0316592_1004708 | 3300033524 | Bacteria | 2551 |
| 788 | Ga0316592_1013427 | 3300033524 | Bacteria | 1688 |
| 789 | Ga0316592_1027484 | 3300033524 | Bacteria | 1230 |
| 790 | Ga0316592_1050351 | 3300033524 | Bacteria | 930 |
| 791 | Ga0316592_1082859 | 3300033524 | Bacteria | 730 |
| 792 | Ga0316588_1005235 | 3300033528 | Bacteria | 2512 |
| 793 | Ga0316588_1006103 | 3300033528 | Bacteria | 2390 |
| 794 | Ga0316588_1116139 | 3300033528 | Bacteria | 675 |
| 795 | Ga0316587_1083935 | 3300033529 | Bacteria | 604 |
| 796 | Ga0316596_1007916 | 3300033541 | Bacteria | 2520 |
| 797 | Ga0316596_1009308 | 3300033541 | Bacteria | 2355 |
| 798 | Ga0316596_1042388 | 3300033541 | Bacteria | 1198 |
| 799 | Ga0316596_1062418 | 3300033541 | Bacteria | 994 |
| 800 | Ga0316596_1081329 | 3300033541 | Bacteria | 871 |
| 801 | Ga0316596_1203839 | 3300033541 | Bacteria | 551 |
| 802 | Ga0373950_0000002 | 3300034818 | Bacteria | 933559 |
| 803 | Ga0373950_0000026 | 3300034818 | Bacteria | 174190 |
| 804 | Ga0373958_0007737 | 3300034819 | Bacteria | 1722 |
| 805 | Ga0373938_0001010 | 3300034957 | Bacteria | 4532 |
| 806 | Ga0373934_0062749 | 3300035086 | Bacteria | 1482 |
| 807 | Ga0373934_0112143 | 3300035086 | Bacteria | 1107 |
| 808 | Ga0373951_0057760 | 3300035091 | Bacteria | 966 |
| 809 | Ga0373951_0175527 | 3300035091 | Bacteria | 613 |
| 810 | Ga0373923_0101442 | 3300035111 | Bacteria | 1269 |
| 811 | Ga0373923_0150450 | 3300035111 | Bacteria | 1057 |
| 812 | Ga0373923_0276514 | 3300035111 | Bacteria | 791 |
| 813 | Ga0373923_0499737 | 3300035111 | Bacteria | 593 |
| 814 | Ga0373936_0122540 | 3300035113 | Bacteria | 1112 |
| 815 | Ga0373941_0105082 | 3300035115 | Bacteria | 988 |
| 816 | Ga0373945_0194670 | 3300035116 | Bacteria | 839 |
| 817 | Ga0373953_0037507 | 3300035117 | Bacteria | 1913 |
| 818 | Ga0373953_0074966 | 3300035117 | Bacteria | 1400 |
| 819 | Ga0373953_0127241 | 3300035117 | Bacteria | 1085 |
| 820 | Ga0373953_0142337 | 3300035117 | Bacteria | 1026 |
| 821 | Ga0373953_0152677 | 3300035117 | Bacteria | 991 |
| 822 | Ga0373954_0004984 | 3300035118 | Bacteria | 5736 |
| 823 | Ga0373954_0040047 | 3300035118 | Bacteria | 2183 |
| 824 | Ga0373954_0073899 | 3300035118 | Bacteria | 1622 |
| 825 | Ga0373954_0227229 | 3300035118 | Bacteria | 918 |
| 826 | Ga0373954_0508358 | 3300035118 | Bacteria | 597 |
| 827 | Ga0373956_0049218 | 3300035119 | Bacteria | 1890 |
| 828 | Ga0373956_0117087 | 3300035119 | Bacteria | 1243 |
| 829 | Ga0373956_0183271 | 3300035119 | Bacteria | 990 |
| 830 | Ga0373957_0046906 | 3300035120 | Bacteria | 1641 |
| 831 | Ga0373957_0051440 | 3300035120 | Bacteria | 1576 |
| 832 | Ga0373957_0062022 | 3300035120 | Bacteria | 1450 |
| 833 | Ga0373957_0115858 | 3300035120 | Bacteria | 1082 |
| 834 | Ga0373960_0432649 | 3300035121 | Bacteria | 513 |
| 835 | Ga0373943_0025906 | 3300035170 | Bacteria | 2743 |
| 836 | Ga0373943_0170342 | 3300035170 | Bacteria | 1191 |
| 837 | Ga0373943_0229603 | 3300035170 | Bacteria | 1036 |
| 838 | Ga0373946_0014057 | 3300035171 | Bacteria | 3016 |
| 839 | Ga0373946_0076428 | 3300035171 | Bacteria | 1458 |
| 840 | Ga0373946_0274006 | 3300035171 | Bacteria | 829 |
| 841 | Ga0373955_0000754 | 3300035172 | Bacteria | 13898 |
| 842 | Ga0373955_0098735 | 3300035172 | Bacteria | 1673 |
| 843 | Ga0373955_0386105 | 3300035172 | Bacteria | 850 |
| 844 | Ga0373955_0435761 | 3300035172 | Bacteria | 798 |
| 845 | Ga0373955_0563855 | 3300035172 | Bacteria | 697 |
| 846 | Ga0373962_0218612 | 3300035242 | Bacteria | 651 |
| 847 | Ga0316574_0015507 | 3300035398 | Bacteria | 4423 |
| 848 | Ga0316574_0025721 | 3300035398 | Bacteria | 3535 |
| 849 | Ga0316574_0062173 | 3300035398 | Bacteria | 2346 |
| 850 | Ga0316574_0078142 | 3300035398 | Bacteria | 2098 |
| 851 | Ga0316574_0154579 | 3300035398 | Bacteria | 1478 |
| 852 | Ga0316574_0204007 | 3300035398 | Bacteria | 1269 |
| 853 | Ga0316574_0369056 | 3300035398 | Bacteria | 906 |
| 854 | Ga0316574_0389402 | 3300035398 | Bacteria | 878 |
| 855 | Ga0316574_0522627 | 3300035398 | Bacteria | 738 |
| 856 | Ga0373924_0055117 | 3300035410 | Bacteria | 1654 |
| 857 | Ga0373924_0301814 | 3300035410 | Bacteria | 711 |
| 858 | Ga0373931_0367101 | 3300035691 | Bacteria | 904 |
| 859 | Ga0373931_0614013 | 3300035691 | Bacteria | 712 |
| 860 | Ga0373935_0028070 | 3300035692 | Bacteria | 3478 |
| 861 | Ga0373935_0227235 | 3300035692 | Bacteria | 1298 |
| 862 | Ga0373935_0271431 | 3300035692 | Bacteria | 1192 |
| 863 | Ga0373935_1034846 | 3300035692 | Bacteria | 610 |
| 864 | Ga0373927_0228044 | 3300035695 | Bacteria | 1224 |
| 865 | Ga0373927_0449265 | 3300035695 | Bacteria | 851 |
| 866 | Ga0373927_0465497 | 3300035695 | Bacteria | 835 |
| 867 | Ga0373933_0000883 | 3300035724 | Bacteria | 18320 |
| 868 | Ga0373933_0006884 | 3300035724 | Bacteria | 6192 |
| 869 | Ga0373933_0011595 | 3300035724 | Bacteria | 4863 |
| 870 | Ga0373933_0049749 | 3300035724 | Bacteria | 2500 |
| 871 | Ga0373933_0050335 | 3300035724 | Bacteria | 2487 |
| 872 | Ga0373933_0060584 | 3300035724 | Bacteria | 2282 |
| 873 | Ga0373933_0112721 | 3300035724 | Bacteria | 1698 |
| 874 | Ga0373933_0356001 | 3300035724 | Bacteria | 951 |
| 875 | Ga0373947_0009334 | 3300035725 | Bacteria | 5637 |
| 876 | Ga0373947_0036740 | 3300035725 | Bacteria | 2905 |
| 877 | Ga0373937_0004251 | 3300036401 | Bacteria | 12135 |
| 878 | Ga0373937_0006344 | 3300036401 | Bacteria | 10198 |
| 879 | Ga0373937_0007260 | 3300036401 | Bacteria | 9589 |
| 880 | Ga0373937_0011768 | 3300036401 | Bacteria | 7675 |
| 881 | Ga0373937_0028426 | 3300036401 | Bacteria | 5060 |
| 882 | Ga0373937_0110279 | 3300036401 | Bacteria | 2559 |
| 883 | Ga0373937_0226779 | 3300036401 | Bacteria | 1759 |
| 884 | Ga0373937_0303505 | 3300036401 | Bacteria | 1509 |
| 885 | Ga0373937_0404561 | 3300036401 | Bacteria | 1295 |
| 886 | Ga0373937_0456312 | 3300036401 | Bacteria | 1214 |
| 887 | Ga0373937_0534093 | 3300036401 | Bacteria | 1114 |
| 888 | Ga0373937_0634940 | 3300036401 | Bacteria | 1013 |
| 889 | Ga0373937_0876066 | 3300036401 | Bacteria | 847 |
| 890 | Ga0373937_1009271 | 3300036401 | Bacteria | 781 |
| 891 | Ga0373937_1193304 | 3300036401 | Bacteria | 709 |
| 892 | Ga0316582_0000230 | 3300036647 | Bacteria | 18454 |
| 893 | Ga0316582_0109941 | 3300036647 | Bacteria | 1833 |
| 894 | Ga0316582_0117801 | 3300036647 | Bacteria | 1774 |
| 895 | Ga0316582_0196120 | 3300036647 | Bacteria | 1376 |
| 896 | Ga0316582_0989928 | 3300036647 | Bacteria | 574 |
| 897 | Ga0316584_0002826 | 3300036712 | Bacteria | 11132 |
| 898 | Ga0316584_0053677 | 3300036712 | Bacteria | 3016 |
| 899 | Ga0316584_0057370 | 3300036712 | Bacteria | 2915 |
| 900 | Ga0316584_0185225 | 3300036712 | Bacteria | 1540 |
| 901 | Ga0316584_0309741 | 3300036712 | Bacteria | 1141 |
| 902 | Ga0316584_0887899 | 3300036712 | Bacteria | 601 |
| 903 | Ga0316584_1072491 | 3300036712 | Bacteria | 535 |
| 904 | Ga0373925_0042455 | 3300037068 | Bacteria | 3373 |
| 905 | Ga0373925_0089006 | 3300037068 | Bacteria | 2358 |
| 906 | Ga0373925_0390815 | 3300037068 | Bacteria | 1134 |
| 907 | Ga0373925_0727278 | 3300037068 | Bacteria | 818 |
| 908 | Ga0395899_0000032 | 3300037312 | Bacteria | 312705 |
| 909 | Ga0395899_0005190 | 3300037312 | Bacteria | 10135 |
| 910 | Ga0395899_0751147 | 3300037312 | Bacteria | 607 |
| 911 | Ga0395900_0002835 | 3300037418 | Bacteria | 18922 |
| 912 | Ga0395900_0076723 | 3300037418 | Bacteria | 3434 |
| 913 | Ga0395900_0877620 | 3300037418 | Bacteria | 821 |
| 914 | Ga0395898_0000562 | 3300037466 | Bacteria | 69459 |
| 915 | Ga0395898_0016837 | 3300037466 | Bacteria | 7467 |
| 916 | Ga0395898_0283538 | 3300037466 | Bacteria | 1580 |
| 917 | Ga0395898_0376812 | 3300037466 | Bacteria | 1353 |
| 918 | Ga0316581_0020456 | 3300037588 | Bacteria | 1938 |
| 919 | Ga0316581_0034511 | 3300037588 | Bacteria | 1531 |
| 920 | Ga0316581_0087721 | 3300037588 | Bacteria | 958 |
| 921 | Ga0316581_0247040 | 3300037588 | Bacteria | 548 |
| 922 | Ga0436364_0122589 | 3300037853 | Bacteria | 2499 |
| 923 | Ga0436364_0538743 | 3300037853 | Bacteria | 971 |
| 924 | Ga0436364_0771622 | 3300037853 | Bacteria | 941 |
| 925 | Ga0436364_1465714 | 3300037853 | Bacteria | 531 |
| 926 | Ga0436364_1553130 | 3300037853 | Bacteria | 752 |
| 927 | Ga0395901_0006379 | 3300038443 | Bacteria | 11952 |
| 928 | Ga0395901_0980363 | 3300038443 | Bacteria | 822 |
| 929 | Ga0242419_003318 | 3300038698 | Bacteria | 1086 |
| 930 | Ga0400483_278692 | 3300039062 | Bacteria | 1826 |
| 931 | Ga0436365_0001915 | 3300039437 | Bacteria | 573 |
| 932 | Ga0436365_0042250 | 3300039437 | Bacteria | 60076 |
| 933 | Ga0436365_0774506 | 3300039437 | Bacteria | 12388 |
| 934 | Ga0436365_1013589 | 3300039437 | Bacteria | 2438 |
| 935 | Ga0436365_1150834 | 3300039437 | Bacteria | 43496 |
| 936 | Ga0436365_1245734 | 3300039437 | Bacteria | 515 |
| 937 | Ga0436365_1370865 | 3300039437 | Bacteria | 1341 |
| 938 | Ga0436365_1801148 | 3300039437 | Bacteria | 2087 |
| 939 | Ga0436360_0220038 | 3300039438 | Bacteria | 795 |
| 940 | Ga0436360_0223987 | 3300039438 | Bacteria | 932 |
| 941 | Ga0436360_0469231 | 3300039438 | Bacteria | 1209 |
| 942 | Ga0436360_0877820 | 3300039438 | Bacteria | 1179 |
| 943 | Ga0436360_0997829 | 3300039438 | Bacteria | 1643 |
| 944 | Ga0436360_1036060 | 3300039438 | Bacteria | 1309 |
| 945 | Ga0436360_1224017 | 3300039438 | Bacteria | 705 |
| 946 | Ga0436360_1290733 | 3300039438 | Bacteria | 2876 |
| 947 | Ga0436360_1324996 | 3300039438 | Bacteria | 1009 |
| 948 | Ga0436361_0052711 | 3300039447 | Bacteria | 5714 |
| 949 | Ga0436361_0192763 | 3300039447 | Bacteria | 1490 |
| 950 | Ga0436361_0274613 | 3300039447 | Bacteria | 1754 |
| 951 | Ga0436361_0300980 | 3300039447 | Bacteria | 4791 |
| 952 | Ga0436361_0398359 | 3300039447 | Bacteria | 3247 |
| 953 | Ga0436361_0422889 | 3300039447 | Bacteria | 2213 |
| 954 | Ga0436361_0506622 | 3300039447 | Bacteria | 3083 |
| 955 | Ga0436361_0516043 | 3300039447 | Bacteria | 6563 |
| 956 | Ga0436361_0573040 | 3300039447 | Bacteria | 1840 |
| 957 | Ga0436361_0645805 | 3300039447 | Bacteria | 3121 |
| 958 | Ga0436361_0663171 | 3300039447 | Bacteria | 3180 |
| 959 | Ga0436361_1140903 | 3300039447 | Bacteria | 4901 |
| 960 | Ga0436361_1200325 | 3300039447 | Bacteria | 1743 |
| 961 | Ga0436363_0298872 | 3300039450 | Bacteria | 546 |
| 962 | Ga0436363_0401838 | 3300039450 | Bacteria | 503 |
| 963 | Ga0436363_0971820 | 3300039450 | Bacteria | 6874 |
| 964 | Ga0436363_1173897 | 3300039450 | Bacteria | 4445 |
| 965 | Ga0436363_1239685 | 3300039450 | Bacteria | 616 |
| 966 | Ga0436362_0110575 | 3300039453 | Bacteria | 516 |
| 967 | Ga0436362_0439444 | 3300039453 | Bacteria | 1054 |
| 968 | Ga0436362_0474002 | 3300039453 | Bacteria | 1027 |
| 969 | Ga0436362_0490626 | 3300039453 | Bacteria | 1661 |
| 970 | Ga0436362_0589333 | 3300039453 | Bacteria | 1379 |
| 971 | Ga0436362_1019744 | 3300039453 | Bacteria | 610 |
| 972 | Ga0436362_1102436 | 3300039453 | Bacteria | 1278 |
| 973 | Ga0436362_1136023 | 3300039453 | Bacteria | 3665 |
| 974 | Ga0436362_1191246 | 3300039453 | Bacteria | 1235 |
| 975 | Ga0439436_0043232 | 3300041404 | Bacteria | 1286 |
| 976 | Ga0451791_0684006 | 3300041451 | Bacteria | 1654 |
| 977 | Ga0451797_1064022 | 3300041453 | Bacteria | 684 |
| 978 | Ga0451798_0071854 | 3300041458 | Bacteria | 674 |
| 979 | Ga0451802_1233454 | 3300041460 | Bacteria | 761 |
| 980 | Ga0451807_2627768 | 3300041486 | Bacteria | 1151 |
| 981 | Ga0451807_2723892 | 3300041486 | Bacteria | 826 |
| 982 | Ga0451835_0622584 | 3300041492 | Bacteria | 1453 |
| 983 | Ga0451841_1289628 | 3300041498 | Bacteria | 520 |
| 984 | Ga0451847_0951203 | 3300041503 | Bacteria | 667 |
| 985 | Ga0451853_2232771 | 3300041512 | Bacteria | 1166 |
| 986 | Ga0451853_3240533 | 3300041512 | Bacteria | 692 |
| 987 | Ga0451853_3276329 | 3300041512 | Bacteria | 664 |
| 988 | Ga0439441_087476 | 3300042001 | Bacteria | 685 |
| 989 | Ga0439460_0046463 | 3300042461 | Bacteria | 1290 |
| 990 | Ga0451577_0001201 | 3300042876 | Bacteria | 36309 |
| 991 | Ga0451577_0004733 | 3300042876 | Bacteria | 14259 |
| 992 | Ga0451577_0449550 | 3300042876 | Bacteria | 1170 |
| 993 | Ga0451577_0952751 | 3300042876 | Bacteria | 772 |
| 994 | Ga0466965_0020889 | 3300044683 | Bacteria | 3151 |
| 995 | Ga0466966_0098676 | 3300044684 | Bacteria | 1808 |
| 996 | Ga0466961_0029200 | 3300044693 | Bacteria | 3546 |
| 997 | Ga0466961_0573313 | 3300044693 | Bacteria | 679 |
| 998 | Ga0466961_0878286 | 3300044693 | Bacteria | 534 |
| 999 | Ga0466963_0031403 | 3300044694 | Bacteria | 3433 |
| 1000 | Ga0466963_0085006 | 3300044694 | Bacteria | 2147 |
| 1001 | Ga0466963_0136287 | 3300044694 | Bacteria | 1698 |
| 1002 | Ga0466963_0256581 | 3300044694 | Bacteria | 1227 |
| 1003 | Ga0466963_0546748 | 3300044694 | Bacteria | 818 |
| 1004 | Ga0466964_0302165 | 3300044706 | Bacteria | 807 |
| 1005 | Ga0453684_0000204 | 3300044712 | Bacteria | 258105 |
| 1006 | Ga0453684_0000233 | 3300044712 | Bacteria | 240186 |
| 1007 | Ga0453684_0000395 | 3300044712 | Bacteria | 179647 |
| 1008 | Ga0453684_0003538 | 3300044712 | Bacteria | 34940 |
| 1009 | Ga0453684_0044880 | 3300044712 | Bacteria | 5905 |
| 1010 | Ga0453684_0104885 | 3300044712 | Bacteria | 3449 |
| 1011 | Ga0453684_0358166 | 3300044712 | Bacteria | 1643 |
| 1012 | Ga0453684_0370191 | 3300044712 | Bacteria | 1611 |
| 1013 | Ga0453684_0517930 | 3300044712 | Bacteria | 1318 |
| 1014 | Ga0466971_0000143 | 3300044719 | Bacteria | 26655 |
| 1015 | Ga0466971_0043904 | 3300044719 | Bacteria | 2008 |
| 1016 | Ga0466971_0482601 | 3300044719 | Bacteria | 610 |
| 1017 | Ga0466970_0493080 | 3300044765 | Bacteria | 705 |
| 1018 | Ga0466957_0001616 | 3300044842 | Bacteria | 11803 |
| 1019 | Ga0466957_0037279 | 3300044842 | Bacteria | 2927 |
| 1020 | Ga0466957_0110031 | 3300044842 | Bacteria | 1746 |
| 1021 | Ga0466957_0212539 | 3300044842 | Bacteria | 1274 |
| 1022 | Ga0466957_0503713 | 3300044842 | Bacteria | 840 |
| 1023 | Ga0466957_0534802 | 3300044842 | Bacteria | 815 |
| 1024 | Ga0466957_0625089 | 3300044842 | Bacteria | 755 |
| 1025 | Ga0466959_0137962 | 3300045049 | Bacteria | 1725 |
| 1026 | Ga0451576_0115142 | 3300045051 | Bacteria | 2799 |
| 1027 | Ga0451576_0170285 | 3300045051 | Bacteria | 2273 |
| 1028 | Ga0451576_0397455 | 3300045051 | Bacteria | 1445 |
| 1029 | Ga0451576_0404911 | 3300045051 | Bacteria | 1431 |
| 1030 | Ga0451576_2333027 | 3300045051 | Bacteria | 548 |
| 1031 | Ga0451576_2369268 | 3300045051 | Bacteria | 543 |
| 1032 | Ga0466958_0074504 | 3300045836 | Bacteria | 2080 |
| 1033 | Ga0466958_0697350 | 3300045836 | Bacteria | 661 |
| 1034 | Ga0466967_0017019 | 3300045976 | Bacteria | 5753 |
| 1035 | Ga0466967_0023166 | 3300045976 | Bacteria | 5084 |
| 1036 | Ga0466967_0170693 | 3300045976 | Bacteria | 2046 |
| 1037 | Ga0466967_0225603 | 3300045976 | Bacteria | 1782 |
| 1038 | Ga0466967_0248949 | 3300045976 | Bacteria | 1697 |
| 1039 | Ga0466967_0378829 | 3300045976 | Bacteria | 1373 |
| 1040 | Ga0466967_0582840 | 3300045976 | Bacteria | 1103 |
| 1041 | Ga0466967_1899630 | 3300045976 | Bacteria | 592 |
| 1042 | Ga0495592_0002231 | 3300046454 | Bacteria | 13664 |
| 1043 | Ga0495592_0168792 | 3300046454 | Bacteria | 1500 |
| 1044 | Ga0495629_0005400 | 3300046459 | Bacteria | 9532 |
| 1045 | Ga0495641_0070658 | 3300046461 | Bacteria | 1568 |
| 1046 | Ga0495641_0197697 | 3300046461 | Bacteria | 901 |
| 1047 | Ga0495651_0000479 | 3300046462 | Bacteria | 30785 |
| 1048 | Ga0495651_0133267 | 3300046462 | Bacteria | 1812 |
| 1049 | Ga0495651_0195293 | 3300046462 | Bacteria | 1421 |
| 1050 | Ga0495653_0000553 | 3300046463 | Bacteria | 28588 |
| 1051 | Ga0495653_0882418 | 3300046463 | Bacteria | 534 |
| 1052 | Ga0495580_0383728 | 3300046472 | Bacteria | 949 |
| 1053 | Ga0495639_0171251 | 3300046475 | Bacteria | 1054 |
| 1054 | Ga0495662_0094115 | 3300046476 | Bacteria | 1463 |
| 1055 | Ga0495664_0272233 | 3300046477 | Bacteria | 1023 |
| 1056 | Ga0495608_0041940 | 3300046511 | Bacteria | 3061 |
| 1057 | Ga0495618_0018351 | 3300046514 | Bacteria | 4295 |
| 1058 | Ga0495628_0304617 | 3300046516 | Bacteria | 1179 |
| 1059 | Ga0495630_0000031 | 3300046517 | Bacteria | 135085 |
| 1060 | Ga0495630_0051241 | 3300046517 | Bacteria | 3090 |
| 1061 | Ga0495630_0090765 | 3300046517 | Bacteria | 2308 |
| 1062 | Ga0495630_0750831 | 3300046517 | Bacteria | 746 |
| 1063 | Ga0495666_0109132 | 3300046526 | Bacteria | 1300 |
| 1064 | Ga0495666_0309863 | 3300046526 | Bacteria | 713 |
| 1065 | Ga0495652_0006143 | 3300046529 | Bacteria | 11225 |
| 1066 | Ga0495665_0191214 | 3300046531 | Bacteria | 1062 |
| 1067 | Ga0495665_0191530 | 3300046531 | Bacteria | 1061 |
| 1068 | Ga0495640_0010403 | 3300046533 | Bacteria | 7196 |
| 1069 | Ga0495640_0094391 | 3300046533 | Bacteria | 1970 |
| 1070 | Ga0495640_0106640 | 3300046533 | Bacteria | 1835 |
| 1071 | Ga0495586_0000016 | 3300046535 | Bacteria | 126380 |
| 1072 | Ga0495586_0505815 | 3300046535 | Bacteria | 697 |
| 1073 | Ga0495587_0001125 | 3300046536 | Bacteria | 17493 |
| 1074 | Ga0495587_0725446 | 3300046536 | Bacteria | 544 |
| 1075 | Ga0495645_0085446 | 3300046543 | Bacteria | 2258 |
| 1076 | Ga0495667_0000294 | 3300046559 | Bacteria | 32145 |
| 1077 | Ga0495667_0260068 | 3300046559 | Bacteria | 1104 |
| 1078 | Ga0495634_0005533 | 3300046642 | Bacteria | 9698 |
| 1079 | Ga0495634_0009460 | 3300046642 | Bacteria | 7186 |
| 1080 | Ga0495634_0014530 | 3300046642 | Bacteria | 5676 |
| 1081 | Ga0495635_0043029 | 3300046663 | Bacteria | 3117 |
| 1082 | Ga0495659_0463799 | 3300046664 | Bacteria | 552 |
| 1083 | Ga0495657_0034867 | 3300046675 | Bacteria | 3492 |
| 1084 | Ga0495599_0004220 | 3300046678 | Bacteria | 8490 |
| 1085 | Ga0495623_0001907 | 3300046679 | Bacteria | 13995 |
| 1086 | Ga0495646_0005159 | 3300046680 | Bacteria | 8241 |
| 1087 | Ga0495647_0148177 | 3300046681 | Bacteria | 1005 |
| 1088 | Ga0495647_0323102 | 3300046681 | Bacteria | 699 |
| 1089 | Ga0495613_0038952 | 3300046689 | Bacteria | 3524 |
| 1090 | Ga0495613_0046018 | 3300046689 | Bacteria | 3227 |
| 1091 | Ga0495613_0434073 | 3300046689 | Bacteria | 892 |
| 1092 | Ga0495624_0147637 | 3300046690 | Bacteria | 1439 |
| 1093 | Ga0495600_0013933 | 3300046809 | Bacteria | 5066 |
| 1094 | Ga0495581_0120594 | 3300047315 | Bacteria | 1526 |
| 1095 | Ga0495581_0628137 | 3300047315 | Bacteria | 621 |
| 1096 | Ga0495604_0000972 | 3300047317 | Bacteria | 23909 |
| 1097 | Ga0495674_0000794 | 3300047319 | Bacteria | 29966 |
| 1098 | Ga0495674_0009055 | 3300047319 | Bacteria | 9455 |
| 1099 | Ga0495674_0031840 | 3300047319 | Bacteria | 4785 |
| 1100 | Ga0495674_1218225 | 3300047319 | Bacteria | 568 |
| 1101 | Ga0495676_0003977 | 3300047321 | Bacteria | 13458 |
| 1102 | Ga0495676_0030408 | 3300047321 | Bacteria | 4584 |
| 1103 | Ga0495680_0038540 | 3300047322 | Bacteria | 3818 |
| 1104 | Ga0495680_0108359 | 3300047322 | Bacteria | 2062 |
| 1105 | Ga0495680_0133996 | 3300047322 | Bacteria | 1818 |
| 1106 | Ga0495680_0324271 | 3300047322 | Bacteria | 1077 |
| 1107 | Ga0495680_0414552 | 3300047322 | Bacteria | 928 |
| 1108 | Ga0495675_0003250 | 3300047444 | Bacteria | 9763 |
| 1109 | Ga0495602_0002877 | 3300048088 | Bacteria | 17634 |
| 1110 | Ga0496100_0092489 | 3300048903 | Bacteria | 2067 |
| 1111 | Ga0496100_0289827 | 3300048903 | Bacteria | 1223 |
| 1112 | Ga0496101_0010734 | 3300048904 | Bacteria | 6057 |
| 1113 | Ga0496101_0027488 | 3300048904 | Bacteria | 3964 |
| 1114 | Ga0496101_0177952 | 3300048904 | Bacteria | 1637 |
| 1115 | Ga0496101_1197310 | 3300048904 | Bacteria | 595 |
| 1116 | Ga0496101_1600073 | 3300048904 | Bacteria | 506 |
| 1117 | Ga0496102_0405159 | 3300048905 | Bacteria | 1282 |
| 1118 | Ga0496102_0849946 | 3300048905 | Bacteria | 835 |
| 1119 | Ga0496102_1277333 | 3300048905 | Bacteria | 653 |
| 1120 | Ga0496102_1551061 | 3300048905 | Bacteria | 581 |
| 1121 | Ga0496104_0006037 | 3300048907 | Bacteria | 10624 |
| 1122 | Ga0496104_0029328 | 3300048907 | Bacteria | 5103 |
| 1123 | Ga0496104_0200827 | 3300048907 | Bacteria | 1906 |
| 1124 | Ga0496104_0551223 | 3300048907 | Bacteria | 1064 |
| 1125 | Ga0496104_0663416 | 3300048907 | Bacteria | 952 |
| 1126 | Ga0496105_0126084 | 3300048908 | Bacteria | 2111 |
| 1127 | Ga0496105_0318189 | 3300048908 | Bacteria | 1248 |
| 1128 | Ga0496105_0471461 | 3300048908 | Bacteria | 989 |
| 1129 | Ga0496106_0089817 | 3300048909 | Bacteria | 2370 |
| 1130 | Ga0496106_0588382 | 3300048909 | Bacteria | 892 |
| 1131 | Ga0496107_0148931 | 3300048910 | Bacteria | 1731 |
| 1132 | Ga0496107_0164274 | 3300048910 | Bacteria | 1646 |
| 1133 | Ga0496107_0597950 | 3300048910 | Bacteria | 815 |
| 1134 | Ga0496108_0018851 | 3300048911 | Bacteria | 5658 |
| 1135 | Ga0496108_0306006 | 3300048911 | Bacteria | 1385 |
| 1136 | Ga0496109_0080539 | 3300048912 | Bacteria | 3000 |
| 1137 | Ga0496109_1204842 | 3300048912 | Bacteria | 694 |
| 1138 | Ga0496109_1259607 | 3300048912 | Bacteria | 676 |
| 1139 | Ga0496109_1494100 | 3300048912 | Bacteria | 611 |
| 1140 | Ga0496110_1495194 | 3300048913 | Bacteria | 585 |
| 1141 | Ga0496112_0144189 | 3300048915 | Bacteria | 2350 |
| 1142 | Ga0496112_0659158 | 3300048915 | Bacteria | 976 |
| 1143 | Ga0496114_0000692 | 3300048917 | Bacteria | 25119 |
| 1144 | Ga0496114_0018457 | 3300048917 | Bacteria | 5639 |
| 1145 | Ga0496114_0094991 | 3300048917 | Bacteria | 2536 |
| 1146 | Ga0496114_0269421 | 3300048917 | Bacteria | 1500 |
| 1147 | Ga0496115_0014290 | 3300048918 | Bacteria | 6011 |
| 1148 | Ga0496115_0023739 | 3300048918 | Bacteria | 4760 |
| 1149 | Ga0496115_0400262 | 3300048918 | Bacteria | 1114 |
| 1150 | Ga0496115_0406273 | 3300048918 | Bacteria | 1104 |
| 1151 | Ga0496116_0052029 | 3300048919 | Bacteria | 2716 |
| 1152 | Ga0496121_0016881 | 3300048924 | Bacteria | 7506 |
| 1153 | Ga0496121_0396663 | 3300048924 | Bacteria | 905 |
| 1154 | Ga0496122_0000033 | 3300048925 | Bacteria | 324104 |
| 1155 | Ga0496122_0178195 | 3300048925 | Bacteria | 1271 |
| 1156 | Ga0496123_0001288 | 3300048926 | Bacteria | 35785 |
| 1157 | Ga0496124_0104999 | 3300048927 | Bacteria | 2283 |
| 1158 | Ga0496125_0076706 | 3300048928 | Bacteria | 2579 |
| 1159 | Ga0496125_0346203 | 3300048928 | Bacteria | 890 |
| 1160 | Ga0496126_0080482 | 3300048929 | Bacteria | 2883 |
| 1161 | Ga0496126_1244478 | 3300048929 | Bacteria | 545 |
| 1162 | Ga0501292_129782 | 3300049515 | Bacteria | 520 |
| 1163 | Ga0501031_0000794 | 3300049568 | Bacteria | 18986 |
| 1164 | Ga0501031_0009384 | 3300049568 | Bacteria | 6360 |
| 1165 | Ga0501031_0030953 | 3300049568 | Bacteria | 3491 |
| 1166 | Ga0501031_0043485 | 3300049568 | Bacteria | 2931 |
| 1167 | Ga0501031_0091029 | 3300049568 | Bacteria | 1989 |
| 1168 | Ga0501032_0000452 | 3300049569 | Bacteria | 33341 |
| 1169 | Ga0501032_0015323 | 3300049569 | Bacteria | 5411 |
| 1170 | Ga0501032_0036934 | 3300049569 | Bacteria | 3333 |
| 1171 | Ga0501032_0186755 | 3300049569 | Bacteria | 1356 |
| 1172 | Ga0501032_0387006 | 3300049569 | Bacteria | 899 |
| 1173 | Ga0501032_0405716 | 3300049569 | Bacteria | 875 |
| 1174 | Ga0501032_0419677 | 3300049569 | Bacteria | 858 |
| 1175 | Ga0501032_0898940 | 3300049569 | Bacteria | 558 |
| 1176 | Ga0501033_0000002 | 3300049570 | Bacteria | 668574 |
| 1177 | Ga0501033_0000047 | 3300049570 | Bacteria | 122884 |
| 1178 | Ga0501033_0012368 | 3300049570 | Bacteria | 6514 |
| 1179 | Ga0501033_0031661 | 3300049570 | Bacteria | 3972 |
| 1180 | Ga0501034_0000037 | 3300049571 | Bacteria | 239254 |
| 1181 | Ga0501034_0022604 | 3300049571 | Bacteria | 6406 |
| 1182 | Ga0501034_0045667 | 3300049571 | Bacteria | 4426 |
| 1183 | Ga0501034_0180281 | 3300049571 | Bacteria | 2077 |
| 1184 | Ga0501034_0190313 | 3300049571 | Bacteria | 2014 |
| 1185 | Ga0501034_0190567 | 3300049571 | Bacteria | 2013 |
| 1186 | Ga0501034_0232724 | 3300049571 | Bacteria | 1791 |
| 1187 | Ga0501034_0241274 | 3300049571 | Bacteria | 1753 |
| 1188 | Ga0501034_1121876 | 3300049571 | Bacteria | 667 |
| 1189 | Ga0501034_1130912 | 3300049571 | Bacteria | 663 |
| 1190 | Ga0501036_0004348 | 3300049572 | Bacteria | 11433 |
| 1191 | Ga0501036_0012199 | 3300049572 | Bacteria | 7120 |
| 1192 | Ga0501036_0023743 | 3300049572 | Bacteria | 5167 |
| 1193 | Ga0501036_0038730 | 3300049572 | Bacteria | 4035 |
| 1194 | Ga0501036_0243882 | 3300049572 | Bacteria | 1507 |
| 1195 | Ga0501036_0624664 | 3300049572 | Bacteria | 893 |
| 1196 | Ga0501036_1372976 | 3300049572 | Bacteria | 573 |
| 1197 | Ga0501037_0000062 | 3300049573 | Bacteria | 97779 |
| 1198 | Ga0501037_0002406 | 3300049573 | Bacteria | 13524 |
| 1199 | Ga0501037_0016989 | 3300049573 | Bacteria | 5354 |
| 1200 | Ga0501037_0040539 | 3300049573 | Bacteria | 3427 |
| 1201 | Ga0501037_0130081 | 3300049573 | Bacteria | 1805 |
| 1202 | Ga0501037_0337086 | 3300049573 | Bacteria | 1042 |
| 1203 | Ga0501038_0002285 | 3300049574 | Bacteria | 17825 |
| 1204 | Ga0501038_0017420 | 3300049574 | Bacteria | 6494 |
| 1205 | Ga0501038_0032242 | 3300049574 | Bacteria | 4624 |
| 1206 | Ga0501038_0057491 | 3300049574 | Bacteria | 3339 |
| 1207 | Ga0501038_0268723 | 3300049574 | Bacteria | 1345 |
| 1208 | Ga0501039_0008291 | 3300049575 | Bacteria | 7919 |
| 1209 | Ga0501039_0070100 | 3300049575 | Bacteria | 2723 |
| 1210 | Ga0501039_0082292 | 3300049575 | Bacteria | 2506 |
| 1211 | Ga0501039_0328142 | 3300049575 | Bacteria | 1203 |
| 1212 | Ga0501039_1089868 | 3300049575 | Bacteria | 619 |
| 1213 | Ga0501040_0000563 | 3300049576 | Bacteria | 22467 |
| 1214 | Ga0501040_0182522 | 3300049576 | Bacteria | 1488 |
| 1215 | Ga0501041_0010892 | 3300049577 | Bacteria | 5366 |
| 1216 | Ga0501042_0004644 | 3300049578 | Bacteria | 8766 |
| 1217 | Ga0501042_0311889 | 3300049578 | Bacteria | 1136 |
| 1218 | Ga0501043_0009436 | 3300049579 | Bacteria | 7657 |
| 1219 | Ga0501043_0032969 | 3300049579 | Bacteria | 4073 |
| 1220 | Ga0501043_0043062 | 3300049579 | Bacteria | 3548 |
| 1221 | Ga0501043_0082598 | 3300049579 | Bacteria | 2526 |
| 1222 | Ga0501043_0178962 | 3300049579 | Bacteria | 1653 |
| 1223 | Ga0501043_0266065 | 3300049579 | Bacteria | 1317 |
| 1224 | Ga0501043_0463265 | 3300049579 | Bacteria | 951 |
| 1225 | Ga0501046_0001437 | 3300049580 | Bacteria | 22916 |
| 1226 | Ga0501046_0002418 | 3300049580 | Bacteria | 17510 |
| 1227 | Ga0501046_0168014 | 3300049580 | Bacteria | 1647 |
| 1228 | Ga0501046_0285606 | 3300049580 | Bacteria | 1208 |
| 1229 | Ga0501046_0359852 | 3300049580 | Bacteria | 1055 |
| 1230 | Ga0501046_0630260 | 3300049580 | Bacteria | 759 |
| 1231 | Ga0501047_0000196 | 3300049581 | Bacteria | 73284 |
| 1232 | Ga0501047_0006607 | 3300049581 | Bacteria | 10910 |
| 1233 | Ga0501047_0086353 | 3300049581 | Bacteria | 3015 |
| 1234 | Ga0501047_0134699 | 3300049581 | Bacteria | 2351 |
| 1235 | Ga0501047_0141632 | 3300049581 | Bacteria | 2283 |
| 1236 | Ga0501047_0149352 | 3300049581 | Bacteria | 2213 |
| 1237 | Ga0501047_0180467 | 3300049581 | Bacteria | 1978 |
| 1238 | Ga0501047_0229035 | 3300049581 | Bacteria | 1712 |
| 1239 | Ga0501047_1020609 | 3300049581 | Bacteria | 640 |
| 1240 | Ga0501048_0003354 | 3300049582 | Bacteria | 12184 |
| 1241 | Ga0501048_0035217 | 3300049582 | Bacteria | 3604 |
| 1242 | Ga0501048_0049380 | 3300049582 | Bacteria | 2998 |
| 1243 | Ga0501048_0125951 | 3300049582 | Bacteria | 1811 |
| 1244 | Ga0501067_0000136 | 3300049583 | Bacteria | 40150 |
| 1245 | Ga0501067_0002058 | 3300049583 | Bacteria | 11093 |
| 1246 | Ga0501067_0031592 | 3300049583 | Bacteria | 2937 |
| 1247 | Ga0501067_0035197 | 3300049583 | Bacteria | 2780 |
| 1248 | Ga0501067_0044332 | 3300049583 | Bacteria | 2471 |
| 1249 | Ga0501067_0054602 | 3300049583 | Bacteria | 2213 |
| 1250 | Ga0501067_0069227 | 3300049583 | Bacteria | 1954 |
| 1251 | Ga0501068_0001264 | 3300049584 | Bacteria | 13424 |
| 1252 | Ga0501068_0002516 | 3300049584 | Bacteria | 9733 |
| 1253 | Ga0501068_0021786 | 3300049584 | Bacteria | 3745 |
| 1254 | Ga0501068_0066828 | 3300049584 | Bacteria | 2190 |
| 1255 | Ga0501068_0132669 | 3300049584 | Bacteria | 1558 |
| 1256 | Ga0501068_0242817 | 3300049584 | Bacteria | 1146 |
| 1257 | Ga0501068_0574553 | 3300049584 | Bacteria | 734 |
| 1258 | Ga0501068_0722885 | 3300049584 | Bacteria | 651 |
| 1259 | Ga0501068_1139207 | 3300049584 | Bacteria | 516 |
| 1260 | Ga0501069_0019936 | 3300049585 | Bacteria | 3628 |
| 1261 | Ga0501069_0025853 | 3300049585 | Bacteria | 3211 |
| 1262 | Ga0501069_0052493 | 3300049585 | Bacteria | 2270 |
| 1263 | Ga0501069_0111610 | 3300049585 | Bacteria | 1557 |
| 1264 | Ga0501069_0369879 | 3300049585 | Bacteria | 846 |
| 1265 | Ga0501070_0000061 | 3300049586 | Bacteria | 92432 |
| 1266 | Ga0501070_0000512 | 3300049586 | Bacteria | 35492 |
| 1267 | Ga0501070_0000879 | 3300049586 | Bacteria | 27249 |
| 1268 | Ga0501070_0002718 | 3300049586 | Bacteria | 15436 |
| 1269 | Ga0501070_0021671 | 3300049586 | Bacteria | 5388 |
| 1270 | Ga0501070_0040516 | 3300049586 | Bacteria | 3884 |
| 1271 | Ga0501070_0084981 | 3300049586 | Bacteria | 2620 |
| 1272 | Ga0501070_0114030 | 3300049586 | Bacteria | 2233 |
| 1273 | Ga0501070_0127555 | 3300049586 | Bacteria | 2102 |
| 1274 | Ga0501070_0150756 | 3300049586 | Bacteria | 1918 |
| 1275 | Ga0501070_0195633 | 3300049586 | Bacteria | 1661 |
| 1276 | Ga0501070_0205693 | 3300049586 | Bacteria | 1616 |
| 1277 | Ga0501070_0690935 | 3300049586 | Bacteria | 807 |
| 1278 | Ga0501071_0220422 | 3300049587 | Bacteria | 1427 |
| 1279 | Ga0501071_0414866 | 3300049587 | Bacteria | 1029 |
| 1280 | Ga0501071_0778895 | 3300049587 | Bacteria | 737 |
| 1281 | Ga0501071_1264820 | 3300049587 | Bacteria | 570 |
| 1282 | Ga0501072_0000056 | 3300049588 | Bacteria | 80824 |
| 1283 | Ga0501072_0211242 | 3300049588 | Bacteria | 1546 |
| 1284 | Ga0501072_0581205 | 3300049588 | Bacteria | 884 |
| 1285 | Ga0501072_0634131 | 3300049588 | Bacteria | 842 |
| 1286 | Ga0501072_1031680 | 3300049588 | Bacteria | 641 |
| 1287 | Ga0501073_0004075 | 3300049589 | Bacteria | 10956 |
| 1288 | Ga0501073_0004822 | 3300049589 | Bacteria | 10126 |
| 1289 | Ga0501073_0007233 | 3300049589 | Bacteria | 8265 |
| 1290 | Ga0501073_0008138 | 3300049589 | Bacteria | 7779 |
| 1291 | Ga0501073_0011070 | 3300049589 | Bacteria | 6598 |
| 1292 | Ga0501073_0011649 | 3300049589 | Bacteria | 6424 |
| 1293 | Ga0501073_0019426 | 3300049589 | Bacteria | 4907 |
| 1294 | Ga0501073_0027784 | 3300049589 | Bacteria | 4043 |
| 1295 | Ga0501073_0038022 | 3300049589 | Bacteria | 3415 |
| 1296 | Ga0501073_0060571 | 3300049589 | Bacteria | 2641 |
| 1297 | Ga0501073_0300338 | 3300049589 | Bacteria | 1108 |
| 1298 | Ga0501073_0485602 | 3300049589 | Bacteria | 854 |
| 1299 | Ga0501073_0608519 | 3300049589 | Bacteria | 754 |
| 1300 | Ga0501073_1070245 | 3300049589 | Bacteria | 554 |
| 1301 | Ga0501074_0001374 | 3300049590 | Bacteria | 16135 |
| 1302 | Ga0501074_0020736 | 3300049590 | Bacteria | 4774 |
| 1303 | Ga0501074_0025498 | 3300049590 | Bacteria | 4293 |
| 1304 | Ga0501074_0028177 | 3300049590 | Bacteria | 4070 |
| 1305 | Ga0501074_0337092 | 3300049590 | Bacteria | 1070 |
| 1306 | Ga0501074_0637317 | 3300049590 | Bacteria | 753 |
| 1307 | Ga0501075_0002074 | 3300049591 | Bacteria | 13228 |
| 1308 | Ga0501075_0009705 | 3300049591 | Bacteria | 6745 |
| 1309 | Ga0501075_0156125 | 3300049591 | Bacteria | 1740 |
| 1310 | Ga0501076_0019636 | 3300049592 | Bacteria | 5166 |
| 1311 | Ga0501076_0094759 | 3300049592 | Bacteria | 2404 |
| 1312 | Ga0501076_1153810 | 3300049592 | Bacteria | 638 |
| 1313 | Ga0501077_0005722 | 3300049593 | Bacteria | 7568 |
| 1314 | Ga0501257_042582 | 3300049686 | Bacteria | 1117 |
| 1315 | Ga0501261_010538 | 3300049690 | Bacteria | 1219 |
| 1316 | Ga0501079_0000667 | 3300049741 | Bacteria | 22986 |
| 1317 | Ga0501079_0001786 | 3300049741 | Bacteria | 15350 |
| 1318 | Ga0501079_0010702 | 3300049741 | Bacteria | 6986 |
| 1319 | Ga0501079_0079896 | 3300049741 | Bacteria | 2529 |
| 1320 | Ga0501079_0957268 | 3300049741 | Bacteria | 674 |
| 1321 | Ga0501079_1335188 | 3300049741 | Bacteria | 564 |
| 1322 | Ga0501080_0000918 | 3300049742 | Bacteria | 24125 |
| 1323 | Ga0501080_0004727 | 3300049742 | Bacteria | 12140 |
| 1324 | Ga0501080_0007246 | 3300049742 | Bacteria | 10008 |
| 1325 | Ga0501080_0009445 | 3300049742 | Bacteria | 8895 |
| 1326 | Ga0501080_0019975 | 3300049742 | Bacteria | 6201 |
| 1327 | Ga0501080_0028886 | 3300049742 | Bacteria | 5162 |
| 1328 | Ga0501080_0043113 | 3300049742 | Bacteria | 4200 |
| 1329 | Ga0501080_0160234 | 3300049742 | Bacteria | 2078 |
| 1330 | Ga0501080_0361791 | 3300049742 | Bacteria | 1309 |
| 1331 | Ga0501080_1571893 | 3300049742 | Bacteria | 557 |
| 1332 | Ga0501080_1623738 | 3300049742 | Bacteria | 547 |
| 1333 | Ga0501081_0002255 | 3300049743 | Bacteria | 12128 |
| 1334 | Ga0501081_0124541 | 3300049743 | Bacteria | 1838 |
| 1335 | Ga0501081_0167350 | 3300049743 | Bacteria | 1586 |
| 1336 | Ga0501083_0004962 | 3300049744 | Bacteria | 9428 |
| 1337 | Ga0501083_0012182 | 3300049744 | Bacteria | 6020 |
| 1338 | Ga0501083_0018307 | 3300049744 | Bacteria | 4881 |
| 1339 | Ga0501083_0035312 | 3300049744 | Bacteria | 3415 |
| 1340 | Ga0501083_0181286 | 3300049744 | Bacteria | 1375 |
| 1341 | Ga0501083_0198180 | 3300049744 | Bacteria | 1310 |
| 1342 | Ga0501083_0251858 | 3300049744 | Bacteria | 1149 |
| 1343 | Ga0501083_0280144 | 3300049744 | Bacteria | 1085 |
| 1344 | Ga0501083_0600726 | 3300049744 | Bacteria | 716 |
| 1345 | Ga0501273_061016 | 3300049770 | Bacteria | 594 |
| 1346 | Ga0501035_0000004 | 3300049822 | Bacteria | 403650 |
| 1347 | Ga0501035_0014804 | 3300049822 | Bacteria | 7199 |
| 1348 | Ga0501035_0015102 | 3300049822 | Bacteria | 7126 |
| 1349 | Ga0501035_0016208 | 3300049822 | Bacteria | 6878 |
| 1350 | Ga0501035_0053797 | 3300049822 | Bacteria | 3598 |
| 1351 | Ga0501035_0221044 | 3300049822 | Bacteria | 1617 |
| 1352 | Ga0501035_0302317 | 3300049822 | Bacteria | 1348 |
| 1353 | Ga0501044_0001842 | 3300049823 | Bacteria | 24647 |
| 1354 | Ga0501044_0003422 | 3300049823 | Bacteria | 17882 |
| 1355 | Ga0501044_0018367 | 3300049823 | Bacteria | 7493 |
| 1356 | Ga0501044_0041848 | 3300049823 | Bacteria | 4769 |
| 1357 | Ga0501044_0297746 | 3300049823 | Bacteria | 1543 |
| 1358 | Ga0501044_0418236 | 3300049823 | Bacteria | 1251 |
| 1359 | Ga0501044_0660314 | 3300049823 | Bacteria | 934 |
| 1360 | Ga0501044_1302007 | 3300049823 | Bacteria | 593 |
| 1361 | Ga0501044_1453271 | 3300049823 | Bacteria | 551 |
| 1362 | Ga0501044_1665581 | 3300049823 | Bacteria | 503 |
| 1363 | Ga0501045_0004093 | 3300049824 | Bacteria | 10065 |
| 1364 | Ga0501045_0352186 | 3300049824 | Bacteria | 1096 |
| 1365 | Ga0501045_1009827 | 3300049824 | Bacteria | 610 |
| 1366 | nmdc:mga03683_314502_c1 | 3300050489 | Bacteria | 736 |
| 1367 | nmdc:mga03683_419792_c1 | 3300050489 | Bacteria | 641 |
| 1368 | nmdc:mga03683_88_c3 | 3300050489 | Bacteria | 4001 |
| 1369 | nmdc:mga03n38_146491_c1 | 3300050490 | Bacteria | 1184 |
| 1370 | nmdc:mga03n38_2587_c1 | 3300050490 | Bacteria | 5631 |
| 1371 | nmdc:mga00v17_386360_c1 | 3300050491 | Bacteria | 910 |
| 1372 | nmdc:mga0k408_170717_c1 | 3300050493 | Bacteria | 1296 |
| 1373 | nmdc:mga0k408_1872_c1 | 3300050493 | Bacteria | 11278 |
| 1374 | nmdc:mga0k408_528900_c1 | 3300050493 | Bacteria | 698 |
| 1375 | nmdc:mga0k408_7601_c1 | 3300050493 | Bacteria | 5788 |
| 1376 | nmdc:mga07m45_3477_c2 | 3300050496 | Bacteria | 6526 |
| 1377 | nmdc:mga05p37_1253825_c1 | 3300050507 | Bacteria | 760 |
| 1378 | nmdc:mga05p37_944370_c1 | 3300050507 | Bacteria | 924 |
| 1379 | nmdc:mga09592_1218876_c1 | 3300050508 | Bacteria | 621 |
| 1380 | nmdc:mga09592_42047_c1 | 3300050508 | Bacteria | 3844 |
| 1381 | nmdc:mga09592_495402_c1 | 3300050508 | Bacteria | 1052 |
| 1382 | nmdc:mga0qj67_13329_c1 | 3300050509 | Bacteria | 5837 |
| 1383 | nmdc:mga06r32_80572_c1 | 3300050510 | Bacteria | 3169 |
| 1384 | nmdc:mga08y16_1038150_c1 | 3300050511 | Bacteria | 798 |
| 1385 | nmdc:mga08y16_1165_c1 | 3300050511 | Bacteria | 25911 |
| 1386 | nmdc:mga08y16_128186_c1 | 3300050511 | Bacteria | 2639 |
| 1387 | nmdc:mga08y16_1438360_c1 | 3300050511 | Bacteria | 651 |
| 1388 | nmdc:mga08y16_4368_c1 | 3300050511 | Bacteria | 14770 |
| 1389 | nmdc:mga08y16_639304_c1 | 3300050511 | Bacteria | 1069 |
| 1390 | nmdc:mga0n895_275031_c1 | 3300050512 | Bacteria | 1708 |
| 1391 | nmdc:mga0n895_750370_c1 | 3300050512 | Bacteria | 969 |
| 1392 | nmdc:mga08x19_250758_c1 | 3300050514 | Bacteria | 1222 |
| 1393 | nmdc:mga08x19_38494_c1 | 3300050514 | Bacteria | 3038 |
| 1394 | nmdc:mga08x19_569890_c1 | 3300050514 | Bacteria | 802 |
| 1395 | nmdc:mga0a205_625493_c1 | 3300050515 | Bacteria | 929 |
| 1396 | nmdc:mga0a205_853177_c1 | 3300050515 | Bacteria | 758 |
| 1397 | Ga0495601_0001493 | 3300053077 | Bacteria | 12895 |
| 1398 | Ga0495601_0086291 | 3300053077 | Bacteria | 2017 |
| 1399 | Ga0495601_0204424 | 3300053077 | Bacteria | 1290 |
| 1400 | Ga0495601_0411743 | 3300053077 | Bacteria | 876 |
| 1401 | Ga0495601_0434103 | 3300053077 | Bacteria | 850 |
| 1402 | Ga0495612_0069407 | 3300053078 | Bacteria | 1467 |
| 1403 | Ga0500610_0032474 | 3300053079 | Bacteria | 2658 |
| 1404 | Ga0495595_0004500 | 3300053084 | Bacteria | 5606 |
| 1405 | Ga0495595_0576303 | 3300053084 | Bacteria | 575 |
| 1406 | Ga0495619_0000426 | 3300053085 | Bacteria | 28605 |
| 1407 | Ga0495619_0242014 | 3300053085 | Bacteria | 1250 |
| 1408 | Ga0495619_0551485 | 3300053085 | Bacteria | 791 |
| 1409 | Ga0495619_1077370 | 3300053085 | Bacteria | 535 |
| 1410 | Ga0500650_0068730 | 3300053098 | Bacteria | 1655 |
| 1411 | Ga0500555_000343 | 3300053103 | Bacteria | 19817 |
| 1412 | Ga0500556_0000010 | 3300053104 | Bacteria | 258288 |
| 1413 | Ga0500556_0180298 | 3300053104 | Bacteria | 834 |
| 1414 | Ga0500593_000072 | 3300053117 | Bacteria | 37884 |
| 1415 | Ga0500642_0029459 | 3300053130 | Bacteria | 2275 |
| 1416 | Ga0500642_0060231 | 3300053130 | Bacteria | 1702 |
| 1417 | Ga0500655_019853 | 3300053133 | Bacteria | 1253 |
| 1418 | Ga0500655_032811 | 3300053133 | Bacteria | 1003 |
| 1419 | Ga0500616_0002331 | 3300053153 | Bacteria | 16017 |
| 1420 | Ga0500616_0023759 | 3300053153 | Bacteria | 3412 |
| 1421 | Ga0500645_065720 | 3300053730 | Bacteria | 1045 |
| 1422 | Ga0501084_0000544 | 3300054114 | Bacteria | 28733 |
| 1423 | Ga0501084_0006037 | 3300054114 | Bacteria | 9962 |
| 1424 | Ga0501084_0029390 | 3300054114 | Bacteria | 4598 |
| 1425 | Ga0501084_0374514 | 3300054114 | Bacteria | 1203 |
| 1426 | Ga0501084_0485450 | 3300054114 | Bacteria | 1044 |
| 1427 | Ga0587080_003782 | 3300059503 | Bacteria | 1915 |
| 1428 | Ga0587080_033958 | 3300059503 | Bacteria | 902 |
| 1429 | Ga0587083_0045829 | 3300059505 | Bacteria | 935 |
| 1430 | Ga0587067_053055 | 3300059640 | Bacteria | 827 |
| 1431 | Ga0587076_117983 | 3300059645 | Bacteria | 612 |
| 1432 | Ga0587079_050777 | 3300059647 | Bacteria | 870 |
| 1433 | Ga0587071_005154 | 3300060344 | Bacteria | 1987 |
| 1434 | Ga0587111_0063772 | 3300060346 | Bacteria | 844 |
| 1435 | Ga0501082_0005564 | 3300060353 | Bacteria | 10939 |
| 1436 | Ga0501082_0011143 | 3300060353 | Bacteria | 7729 |
| 1437 | Ga0501082_0017087 | 3300060353 | Bacteria | 6251 |
| 1438 | Ga0501082_0037852 | 3300060353 | Bacteria | 4160 |
| 1439 | Ga0501082_0039727 | 3300060353 | Bacteria | 4059 |
| 1440 | Ga0501082_0041755 | 3300060353 | Bacteria | 3955 |
| 1441 | Ga0501082_0124040 | 3300060353 | Bacteria | 2239 |
| 1442 | Ga0501082_0136997 | 3300060353 | Bacteria | 2124 |
| 1443 | Ga0501082_0801022 | 3300060353 | Bacteria | 824 |
| 1444 | Ga0501082_0972126 | 3300060353 | Bacteria | 742 |
| 1445 | Ga0466962_0017640 | 3300061719 | Bacteria | 3437 |
| 1446 | Ga0466962_0036578 | 3300061719 | Bacteria | 2350 |
| 1447 | Ga0466962_0109327 | 3300061719 | Bacteria | 1330 |
| 1448 | Ga0530510_0027093 | 3300061734 | Bacteria | 4105 |
| 1449 | Ga0530510_0066938 | 3300061734 | Bacteria | 2605 |
| 1450 | Ga0530510_0395563 | 3300061734 | Bacteria | 1041 |
| 1451 | 2787508105 | 2786546548 | Bacteria | 4745694 |
| 1452 | rootH2_10009508 | |||
| 1453 | JGI24033J14998_100040 | |||
| 1454 | JGI24743J22301_10000046 | |||
| 1455 | JGI24033J26618_1000022 | |||
| 1456 | Ga0006767J43181_102738 | |||
| 1457 | Ga0006763J43179_103811 | |||
| 1458 | Ga0006765J45826_107625 | |||
| 1459 | Ga0006778J45830_1033904 | |||
| 1460 | Ga0006758J48902_1014192 | |||
| 1461 | rootH2_10000766 | |||
| 1462 | rootH2_10087759 | |||
| 1463 | rootH1_10236075 | |||
| 1464 | Ga0032354_1004574 | |||
| 1465 | Ga0055540_1081610 | |||
| 1466 | Ga0058859_10017652 | |||
| 1467 | Ga0058863_10089126 | |||
| 1468 | Ga0058863_11301227 | |||
| 1469 | Ga0058863_11859074 | |||
| 1470 | Ga0058861_10043227 | |||
| 1471 | Ga0058860_11878483 | |||
| 1472 | Ga0058860_12243724 | |||
| 1473 | Ga0058862_10016066 | |||
| 1474 | Ga0058862_12245081 | |||
| 1475 | Ga0058862_12869646 | |||
| 1476 | Ga0065704_10200999 | |||
| 1477 | Ga0065704_10735280 | |||
| 1478 | Ga0065712_10404380 | |||
| 1479 | Ga0065712_10758685 | |||
| 1480 | Ga0065715_10435202 | |||
| 1481 | Ga0065707_10638827 | |||
| 1482 | Ga0070658_10548068 | |||
| 1483 | Ga0070676_10008133 | |||
| 1484 | Ga0070676_10164732 | |||
| 1485 | Ga0070676_10818777 | |||
| 1486 | Ga0070683_101093001 | |||
| 1487 | Ga0070683_101144020 | |||
| 1488 | Ga0070690_100013678 | |||
| 1489 | Ga0070690_100030194 | |||
| 1490 | Ga0070690_100231082 | |||
| 1491 | Ga0070690_100842158 | |||
| 1492 | Ga0070690_101084178 | |||
| 1493 | Ga0070670_100083169 | |||
| 1494 | Ga0070670_100100107 | |||
| 1495 | Ga0068869_100425265 | |||
| 1496 | Ga0070666_10027445 | |||
| 1497 | Ga0070666_10031114 | |||
| 1498 | Ga0070666_10273089 | |||
| 1499 | Ga0070680_100442456 | |||
| 1500 | Ga0070680_100737881 | |||
| 1501 | Ga0070680_101198018 | |||
| 1502 | Ga0070682_100903533 | |||
| 1503 | Ga0068868_100537999 | |||
| 1504 | Ga0068868_101613712 | |||
| 1505 | Ga0070689_100043362 | |||
| 1506 | Ga0070689_100062309 | |||
| 1507 | Ga0070691_10020450 | |||
| 1508 | Ga0070691_10178271 | |||
| 1509 | Ga0070687_100040520 | |||
| 1510 | Ga0070687_100040693 | |||
| 1511 | Ga0070687_100123528 | |||
| 1512 | Ga0070687_100145104 | |||
| 1513 | Ga0070687_100185739 | |||
| 1514 | Ga0070661_100007296 | |||
| 1515 | Ga0070692_10025468 | |||
| 1516 | Ga0070692_10418555 | |||
| 1517 | Ga0070668_100012673 | |||
| 1518 | Ga0070668_100596076 | |||
| 1519 | Ga0070669_100031851 | |||
| 1520 | Ga0070675_100024404 | |||
| 1521 | Ga0070675_100100099 | |||
| 1522 | Ga0070675_101813484 | |||
| 1523 | Ga0070675_102101375 | |||
| 1524 | Ga0070671_100050450 | |||
| 1525 | Ga0070671_100086977 | |||
| 1526 | Ga0070674_100164066 | |||
| 1527 | Ga0070674_100238508 | |||
| 1528 | Ga0070674_100586647 | |||
| 1529 | Ga0070674_100722096 | |||
| 1530 | Ga0070674_100782098 | |||
| 1531 | Ga0070673_100006487 | |||
| 1532 | Ga0070673_100191763 | |||
| 1533 | Ga0070673_100247337 | |||
| 1534 | Ga0070673_100249130 | |||
| 1535 | Ga0070673_100345424 | |||
| 1536 | Ga0070673_100408817 | |||
| 1537 | Ga0070688_100107250 | |||
| 1538 | Ga0070688_100435253 | |||
| 1539 | Ga0070688_100529926 | |||
| 1540 | Ga0070688_100673592 | |||
| 1541 | Ga0070659_100044632 | |||
| 1542 | Ga0070659_100173439 | |||
| 1543 | Ga0070659_100263635 | |||
| 1544 | Ga0070659_100633316 | |||
| 1545 | Ga0070659_101077065 | |||
| 1546 | Ga0070667_100169238 | |||
| 1547 | Ga0070667_100266709 | |||
| 1548 | Ga0070667_100414487 | |||
| 1549 | Ga0070667_100627854 | |||
| 1550 | Ga0070667_101018261 | |||
| 1551 | Ga0070667_101055686 | |||
| 1552 | Ga0070709_10076963 | |||
| 1553 | Ga0070714_100154716 | |||
| 1554 | Ga0070713_100058956 | |||
| 1555 | Ga0070713_100405479 | |||
| 1556 | Ga0070713_100546412 | |||
| 1557 | Ga0070713_101104026 | |||
| 1558 | Ga0070710_10034913 | |||
| 1559 | Ga0070710_10119604 | |||
| 1560 | Ga0070710_11176075 | |||
| 1561 | Ga0070710_11306267 | |||
| 1562 | Ga0070701_10026586 | |||
| 1563 | Ga0070701_10085744 | |||
| 1564 | Ga0070701_10142610 | |||
| 1565 | Ga0070711_100106782 | |||
| 1566 | Ga0070711_100150550 | |||
| 1567 | Ga0070711_100489861 | |||
| 1568 | Ga0070711_100549541 | |||
| 1569 | Ga0070711_100719610 | |||
| 1570 | Ga0070705_100107580 | |||
| 1571 | Ga0070705_100127856 | |||
| 1572 | Ga0070700_100015700 | |||
| 1573 | Ga0070694_100281997 | |||
| 1574 | Ga0070708_100098299 | |||
| 1575 | Ga0070708_100111862 | |||
| 1576 | Ga0070708_100122017 | |||
| 1577 | Ga0070708_100870280 | |||
| 1578 | Ga0070663_100429790 | |||
| 1579 | Ga0070663_101035743 | |||
| 1580 | Ga0070678_100343124 | |||
| 1581 | Ga0070678_100419539 | |||
| 1582 | Ga0070678_100880205 | |||
| 1583 | Ga0070678_101038601 | |||
| 1584 | Ga0070678_101823022 | |||
| 1585 | Ga0070662_100300526 | |||
| 1586 | Ga0070662_100308505 | |||
| 1587 | Ga0070662_100681474 | |||
| 1588 | Ga0070681_10062942 | |||
| 1589 | Ga0070681_10277019 | |||
| 1590 | Ga0070681_11566054 | |||
| 1591 | Ga0068867_100023122 | |||
| 1592 | Ga0068867_100127791 | |||
| 1593 | Ga0068867_100763851 | |||
| 1594 | Ga0070685_10067144 | |||
| 1595 | Ga0070685_10189451 | |||
| 1596 | Ga0070685_10255044 | |||
| 1597 | Ga0070685_10319772 | |||
| 1598 | Ga0070685_10555633 | |||
| 1599 | Ga0070685_11195342 | |||
| 1600 | Ga0070706_100001357 | |||
| 1601 | Ga0070706_100209453 | |||
| 1602 | Ga0070706_100222379 | |||
| 1603 | Ga0070706_100681534 | |||
| 1604 | Ga0070706_101168525 | |||
| 1605 | Ga0070707_100058669 | |||
| 1606 | Ga0070707_100164467 | |||
| 1607 | Ga0070698_100000876 | |||
| 1608 | Ga0070698_100005165 | |||
| 1609 | Ga0070698_100040114 | |||
| 1610 | Ga0070698_100047454 | |||
| 1611 | Ga0070698_100050679 | |||
| 1612 | Ga0070699_100044930 | |||
| 1613 | Ga0070699_100354791 | |||
| 1614 | Ga0070699_100825658 | |||
| 1615 | Ga0070699_101276977 | |||
| 1616 | Ga0070679_100073713 | |||
| 1617 | Ga0070684_100570786 | |||
| 1618 | Ga0070684_100933251 | |||
| 1619 | Ga0070684_100966346 | |||
| 1620 | Ga0070684_101863506 | |||
| 1621 | Ga0070697_100069934 | |||
| 1622 | Ga0070697_100130084 | |||
| 1623 | Ga0070697_100278191 | |||
| 1624 | Ga0070697_100563599 | |||
| 1625 | Ga0070697_100610921 | |||
| 1626 | Ga0070697_100756096 | |||
| 1627 | Ga0068853_100192614 | |||
| 1628 | Ga0068853_100204469 | |||
| 1629 | Ga0068853_100751632 | |||
| 1630 | Ga0068853_100975898 | |||
| 1631 | Ga0068853_101377014 | |||
| 1632 | Ga0070672_100016466 | |||
| 1633 | Ga0070672_100334037 | |||
| 1634 | Ga0070672_100450402 | |||
| 1635 | Ga0070672_100815382 | |||
| 1636 | Ga0070686_100010762 | |||
| 1637 | Ga0070686_100053860 | |||
| 1638 | Ga0070686_100058785 | |||
| 1639 | Ga0070686_100106937 | |||
| 1640 | Ga0070686_100376312 | |||
| 1641 | Ga0070686_100855265 | |||
| 1642 | Ga0070696_101046924 | |||
| 1643 | Ga0070693_100506555 | |||
| 1644 | Ga0070693_100510972 | |||
| 1645 | Ga0070665_100736200 | |||
| 1646 | Ga0070665_100779741 | |||
| 1647 | Ga0068855_100002380 | |||
| 1648 | Ga0068855_100025181 | |||
| 1649 | Ga0068855_100058765 | |||
| 1650 | Ga0068855_100517297 | |||
| 1651 | Ga0070664_101662120 | |||
| 1652 | Ga0068857_100230538 | |||
| 1653 | Ga0068857_100279929 | |||
| 1654 | Ga0068857_101150734 | |||
| 1655 | Ga0068857_101547501 | |||
| 1656 | Ga0068854_100650572 | |||
| 1657 | Ga0068856_100000034 | |||
| 1658 | Ga0068856_100008797 | |||
| 1659 | Ga0068856_100140681 | |||
| 1660 | Ga0068856_100149613 | |||
| 1661 | Ga0068856_100218977 | |||
| 1662 | Ga0068856_100337427 | |||
| 1663 | Ga0070702_100133662 | |||
| 1664 | Ga0070702_100223846 | |||
| 1665 | Ga0070702_100350529 | |||
| 1666 | Ga0070702_100462953 | |||
| 1667 | Ga0070702_100548616 | |||
| 1668 | Ga0070702_100692048 | |||
| 1669 | Ga0070702_101066393 | |||
| 1670 | Ga0068852_100096637 | |||
| 1671 | Ga0068852_102121910 | |||
| 1672 | Ga0068859_100001788 | |||
| 1673 | Ga0068859_100096940 | |||
| 1674 | Ga0068859_100537309 | |||
| 1675 | Ga0068859_100617739 | |||
| 1676 | Ga0068864_100208362 | |||
| 1677 | Ga0068866_10008221 | |||
| 1678 | Ga0068866_10215792 | |||
| 1679 | Ga0068861_100017078 | |||
| 1680 | Ga0068861_100257834 | |||
| 1681 | Ga0068861_101713826 | |||
| 1682 | Ga0068863_100191523 | |||
| 1683 | Ga0068863_100520471 | |||
| 1684 | Ga0068863_100988477 | |||
| 1685 | Ga0068858_100043912 | |||
| 1686 | Ga0068858_100233399 | |||
| 1687 | Ga0068858_100367273 | |||
| 1688 | Ga0068858_101325732 | |||
| 1689 | Ga0068860_100348643 | |||
| 1690 | Ga0068860_100857988 | |||
| 1691 | Ga0068862_100214943 | |||
| 1692 | Ga0068862_100669840 | |||
| 1693 | Ga0068862_101245344 | |||
| 1694 | Ga0081455_10069915 | |||
| 1695 | Ga0081455_10109655 | |||
| 1696 | Ga0081455_10121526 | |||
| 1697 | Ga0081455_10197461 | |||
| 1698 | Ga0081455_10924447 | |||
| 1699 | Ga0081540_1040002 | |||
| 1700 | Ga0081540_1091687 | |||
| 1701 | Ga0081540_1155738 | |||
| 1702 | Ga0070717_10147478 | |||
| 1703 | Ga0070717_11817011 | |||
| 1704 | Ga0075363_100031796 | |||
| 1705 | Ga0075363_100274519 | |||
| 1706 | Ga0075364_10387748 | |||
| 1707 | Ga0070715_10217187 | |||
| 1708 | Ga0070716_100037586 | |||
| 1709 | Ga0070712_100811185 | |||
| 1710 | Ga0075362_10016318 | |||
| 1711 | Ga0075362_10030032 | |||
| 1712 | Ga0075362_10573166 | |||
| 1713 | Ga0075369_10461562 | |||
| 1714 | Ga0075366_10027432 | |||
| 1715 | Ga0075366_10033077 | |||
| 1716 | Ga0075366_10459969 | |||
| 1717 | Ga0075366_10611606 | |||
| 1718 | Ga0097621_100117829 | |||
| 1719 | Ga0097621_100194261 | |||
| 1720 | Ga0097621_100479555 | |||
| 1721 | Ga0097621_100683581 | |||
| 1722 | Ga0097621_100698579 | |||
| 1723 | Ga0075370_10014773 | |||
| 1724 | Ga0068871_100313458 | |||
| 1725 | Ga0068871_100514088 | |||
| 1726 | Ga0068871_100706500 | |||
| 1727 | Ga0068871_100801531 | |||
| 1728 | Ga0068871_101147191 | |||
| 1729 | Ga0068871_101518087 | |||
| 1730 | Ga0075428_100180570 | |||
| 1731 | Ga0075428_101442071 | |||
| 1732 | Ga0075430_100006122 | |||
| 1733 | Ga0075430_101413212 | |||
| 1734 | Ga0075431_100001910 | |||
| 1735 | Ga0075431_101035980 | |||
| 1736 | Ga0075434_100377933 | |||
| 1737 | Ga0075434_101125048 | |||
| 1738 | Ga0075434_101820037 | |||
| 1739 | Ga0075429_100093338 | |||
| 1740 | Ga0075429_100737722 | |||
| 1741 | Ga0075429_101636026 | |||
| 1742 | Ga0075429_101748042 | |||
| 1743 | Ga0068865_100003577 | |||
| 1744 | Ga0068865_100190591 | |||
| 1745 | Ga0068865_100567651 | |||
| 1746 | Ga0068865_100677466 | |||
| 1747 | Ga0097620_100001788 | |||
| 1748 | Ga0097620_100096939 | |||
| 1749 | Ga0097620_100537285 | |||
| 1750 | Ga0097620_100617772 | |||
| 1751 | Ga0097620_101233198 | |||
| 1752 | Ga0075435_100863079 | |||
| 1753 | Ga0099794_10259303 | |||
| 1754 | Ga0105240_10072975 | |||
| 1755 | Ga0105240_10094834 | |||
| 1756 | Ga0105240_10144397 | |||
| 1757 | Ga0105240_10616903 | |||
| 1758 | Ga0105240_10758954 | |||
| 1759 | Ga0105240_11307838 | |||
| 1760 | Ga0111539_10004360 | |||
| 1761 | Ga0111539_10071139 | |||
| 1762 | Ga0111539_10151426 | |||
| 1763 | Ga0111539_10737832 | |||
| 1764 | Ga0105245_10072219 | |||
| 1765 | Ga0105245_10365918 | |||
| 1766 | Ga0105245_11118502 | |||
| 1767 | Ga0105245_11573338 | |||
| 1768 | Ga0105245_12435506 | |||
| 1769 | Ga0105247_10000590 | |||
| 1770 | Ga0114129_10266953 | |||
| 1771 | Ga0114129_10606398 | |||
| 1772 | Ga0105243_10055115 | |||
| 1773 | Ga0105243_10731056 | |||
| 1774 | Ga0105241_10255970 | |||
| 1775 | Ga0105241_10823495 | |||
| 1776 | Ga0105242_10248790 | |||
| 1777 | Ga0105242_11300956 | |||
| 1778 | Ga0105242_11358261 | |||
| 1779 | Ga0105242_12015693 | |||
| 1780 | Ga0105242_12042347 | |||
| 1781 | Ga0105248_10126121 | |||
| 1782 | Ga0105248_10279060 | |||
| 1783 | Ga0105248_11359649 | |||
| 1784 | Ga0105248_11631718 | |||
| 1785 | Ga0105248_12647586 | |||
| 1786 | Ga0105237_10274327 | |||
| 1787 | Ga0105237_10505112 | |||
| 1788 | Ga0105237_12464750 | |||
| 1789 | Ga0105238_10034529 | |||
| 1790 | Ga0105238_11030754 | |||
| 1791 | Ga0105249_10368153 | |||
| 1792 | Ga0105249_10394076 | |||
| 1793 | Ga0105249_10628614 | |||
| 1794 | Ga0105249_11148941 | |||
| 1795 | Ga0105239_10028406 | |||
| 1796 | Ga0105239_10154764 | |||
| 1797 | Ga0105239_10436599 | |||
| 1798 | Ga0105239_10522178 | |||
| 1799 | Ga0105239_10605720 | |||
| 1800 | Ga0105239_10945482 | |||
| 1801 | Ga0105239_13338008 | |||
| 1802 | Ga0105246_10351452 | |||
| 1803 | Ga0105246_10499939 | |||
| 1804 | Ga0105246_10968531 | |||
| 1805 | Ga0105246_11196104 | |||
| 1806 | Ga0105246_11263828 | |||
| 1807 | Ga0157373_11387752 | |||
| 1808 | Ga0157369_10691266 | |||
| 1809 | Ga0157369_10695868 | |||
| 1810 | Ga0157374_10000476 | |||
| 1811 | Ga0157374_10014770 | |||
| 1812 | Ga0157374_10944328 | |||
| 1813 | Ga0157374_11001294 | |||
| 1814 | Ga0157374_11146442 | |||
| 1815 | Ga0157374_11176428 | |||
| 1816 | Ga0157374_11209700 | |||
| 1817 | Ga0157374_12491035 | |||
| 1818 | Ga0157374_12844696 | |||
| 1819 | Ga0157378_10006080 | |||
| 1820 | Ga0157378_10155646 | |||
| 1821 | Ga0157378_10362479 | |||
| 1822 | Ga0157378_10611103 | |||
| 1823 | Ga0157378_12250546 | |||
| 1824 | Ga0157378_12303738 | |||
| 1825 | Ga0157378_12398023 | |||
| 1826 | Ga0163162_10280142 | |||
| 1827 | Ga0163162_10386433 | |||
| 1828 | Ga0163162_10587386 | |||
| 1829 | Ga0163162_11078568 | |||
| 1830 | Ga0163162_11087494 | |||
| 1831 | Ga0163162_11900160 | |||
| 1832 | Ga0163162_12395262 | |||
| 1833 | Ga0157372_10867715 | |||
| 1834 | Ga0157372_10907575 | |||
| 1835 | Ga0157372_11323291 | |||
| 1836 | Ga0157375_10001065 | |||
| 1837 | Ga0157375_10356481 | |||
| 1838 | Ga0157375_10504949 | |||
| 1839 | Ga0157375_12261829 | |||
| 1840 | Ga0163163_10337011 | |||
| 1841 | Ga0163163_10545874 | |||
| 1842 | Ga0163163_10632201 | |||
| 1843 | Ga0163163_10742859 | |||
| 1844 | Ga0163163_10987885 | |||
| 1845 | Ga0163163_11026736 | |||
| 1846 | Ga0163163_11702931 | |||
| 1847 | Ga0163163_12261561 | |||
| 1848 | Ga0157380_10294262 | |||
| 1849 | Ga0157380_11398424 | |||
| 1850 | Ga0157377_10235855 | |||
| 1851 | Ga0157379_10551871 | |||
| 1852 | Ga0157379_11216972 | |||
| 1853 | Ga0157376_10298912 | |||
| 1854 | Ga0157376_10628629 | |||
| 1855 | Ga0157376_10750764 | |||
| 1856 | Ga0157376_10874435 | |||
| 1857 | Ga0157376_11011883 | |||
| 1858 | Ga0157376_11638140 | |||
| 1859 | Ga0157376_11658422 | |||
| 1860 | Ga0157376_11996883 | |||
| 1861 | Ga0163161_10122320 | |||
| 1862 | Ga0163161_10821559 | |||
| 1863 | Ga0206356_10010424 | |||
| 1864 | Ga0206356_10602174 | |||
| 1865 | Ga0206356_11494082 | |||
| 1866 | Ga0206351_10933183 | |||
| 1867 | Ga0206352_10724423 | |||
| 1868 | Ga0206352_11328313 | |||
| 1869 | Ga0206350_11274299 | |||
| 1870 | Ga0154015_1418828 | |||
| 1871 | Ga0213873_10113755 | |||
| 1872 | Ga0213873_10152581 | |||
| 1873 | Ga0213873_10209344 | |||
| 1874 | Ga0213872_10000347 | |||
| 1875 | Ga0213872_10019579 | |||
| 1876 | Ga0213872_10036356 | |||
| 1877 | Ga0213872_10143099 | |||
| 1878 | Ga0213872_10170234 | |||
| 1879 | Ga0213872_10235976 | |||
| 1880 | Ga0213874_10246725 | |||
| 1881 | Ga0213876_10000625 | |||
| 1882 | Ga0213876_10020022 | |||
| 1883 | Ga0213876_10022119 | |||
| 1884 | Ga0213876_10046119 | |||
| 1885 | Ga0213876_10080950 | |||
| 1886 | Ga0213876_10157327 | |||
| 1887 | Ga0213876_10241588 | |||
| 1888 | Ga0213876_10459308 | |||
| 1889 | Ga0213875_10209791 | |||
| 1890 | Ga0213875_10338228 | |||
| 1891 | Ga0213871_10013545 | |||
| 1892 | Ga0213871_10032464 | |||
| 1893 | Ga0213871_10047268 | |||
| 1894 | Ga0213871_10063925 | |||
| 1895 | Ga0207638_1004678 | |||
| 1896 | Ga0209675_1002886 | |||
| 1897 | Ga0209676_1007618 | |||
| 1898 | Ga0209676_1098937 | |||
| 1899 | Ga0209025_1000026 | |||
| 1900 | Ga0209050_1019384 | |||
| 1901 | Ga0209051_1013568 | |||
| 1902 | Ga0207697_10060121 | |||
| 1903 | Ga0207697_10157045 | |||
| 1904 | Ga0207697_10245407 | |||
| 1905 | Ga0207692_10118544 | |||
| 1906 | Ga0207692_10729359 | |||
| 1907 | Ga0207692_11167786 | |||
| 1908 | Ga0207642_10009878 | |||
| 1909 | Ga0207642_10495476 | |||
| 1910 | Ga0207710_10002562 | |||
| 1911 | Ga0207710_10720868 | |||
| 1912 | Ga0207688_10299895 | |||
| 1913 | Ga0207688_10363132 | |||
| 1914 | Ga0207680_10262503 | |||
| 1915 | Ga0207685_10172230 | |||
| 1916 | Ga0207699_10065974 | |||
| 1917 | Ga0207699_10923927 | |||
| 1918 | Ga0207699_11252521 | |||
| 1919 | Ga0207699_11353766 | |||
| 1920 | Ga0207645_10000728 | |||
| 1921 | Ga0207645_10169569 | |||
| 1922 | Ga0207645_10359290 | |||
| 1923 | Ga0207645_10502135 | |||
| 1924 | Ga0207643_10294026 | |||
| 1925 | Ga0207705_11448403 | |||
| 1926 | Ga0207684_10002013 | |||
| 1927 | Ga0207684_10127191 | |||
| 1928 | Ga0207684_10259174 | |||
| 1929 | Ga0207684_10456915 | |||
| 1930 | Ga0207684_11099042 | |||
| 1931 | Ga0207654_11326221 | |||
| 1932 | Ga0207707_10615079 | |||
| 1933 | Ga0207707_10841728 | |||
| 1934 | Ga0207707_11320105 | |||
| 1935 | Ga0207695_10000061 | |||
| 1936 | Ga0207695_10132686 | |||
| 1937 | Ga0207695_10175100 | |||
| 1938 | Ga0207695_10324365 | |||
| 1939 | Ga0207695_10478153 | |||
| 1940 | Ga0207671_10119846 | |||
| 1941 | Ga0207671_10269415 | |||
| 1942 | Ga0207671_10339380 | |||
| 1943 | Ga0207693_10651742 | |||
| 1944 | Ga0207693_10658091 | |||
| 1945 | Ga0207693_10795636 | |||
| 1946 | Ga0207693_10868223 | |||
| 1947 | Ga0207663_10048355 | |||
| 1948 | Ga0207663_10130938 | |||
| 1949 | Ga0207663_10274511 | |||
| 1950 | Ga0207663_10577325 | |||
| 1951 | Ga0207663_10905079 | |||
| 1952 | Ga0207663_11222733 | |||
| 1953 | Ga0207660_10308001 | |||
| 1954 | Ga0207662_10074152 | |||
| 1955 | Ga0207662_10104235 | |||
| 1956 | Ga0207662_10171787 | |||
| 1957 | Ga0207657_10085546 | |||
| 1958 | Ga0207657_10195509 | |||
| 1959 | Ga0207649_10000838 | |||
| 1960 | Ga0207649_11611782 | |||
| 1961 | Ga0207652_10160801 | |||
| 1962 | Ga0207652_10760992 | |||
| 1963 | Ga0207646_10038118 | |||
| 1964 | Ga0207646_10050397 | |||
| 1965 | Ga0207681_10026963 | |||
| 1966 | Ga0207694_10003577 | |||
| 1967 | Ga0207694_10481798 | |||
| 1968 | Ga0207650_10401362 | |||
| 1969 | Ga0207650_10472503 | |||
| 1970 | Ga0207659_10049016 | |||
| 1971 | Ga0207659_10195247 | |||
| 1972 | Ga0207659_10262652 | |||
| 1973 | Ga0207659_10302387 | |||
| 1974 | Ga0207659_10780224 | |||
| 1975 | Ga0207687_10041006 | |||
| 1976 | Ga0207687_10523574 | |||
| 1977 | Ga0207700_10019741 | |||
| 1978 | Ga0207700_10106933 | |||
| 1979 | Ga0207700_10640169 | |||
| 1980 | Ga0207700_11612209 | |||
| 1981 | Ga0207664_10493183 | |||
| 1982 | Ga0207644_10055737 | |||
| 1983 | Ga0207644_10364252 | |||
| 1984 | Ga0207644_10458496 | |||
| 1985 | Ga0207690_10076447 | |||
| 1986 | Ga0207690_11063486 | |||
| 1987 | Ga0207706_10034212 | |||
| 1988 | Ga0207706_10066355 | |||
| 1989 | Ga0207706_11011891 | |||
| 1990 | Ga0207706_11038423 | |||
| 1991 | Ga0207686_10144004 | |||
| 1992 | Ga0207686_10886872 | |||
| 1993 | Ga0207686_11186516 | |||
| 1994 | Ga0207709_11156999 | |||
| 1995 | Ga0207670_10005563 | |||
| 1996 | Ga0207670_10016581 | |||
| 1997 | Ga0207670_10021302 | |||
| 1998 | Ga0207670_10033461 | |||
| 1999 | Ga0207670_10042944 | |||
| 2000 | Ga0207670_10262812 | |||
| 2001 | Ga0207670_10686585 | |||
| 2002 | Ga0207670_10881485 | |||
| 2003 | Ga0207670_10943865 | |||
| 2004 | Ga0207670_11191073 | |||
| 2005 | Ga0207669_10012954 | |||
| 2006 | Ga0207669_10022419 | |||
| 2007 | Ga0207669_10131760 | |||
| 2008 | Ga0207669_10372883 | |||
| 2009 | Ga0207669_10442314 | |||
| 2010 | Ga0207704_10002756 | |||
| 2011 | Ga0207704_10029724 | |||
| 2012 | Ga0207704_10177326 | |||
| 2013 | Ga0207704_10479434 | |||
| 2014 | Ga0207665_10138887 | |||
| 2015 | Ga0207691_10052873 | |||
| 2016 | Ga0207691_10257678 | |||
| 2017 | Ga0207691_10307684 | |||
| 2018 | Ga0207691_10364123 | |||
| 2019 | Ga0207691_10668268 | |||
| 2020 | Ga0207691_10737533 | |||
| 2021 | Ga0207711_10053329 | |||
| 2022 | Ga0207711_10574550 | |||
| 2023 | Ga0207711_11104317 | |||
| 2024 | Ga0207711_11615385 | |||
| 2025 | Ga0207711_11814378 | |||
| 2026 | Ga0207689_10021711 | |||
| 2027 | Ga0207689_10031998 | |||
| 2028 | Ga0207661_10238366 | |||
| 2029 | Ga0207661_10511164 | |||
| 2030 | Ga0207661_10921126 | |||
| 2031 | Ga0207661_10990171 | |||
| 2032 | Ga0207667_10107153 | |||
| 2033 | Ga0207667_10122989 | |||
| 2034 | Ga0207667_10408090 | |||
| 2035 | Ga0207667_10708120 | |||
| 2036 | Ga0207651_10102955 | |||
| 2037 | Ga0207651_10127381 | |||
| 2038 | Ga0207651_10217392 | |||
| 2039 | Ga0207651_10546257 | |||
| 2040 | Ga0207651_10787973 | |||
| 2041 | Ga0207651_11162062 | |||
| 2042 | Ga0207712_10291528 | |||
| 2043 | Ga0207668_10113654 | |||
| 2044 | Ga0207668_10135439 | |||
| 2045 | Ga0207668_10574599 | |||
| 2046 | Ga0207658_10138332 | |||
| 2047 | Ga0207658_10181976 | |||
| 2048 | Ga0207658_11221042 | |||
| 2049 | Ga0207658_11623548 | |||
| 2050 | Ga0207677_10261590 | |||
| 2051 | Ga0207677_10279578 | |||
| 2052 | Ga0207677_10485780 | |||
| 2053 | Ga0207677_10573767 | |||
| 2054 | Ga0207677_10612541 | |||
| 2055 | Ga0207703_10005872 | |||
| 2056 | Ga0207703_10082836 | |||
| 2057 | Ga0207703_10222118 | |||
| 2058 | Ga0207703_10269954 | |||
| 2059 | Ga0207703_10711853 | |||
| 2060 | Ga0207703_11045353 | |||
| 2061 | Ga0207703_12010368 | |||
| 2062 | Ga0207639_10236408 | |||
| 2063 | Ga0207639_10617932 | |||
| 2064 | Ga0207639_10863396 | |||
| 2065 | Ga0207639_11151236 | |||
| 2066 | Ga0207639_11177816 | |||
| 2067 | Ga0207639_11324974 | |||
| 2068 | Ga0207678_10434915 | |||
| 2069 | Ga0207708_10003243 | |||
| 2070 | Ga0207708_10010463 | |||
| 2071 | Ga0207708_11776870 | |||
| 2072 | Ga0207702_10002417 | |||
| 2073 | Ga0207702_10005944 | |||
| 2074 | Ga0207702_10185488 | |||
| 2075 | Ga0207702_10652421 | |||
| 2076 | Ga0207702_11019409 | |||
| 2077 | Ga0207702_12408616 | |||
| 2078 | Ga0207641_10196832 | |||
| 2079 | Ga0207641_10199610 | |||
| 2080 | Ga0207641_10657978 | |||
| 2081 | Ga0207641_11502248 | |||
| 2082 | Ga0207641_11842806 | |||
| 2083 | Ga0207648_10016763 | |||
| 2084 | Ga0207648_10031685 | |||
| 2085 | Ga0207648_10600952 | |||
| 2086 | Ga0207676_10168259 | |||
| 2087 | Ga0207676_10592493 | |||
| 2088 | Ga0207674_10163375 | |||
| 2089 | Ga0207674_10233428 | |||
| 2090 | Ga0207674_10449031 | |||
| 2091 | Ga0207674_11907965 | |||
| 2092 | Ga0207675_100006962 | |||
| 2093 | Ga0207675_100016985 | |||
| 2094 | Ga0207675_100083691 | |||
| 2095 | Ga0207675_101039728 | |||
| 2096 | Ga0207675_101492464 | |||
| 2097 | Ga0207683_10017435 | |||
| 2098 | Ga0207683_10045829 | |||
| 2099 | Ga0207683_10146235 | |||
| 2100 | Ga0207683_10596257 | |||
| 2101 | Ga0207698_10050458 | |||
| 2102 | Ga0207698_11089511 | |||
| 2103 | Ga0207698_12179782 | |||
| 2104 | Ga0209983_1040734 | |||
| 2105 | Ga0209588_1140098 | |||
| 2106 | Ga0209998_10077241 | |||
| 2107 | Ga0209974_10022976 | |||
| 2108 | Ga0209974_10127129 | |||
| 2109 | Ga0207428_10012269 | |||
| 2110 | Ga0207428_10037670 | |||
| 2111 | Ga0207428_10111835 | |||
| 2112 | Ga0268266_10454658 | |||
| 2113 | Ga0268266_10720316 | |||
| 2114 | Ga0268266_11397925 | |||
| 2115 | Ga0268265_10110452 | |||
| 2116 | Ga0268265_10663912 | |||
| 2117 | Ga0268265_11211332 | |||
| 2118 | Ga0268265_11420923 | |||
| 2119 | Ga0268264_10000241 | |||
| 2120 | Ga0268264_10001424 | |||
| 2121 | Ga0268264_10167723 | |||
| 2122 | Ga0268264_10277451 | |||
| 2123 | Ga0268264_11074583 | |||
| 2124 | Ga0265337_1060117 | |||
| 2125 | Ga0265337_1176762 | |||
| 2126 | Ga0265326_10040365 | |||
| 2127 | Ga0265319_1001620 | |||
| 2128 | Ga0265319_1031555 | |||
| 2129 | Ga0265319_1140748 | |||
| 2130 | Ga0265334_10140820 | |||
| 2131 | Ga0265322_10023498 | |||
| 2132 | Ga0265336_10032425 | |||
| 2133 | Ga0265338_10000009 | |||
| 2134 | Ga0265338_10001990 | |||
| 2135 | Ga0265338_10017031 | |||
| 2136 | Ga0265338_10027181 | |||
| 2137 | Ga0265338_10115482 | |||
| 2138 | Ga0265338_10163503 | |||
| 2139 | Ga0265338_10285466 | |||
| 2140 | Ga0265324_10024450 | |||
| 2141 | Ga0265330_10006098 | |||
| 2142 | Ga0265330_10024000 | |||
| 2143 | Ga0265330_10362708 | |||
| 2144 | Ga0265332_10218663 | |||
| 2145 | Ga0265328_10005804 | |||
| 2146 | Ga0265328_10023332 | |||
| 2147 | Ga0265328_10320851 | |||
| 2148 | Ga0265320_10000369 | |||
| 2149 | Ga0265320_10008183 | |||
| 2150 | Ga0265320_10012918 | |||
| 2151 | Ga0265320_10494902 | |||
| 2152 | Ga0265325_10079405 | |||
| 2153 | Ga0265325_10096260 | |||
| 2154 | Ga0265329_10002718 | |||
| 2155 | Ga0265329_10092165 | |||
| 2156 | Ga0265339_10003100 | |||
| 2157 | Ga0265339_10326923 | |||
| 2158 | Ga0265339_10605753 | |||
| 2159 | Ga0265331_10212373 | |||
| 2160 | Ga0265327_10000041 | |||
| 2161 | Ga0265327_10001257 | |||
| 2162 | Ga0265327_10005146 | |||
| 2163 | Ga0265327_10034602 | |||
| 2164 | Ga0265327_10439375 | |||
| 2165 | Ga0265327_10445285 | |||
| 2166 | Ga0265316_10003266 | |||
| 2167 | Ga0265316_10034662 | |||
| 2168 | Ga0265316_10202846 | |||
| 2169 | Ga0265316_10269131 | |||
| 2170 | Ga0265316_10333779 | |||
| 2171 | Ga0265316_10888215 | |||
| 2172 | Ga0307509_10104457 | |||
| 2173 | Ga0265313_10193778 | |||
| 2174 | Ga0265313_10233522 | |||
| 2175 | Ga0265313_10257067 | |||
| 2176 | Ga0265313_10365564 | |||
| 2177 | Ga0316575_10004516 | |||
| 2178 | Ga0316575_10005680 | |||
| 2179 | Ga0316575_10015125 | |||
| 2180 | Ga0316575_10020547 | |||
| 2181 | Ga0316575_10084277 | |||
| 2182 | Ga0316579_10009041 | |||
| 2183 | Ga0316579_10145806 | |||
| 2184 | Ga0316579_10430158 | |||
| 2185 | Ga0316579_10599621 | |||
| 2186 | Ga0265314_10000148 | |||
| 2187 | Ga0265314_10017491 | |||
| 2188 | Ga0265314_10028511 | |||
| 2189 | Ga0265314_10060329 | |||
| 2190 | Ga0265314_10149754 | |||
| 2191 | Ga0265314_10213728 | |||
| 2192 | Ga0265314_10611379 | |||
| 2193 | Ga0265342_10000349 | |||
| 2194 | Ga0265342_10001028 | |||
| 2195 | Ga0265342_10033034 | |||
| 2196 | Ga0265342_10110950 | |||
| 2197 | Ga0316576_10043253 | |||
| 2198 | Ga0316576_10063255 | |||
| 2199 | Ga0316576_10246837 | |||
| 2200 | Ga0316576_10332649 | |||
| 2201 | Ga0316576_11079216 | |||
| 2202 | Ga0316578_10006308 | |||
| 2203 | Ga0316578_10006710 | |||
| 2204 | Ga0316578_10016820 | |||
| 2205 | Ga0316578_10042621 | |||
| 2206 | Ga0316578_10061021 | |||
| 2207 | Ga0316578_10178287 | |||
| 2208 | Ga0316578_10269987 | |||
| 2209 | Ga0316578_10375520 | |||
| 2210 | Ga0316578_10686774 | |||
| 2211 | Ga0316577_10001918 | |||
| 2212 | Ga0316577_10002629 | |||
| 2213 | Ga0316577_10025378 | |||
| 2214 | Ga0316577_10026096 | |||
| 2215 | Ga0307413_11161364 | |||
| 2216 | Ga0307413_11860371 | |||
| 2217 | Ga0307412_10002918 | |||
| 2218 | Ga0307412_10123518 | |||
| 2219 | Ga0307414_10556360 | |||
| 2220 | Ga0307414_10869105 | |||
| 2221 | Ga0316583_10000030 | |||
| 2222 | Ga0316583_10002908 | |||
| 2223 | Ga0316583_10009435 | |||
| 2224 | Ga0316583_10025438 | |||
| 2225 | Ga0316583_10060757 | |||
| 2226 | Ga0316585_10014221 | |||
| 2227 | Ga0316585_10017349 | |||
| 2228 | Ga0316585_10035443 | |||
| 2229 | Ga0316585_10063295 | |||
| 2230 | Ga0316585_10147499 | |||
| 2231 | Ga0316580_10005240 | |||
| 2232 | Ga0316580_10018717 | |||
| 2233 | Ga0316580_10031690 | |||
| 2234 | Ga0316580_10044287 | |||
| 2235 | Ga0316593_10005354 | |||
| 2236 | Ga0316593_10267274 | |||
| 2237 | Ga0316593_10307580 | |||
| 2238 | Ga0316592_1004708 | |||
| 2239 | Ga0316592_1013427 | |||
| 2240 | Ga0316592_1027484 | |||
| 2241 | Ga0316592_1050351 | |||
| 2242 | Ga0316592_1082859 | |||
| 2243 | Ga0316588_1005235 | |||
| 2244 | Ga0316588_1006103 | |||
| 2245 | Ga0316588_1116139 | |||
| 2246 | Ga0316587_1083935 | |||
| 2247 | Ga0316596_1007916 | |||
| 2248 | Ga0316596_1009308 | |||
| 2249 | Ga0316596_1042388 | |||
| 2250 | Ga0316596_1062418 | |||
| 2251 | Ga0316596_1081329 | |||
| 2252 | Ga0316596_1203839 | |||
| 2253 | Ga0373950_0000002 | |||
| 2254 | Ga0373950_0000026 | |||
| 2255 | Ga0373958_0007737 | |||
| 2256 | Ga0373938_0001010 | |||
| 2257 | Ga0373934_0062749 | |||
| 2258 | Ga0373934_0112143 | |||
| 2259 | Ga0373951_0057760 | |||
| 2260 | Ga0373951_0175527 | |||
| 2261 | Ga0373923_0101442 | |||
| 2262 | Ga0373923_0150450 | |||
| 2263 | Ga0373923_0276514 | |||
| 2264 | Ga0373923_0499737 | |||
| 2265 | Ga0373936_0122540 | |||
| 2266 | Ga0373941_0105082 | |||
| 2267 | Ga0373945_0194670 | |||
| 2268 | Ga0373953_0037507 | |||
| 2269 | Ga0373953_0074966 | |||
| 2270 | Ga0373953_0127241 | |||
| 2271 | Ga0373953_0142337 | |||
| 2272 | Ga0373953_0152677 | |||
| 2273 | Ga0373954_0004984 | |||
| 2274 | Ga0373954_0040047 | |||
| 2275 | Ga0373954_0073899 | |||
| 2276 | Ga0373954_0227229 | |||
| 2277 | Ga0373954_0508358 | |||
| 2278 | Ga0373956_0049218 | |||
| 2279 | Ga0373956_0117087 | |||
| 2280 | Ga0373956_0183271 | |||
| 2281 | Ga0373957_0046906 | |||
| 2282 | Ga0373957_0051440 | |||
| 2283 | Ga0373957_0062022 | |||
| 2284 | Ga0373957_0115858 | |||
| 2285 | Ga0373960_0432649 | |||
| 2286 | Ga0373943_0025906 | |||
| 2287 | Ga0373943_0170342 | |||
| 2288 | Ga0373943_0229603 | |||
| 2289 | Ga0373946_0014057 | |||
| 2290 | Ga0373946_0076428 | |||
| 2291 | Ga0373946_0274006 | |||
| 2292 | Ga0373955_0000754 | |||
| 2293 | Ga0373955_0098735 | |||
| 2294 | Ga0373955_0386105 | |||
| 2295 | Ga0373955_0435761 | |||
| 2296 | Ga0373955_0563855 | |||
| 2297 | Ga0373962_0218612 | |||
| 2298 | Ga0316574_0015507 | |||
| 2299 | Ga0316574_0025721 | |||
| 2300 | Ga0316574_0062173 | |||
| 2301 | Ga0316574_0078142 | |||
| 2302 | Ga0316574_0154579 | |||
| 2303 | Ga0316574_0204007 | |||
| 2304 | Ga0316574_0369056 | |||
| 2305 | Ga0316574_0389402 | |||
| 2306 | Ga0316574_0522627 | |||
| 2307 | Ga0373924_0055117 | |||
| 2308 | Ga0373924_0301814 | |||
| 2309 | Ga0373931_0367101 | |||
| 2310 | Ga0373931_0614013 | |||
| 2311 | Ga0373935_0028070 | |||
| 2312 | Ga0373935_0227235 | |||
| 2313 | Ga0373935_0271431 | |||
| 2314 | Ga0373935_1034846 | |||
| 2315 | Ga0373927_0228044 | |||
| 2316 | Ga0373927_0449265 | |||
| 2317 | Ga0373927_0465497 | |||
| 2318 | Ga0373933_0000883 | |||
| 2319 | Ga0373933_0006884 | |||
| 2320 | Ga0373933_0011595 | |||
| 2321 | Ga0373933_0049749 | |||
| 2322 | Ga0373933_0050335 | |||
| 2323 | Ga0373933_0060584 | |||
| 2324 | Ga0373933_0112721 | |||
| 2325 | Ga0373933_0356001 | |||
| 2326 | Ga0373947_0009334 | |||
| 2327 | Ga0373947_0036740 | |||
| 2328 | Ga0373937_0004251 | |||
| 2329 | Ga0373937_0006344 | |||
| 2330 | Ga0373937_0007260 | |||
| 2331 | Ga0373937_0011768 | |||
| 2332 | Ga0373937_0028426 | |||
| 2333 | Ga0373937_0110279 | |||
| 2334 | Ga0373937_0226779 | |||
| 2335 | Ga0373937_0303505 | |||
| 2336 | Ga0373937_0404561 | |||
| 2337 | Ga0373937_0456312 | |||
| 2338 | Ga0373937_0534093 | |||
| 2339 | Ga0373937_0634940 | |||
| 2340 | Ga0373937_0876066 | |||
| 2341 | Ga0373937_1009271 | |||
| 2342 | Ga0373937_1193304 | |||
| 2343 | Ga0316582_0000230 | |||
| 2344 | Ga0316582_0109941 | |||
| 2345 | Ga0316582_0117801 | |||
| 2346 | Ga0316582_0196120 | |||
| 2347 | Ga0316582_0989928 | |||
| 2348 | Ga0316584_0002826 | |||
| 2349 | Ga0316584_0053677 | |||
| 2350 | Ga0316584_0057370 | |||
| 2351 | Ga0316584_0185225 | |||
| 2352 | Ga0316584_0309741 | |||
| 2353 | Ga0316584_0887899 | |||
| 2354 | Ga0316584_1072491 | |||
| 2355 | Ga0373925_0042455 | |||
| 2356 | Ga0373925_0089006 | |||
| 2357 | Ga0373925_0390815 | |||
| 2358 | Ga0373925_0727278 | |||
| 2359 | Ga0395899_0000032 | |||
| 2360 | Ga0395899_0005190 | |||
| 2361 | Ga0395899_0751147 | |||
| 2362 | Ga0395900_0002835 | |||
| 2363 | Ga0395900_0076723 | |||
| 2364 | Ga0395900_0877620 | |||
| 2365 | Ga0395898_0000562 | |||
| 2366 | Ga0395898_0016837 | |||
| 2367 | Ga0395898_0283538 | |||
| 2368 | Ga0395898_0376812 | |||
| 2369 | Ga0316581_0020456 | |||
| 2370 | Ga0316581_0034511 | |||
| 2371 | Ga0316581_0087721 | |||
| 2372 | Ga0316581_0247040 | |||
| 2373 | Ga0436364_0122589 | |||
| 2374 | Ga0436364_0538743 | |||
| 2375 | Ga0436364_0771622 | |||
| 2376 | Ga0436364_1465714 | |||
| 2377 | Ga0436364_1553130 | |||
| 2378 | Ga0395901_0006379 | |||
| 2379 | Ga0395901_0980363 | |||
| 2380 | Ga0242419_003318 | |||
| 2381 | Ga0400483_278692 | |||
| 2382 | Ga0436365_0001915 | |||
| 2383 | Ga0436365_0042250 | |||
| 2384 | Ga0436365_0774506 | |||
| 2385 | Ga0436365_1013589 | |||
| 2386 | Ga0436365_1150834 | |||
| 2387 | Ga0436365_1245734 | |||
| 2388 | Ga0436365_1370865 | |||
| 2389 | Ga0436365_1801148 | |||
| 2390 | Ga0436360_0220038 | |||
| 2391 | Ga0436360_0223987 | |||
| 2392 | Ga0436360_0469231 | |||
| 2393 | Ga0436360_0877820 | |||
| 2394 | Ga0436360_0997829 | |||
| 2395 | Ga0436360_1036060 | |||
| 2396 | Ga0436360_1224017 | |||
| 2397 | Ga0436360_1290733 | |||
| 2398 | Ga0436360_1324996 | |||
| 2399 | Ga0436361_0052711 | |||
| 2400 | Ga0436361_0192763 | |||
| 2401 | Ga0436361_0274613 | |||
| 2402 | Ga0436361_0300980 | |||
| 2403 | Ga0436361_0398359 | |||
| 2404 | Ga0436361_0422889 | |||
| 2405 | Ga0436361_0506622 | |||
| 2406 | Ga0436361_0516043 | |||
| 2407 | Ga0436361_0573040 | |||
| 2408 | Ga0436361_0645805 | |||
| 2409 | Ga0436361_0663171 | |||
| 2410 | Ga0436361_1140903 | |||
| 2411 | Ga0436361_1200325 | |||
| 2412 | Ga0436363_0298872 | |||
| 2413 | Ga0436363_0401838 | |||
| 2414 | Ga0436363_0971820 | |||
| 2415 | Ga0436363_1173897 | |||
| 2416 | Ga0436363_1239685 | |||
| 2417 | Ga0436362_0110575 | |||
| 2418 | Ga0436362_0439444 | |||
| 2419 | Ga0436362_0474002 | |||
| 2420 | Ga0436362_0490626 | |||
| 2421 | Ga0436362_0589333 | |||
| 2422 | Ga0436362_1019744 | |||
| 2423 | Ga0436362_1102436 | |||
| 2424 | Ga0436362_1136023 | |||
| 2425 | Ga0436362_1191246 | |||
| 2426 | Ga0439436_0043232 | |||
| 2427 | Ga0451791_0684006 | |||
| 2428 | Ga0451797_1064022 | |||
| 2429 | Ga0451798_0071854 | |||
| 2430 | Ga0451802_1233454 | |||
| 2431 | Ga0451807_2627768 | |||
| 2432 | Ga0451807_2723892 | |||
| 2433 | Ga0451835_0622584 | |||
| 2434 | Ga0451841_1289628 | |||
| 2435 | Ga0451847_0951203 | |||
| 2436 | Ga0451853_2232771 | |||
| 2437 | Ga0451853_3240533 | |||
| 2438 | Ga0451853_3276329 | |||
| 2439 | Ga0439441_087476 | |||
| 2440 | Ga0439460_0046463 | |||
| 2441 | Ga0451577_0001201 | |||
| 2442 | Ga0451577_0004733 | |||
| 2443 | Ga0451577_0449550 | |||
| 2444 | Ga0451577_0952751 | |||
| 2445 | Ga0466965_0020889 | |||
| 2446 | Ga0466966_0098676 | |||
| 2447 | Ga0466961_0029200 | |||
| 2448 | Ga0466961_0573313 | |||
| 2449 | Ga0466961_0878286 | |||
| 2450 | Ga0466963_0031403 | |||
| 2451 | Ga0466963_0085006 | |||
| 2452 | Ga0466963_0136287 | |||
| 2453 | Ga0466963_0256581 | |||
| 2454 | Ga0466963_0546748 | |||
| 2455 | Ga0466964_0302165 | |||
| 2456 | Ga0453684_0000204 | |||
| 2457 | Ga0453684_0000233 | |||
| 2458 | Ga0453684_0000395 | |||
| 2459 | Ga0453684_0003538 | |||
| 2460 | Ga0453684_0044880 | |||
| 2461 | Ga0453684_0104885 | |||
| 2462 | Ga0453684_0358166 | |||
| 2463 | Ga0453684_0370191 | |||
| 2464 | Ga0453684_0517930 | |||
| 2465 | Ga0466971_0000143 | |||
| 2466 | Ga0466971_0043904 | |||
| 2467 | Ga0466971_0482601 | |||
| 2468 | Ga0466970_0493080 | |||
| 2469 | Ga0466957_0001616 | |||
| 2470 | Ga0466957_0037279 | |||
| 2471 | Ga0466957_0110031 | |||
| 2472 | Ga0466957_0212539 | |||
| 2473 | Ga0466957_0503713 | |||
| 2474 | Ga0466957_0534802 | |||
| 2475 | Ga0466957_0625089 | |||
| 2476 | Ga0466959_0137962 | |||
| 2477 | Ga0451576_0115142 | |||
| 2478 | Ga0451576_0170285 | |||
| 2479 | Ga0451576_0397455 | |||
| 2480 | Ga0451576_0404911 | |||
| 2481 | Ga0451576_2333027 | |||
| 2482 | Ga0451576_2369268 | |||
| 2483 | Ga0466958_0074504 | |||
| 2484 | Ga0466958_0697350 | |||
| 2485 | Ga0466967_0017019 | |||
| 2486 | Ga0466967_0023166 | |||
| 2487 | Ga0466967_0170693 | |||
| 2488 | Ga0466967_0225603 | |||
| 2489 | Ga0466967_0248949 | |||
| 2490 | Ga0466967_0378829 | |||
| 2491 | Ga0466967_0582840 | |||
| 2492 | Ga0466967_1899630 | |||
| 2493 | Ga0495592_0002231 | |||
| 2494 | Ga0495592_0168792 | |||
| 2495 | Ga0495629_0005400 | |||
| 2496 | Ga0495641_0070658 | |||
| 2497 | Ga0495641_0197697 | |||
| 2498 | Ga0495651_0000479 | |||
| 2499 | Ga0495651_0133267 | |||
| 2500 | Ga0495651_0195293 | |||
| 2501 | Ga0495653_0000553 | |||
| 2502 | Ga0495653_0882418 | |||
| 2503 | Ga0495580_0383728 | |||
| 2504 | Ga0495639_0171251 | |||
| 2505 | Ga0495662_0094115 | |||
| 2506 | Ga0495664_0272233 | |||
| 2507 | Ga0495608_0041940 | |||
| 2508 | Ga0495618_0018351 | |||
| 2509 | Ga0495628_0304617 | |||
| 2510 | Ga0495630_0000031 | |||
| 2511 | Ga0495630_0051241 | |||
| 2512 | Ga0495630_0090765 | |||
| 2513 | Ga0495630_0750831 | |||
| 2514 | Ga0495666_0109132 | |||
| 2515 | Ga0495666_0309863 | |||
| 2516 | Ga0495652_0006143 | |||
| 2517 | Ga0495665_0191214 | |||
| 2518 | Ga0495665_0191530 | |||
| 2519 | Ga0495640_0010403 | |||
| 2520 | Ga0495640_0094391 | |||
| 2521 | Ga0495640_0106640 | |||
| 2522 | Ga0495586_0000016 | |||
| 2523 | Ga0495586_0505815 | |||
| 2524 | Ga0495587_0001125 | |||
| 2525 | Ga0495587_0725446 | |||
| 2526 | Ga0495645_0085446 | |||
| 2527 | Ga0495667_0000294 | |||
| 2528 | Ga0495667_0260068 | |||
| 2529 | Ga0495634_0005533 | |||
| 2530 | Ga0495634_0009460 | |||
| 2531 | Ga0495634_0014530 | |||
| 2532 | Ga0495635_0043029 | |||
| 2533 | Ga0495659_0463799 | |||
| 2534 | Ga0495657_0034867 | |||
| 2535 | Ga0495599_0004220 | |||
| 2536 | Ga0495623_0001907 | |||
| 2537 | Ga0495646_0005159 | |||
| 2538 | Ga0495647_0148177 | |||
| 2539 | Ga0495647_0323102 | |||
| 2540 | Ga0495613_0038952 | |||
| 2541 | Ga0495613_0046018 | |||
| 2542 | Ga0495613_0434073 | |||
| 2543 | Ga0495624_0147637 | |||
| 2544 | Ga0495600_0013933 | |||
| 2545 | Ga0495581_0120594 | |||
| 2546 | Ga0495581_0628137 | |||
| 2547 | Ga0495604_0000972 | |||
| 2548 | Ga0495674_0000794 | |||
| 2549 | Ga0495674_0009055 | |||
| 2550 | Ga0495674_0031840 | |||
| 2551 | Ga0495674_1218225 | |||
| 2552 | Ga0495676_0003977 | |||
| 2553 | Ga0495676_0030408 | |||
| 2554 | Ga0495680_0038540 | |||
| 2555 | Ga0495680_0108359 | |||
| 2556 | Ga0495680_0133996 | |||
| 2557 | Ga0495680_0324271 | |||
| 2558 | Ga0495680_0414552 | |||
| 2559 | Ga0495675_0003250 | |||
| 2560 | Ga0495602_0002877 | |||
| 2561 | Ga0496100_0092489 | |||
| 2562 | Ga0496100_0289827 | |||
| 2563 | Ga0496101_0010734 | |||
| 2564 | Ga0496101_0027488 | |||
| 2565 | Ga0496101_0177952 | |||
| 2566 | Ga0496101_1197310 | |||
| 2567 | Ga0496101_1600073 | |||
| 2568 | Ga0496102_0405159 | |||
| 2569 | Ga0496102_0849946 | |||
| 2570 | Ga0496102_1277333 | |||
| 2571 | Ga0496102_1551061 | |||
| 2572 | Ga0496104_0006037 | |||
| 2573 | Ga0496104_0029328 | |||
| 2574 | Ga0496104_0200827 | |||
| 2575 | Ga0496104_0551223 | |||
| 2576 | Ga0496104_0663416 | |||
| 2577 | Ga0496105_0126084 | |||
| 2578 | Ga0496105_0318189 | |||
| 2579 | Ga0496105_0471461 | |||
| 2580 | Ga0496106_0089817 | |||
| 2581 | Ga0496106_0588382 | |||
| 2582 | Ga0496107_0148931 | |||
| 2583 | Ga0496107_0164274 | |||
| 2584 | Ga0496107_0597950 | |||
| 2585 | Ga0496108_0018851 | |||
| 2586 | Ga0496108_0306006 | |||
| 2587 | Ga0496109_0080539 | |||
| 2588 | Ga0496109_1204842 | |||
| 2589 | Ga0496109_1259607 | |||
| 2590 | Ga0496109_1494100 | |||
| 2591 | Ga0496110_1495194 | |||
| 2592 | Ga0496112_0144189 | |||
| 2593 | Ga0496112_0659158 | |||
| 2594 | Ga0496114_0000692 | |||
| 2595 | Ga0496114_0018457 | |||
| 2596 | Ga0496114_0094991 | |||
| 2597 | Ga0496114_0269421 | |||
| 2598 | Ga0496115_0014290 | |||
| 2599 | Ga0496115_0023739 | |||
| 2600 | Ga0496115_0400262 | |||
| 2601 | Ga0496115_0406273 | |||
| 2602 | Ga0496116_0052029 | |||
| 2603 | Ga0496121_0016881 | |||
| 2604 | Ga0496121_0396663 | |||
| 2605 | Ga0496122_0000033 | |||
| 2606 | Ga0496122_0178195 | |||
| 2607 | Ga0496123_0001288 | |||
| 2608 | Ga0496124_0104999 | |||
| 2609 | Ga0496125_0076706 | |||
| 2610 | Ga0496125_0346203 | |||
| 2611 | Ga0496126_0080482 | |||
| 2612 | Ga0496126_1244478 | |||
| 2613 | Ga0501292_129782 | |||
| 2614 | Ga0501031_0000794 | |||
| 2615 | Ga0501031_0009384 | |||
| 2616 | Ga0501031_0030953 | |||
| 2617 | Ga0501031_0043485 | |||
| 2618 | Ga0501031_0091029 | |||
| 2619 | Ga0501032_0000452 | |||
| 2620 | Ga0501032_0015323 | |||
| 2621 | Ga0501032_0036934 | |||
| 2622 | Ga0501032_0186755 | |||
| 2623 | Ga0501032_0387006 | |||
| 2624 | Ga0501032_0405716 | |||
| 2625 | Ga0501032_0419677 | |||
| 2626 | Ga0501032_0898940 | |||
| 2627 | Ga0501033_0000002 | |||
| 2628 | Ga0501033_0000047 | |||
| 2629 | Ga0501033_0012368 | |||
| 2630 | Ga0501033_0031661 | |||
| 2631 | Ga0501034_0000037 | |||
| 2632 | Ga0501034_0022604 | |||
| 2633 | Ga0501034_0045667 | |||
| 2634 | Ga0501034_0180281 | |||
| 2635 | Ga0501034_0190313 | |||
| 2636 | Ga0501034_0190567 | |||
| 2637 | Ga0501034_0232724 | |||
| 2638 | Ga0501034_0241274 | |||
| 2639 | Ga0501034_1121876 | |||
| 2640 | Ga0501034_1130912 | |||
| 2641 | Ga0501036_0004348 | |||
| 2642 | Ga0501036_0012199 | |||
| 2643 | Ga0501036_0023743 | |||
| 2644 | Ga0501036_0038730 | |||
| 2645 | Ga0501036_0243882 | |||
| 2646 | Ga0501036_0624664 | |||
| 2647 | Ga0501036_1372976 | |||
| 2648 | Ga0501037_0000062 | |||
| 2649 | Ga0501037_0002406 | |||
| 2650 | Ga0501037_0016989 | |||
| 2651 | Ga0501037_0040539 | |||
| 2652 | Ga0501037_0130081 | |||
| 2653 | Ga0501037_0337086 | |||
| 2654 | Ga0501038_0002285 | |||
| 2655 | Ga0501038_0017420 | |||
| 2656 | Ga0501038_0032242 | |||
| 2657 | Ga0501038_0057491 | |||
| 2658 | Ga0501038_0268723 | |||
| 2659 | Ga0501039_0008291 | |||
| 2660 | Ga0501039_0070100 | |||
| 2661 | Ga0501039_0082292 | |||
| 2662 | Ga0501039_0328142 | |||
| 2663 | Ga0501039_1089868 | |||
| 2664 | Ga0501040_0000563 | |||
| 2665 | Ga0501040_0182522 | |||
| 2666 | Ga0501041_0010892 | |||
| 2667 | Ga0501042_0004644 | |||
| 2668 | Ga0501042_0311889 | |||
| 2669 | Ga0501043_0009436 | |||
| 2670 | Ga0501043_0032969 | |||
| 2671 | Ga0501043_0043062 | |||
| 2672 | Ga0501043_0082598 | |||
| 2673 | Ga0501043_0178962 | |||
| 2674 | Ga0501043_0266065 | |||
| 2675 | Ga0501043_0463265 | |||
| 2676 | Ga0501046_0001437 | |||
| 2677 | Ga0501046_0002418 | |||
| 2678 | Ga0501046_0168014 | |||
| 2679 | Ga0501046_0285606 | |||
| 2680 | Ga0501046_0359852 | |||
| 2681 | Ga0501046_0630260 | |||
| 2682 | Ga0501047_0000196 | |||
| 2683 | Ga0501047_0006607 | |||
| 2684 | Ga0501047_0086353 | |||
| 2685 | Ga0501047_0134699 | |||
| 2686 | Ga0501047_0141632 | |||
| 2687 | Ga0501047_0149352 | |||
| 2688 | Ga0501047_0180467 | |||
| 2689 | Ga0501047_0229035 | |||
| 2690 | Ga0501047_1020609 | |||
| 2691 | Ga0501048_0003354 | |||
| 2692 | Ga0501048_0035217 | |||
| 2693 | Ga0501048_0049380 | |||
| 2694 | Ga0501048_0125951 | |||
| 2695 | Ga0501067_0000136 | |||
| 2696 | Ga0501067_0002058 | |||
| 2697 | Ga0501067_0031592 | |||
| 2698 | Ga0501067_0035197 | |||
| 2699 | Ga0501067_0044332 | |||
| 2700 | Ga0501067_0054602 | |||
| 2701 | Ga0501067_0069227 | |||
| 2702 | Ga0501068_0001264 | |||
| 2703 | Ga0501068_0002516 | |||
| 2704 | Ga0501068_0021786 | |||
| 2705 | Ga0501068_0066828 | |||
| 2706 | Ga0501068_0132669 | |||
| 2707 | Ga0501068_0242817 | |||
| 2708 | Ga0501068_0574553 | |||
| 2709 | Ga0501068_0722885 | |||
| 2710 | Ga0501068_1139207 | |||
| 2711 | Ga0501069_0019936 | |||
| 2712 | Ga0501069_0025853 | |||
| 2713 | Ga0501069_0052493 | |||
| 2714 | Ga0501069_0111610 | |||
| 2715 | Ga0501069_0369879 | |||
| 2716 | Ga0501070_0000061 | |||
| 2717 | Ga0501070_0000512 | |||
| 2718 | Ga0501070_0000879 | |||
| 2719 | Ga0501070_0002718 | |||
| 2720 | Ga0501070_0021671 | |||
| 2721 | Ga0501070_0040516 | |||
| 2722 | Ga0501070_0084981 | |||
| 2723 | Ga0501070_0114030 | |||
| 2724 | Ga0501070_0127555 | |||
| 2725 | Ga0501070_0150756 | |||
| 2726 | Ga0501070_0195633 | |||
| 2727 | Ga0501070_0205693 | |||
| 2728 | Ga0501070_0690935 | |||
| 2729 | Ga0501071_0220422 | |||
| 2730 | Ga0501071_0414866 | |||
| 2731 | Ga0501071_0778895 | |||
| 2732 | Ga0501071_1264820 | |||
| 2733 | Ga0501072_0000056 | |||
| 2734 | Ga0501072_0211242 | |||
| 2735 | Ga0501072_0581205 | |||
| 2736 | Ga0501072_0634131 | |||
| 2737 | Ga0501072_1031680 | |||
| 2738 | Ga0501073_0004075 | |||
| 2739 | Ga0501073_0004822 | |||
| 2740 | Ga0501073_0007233 | |||
| 2741 | Ga0501073_0008138 | |||
| 2742 | Ga0501073_0011070 | |||
| 2743 | Ga0501073_0011649 | |||
| 2744 | Ga0501073_0019426 | |||
| 2745 | Ga0501073_0027784 | |||
| 2746 | Ga0501073_0038022 | |||
| 2747 | Ga0501073_0060571 | |||
| 2748 | Ga0501073_0300338 | |||
| 2749 | Ga0501073_0485602 | |||
| 2750 | Ga0501073_0608519 | |||
| 2751 | Ga0501073_1070245 | |||
| 2752 | Ga0501074_0001374 | |||
| 2753 | Ga0501074_0020736 | |||
| 2754 | Ga0501074_0025498 | |||
| 2755 | Ga0501074_0028177 | |||
| 2756 | Ga0501074_0337092 | |||
| 2757 | Ga0501074_0637317 | |||
| 2758 | Ga0501075_0002074 | |||
| 2759 | Ga0501075_0009705 | |||
| 2760 | Ga0501075_0156125 | |||
| 2761 | Ga0501076_0019636 | |||
| 2762 | Ga0501076_0094759 | |||
| 2763 | Ga0501076_1153810 | |||
| 2764 | Ga0501077_0005722 | |||
| 2765 | Ga0501257_042582 | |||
| 2766 | Ga0501261_010538 | |||
| 2767 | Ga0501079_0000667 | |||
| 2768 | Ga0501079_0001786 | |||
| 2769 | Ga0501079_0010702 | |||
| 2770 | Ga0501079_0079896 | |||
| 2771 | Ga0501079_0957268 | |||
| 2772 | Ga0501079_1335188 | |||
| 2773 | Ga0501080_0000918 | |||
| 2774 | Ga0501080_0004727 | |||
| 2775 | Ga0501080_0007246 | |||
| 2776 | Ga0501080_0009445 | |||
| 2777 | Ga0501080_0019975 | |||
| 2778 | Ga0501080_0028886 | |||
| 2779 | Ga0501080_0043113 | |||
| 2780 | Ga0501080_0160234 | |||
| 2781 | Ga0501080_0361791 | |||
| 2782 | Ga0501080_1571893 | |||
| 2783 | Ga0501080_1623738 | |||
| 2784 | Ga0501081_0002255 | |||
| 2785 | Ga0501081_0124541 | |||
| 2786 | Ga0501081_0167350 | |||
| 2787 | Ga0501083_0004962 | |||
| 2788 | Ga0501083_0012182 | |||
| 2789 | Ga0501083_0018307 | |||
| 2790 | Ga0501083_0035312 | |||
| 2791 | Ga0501083_0181286 | |||
| 2792 | Ga0501083_0198180 | |||
| 2793 | Ga0501083_0251858 | |||
| 2794 | Ga0501083_0280144 | |||
| 2795 | Ga0501083_0600726 | |||
| 2796 | Ga0501273_061016 | |||
| 2797 | Ga0501035_0000004 | |||
| 2798 | Ga0501035_0014804 | |||
| 2799 | Ga0501035_0015102 | |||
| 2800 | Ga0501035_0016208 | |||
| 2801 | Ga0501035_0053797 | |||
| 2802 | Ga0501035_0221044 | |||
| 2803 | Ga0501035_0302317 | |||
| 2804 | Ga0501044_0001842 | |||
| 2805 | Ga0501044_0003422 | |||
| 2806 | Ga0501044_0018367 | |||
| 2807 | Ga0501044_0041848 | |||
| 2808 | Ga0501044_0297746 | |||
| 2809 | Ga0501044_0418236 | |||
| 2810 | Ga0501044_0660314 | |||
| 2811 | Ga0501044_1302007 | |||
| 2812 | Ga0501044_1453271 | |||
| 2813 | Ga0501044_1665581 | |||
| 2814 | Ga0501045_0004093 | |||
| 2815 | Ga0501045_0352186 | |||
| 2816 | Ga0501045_1009827 | |||
| 2817 | nmdc:mga03683_314502_c1 | |||
| 2818 | nmdc:mga03683_419792_c1 | |||
| 2819 | nmdc:mga03683_88_c3 | |||
| 2820 | nmdc:mga03n38_146491_c1 | |||
| 2821 | nmdc:mga03n38_2587_c1 | |||
| 2822 | nmdc:mga00v17_386360_c1 | |||
| 2823 | nmdc:mga0k408_170717_c1 | |||
| 2824 | nmdc:mga0k408_1872_c1 | |||
| 2825 | nmdc:mga0k408_528900_c1 | |||
| 2826 | nmdc:mga0k408_7601_c1 | |||
| 2827 | nmdc:mga07m45_3477_c2 | |||
| 2828 | nmdc:mga05p37_1253825_c1 | |||
| 2829 | nmdc:mga05p37_944370_c1 | |||
| 2830 | nmdc:mga09592_1218876_c1 | |||
| 2831 | nmdc:mga09592_42047_c1 | |||
| 2832 | nmdc:mga09592_495402_c1 | |||
| 2833 | nmdc:mga0qj67_13329_c1 | |||
| 2834 | nmdc:mga06r32_80572_c1 | |||
| 2835 | nmdc:mga08y16_1038150_c1 | |||
| 2836 | nmdc:mga08y16_1165_c1 | |||
| 2837 | nmdc:mga08y16_128186_c1 | |||
| 2838 | nmdc:mga08y16_1438360_c1 | |||
| 2839 | nmdc:mga08y16_4368_c1 | |||
| 2840 | nmdc:mga08y16_639304_c1 | |||
| 2841 | nmdc:mga0n895_275031_c1 | |||
| 2842 | nmdc:mga0n895_750370_c1 | |||
| 2843 | nmdc:mga08x19_250758_c1 | |||
| 2844 | nmdc:mga08x19_38494_c1 | |||
| 2845 | nmdc:mga08x19_569890_c1 | |||
| 2846 | nmdc:mga0a205_625493_c1 | |||
| 2847 | nmdc:mga0a205_853177_c1 | |||
| 2848 | Ga0495601_0001493 | |||
| 2849 | Ga0495601_0086291 | |||
| 2850 | Ga0495601_0204424 | |||
| 2851 | Ga0495601_0411743 | |||
| 2852 | Ga0495601_0434103 | |||
| 2853 | Ga0495612_0069407 | |||
| 2854 | Ga0500610_0032474 | |||
| 2855 | Ga0495595_0004500 | |||
| 2856 | Ga0495595_0576303 | |||
| 2857 | Ga0495619_0000426 | |||
| 2858 | Ga0495619_0242014 | |||
| 2859 | Ga0495619_0551485 | |||
| 2860 | Ga0495619_1077370 | |||
| 2861 | Ga0500650_0068730 | |||
| 2862 | Ga0500555_000343 | |||
| 2863 | Ga0500556_0000010 | |||
| 2864 | Ga0500556_0180298 | |||
| 2865 | Ga0500593_000072 | |||
| 2866 | Ga0500642_0029459 | |||
| 2867 | Ga0500642_0060231 | |||
| 2868 | Ga0500655_019853 | |||
| 2869 | Ga0500655_032811 | |||
| 2870 | Ga0500616_0002331 | |||
| 2871 | Ga0500616_0023759 | |||
| 2872 | Ga0500645_065720 | |||
| 2873 | Ga0501084_0000544 | |||
| 2874 | Ga0501084_0006037 | |||
| 2875 | Ga0501084_0029390 | |||
| 2876 | Ga0501084_0374514 | |||
| 2877 | Ga0501084_0485450 | |||
| 2878 | Ga0587080_003782 | |||
| 2879 | Ga0587080_033958 | |||
| 2880 | Ga0587083_0045829 | |||
| 2881 | Ga0587067_053055 | |||
| 2882 | Ga0587076_117983 | |||
| 2883 | Ga0587079_050777 | |||
| 2884 | Ga0587071_005154 | |||
| 2885 | Ga0587111_0063772 | |||
| 2886 | Ga0501082_0005564 | |||
| 2887 | Ga0501082_0011143 | |||
| 2888 | Ga0501082_0017087 | |||
| 2889 | Ga0501082_0037852 | |||
| 2890 | Ga0501082_0039727 | |||
| 2891 | Ga0501082_0041755 | |||
| 2892 | Ga0501082_0124040 | |||
| 2893 | Ga0501082_0136997 | |||
| 2894 | Ga0501082_0801022 | |||
| 2895 | Ga0501082_0972126 | |||
| 2896 | Ga0466962_0017640 | |||
| 2897 | Ga0466962_0036578 | |||
| 2898 | Ga0466962_0109327 | |||
| 2899 | Ga0530510_0027093 | |||
| 2900 | Ga0530510_0066938 | |||
| 2901 | Ga0530510_0395563 | |||
| 2902 | 2787508105 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5l9n-assembly1.cif.gz_A | structure of uridylylated glnb from escherichia coli bound to atp | 0.9957 | 1 | 108 |
| 6yc7-assembly1.cif.gz_F | structure of adenylylated c. glutamicum glnk | 0.9921 | 1 | 112 |
| 4co4-assembly1.cif.gz_A | structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate | 0.9902 | 1 | 108 |
| 2eg1-assembly1.cif.gz_A | the crystal structure of pii protein | 0.9895 | 1 | 112 |
| 7p4y-assembly4.cif.gz_K | glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a | 0.9883 | 2 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9782 | 1 | 111 | 3.30.70.120 |
| 2o66C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9697 | 2 | 111 | 3.30.70.120 |
| 4c3kE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9683 | 1 | 111 | 3.30.70.120 |
| 4usiC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9412 | 2 | 108 | 3.30.70.120 |
| 4oznB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9368 | 2 | 112 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U1T6E6-F1-model_v4 | P-II family nitrogen regulator | 0.9565 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A357BKJ3-F1-model_v4 | P-II family nitrogen regulator | 0.9443 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A1F7F2C5-F1-model_v4 | Transcriptional regulator | 0.9386 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A357BKJ3-F1-model_v4 | P-II family nitrogen regulator | 0.935 | 1 | 112 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |
| AF-A0A517TUK5-F1-model_v4 | Nitrogen regulatory protein P-II | 0.9303 | 1 | 107 |
GO:0005524
GO:0005829 GO:0006808 GO:0030234 |