F494065

General Info

Members Datasets Scaffolds Average Seq Length
1452 466 2902 113

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10009508|rootH2_1000950854
Length 115
Sequence MKKIEAIIKPFKLEEVKDALADLGIEGMTVSEVKGFGRQKGHTEIYRGSEYTVDFLPKIKIEVVLSDSLLESATAAIVKAAKTGXXXKIGDGKVFVSPVEEAIRIRTDETGEKAV

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300001456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
97 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
98 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
146 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
147 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
148 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
149 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
150 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
151 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
228 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
229 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
230 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
231 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
232 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
233 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
234 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
235 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
236 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
237 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
238 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
239 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
240 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
241 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
242 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
243 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
244 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
245 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
246 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
247 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
248 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
252 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
253 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
254 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
257 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
258 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
259 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
260 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
266 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
267 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
268 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
269 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
273 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
276 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
277 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
278 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
279 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
280 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
281 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
282 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
283 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
284 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
286 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
287 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
288 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
289 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
290 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
291 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
292 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
293 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
294 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
295 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
296 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
297 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
298 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
301 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
302 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
303 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
304 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
305 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
306 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
307 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
308 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
309 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
310 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
311 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
312 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
313 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
314 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
315 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
316 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
317 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
318 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
319 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
320 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
321 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
322 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
323 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
324 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
325 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
326 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
327 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
328 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
329 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
330 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
336 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
337 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
338 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
339 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
340 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
341 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
342 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
343 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
344 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
345 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
346 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
347 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
351 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
352 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
353 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
354 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
358 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
359 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
360 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
361 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
381 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
386 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
387 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
388 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
389 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
390 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
391 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
392 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
393 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
409 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
410 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
411 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
412 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
413 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
414 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
415 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
416 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
417 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
418 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
419 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
420 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
424 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
425 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
426 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
429 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
430 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
431 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
432 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
433 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
434 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
435 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
436 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
437 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
438 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
439 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
440 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
441 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
442 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
443 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
444 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
445 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
446 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
447 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
448 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
449 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
450 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
451 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
452 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
453 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
454 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
464 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
466 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 3.44
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 3.24
Rhizosphere 89.94
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10009508 3300003320 Bacteria 78035
2 JGI24033J14998_100040 3300001456 Bacteria 1518
3 JGI24743J22301_10000046 3300001991 Bacteria 11116
4 JGI24033J26618_1000022 3300002155 Bacteria 24100
5 Ga0006767J43181_102738 3300002868 Bacteria 2693
6 Ga0006763J43179_103811 3300002870 Bacteria 1275
7 Ga0006765J45826_107625 3300003161 Bacteria 840
8 Ga0006778J45830_1033904 3300003162 Bacteria 881
9 Ga0006758J48902_1014192 3300003300 Bacteria 2002
10 rootH2_10000766 3300003320 Bacteria 10458
11 rootH2_10087759 3300003320 Bacteria 9348
12 rootH1_10236075 3300003323 Bacteria 1311
13 Ga0032354_1004574 3300003693 Bacteria 3070
14 Ga0055540_1081610 3300003792 Bacteria 619
15 Ga0058859_10017652 3300004798 Bacteria 742
16 Ga0058863_10089126 3300004799 Bacteria 1875
17 Ga0058863_11301227 3300004799 Bacteria 550
18 Ga0058863_11859074 3300004799 Bacteria 590
19 Ga0058861_10043227 3300004800 Bacteria 838
20 Ga0058860_11878483 3300004801 Bacteria 556
21 Ga0058860_12243724 3300004801 Bacteria 699
22 Ga0058862_10016066 3300004803 Bacteria 924
23 Ga0058862_12245081 3300004803 Bacteria 610
24 Ga0058862_12869646 3300004803 Bacteria 872
25 Ga0065704_10200999 3300005289 Bacteria 1146
26 Ga0065704_10735280 3300005289 Bacteria 548
27 Ga0065712_10404380 3300005290 Bacteria 728
28 Ga0065712_10758685 3300005290 Bacteria 526
29 Ga0065715_10435202 3300005293 Bacteria 842
30 Ga0065707_10638827 3300005295 Bacteria 669
31 Ga0070658_10548068 3300005327 Bacteria 1001
32 Ga0070676_10008133 3300005328 Bacteria 5642
33 Ga0070676_10164732 3300005328 Bacteria 1429
34 Ga0070676_10818777 3300005328 Bacteria 688
35 Ga0070683_101093001 3300005329 Bacteria 766
36 Ga0070683_101144020 3300005329 Bacteria 748
37 Ga0070690_100013678 3300005330 Bacteria 4802
38 Ga0070690_100030194 3300005330 Bacteria 3366
39 Ga0070690_100231082 3300005330 Bacteria 1300
40 Ga0070690_100842158 3300005330 Bacteria 714
41 Ga0070690_101084178 3300005330 Bacteria 634
42 Ga0070670_100083169 3300005331 Bacteria 2751
43 Ga0070670_100100107 3300005331 Bacteria 2495
44 Ga0068869_100425265 3300005334 Bacteria 1097
45 Ga0070666_10027445 3300005335 Bacteria 3729
46 Ga0070666_10031114 3300005335 Bacteria 3522
47 Ga0070666_10273089 3300005335 Bacteria 1200
48 Ga0070680_100442456 3300005336 Bacteria 1110
49 Ga0070680_100737881 3300005336 Bacteria 848
50 Ga0070680_101198018 3300005336 Bacteria 657
51 Ga0070682_100903533 3300005337 Bacteria 726
52 Ga0068868_100537999 3300005338 Bacteria 1028
53 Ga0068868_101613712 3300005338 Bacteria 610
54 Ga0070689_100043362 3300005340 Bacteria 3457
55 Ga0070689_100062309 3300005340 Bacteria 2902
56 Ga0070691_10020450 3300005341 Bacteria 3058
57 Ga0070691_10178271 3300005341 Bacteria 1105
58 Ga0070687_100040520 3300005343 Bacteria 2347
59 Ga0070687_100040693 3300005343 Bacteria 2343
60 Ga0070687_100123528 3300005343 Bacteria 1484
61 Ga0070687_100145104 3300005343 Bacteria 1387
62 Ga0070687_100185739 3300005343 Bacteria 1249
63 Ga0070661_100007296 3300005344 Bacteria 7625
64 Ga0070692_10025468 3300005345 Bacteria 2915
65 Ga0070692_10418555 3300005345 Bacteria 850
66 Ga0070668_100012673 3300005347 Bacteria 6276
67 Ga0070668_100596076 3300005347 Bacteria 966
68 Ga0070669_100031851 3300005353 Bacteria 3808
69 Ga0070675_100024404 3300005354 Bacteria 4843
70 Ga0070675_100100099 3300005354 Bacteria 2441
71 Ga0070675_101813484 3300005354 Bacteria 563
72 Ga0070675_102101375 3300005354 Bacteria 521
73 Ga0070671_100050450 3300005355 Bacteria 3461
74 Ga0070671_100086977 3300005355 Bacteria 2616
75 Ga0070674_100164066 3300005356 Bacteria 1688
76 Ga0070674_100238508 3300005356 Bacteria 1422
77 Ga0070674_100586647 3300005356 Bacteria 940
78 Ga0070674_100722096 3300005356 Bacteria 854
79 Ga0070674_100782098 3300005356 Bacteria 823
80 Ga0070673_100006487 3300005364 Bacteria 7608
81 Ga0070673_100191763 3300005364 Bacteria 1756
82 Ga0070673_100247337 3300005364 Bacteria 1553
83 Ga0070673_100249130 3300005364 Bacteria 1548
84 Ga0070673_100345424 3300005364 Bacteria 1319
85 Ga0070673_100408817 3300005364 Bacteria 1215
86 Ga0070688_100107250 3300005365 Bacteria 1851
87 Ga0070688_100435253 3300005365 Bacteria 977
88 Ga0070688_100529926 3300005365 Bacteria 893
89 Ga0070688_100673592 3300005365 Bacteria 799
90 Ga0070659_100044632 3300005366 Bacteria 3471
91 Ga0070659_100173439 3300005366 Bacteria 1768
92 Ga0070659_100263635 3300005366 Bacteria 1430
93 Ga0070659_100633316 3300005366 Bacteria 921
94 Ga0070659_101077065 3300005366 Bacteria 708
95 Ga0070667_100169238 3300005367 Bacteria 1928
96 Ga0070667_100266709 3300005367 Bacteria 1534
97 Ga0070667_100414487 3300005367 Bacteria 1227
98 Ga0070667_100627854 3300005367 Bacteria 991
99 Ga0070667_101018261 3300005367 Bacteria 773
100 Ga0070667_101055686 3300005367 Bacteria 759
101 Ga0070709_10076963 3300005434 Bacteria 2168
102 Ga0070714_100154716 3300005435 Bacteria 2069
103 Ga0070713_100058956 3300005436 Bacteria 3203
104 Ga0070713_100405479 3300005436 Bacteria 1274
105 Ga0070713_100546412 3300005436 Bacteria 1096
106 Ga0070713_101104026 3300005436 Bacteria 767
107 Ga0070710_10034913 3300005437 Bacteria 2738
108 Ga0070710_10119604 3300005437 Bacteria 1592
109 Ga0070710_11176075 3300005437 Bacteria 566
110 Ga0070710_11306267 3300005437 Bacteria 539
111 Ga0070701_10026586 3300005438 Bacteria 2823
112 Ga0070701_10085744 3300005438 Bacteria 1715
113 Ga0070701_10142610 3300005438 Bacteria 1372
114 Ga0070711_100106782 3300005439 Bacteria 2048
115 Ga0070711_100150550 3300005439 Bacteria 1754
116 Ga0070711_100489861 3300005439 Bacteria 1012
117 Ga0070711_100549541 3300005439 Bacteria 958
118 Ga0070711_100719610 3300005439 Bacteria 842
119 Ga0070705_100107580 3300005440 Bacteria 1775
120 Ga0070705_100127856 3300005440 Bacteria 1652
121 Ga0070700_100015700 3300005441 Bacteria 4300
122 Ga0070694_100281997 3300005444 Bacteria 1267
123 Ga0070708_100098299 3300005445 Bacteria 2676
124 Ga0070708_100111862 3300005445 Bacteria 2511
125 Ga0070708_100122017 3300005445 Bacteria 2405
126 Ga0070708_100870280 3300005445 Bacteria 846
127 Ga0070663_100429790 3300005455 Bacteria 1085
128 Ga0070663_101035743 3300005455 Bacteria 715
129 Ga0070678_100343124 3300005456 Bacteria 1282
130 Ga0070678_100419539 3300005456 Bacteria 1166
131 Ga0070678_100880205 3300005456 Bacteria 818
132 Ga0070678_101038601 3300005456 Bacteria 755
133 Ga0070678_101823022 3300005456 Bacteria 574
134 Ga0070662_100300526 3300005457 Bacteria 1304
135 Ga0070662_100308505 3300005457 Bacteria 1287
136 Ga0070662_100681474 3300005457 Bacteria 869
137 Ga0070681_10062942 3300005458 Bacteria 3682
138 Ga0070681_10277019 3300005458 Bacteria 1589
139 Ga0070681_11566054 3300005458 Bacteria 584
140 Ga0068867_100023122 3300005459 Bacteria 4449
141 Ga0068867_100127791 3300005459 Bacteria 1971
142 Ga0068867_100763851 3300005459 Bacteria 859
143 Ga0070685_10067144 3300005466 Bacteria 2115
144 Ga0070685_10189451 3300005466 Bacteria 1329
145 Ga0070685_10255044 3300005466 Bacteria 1163
146 Ga0070685_10319772 3300005466 Bacteria 1051
147 Ga0070685_10555633 3300005466 Bacteria 820
148 Ga0070685_11195342 3300005466 Bacteria 578
149 Ga0070706_100001357 3300005467 Bacteria 26038
150 Ga0070706_100209453 3300005467 Bacteria 1820
151 Ga0070706_100222379 3300005467 Bacteria 1762
152 Ga0070706_100681534 3300005467 Bacteria 954
153 Ga0070706_101168525 3300005467 Bacteria 707
154 Ga0070707_100058669 3300005468 Bacteria 3691
155 Ga0070707_100164467 3300005468 Bacteria 2162
156 Ga0070698_100000876 3300005471 Bacteria 33074
157 Ga0070698_100005165 3300005471 Bacteria 14274
158 Ga0070698_100040114 3300005471 Bacteria 4814
159 Ga0070698_100047454 3300005471 Bacteria 4390
160 Ga0070698_100050679 3300005471 Bacteria 4231
161 Ga0070699_100044930 3300005518 Bacteria 3824
162 Ga0070699_100354791 3300005518 Bacteria 1321
163 Ga0070699_100825658 3300005518 Bacteria 848
164 Ga0070699_101276977 3300005518 Unclassified 673
165 Ga0070679_100073713 3300005530 Bacteria 3404
166 Ga0070684_100570786 3300005535 Bacteria 1051
167 Ga0070684_100933251 3300005535 Bacteria 813
168 Ga0070684_100966346 3300005535 Bacteria 799
169 Ga0070684_101863506 3300005535 Bacteria 567
170 Ga0070697_100069934 3300005536 Bacteria 2876
171 Ga0070697_100130084 3300005536 Bacteria 2111
172 Ga0070697_100278191 3300005536 Bacteria 1435
173 Ga0070697_100563599 3300005536 Bacteria 999
174 Ga0070697_100610921 3300005536 Bacteria 959
175 Ga0070697_100756096 3300005536 Bacteria 859
176 Ga0068853_100192614 3300005539 Bacteria 1853
177 Ga0068853_100204469 3300005539 Bacteria 1798
178 Ga0068853_100751632 3300005539 Bacteria 932
179 Ga0068853_100975898 3300005539 Bacteria 815
180 Ga0068853_101377014 3300005539 Bacteria 682
181 Ga0070672_100016466 3300005543 Bacteria 5293
182 Ga0070672_100334037 3300005543 Bacteria 1290
183 Ga0070672_100450402 3300005543 Bacteria 1109
184 Ga0070672_100815382 3300005543 Bacteria 822
185 Ga0070686_100010762 3300005544 Bacteria 5172
186 Ga0070686_100053860 3300005544 Bacteria 2571
187 Ga0070686_100058785 3300005544 Unclassified 2475
188 Ga0070686_100106937 3300005544 Bacteria 1899
189 Ga0070686_100376312 3300005544 Bacteria 1074
190 Ga0070686_100855265 3300005544 Bacteria 737
191 Ga0070696_101046924 3300005546 Bacteria 684
192 Ga0070693_100506555 3300005547 Bacteria 857
193 Ga0070693_100510972 3300005547 Bacteria 854
194 Ga0070665_100736200 3300005548 Bacteria 999
195 Ga0070665_100779741 3300005548 Bacteria 969
196 Ga0068855_100002380 3300005563 Bacteria 23184
197 Ga0068855_100025181 3300005563 Bacteria 7124
198 Ga0068855_100058765 3300005563 Bacteria 4501
199 Ga0068855_100517297 3300005563 Bacteria 1295
200 Ga0070664_101662120 3300005564 Bacteria 605
201 Ga0068857_100230538 3300005577 Bacteria 1694
202 Ga0068857_100279929 3300005577 Bacteria 1534
203 Ga0068857_101150734 3300005577 Bacteria 750
204 Ga0068857_101547501 3300005577 Bacteria 647
205 Ga0068854_100650572 3300005578 Bacteria 905
206 Ga0068856_100000034 3300005614 Bacteria 124288
207 Ga0068856_100008797 3300005614 Bacteria 9825
208 Ga0068856_100140681 3300005614 Bacteria 2420
209 Ga0068856_100149613 3300005614 Bacteria 2343
210 Ga0068856_100218977 3300005614 Bacteria 1919
211 Ga0068856_100337427 3300005614 Bacteria 1525
212 Ga0070702_100133662 3300005615 Bacteria 1571
213 Ga0070702_100223846 3300005615 Bacteria 1260
214 Ga0070702_100350529 3300005615 Bacteria 1040
215 Ga0070702_100462953 3300005615 Bacteria 922
216 Ga0070702_100548616 3300005615 Bacteria 858
217 Ga0070702_100692048 3300005615 Bacteria 776
218 Ga0070702_101066393 3300005615 Bacteria 644
219 Ga0068852_100096637 3300005616 Bacteria 2656
220 Ga0068852_102121910 3300005616 Bacteria 584
221 Ga0068859_100001788 3300005617 Bacteria 21889
222 Ga0068859_100096940 3300005617 Bacteria 3001
223 Ga0068859_100537309 3300005617 Bacteria 1264
224 Ga0068859_100617739 3300005617 Bacteria 1177
225 Ga0068864_100208362 3300005618 Bacteria 1799
226 Ga0068866_10008221 3300005718 Bacteria 4387
227 Ga0068866_10215792 3300005718 Bacteria 1154
228 Ga0068861_100017078 3300005719 Bacteria 5147
229 Ga0068861_100257834 3300005719 Bacteria 1491
230 Ga0068861_101713826 3300005719 Bacteria 622
231 Ga0068863_100191523 3300005841 Bacteria 1965
232 Ga0068863_100520471 3300005841 Bacteria 1173
233 Ga0068863_100988477 3300005841 Bacteria 844
234 Ga0068858_100043912 3300005842 Bacteria 4144
235 Ga0068858_100233399 3300005842 Bacteria 1744
236 Ga0068858_100367273 3300005842 Bacteria 1380
237 Ga0068858_101325732 3300005842 Bacteria 708
238 Ga0068860_100348643 3300005843 Bacteria 1457
239 Ga0068860_100857988 3300005843 Bacteria 923
240 Ga0068862_100214943 3300005844 Bacteria 1738
241 Ga0068862_100669840 3300005844 Bacteria 1002
242 Ga0068862_101245344 3300005844 Bacteria 744
243 Ga0081455_10069915 3300005937 Bacteria 2917
244 Ga0081455_10109655 3300005937 Bacteria 2196
245 Ga0081455_10121526 3300005937 Bacteria 2057
246 Ga0081455_10197461 3300005937 Bacteria 1509
247 Ga0081455_10924447 3300005937 Bacteria 542
248 Ga0081540_1040002 3300005983 Bacteria 2449
249 Ga0081540_1091687 3300005983 Bacteria 1335
250 Ga0081540_1155738 3300005983 Bacteria 894
251 Ga0070717_10147478 3300006028 Bacteria 2033
252 Ga0070717_11817011 3300006028 Bacteria 551
253 Ga0075363_100031796 3300006048 Bacteria 2738
254 Ga0075363_100274519 3300006048 Bacteria 974
255 Ga0075364_10387748 3300006051 Bacteria 953
256 Ga0070715_10217187 3300006163 Bacteria 981
257 Ga0070716_100037586 3300006173 Bacteria 2677
258 Ga0070712_100811185 3300006175 Bacteria 803
259 Ga0075362_10016318 3300006177 Bacteria 3039
260 Ga0075362_10030032 3300006177 Bacteria 2346
261 Ga0075362_10573166 3300006177 Bacteria 582
262 Ga0075369_10461562 3300006186 Bacteria 602
263 Ga0075366_10027432 3300006195 Bacteria 3341
264 Ga0075366_10033077 3300006195 Bacteria 3046
265 Ga0075366_10459969 3300006195 Bacteria 785
266 Ga0075366_10611606 3300006195 Bacteria 676
267 Ga0097621_100117829 3300006237 Bacteria 2250
268 Ga0097621_100194261 3300006237 Bacteria 1759
269 Ga0097621_100479555 3300006237 Bacteria 1124
270 Ga0097621_100683581 3300006237 Bacteria 944
271 Ga0097621_100698579 3300006237 Bacteria 934
272 Ga0075370_10014773 3300006353 Bacteria 4168
273 Ga0068871_100313458 3300006358 Bacteria 1379
274 Ga0068871_100514088 3300006358 Bacteria 1081
275 Ga0068871_100706500 3300006358 Bacteria 924
276 Ga0068871_100801531 3300006358 Bacteria 868
277 Ga0068871_101147191 3300006358 Bacteria 728
278 Ga0068871_101518087 3300006358 Bacteria 633
279 Ga0075428_100180570 3300006844 Bacteria 2284
280 Ga0075428_101442071 3300006844 Bacteria 722
281 Ga0075430_100006122 3300006846 Bacteria 10136
282 Ga0075430_101413212 3300006846 Bacteria 572
283 Ga0075431_100001910 3300006847 Bacteria 19792
284 Ga0075431_101035980 3300006847 Bacteria 787
285 Ga0075434_100377933 3300006871 Bacteria 1437
286 Ga0075434_101125048 3300006871 Bacteria 798
287 Ga0075434_101820037 3300006871 Bacteria 615
288 Ga0075429_100093338 3300006880 Bacteria 2625
289 Ga0075429_100737722 3300006880 Bacteria 863
290 Ga0075429_101636026 3300006880 Bacteria 560
291 Ga0075429_101748042 3300006880 Bacteria 540
292 Ga0068865_100003577 3300006881 Bacteria 9336
293 Ga0068865_100190591 3300006881 Bacteria 1585
294 Ga0068865_100567651 3300006881 Bacteria 955
295 Ga0068865_100677466 3300006881 Bacteria 879
296 Ga0097620_100001788 3300006931 Bacteria 21889
297 Ga0097620_100096939 3300006931 Bacteria 3001
298 Ga0097620_100537285 3300006931 Bacteria 1264
299 Ga0097620_100617772 3300006931 Bacteria 1177
300 Ga0097620_101233198 3300006931 Bacteria 824
301 Ga0075435_100863079 3300007076 Bacteria 789
302 Ga0099794_10259303 3300007265 Bacteria 897
303 Ga0105240_10072975 3300009093 Bacteria 4239
304 Ga0105240_10094834 3300009093 Bacteria 3639
305 Ga0105240_10144397 3300009093 Bacteria 2841
306 Ga0105240_10616903 3300009093 Bacteria 1192
307 Ga0105240_10758954 3300009093 Bacteria 1054
308 Ga0105240_11307838 3300009093 Bacteria 764
309 Ga0111539_10004360 3300009094 Bacteria 18533
310 Ga0111539_10071139 3300009094 Bacteria 4105
311 Ga0111539_10151426 3300009094 Bacteria 2715
312 Ga0111539_10737832 3300009094 Bacteria 1146
313 Ga0105245_10072219 3300009098 Bacteria 3134
314 Ga0105245_10365918 3300009098 Bacteria 1432
315 Ga0105245_11118502 3300009098 Bacteria 834
316 Ga0105245_11573338 3300009098 Bacteria 709
317 Ga0105245_12435506 3300009098 Bacteria 577
318 Ga0105247_10000590 3300009101 Bacteria 29497
319 Ga0114129_10266953 3300009147 Bacteria 2291
320 Ga0114129_10606398 3300009147 Bacteria 1418
321 Ga0105243_10055115 3300009148 Bacteria 3158
322 Ga0105243_10731056 3300009148 Bacteria 968
323 Ga0105241_10255970 3300009174 Bacteria 1486
324 Ga0105241_10823495 3300009174 Bacteria 857
325 Ga0105242_10248790 3300009176 Bacteria 1601
326 Ga0105242_11300956 3300009176 Bacteria 751
327 Ga0105242_11358261 3300009176 Bacteria 736
328 Ga0105242_12015693 3300009176 Bacteria 620
329 Ga0105242_12042347 3300009176 Bacteria 616
330 Ga0105248_10126121 3300009177 Bacteria 2888
331 Ga0105248_10279060 3300009177 Bacteria 1881
332 Ga0105248_11359649 3300009177 Bacteria 803
333 Ga0105248_11631718 3300009177 Bacteria 731
334 Ga0105248_12647586 3300009177 Bacteria 572
335 Ga0105237_10274327 3300009545 Bacteria 1689
336 Ga0105237_10505112 3300009545 Bacteria 1216
337 Ga0105237_12464750 3300009545 Bacteria 530
338 Ga0105238_10034529 3300009551 Bacteria 5144
339 Ga0105238_11030754 3300009551 Bacteria 844
340 Ga0105249_10368153 3300009553 Bacteria 1460
341 Ga0105249_10394076 3300009553 Bacteria 1413
342 Ga0105249_10628614 3300009553 Bacteria 1130
343 Ga0105249_11148941 3300009553 Bacteria 847
344 Ga0105239_10028406 3300010375 Bacteria 6153
345 Ga0105239_10154764 3300010375 Bacteria 2560
346 Ga0105239_10436599 3300010375 Bacteria 1484
347 Ga0105239_10522178 3300010375 Bacteria 1351
348 Ga0105239_10605720 3300010375 Bacteria 1250
349 Ga0105239_10945482 3300010375 Bacteria 990
350 Ga0105239_13338008 3300010375 Bacteria 522
351 Ga0105246_10351452 3300011119 Bacteria 1208
352 Ga0105246_10499939 3300011119 Bacteria 1032
353 Ga0105246_10968531 3300011119 Bacteria 768
354 Ga0105246_11196104 3300011119 Bacteria 699
355 Ga0105246_11263828 3300011119 Bacteria 682
356 Ga0157373_11387752 3300013100 Bacteria 534
357 Ga0157369_10691266 3300013105 Bacteria 1051
358 Ga0157369_10695868 3300013105 Bacteria 1047
359 Ga0157374_10000476 3300013296 Bacteria 36354
360 Ga0157374_10014770 3300013296 Bacteria 6838
361 Ga0157374_10944328 3300013296 Bacteria 881
362 Ga0157374_11001294 3300013296 Bacteria 855
363 Ga0157374_11146442 3300013296 Bacteria 798
364 Ga0157374_11176428 3300013296 Bacteria 788
365 Ga0157374_11209700 3300013296 Bacteria 777
366 Ga0157374_12491035 3300013296 Bacteria 545
367 Ga0157374_12844696 3300013296 Bacteria 511
368 Ga0157378_10006080 3300013297 Bacteria 10579
369 Ga0157378_10155646 3300013297 Bacteria 2133
370 Ga0157378_10362479 3300013297 Bacteria 1419
371 Ga0157378_10611103 3300013297 Bacteria 1102
372 Ga0157378_12250546 3300013297 Bacteria 596
373 Ga0157378_12303738 3300013297 Bacteria 590
374 Ga0157378_12398023 3300013297 Bacteria 579
375 Ga0163162_10280142 3300013306 Bacteria 1799
376 Ga0163162_10386433 3300013306 Bacteria 1533
377 Ga0163162_10587386 3300013306 Bacteria 1240
378 Ga0163162_11078568 3300013306 Bacteria 910
379 Ga0163162_11087494 3300013306 Bacteria 906
380 Ga0163162_11900160 3300013306 Bacteria 681
381 Ga0163162_12395262 3300013306 Bacteria 607
382 Ga0157372_10867715 3300013307 Bacteria 1047
383 Ga0157372_10907575 3300013307 Bacteria 1022
384 Ga0157372_11323291 3300013307 Bacteria 831
385 Ga0157375_10001065 3300013308 Bacteria 23722
386 Ga0157375_10356481 3300013308 Bacteria 1629
387 Ga0157375_10504949 3300013308 Bacteria 1373
388 Ga0157375_12261829 3300013308 Bacteria 648
389 Ga0163163_10337011 3300014325 Bacteria 1563
390 Ga0163163_10545874 3300014325 Bacteria 1221
391 Ga0163163_10632201 3300014325 Bacteria 1134
392 Ga0163163_10742859 3300014325 Bacteria 1045
393 Ga0163163_10987885 3300014325 Bacteria 905
394 Ga0163163_11026736 3300014325 Bacteria 888
395 Ga0163163_11702931 3300014325 Bacteria 691
396 Ga0163163_12261561 3300014325 Bacteria 603
397 Ga0157380_10294262 3300014326 Bacteria 1492
398 Ga0157380_11398424 3300014326 Bacteria 750
399 Ga0157377_10235855 3300014745 Bacteria 1178
400 Ga0157379_10551871 3300014968 Bacteria 1072
401 Ga0157379_11216972 3300014968 Bacteria 725
402 Ga0157376_10298912 3300014969 Bacteria 1523
403 Ga0157376_10628629 3300014969 Bacteria 1072
404 Ga0157376_10750764 3300014969 Bacteria 985
405 Ga0157376_10874435 3300014969 Bacteria 915
406 Ga0157376_11011883 3300014969 Bacteria 854
407 Ga0157376_11638140 3300014969 Bacteria 678
408 Ga0157376_11658422 3300014969 Bacteria 674
409 Ga0157376_11996883 3300014969 Bacteria 618
410 Ga0163161_10122320 3300017792 Bacteria 1957
411 Ga0163161_10821559 3300017792 Bacteria 782
412 Ga0206356_10010424 3300020070 Bacteria 1224
413 Ga0206356_10602174 3300020070 Bacteria 515
414 Ga0206356_11494082 3300020070 Bacteria 698
415 Ga0206351_10933183 3300020077 Bacteria 962
416 Ga0206352_10724423 3300020078 Bacteria 842
417 Ga0206352_11328313 3300020078 Bacteria 1391
418 Ga0206350_11274299 3300020080 Bacteria 747
419 Ga0154015_1418828 3300020610 Bacteria 530
420 Ga0213873_10113755 3300021358 Bacteria 789
421 Ga0213873_10152581 3300021358 Bacteria 696
422 Ga0213873_10209344 3300021358 Bacteria 607
423 Ga0213872_10000347 3300021361 Bacteria 39054
424 Ga0213872_10019579 3300021361 Bacteria 3117
425 Ga0213872_10036356 3300021361 Bacteria 2251
426 Ga0213872_10143099 3300021361 Bacteria 1048
427 Ga0213872_10170234 3300021361 Bacteria 944
428 Ga0213872_10235976 3300021361 Bacteria 774
429 Ga0213874_10246725 3300021377 Bacteria 657
430 Ga0213876_10000625 3300021384 Bacteria 25956
431 Ga0213876_10020022 3300021384 Bacteria 3534
432 Ga0213876_10022119 3300021384 Bacteria 3363
433 Ga0213876_10046119 3300021384 Bacteria 2304
434 Ga0213876_10080950 3300021384 Bacteria 1717
435 Ga0213876_10157327 3300021384 Bacteria 1209
436 Ga0213876_10241588 3300021384 Bacteria 960
437 Ga0213876_10459308 3300021384 Bacteria 677
438 Ga0213875_10209791 3300021388 Bacteria 917
439 Ga0213875_10338228 3300021388 Bacteria 714
440 Ga0213871_10013545 3300021441 Bacteria 1918
441 Ga0213871_10032464 3300021441 Bacteria 1368
442 Ga0213871_10047268 3300021441 Bacteria 1170
443 Ga0213871_10063925 3300021441 Bacteria 1029
444 Ga0207638_1004678 3300025227 Bacteria 577
445 Ga0209675_1002886 3300025291 Bacteria 8512
446 Ga0209676_1007618 3300025292 Bacteria 5025
447 Ga0209676_1098937 3300025292 Bacteria 625
448 Ga0209025_1000026 3300025294 Bacteria 519850
449 Ga0209050_1019384 3300025298 Bacteria 2585
450 Ga0209051_1013568 3300025303 Bacteria 3868
451 Ga0207697_10060121 3300025315 Bacteria 1580
452 Ga0207697_10157045 3300025315 Bacteria 991
453 Ga0207697_10245407 3300025315 Bacteria 792
454 Ga0207692_10118544 3300025898 Bacteria 1479
455 Ga0207692_10729359 3300025898 Bacteria 645
456 Ga0207692_11167786 3300025898 Bacteria 511
457 Ga0207642_10009878 3300025899 Bacteria 3339
458 Ga0207642_10495476 3300025899 Bacteria 747
459 Ga0207710_10002562 3300025900 Bacteria 8400
460 Ga0207710_10720868 3300025900 Bacteria 523
461 Ga0207688_10299895 3300025901 Bacteria 982
462 Ga0207688_10363132 3300025901 Bacteria 894
463 Ga0207680_10262503 3300025903 Bacteria 1196
464 Ga0207685_10172230 3300025905 Bacteria 997
465 Ga0207699_10065974 3300025906 Bacteria 2196
466 Ga0207699_10923927 3300025906 Unclassified 644
467 Ga0207699_11252521 3300025906 Bacteria 549
468 Ga0207699_11353766 3300025906 Bacteria 527
469 Ga0207645_10000728 3300025907 Bacteria 27395
470 Ga0207645_10169569 3300025907 Bacteria 1430
471 Ga0207645_10359290 3300025907 Bacteria 975
472 Ga0207645_10502135 3300025907 Bacteria 821
473 Ga0207643_10294026 3300025908 Bacteria 1010
474 Ga0207705_11448403 3300025909 Bacteria 521
475 Ga0207684_10002013 3300025910 Bacteria 20941
476 Ga0207684_10127191 3300025910 Bacteria 2187
477 Ga0207684_10259174 3300025910 Bacteria 1500
478 Ga0207684_10456915 3300025910 Bacteria 1096
479 Ga0207684_11099042 3300025910 Bacteria 662
480 Ga0207654_11326221 3300025911 Bacteria 525
481 Ga0207707_10615079 3300025912 Bacteria 918
482 Ga0207707_10841728 3300025912 Bacteria 762
483 Ga0207707_11320105 3300025912 Bacteria 579
484 Ga0207695_10000061 3300025913 Bacteria 359827
485 Ga0207695_10132686 3300025913 Bacteria 2446
486 Ga0207695_10175100 3300025913 Bacteria 2068
487 Ga0207695_10324365 3300025913 Bacteria 1429
488 Ga0207695_10478153 3300025913 Bacteria 1128
489 Ga0207671_10119846 3300025914 Bacteria 2011
490 Ga0207671_10269415 3300025914 Bacteria 1341
491 Ga0207671_10339380 3300025914 Bacteria 1190
492 Ga0207693_10651742 3300025915 Bacteria 818
493 Ga0207693_10658091 3300025915 Bacteria 813
494 Ga0207693_10795636 3300025915 Bacteria 729
495 Ga0207693_10868223 3300025915 Bacteria 693
496 Ga0207663_10048355 3300025916 Bacteria 2632
497 Ga0207663_10130938 3300025916 Bacteria 1733
498 Ga0207663_10274511 3300025916 Bacteria 1250
499 Ga0207663_10577325 3300025916 Bacteria 881
500 Ga0207663_10905079 3300025916 Bacteria 706
501 Ga0207663_11222733 3300025916 Bacteria 605
502 Ga0207660_10308001 3300025917 Bacteria 1262
503 Ga0207662_10074152 3300025918 Bacteria 2065
504 Ga0207662_10104235 3300025918 Bacteria 1761
505 Ga0207662_10171787 3300025918 Bacteria 1390
506 Ga0207657_10085546 3300025919 Bacteria 2641
507 Ga0207657_10195509 3300025919 Bacteria 1629
508 Ga0207649_10000838 3300025920 Bacteria 19781
509 Ga0207649_11611782 3300025920 Bacteria 514
510 Ga0207652_10160801 3300025921 Bacteria 2013
511 Ga0207652_10760992 3300025921 Bacteria 862
512 Ga0207646_10038118 3300025922 Bacteria 4331
513 Ga0207646_10050397 3300025922 Bacteria 3726
514 Ga0207681_10026963 3300025923 Bacteria 3710
515 Ga0207694_10003577 3300025924 Bacteria 12322
516 Ga0207694_10481798 3300025924 Bacteria 1038
517 Ga0207650_10401362 3300025925 Bacteria 1135
518 Ga0207650_10472503 3300025925 Bacteria 1045
519 Ga0207659_10049016 3300025926 Bacteria 2994
520 Ga0207659_10195247 3300025926 Bacteria 1613
521 Ga0207659_10262652 3300025926 Bacteria 1405
522 Ga0207659_10302387 3300025926 Bacteria 1314
523 Ga0207659_10780224 3300025926 Bacteria 821
524 Ga0207687_10041006 3300025927 Bacteria 3176
525 Ga0207687_10523574 3300025927 Bacteria 992
526 Ga0207700_10019741 3300025928 Bacteria 4558
527 Ga0207700_10106933 3300025928 Bacteria 2244
528 Ga0207700_10640169 3300025928 Bacteria 948
529 Ga0207700_11612209 3300025928 Bacteria 574
530 Ga0207664_10493183 3300025929 Bacteria 1096
531 Ga0207644_10055737 3300025931 Bacteria 2850
532 Ga0207644_10364252 3300025931 Bacteria 1176
533 Ga0207644_10458496 3300025931 Bacteria 1048
534 Ga0207690_10076447 3300025932 Bacteria 2325
535 Ga0207690_11063486 3300025932 Bacteria 674
536 Ga0207706_10034212 3300025933 Bacteria 4521
537 Ga0207706_10066355 3300025933 Bacteria 3176
538 Ga0207706_11011891 3300025933 Bacteria 698
539 Ga0207706_11038423 3300025933 Bacteria 687
540 Ga0207686_10144004 3300025934 Bacteria 1651
541 Ga0207686_10886872 3300025934 Bacteria 719
542 Ga0207686_11186516 3300025934 Bacteria 624
543 Ga0207709_11156999 3300025935 Bacteria 636
544 Ga0207670_10005563 3300025936 Bacteria 6927
545 Ga0207670_10016581 3300025936 Bacteria 4432
546 Ga0207670_10021302 3300025936 Bacteria 3997
547 Ga0207670_10033461 3300025936 Bacteria 3312
548 Ga0207670_10042944 3300025936 Bacteria 2983
549 Ga0207670_10262812 3300025936 Unclassified 1339
550 Ga0207670_10686585 3300025936 Bacteria 847
551 Ga0207670_10881485 3300025936 Bacteria 749
552 Ga0207670_10943865 3300025936 Bacteria 724
553 Ga0207670_11191073 3300025936 Bacteria 645
554 Ga0207669_10012954 3300025937 Bacteria 4122
555 Ga0207669_10022419 3300025937 Bacteria 3355
556 Ga0207669_10131760 3300025937 Bacteria 1719
557 Ga0207669_10372883 3300025937 Bacteria 1109
558 Ga0207669_10442314 3300025937 Bacteria 1028
559 Ga0207704_10002756 3300025938 Bacteria 7929
560 Ga0207704_10029724 3300025938 Bacteria 3052
561 Ga0207704_10177326 3300025938 Bacteria 1536
562 Ga0207704_10479434 3300025938 Bacteria 998
563 Ga0207665_10138887 3300025939 Bacteria 1731
564 Ga0207691_10052873 3300025940 Bacteria 3708
565 Ga0207691_10257678 3300025940 Bacteria 1504
566 Ga0207691_10307684 3300025940 Bacteria 1360
567 Ga0207691_10364123 3300025940 Bacteria 1236
568 Ga0207691_10668268 3300025940 Bacteria 877
569 Ga0207691_10737533 3300025940 Bacteria 830
570 Ga0207711_10053329 3300025941 Bacteria 3468
571 Ga0207711_10574550 3300025941 Bacteria 1051
572 Ga0207711_11104317 3300025941 Bacteria 734
573 Ga0207711_11615385 3300025941 Bacteria 592
574 Ga0207711_11814378 3300025941 Bacteria 553
575 Ga0207689_10021711 3300025942 Bacteria 5399
576 Ga0207689_10031998 3300025942 Bacteria 4375
577 Ga0207661_10238366 3300025944 Bacteria 1613
578 Ga0207661_10511164 3300025944 Bacteria 1098
579 Ga0207661_10921126 3300025944 Bacteria 805
580 Ga0207661_10990171 3300025944 Bacteria 774
581 Ga0207667_10107153 3300025949 Bacteria 2883
582 Ga0207667_10122989 3300025949 Bacteria 2673
583 Ga0207667_10408090 3300025949 Bacteria 1383
584 Ga0207667_10708120 3300025949 Bacteria 1009
585 Ga0207651_10102955 3300025960 Bacteria 2124
586 Ga0207651_10127381 3300025960 Bacteria 1942
587 Ga0207651_10217392 3300025960 Bacteria 1542
588 Ga0207651_10546257 3300025960 Bacteria 1007
589 Ga0207651_10787973 3300025960 Bacteria 842
590 Ga0207651_11162062 3300025960 Bacteria 692
591 Ga0207712_10291528 3300025961 Bacteria 1335
592 Ga0207668_10113654 3300025972 Bacteria 2036
593 Ga0207668_10135439 3300025972 Bacteria 1887
594 Ga0207668_10574599 3300025972 Bacteria 979
595 Ga0207658_10138332 3300025986 Bacteria 1967
596 Ga0207658_10181976 3300025986 Bacteria 1740
597 Ga0207658_11221042 3300025986 Bacteria 687
598 Ga0207658_11623548 3300025986 Bacteria 591
599 Ga0207677_10261590 3300026023 Bacteria 1411
600 Ga0207677_10279578 3300026023 Bacteria 1369
601 Ga0207677_10485780 3300026023 Bacteria 1065
602 Ga0207677_10573767 3300026023 Bacteria 986
603 Ga0207677_10612541 3300026023 Bacteria 957
604 Ga0207703_10005872 3300026035 Bacteria 9832
605 Ga0207703_10082836 3300026035 Bacteria 2679
606 Ga0207703_10222118 3300026035 Bacteria 1690
607 Ga0207703_10269954 3300026035 Bacteria 1541
608 Ga0207703_10711853 3300026035 Bacteria 955
609 Ga0207703_11045353 3300026035 Bacteria 784
610 Ga0207703_12010368 3300026035 Bacteria 554
611 Ga0207639_10236408 3300026041 Bacteria 1586
612 Ga0207639_10617932 3300026041 Bacteria 1000
613 Ga0207639_10863396 3300026041 Bacteria 845
614 Ga0207639_11151236 3300026041 Bacteria 728
615 Ga0207639_11177816 3300026041 Bacteria 719
616 Ga0207639_11324974 3300026041 Bacteria 676
617 Ga0207678_10434915 3300026067 Bacteria 1139
618 Ga0207708_10003243 3300026075 Bacteria 11980
619 Ga0207708_10010463 3300026075 Bacteria 6887
620 Ga0207708_11776870 3300026075 Bacteria 541
621 Ga0207702_10002417 3300026078 Bacteria 17759
622 Ga0207702_10005944 3300026078 Bacteria 10599
623 Ga0207702_10185488 3300026078 Bacteria 1918
624 Ga0207702_10652421 3300026078 Unclassified 1035
625 Ga0207702_11019409 3300026078 Bacteria 821
626 Ga0207702_12408616 3300026078 Bacteria 513
627 Ga0207641_10196832 3300026088 Bacteria 1855
628 Ga0207641_10199610 3300026088 Bacteria 1843
629 Ga0207641_10657978 3300026088 Bacteria 1029
630 Ga0207641_11502248 3300026088 Bacteria 675
631 Ga0207641_11842806 3300026088 Bacteria 607
632 Ga0207648_10016763 3300026089 Bacteria 6683
633 Ga0207648_10031685 3300026089 Bacteria 4673
634 Ga0207648_10600952 3300026089 Bacteria 1014
635 Ga0207676_10168259 3300026095 Bacteria 1907
636 Ga0207676_10592493 3300026095 Bacteria 1064
637 Ga0207674_10163375 3300026116 Bacteria 2181
638 Ga0207674_10233428 3300026116 Bacteria 1787
639 Ga0207674_10449031 3300026116 Bacteria 1246
640 Ga0207674_11907965 3300026116 Unclassified 560
641 Ga0207675_100006962 3300026118 Bacteria 10699
642 Ga0207675_100016985 3300026118 Bacteria 6801
643 Ga0207675_100083691 3300026118 Bacteria 2993
644 Ga0207675_101039728 3300026118 Bacteria 838
645 Ga0207675_101492464 3300026118 Bacteria 697
646 Ga0207683_10017435 3300026121 Bacteria 6120
647 Ga0207683_10045829 3300026121 Bacteria 3824
648 Ga0207683_10146235 3300026121 Bacteria 2131
649 Ga0207683_10596257 3300026121 Bacteria 1022
650 Ga0207698_10050458 3300026142 Bacteria 3174
651 Ga0207698_11089511 3300026142 Bacteria 811
652 Ga0207698_12179782 3300026142 Bacteria 567
653 Ga0209983_1040734 3300027665 Bacteria 1004
654 Ga0209588_1140098 3300027671 Bacteria 769
655 Ga0209998_10077241 3300027717 Bacteria 803
656 Ga0209974_10022976 3300027876 Bacteria 2064
657 Ga0209974_10127129 3300027876 Bacteria 907
658 Ga0207428_10012269 3300027907 Bacteria 7534
659 Ga0207428_10037670 3300027907 Bacteria 3934
660 Ga0207428_10111835 3300027907 Bacteria 2101
661 Ga0268266_10454658 3300028379 Bacteria 1218
662 Ga0268266_10720316 3300028379 Bacteria 962
663 Ga0268266_11397925 3300028379 Bacteria 675
664 Ga0268265_10110452 3300028380 Bacteria 2243
665 Ga0268265_10663912 3300028380 Bacteria 1003
666 Ga0268265_11211332 3300028380 Bacteria 753
667 Ga0268265_11420923 3300028380 Bacteria 696
668 Ga0268264_10000241 3300028381 Bacteria 103608
669 Ga0268264_10001424 3300028381 Bacteria 22372
670 Ga0268264_10167723 3300028381 Bacteria 1983
671 Ga0268264_10277451 3300028381 Bacteria 1568
672 Ga0268264_11074583 3300028381 Bacteria 813
673 Ga0265337_1060117 3300028556 Bacteria 1054
674 Ga0265337_1176762 3300028556 Bacteria 579
675 Ga0265326_10040365 3300028558 Bacteria 1325
676 Ga0265319_1001620 3300028563 Bacteria 13129
677 Ga0265319_1031555 3300028563 Bacteria 1844
678 Ga0265319_1140748 3300028563 Bacteria 749
679 Ga0265334_10140820 3300028573 Bacteria 854
680 Ga0265322_10023498 3300028654 Bacteria 1763
681 Ga0265336_10032425 3300028666 Bacteria 1620
682 Ga0265338_10000009 3300028800 Bacteria 448611
683 Ga0265338_10001990 3300028800 Bacteria 31793
684 Ga0265338_10017031 3300028800 Bacteria 7860
685 Ga0265338_10027181 3300028800 Bacteria 5747
686 Ga0265338_10115482 3300028800 Bacteria 2152
687 Ga0265338_10163503 3300028800 Bacteria 1716
688 Ga0265338_10285466 3300028800 Bacteria 1204
689 Ga0265324_10024450 3300029957 Bacteria 2145
690 Ga0265330_10006098 3300031235 Bacteria 5970
691 Ga0265330_10024000 3300031235 Unclassified 2766
692 Ga0265330_10362708 3300031235 Bacteria 612
693 Ga0265332_10218663 3300031238 Bacteria 790
694 Ga0265328_10005804 3300031239 Bacteria 5267
695 Ga0265328_10023332 3300031239 Bacteria 2349
696 Ga0265328_10320851 3300031239 Bacteria 600
697 Ga0265320_10000369 3300031240 Bacteria 36482
698 Ga0265320_10008183 3300031240 Bacteria 6418
699 Ga0265320_10012918 3300031240 Bacteria 4827
700 Ga0265320_10494902 3300031240 Bacteria 540
701 Ga0265325_10079405 3300031241 Bacteria 1633
702 Ga0265325_10096260 3300031241 Bacteria 1454
703 Ga0265329_10002718 3300031242 Bacteria 7939
704 Ga0265329_10092165 3300031242 Bacteria 962
705 Ga0265339_10003100 3300031249 Bacteria 11696
706 Ga0265339_10326923 3300031249 Bacteria 726
707 Ga0265339_10605753 3300031249 Bacteria 502
708 Ga0265331_10212373 3300031250 Bacteria 870
709 Ga0265327_10000041 3300031251 Bacteria 288506
710 Ga0265327_10001257 3300031251 Bacteria 33614
711 Ga0265327_10005146 3300031251 Bacteria 11096
712 Ga0265327_10034602 3300031251 Bacteria 2801
713 Ga0265327_10439375 3300031251 Bacteria 564
714 Ga0265327_10445285 3300031251 Bacteria 560
715 Ga0265316_10003266 3300031344 Bacteria 16468
716 Ga0265316_10034662 3300031344 Bacteria 4098
717 Ga0265316_10202846 3300031344 Bacteria 1469
718 Ga0265316_10269131 3300031344 Bacteria 1247
719 Ga0265316_10333779 3300031344 Bacteria 1100
720 Ga0265316_10888215 3300031344 Bacteria 623
721 Ga0307509_10104457 3300031507 Bacteria 2858
722 Ga0265313_10193778 3300031595 Bacteria 848
723 Ga0265313_10233522 3300031595 Bacteria 755
724 Ga0265313_10257067 3300031595 Bacteria 711
725 Ga0265313_10365564 3300031595 Bacteria 570
726 Ga0316575_10004516 3300031665 Bacteria 4898
727 Ga0316575_10005680 3300031665 Bacteria 4454
728 Ga0316575_10015125 3300031665 Bacteria 2906
729 Ga0316575_10020547 3300031665 Bacteria 2534
730 Ga0316575_10084277 3300031665 Bacteria 1283
731 Ga0316579_10009041 3300031691 Bacteria 4181
732 Ga0316579_10145806 3300031691 Bacteria 1141
733 Ga0316579_10430158 3300031691 Bacteria 638
734 Ga0316579_10599621 3300031691 Bacteria 533
735 Ga0265314_10000148 3300031711 Bacteria 105207
736 Ga0265314_10017491 3300031711 Bacteria 5626
737 Ga0265314_10028511 3300031711 Bacteria 4162
738 Ga0265314_10060329 3300031711 Bacteria 2589
739 Ga0265314_10149754 3300031711 Bacteria 1432
740 Ga0265314_10213728 3300031711 Bacteria 1131
741 Ga0265314_10611379 3300031711 Bacteria 560
742 Ga0265342_10000349 3300031712 Bacteria 51668
743 Ga0265342_10001028 3300031712 Bacteria 27405
744 Ga0265342_10033034 3300031712 Bacteria 3186
745 Ga0265342_10110950 3300031712 Bacteria 1552
746 Ga0316576_10043253 3300031727 Bacteria 3249
747 Ga0316576_10063255 3300031727 Bacteria 2715
748 Ga0316576_10246837 3300031727 Bacteria 1340
749 Ga0316576_10332649 3300031727 Bacteria 1132
750 Ga0316576_11079216 3300031727 Bacteria 570
751 Ga0316578_10006308 3300031728 Bacteria 5839
752 Ga0316578_10006710 3300031728 Bacteria 5702
753 Ga0316578_10016820 3300031728 Bacteria 3968
754 Ga0316578_10042621 3300031728 Bacteria 2632
755 Ga0316578_10061021 3300031728 Bacteria 2220
756 Ga0316578_10178287 3300031728 Bacteria 1280
757 Ga0316578_10269987 3300031728 Bacteria 1019
758 Ga0316578_10375520 3300031728 Bacteria 844
759 Ga0316578_10686774 3300031728 Bacteria 597
760 Ga0316577_10001918 3300031733 Bacteria 10067
761 Ga0316577_10002629 3300031733 Bacteria 8927
762 Ga0316577_10025378 3300031733 Bacteria 3296
763 Ga0316577_10026096 3300031733 Bacteria 3251
764 Ga0307413_11161364 3300031824 Bacteria 670
765 Ga0307413_11860371 3300031824 Bacteria 540
766 Ga0307412_10002918 3300031911 Bacteria 9484
767 Ga0307412_10123518 3300031911 Bacteria 1868
768 Ga0307414_10556360 3300032004 Bacteria 1023
769 Ga0307414_10869105 3300032004 Bacteria 825
770 Ga0316583_10000030 3300032133 Bacteria 26612
771 Ga0316583_10002908 3300032133 Bacteria 6015
772 Ga0316583_10009435 3300032133 Bacteria 3512
773 Ga0316583_10025438 3300032133 Bacteria 2114
774 Ga0316583_10060757 3300032133 Bacteria 1324
775 Ga0316585_10014221 3300032137 Bacteria 2376
776 Ga0316585_10017349 3300032137 Bacteria 2176
777 Ga0316585_10035443 3300032137 Bacteria 1580
778 Ga0316585_10063295 3300032137 Bacteria 1196
779 Ga0316585_10147499 3300032137 Bacteria 776
780 Ga0316580_10005240 3300032139 Bacteria 3778
781 Ga0316580_10018717 3300032139 Bacteria 2131
782 Ga0316580_10031690 3300032139 Bacteria 1636
783 Ga0316580_10044287 3300032139 Bacteria 1373
784 Ga0316593_10005354 3300032168 Bacteria 3376
785 Ga0316593_10267274 3300032168 Bacteria 642
786 Ga0316593_10307580 3300032168 Bacteria 601
787 Ga0316592_1004708 3300033524 Bacteria 2551
788 Ga0316592_1013427 3300033524 Bacteria 1688
789 Ga0316592_1027484 3300033524 Bacteria 1230
790 Ga0316592_1050351 3300033524 Bacteria 930
791 Ga0316592_1082859 3300033524 Bacteria 730
792 Ga0316588_1005235 3300033528 Bacteria 2512
793 Ga0316588_1006103 3300033528 Bacteria 2390
794 Ga0316588_1116139 3300033528 Bacteria 675
795 Ga0316587_1083935 3300033529 Bacteria 604
796 Ga0316596_1007916 3300033541 Bacteria 2520
797 Ga0316596_1009308 3300033541 Bacteria 2355
798 Ga0316596_1042388 3300033541 Bacteria 1198
799 Ga0316596_1062418 3300033541 Bacteria 994
800 Ga0316596_1081329 3300033541 Bacteria 871
801 Ga0316596_1203839 3300033541 Bacteria 551
802 Ga0373950_0000002 3300034818 Bacteria 933559
803 Ga0373950_0000026 3300034818 Bacteria 174190
804 Ga0373958_0007737 3300034819 Bacteria 1722
805 Ga0373938_0001010 3300034957 Bacteria 4532
806 Ga0373934_0062749 3300035086 Bacteria 1482
807 Ga0373934_0112143 3300035086 Bacteria 1107
808 Ga0373951_0057760 3300035091 Bacteria 966
809 Ga0373951_0175527 3300035091 Bacteria 613
810 Ga0373923_0101442 3300035111 Bacteria 1269
811 Ga0373923_0150450 3300035111 Bacteria 1057
812 Ga0373923_0276514 3300035111 Bacteria 791
813 Ga0373923_0499737 3300035111 Bacteria 593
814 Ga0373936_0122540 3300035113 Bacteria 1112
815 Ga0373941_0105082 3300035115 Bacteria 988
816 Ga0373945_0194670 3300035116 Bacteria 839
817 Ga0373953_0037507 3300035117 Bacteria 1913
818 Ga0373953_0074966 3300035117 Bacteria 1400
819 Ga0373953_0127241 3300035117 Bacteria 1085
820 Ga0373953_0142337 3300035117 Bacteria 1026
821 Ga0373953_0152677 3300035117 Bacteria 991
822 Ga0373954_0004984 3300035118 Bacteria 5736
823 Ga0373954_0040047 3300035118 Bacteria 2183
824 Ga0373954_0073899 3300035118 Bacteria 1622
825 Ga0373954_0227229 3300035118 Bacteria 918
826 Ga0373954_0508358 3300035118 Bacteria 597
827 Ga0373956_0049218 3300035119 Bacteria 1890
828 Ga0373956_0117087 3300035119 Bacteria 1243
829 Ga0373956_0183271 3300035119 Bacteria 990
830 Ga0373957_0046906 3300035120 Bacteria 1641
831 Ga0373957_0051440 3300035120 Bacteria 1576
832 Ga0373957_0062022 3300035120 Bacteria 1450
833 Ga0373957_0115858 3300035120 Bacteria 1082
834 Ga0373960_0432649 3300035121 Bacteria 513
835 Ga0373943_0025906 3300035170 Bacteria 2743
836 Ga0373943_0170342 3300035170 Bacteria 1191
837 Ga0373943_0229603 3300035170 Bacteria 1036
838 Ga0373946_0014057 3300035171 Bacteria 3016
839 Ga0373946_0076428 3300035171 Bacteria 1458
840 Ga0373946_0274006 3300035171 Bacteria 829
841 Ga0373955_0000754 3300035172 Bacteria 13898
842 Ga0373955_0098735 3300035172 Bacteria 1673
843 Ga0373955_0386105 3300035172 Bacteria 850
844 Ga0373955_0435761 3300035172 Bacteria 798
845 Ga0373955_0563855 3300035172 Bacteria 697
846 Ga0373962_0218612 3300035242 Bacteria 651
847 Ga0316574_0015507 3300035398 Bacteria 4423
848 Ga0316574_0025721 3300035398 Bacteria 3535
849 Ga0316574_0062173 3300035398 Bacteria 2346
850 Ga0316574_0078142 3300035398 Bacteria 2098
851 Ga0316574_0154579 3300035398 Bacteria 1478
852 Ga0316574_0204007 3300035398 Bacteria 1269
853 Ga0316574_0369056 3300035398 Bacteria 906
854 Ga0316574_0389402 3300035398 Bacteria 878
855 Ga0316574_0522627 3300035398 Bacteria 738
856 Ga0373924_0055117 3300035410 Bacteria 1654
857 Ga0373924_0301814 3300035410 Bacteria 711
858 Ga0373931_0367101 3300035691 Bacteria 904
859 Ga0373931_0614013 3300035691 Bacteria 712
860 Ga0373935_0028070 3300035692 Bacteria 3478
861 Ga0373935_0227235 3300035692 Bacteria 1298
862 Ga0373935_0271431 3300035692 Bacteria 1192
863 Ga0373935_1034846 3300035692 Bacteria 610
864 Ga0373927_0228044 3300035695 Bacteria 1224
865 Ga0373927_0449265 3300035695 Bacteria 851
866 Ga0373927_0465497 3300035695 Bacteria 835
867 Ga0373933_0000883 3300035724 Bacteria 18320
868 Ga0373933_0006884 3300035724 Bacteria 6192
869 Ga0373933_0011595 3300035724 Bacteria 4863
870 Ga0373933_0049749 3300035724 Bacteria 2500
871 Ga0373933_0050335 3300035724 Bacteria 2487
872 Ga0373933_0060584 3300035724 Bacteria 2282
873 Ga0373933_0112721 3300035724 Bacteria 1698
874 Ga0373933_0356001 3300035724 Bacteria 951
875 Ga0373947_0009334 3300035725 Bacteria 5637
876 Ga0373947_0036740 3300035725 Bacteria 2905
877 Ga0373937_0004251 3300036401 Bacteria 12135
878 Ga0373937_0006344 3300036401 Bacteria 10198
879 Ga0373937_0007260 3300036401 Bacteria 9589
880 Ga0373937_0011768 3300036401 Bacteria 7675
881 Ga0373937_0028426 3300036401 Bacteria 5060
882 Ga0373937_0110279 3300036401 Bacteria 2559
883 Ga0373937_0226779 3300036401 Bacteria 1759
884 Ga0373937_0303505 3300036401 Bacteria 1509
885 Ga0373937_0404561 3300036401 Bacteria 1295
886 Ga0373937_0456312 3300036401 Bacteria 1214
887 Ga0373937_0534093 3300036401 Bacteria 1114
888 Ga0373937_0634940 3300036401 Bacteria 1013
889 Ga0373937_0876066 3300036401 Bacteria 847
890 Ga0373937_1009271 3300036401 Bacteria 781
891 Ga0373937_1193304 3300036401 Bacteria 709
892 Ga0316582_0000230 3300036647 Bacteria 18454
893 Ga0316582_0109941 3300036647 Bacteria 1833
894 Ga0316582_0117801 3300036647 Bacteria 1774
895 Ga0316582_0196120 3300036647 Bacteria 1376
896 Ga0316582_0989928 3300036647 Bacteria 574
897 Ga0316584_0002826 3300036712 Bacteria 11132
898 Ga0316584_0053677 3300036712 Bacteria 3016
899 Ga0316584_0057370 3300036712 Bacteria 2915
900 Ga0316584_0185225 3300036712 Bacteria 1540
901 Ga0316584_0309741 3300036712 Bacteria 1141
902 Ga0316584_0887899 3300036712 Bacteria 601
903 Ga0316584_1072491 3300036712 Bacteria 535
904 Ga0373925_0042455 3300037068 Bacteria 3373
905 Ga0373925_0089006 3300037068 Bacteria 2358
906 Ga0373925_0390815 3300037068 Bacteria 1134
907 Ga0373925_0727278 3300037068 Bacteria 818
908 Ga0395899_0000032 3300037312 Bacteria 312705
909 Ga0395899_0005190 3300037312 Bacteria 10135
910 Ga0395899_0751147 3300037312 Bacteria 607
911 Ga0395900_0002835 3300037418 Bacteria 18922
912 Ga0395900_0076723 3300037418 Bacteria 3434
913 Ga0395900_0877620 3300037418 Bacteria 821
914 Ga0395898_0000562 3300037466 Bacteria 69459
915 Ga0395898_0016837 3300037466 Bacteria 7467
916 Ga0395898_0283538 3300037466 Bacteria 1580
917 Ga0395898_0376812 3300037466 Bacteria 1353
918 Ga0316581_0020456 3300037588 Bacteria 1938
919 Ga0316581_0034511 3300037588 Bacteria 1531
920 Ga0316581_0087721 3300037588 Bacteria 958
921 Ga0316581_0247040 3300037588 Bacteria 548
922 Ga0436364_0122589 3300037853 Bacteria 2499
923 Ga0436364_0538743 3300037853 Bacteria 971
924 Ga0436364_0771622 3300037853 Bacteria 941
925 Ga0436364_1465714 3300037853 Bacteria 531
926 Ga0436364_1553130 3300037853 Bacteria 752
927 Ga0395901_0006379 3300038443 Bacteria 11952
928 Ga0395901_0980363 3300038443 Bacteria 822
929 Ga0242419_003318 3300038698 Bacteria 1086
930 Ga0400483_278692 3300039062 Bacteria 1826
931 Ga0436365_0001915 3300039437 Bacteria 573
932 Ga0436365_0042250 3300039437 Bacteria 60076
933 Ga0436365_0774506 3300039437 Bacteria 12388
934 Ga0436365_1013589 3300039437 Bacteria 2438
935 Ga0436365_1150834 3300039437 Bacteria 43496
936 Ga0436365_1245734 3300039437 Bacteria 515
937 Ga0436365_1370865 3300039437 Bacteria 1341
938 Ga0436365_1801148 3300039437 Bacteria 2087
939 Ga0436360_0220038 3300039438 Bacteria 795
940 Ga0436360_0223987 3300039438 Bacteria 932
941 Ga0436360_0469231 3300039438 Bacteria 1209
942 Ga0436360_0877820 3300039438 Bacteria 1179
943 Ga0436360_0997829 3300039438 Bacteria 1643
944 Ga0436360_1036060 3300039438 Bacteria 1309
945 Ga0436360_1224017 3300039438 Bacteria 705
946 Ga0436360_1290733 3300039438 Bacteria 2876
947 Ga0436360_1324996 3300039438 Bacteria 1009
948 Ga0436361_0052711 3300039447 Bacteria 5714
949 Ga0436361_0192763 3300039447 Bacteria 1490
950 Ga0436361_0274613 3300039447 Bacteria 1754
951 Ga0436361_0300980 3300039447 Bacteria 4791
952 Ga0436361_0398359 3300039447 Bacteria 3247
953 Ga0436361_0422889 3300039447 Bacteria 2213
954 Ga0436361_0506622 3300039447 Bacteria 3083
955 Ga0436361_0516043 3300039447 Bacteria 6563
956 Ga0436361_0573040 3300039447 Bacteria 1840
957 Ga0436361_0645805 3300039447 Bacteria 3121
958 Ga0436361_0663171 3300039447 Bacteria 3180
959 Ga0436361_1140903 3300039447 Bacteria 4901
960 Ga0436361_1200325 3300039447 Bacteria 1743
961 Ga0436363_0298872 3300039450 Bacteria 546
962 Ga0436363_0401838 3300039450 Bacteria 503
963 Ga0436363_0971820 3300039450 Bacteria 6874
964 Ga0436363_1173897 3300039450 Bacteria 4445
965 Ga0436363_1239685 3300039450 Bacteria 616
966 Ga0436362_0110575 3300039453 Bacteria 516
967 Ga0436362_0439444 3300039453 Bacteria 1054
968 Ga0436362_0474002 3300039453 Bacteria 1027
969 Ga0436362_0490626 3300039453 Bacteria 1661
970 Ga0436362_0589333 3300039453 Bacteria 1379
971 Ga0436362_1019744 3300039453 Bacteria 610
972 Ga0436362_1102436 3300039453 Bacteria 1278
973 Ga0436362_1136023 3300039453 Bacteria 3665
974 Ga0436362_1191246 3300039453 Bacteria 1235
975 Ga0439436_0043232 3300041404 Bacteria 1286
976 Ga0451791_0684006 3300041451 Bacteria 1654
977 Ga0451797_1064022 3300041453 Bacteria 684
978 Ga0451798_0071854 3300041458 Bacteria 674
979 Ga0451802_1233454 3300041460 Bacteria 761
980 Ga0451807_2627768 3300041486 Bacteria 1151
981 Ga0451807_2723892 3300041486 Bacteria 826
982 Ga0451835_0622584 3300041492 Bacteria 1453
983 Ga0451841_1289628 3300041498 Bacteria 520
984 Ga0451847_0951203 3300041503 Bacteria 667
985 Ga0451853_2232771 3300041512 Bacteria 1166
986 Ga0451853_3240533 3300041512 Bacteria 692
987 Ga0451853_3276329 3300041512 Bacteria 664
988 Ga0439441_087476 3300042001 Bacteria 685
989 Ga0439460_0046463 3300042461 Bacteria 1290
990 Ga0451577_0001201 3300042876 Bacteria 36309
991 Ga0451577_0004733 3300042876 Bacteria 14259
992 Ga0451577_0449550 3300042876 Bacteria 1170
993 Ga0451577_0952751 3300042876 Bacteria 772
994 Ga0466965_0020889 3300044683 Bacteria 3151
995 Ga0466966_0098676 3300044684 Bacteria 1808
996 Ga0466961_0029200 3300044693 Bacteria 3546
997 Ga0466961_0573313 3300044693 Bacteria 679
998 Ga0466961_0878286 3300044693 Bacteria 534
999 Ga0466963_0031403 3300044694 Bacteria 3433
1000 Ga0466963_0085006 3300044694 Bacteria 2147
1001 Ga0466963_0136287 3300044694 Bacteria 1698
1002 Ga0466963_0256581 3300044694 Bacteria 1227
1003 Ga0466963_0546748 3300044694 Bacteria 818
1004 Ga0466964_0302165 3300044706 Bacteria 807
1005 Ga0453684_0000204 3300044712 Bacteria 258105
1006 Ga0453684_0000233 3300044712 Bacteria 240186
1007 Ga0453684_0000395 3300044712 Bacteria 179647
1008 Ga0453684_0003538 3300044712 Bacteria 34940
1009 Ga0453684_0044880 3300044712 Bacteria 5905
1010 Ga0453684_0104885 3300044712 Bacteria 3449
1011 Ga0453684_0358166 3300044712 Bacteria 1643
1012 Ga0453684_0370191 3300044712 Bacteria 1611
1013 Ga0453684_0517930 3300044712 Bacteria 1318
1014 Ga0466971_0000143 3300044719 Bacteria 26655
1015 Ga0466971_0043904 3300044719 Bacteria 2008
1016 Ga0466971_0482601 3300044719 Bacteria 610
1017 Ga0466970_0493080 3300044765 Bacteria 705
1018 Ga0466957_0001616 3300044842 Bacteria 11803
1019 Ga0466957_0037279 3300044842 Bacteria 2927
1020 Ga0466957_0110031 3300044842 Bacteria 1746
1021 Ga0466957_0212539 3300044842 Bacteria 1274
1022 Ga0466957_0503713 3300044842 Bacteria 840
1023 Ga0466957_0534802 3300044842 Bacteria 815
1024 Ga0466957_0625089 3300044842 Bacteria 755
1025 Ga0466959_0137962 3300045049 Bacteria 1725
1026 Ga0451576_0115142 3300045051 Bacteria 2799
1027 Ga0451576_0170285 3300045051 Bacteria 2273
1028 Ga0451576_0397455 3300045051 Bacteria 1445
1029 Ga0451576_0404911 3300045051 Bacteria 1431
1030 Ga0451576_2333027 3300045051 Bacteria 548
1031 Ga0451576_2369268 3300045051 Bacteria 543
1032 Ga0466958_0074504 3300045836 Bacteria 2080
1033 Ga0466958_0697350 3300045836 Bacteria 661
1034 Ga0466967_0017019 3300045976 Bacteria 5753
1035 Ga0466967_0023166 3300045976 Bacteria 5084
1036 Ga0466967_0170693 3300045976 Bacteria 2046
1037 Ga0466967_0225603 3300045976 Bacteria 1782
1038 Ga0466967_0248949 3300045976 Bacteria 1697
1039 Ga0466967_0378829 3300045976 Bacteria 1373
1040 Ga0466967_0582840 3300045976 Bacteria 1103
1041 Ga0466967_1899630 3300045976 Bacteria 592
1042 Ga0495592_0002231 3300046454 Bacteria 13664
1043 Ga0495592_0168792 3300046454 Bacteria 1500
1044 Ga0495629_0005400 3300046459 Bacteria 9532
1045 Ga0495641_0070658 3300046461 Bacteria 1568
1046 Ga0495641_0197697 3300046461 Bacteria 901
1047 Ga0495651_0000479 3300046462 Bacteria 30785
1048 Ga0495651_0133267 3300046462 Bacteria 1812
1049 Ga0495651_0195293 3300046462 Bacteria 1421
1050 Ga0495653_0000553 3300046463 Bacteria 28588
1051 Ga0495653_0882418 3300046463 Bacteria 534
1052 Ga0495580_0383728 3300046472 Bacteria 949
1053 Ga0495639_0171251 3300046475 Bacteria 1054
1054 Ga0495662_0094115 3300046476 Bacteria 1463
1055 Ga0495664_0272233 3300046477 Bacteria 1023
1056 Ga0495608_0041940 3300046511 Bacteria 3061
1057 Ga0495618_0018351 3300046514 Bacteria 4295
1058 Ga0495628_0304617 3300046516 Bacteria 1179
1059 Ga0495630_0000031 3300046517 Bacteria 135085
1060 Ga0495630_0051241 3300046517 Bacteria 3090
1061 Ga0495630_0090765 3300046517 Bacteria 2308
1062 Ga0495630_0750831 3300046517 Bacteria 746
1063 Ga0495666_0109132 3300046526 Bacteria 1300
1064 Ga0495666_0309863 3300046526 Bacteria 713
1065 Ga0495652_0006143 3300046529 Bacteria 11225
1066 Ga0495665_0191214 3300046531 Bacteria 1062
1067 Ga0495665_0191530 3300046531 Bacteria 1061
1068 Ga0495640_0010403 3300046533 Bacteria 7196
1069 Ga0495640_0094391 3300046533 Bacteria 1970
1070 Ga0495640_0106640 3300046533 Bacteria 1835
1071 Ga0495586_0000016 3300046535 Bacteria 126380
1072 Ga0495586_0505815 3300046535 Bacteria 697
1073 Ga0495587_0001125 3300046536 Bacteria 17493
1074 Ga0495587_0725446 3300046536 Bacteria 544
1075 Ga0495645_0085446 3300046543 Bacteria 2258
1076 Ga0495667_0000294 3300046559 Bacteria 32145
1077 Ga0495667_0260068 3300046559 Bacteria 1104
1078 Ga0495634_0005533 3300046642 Bacteria 9698
1079 Ga0495634_0009460 3300046642 Bacteria 7186
1080 Ga0495634_0014530 3300046642 Bacteria 5676
1081 Ga0495635_0043029 3300046663 Bacteria 3117
1082 Ga0495659_0463799 3300046664 Bacteria 552
1083 Ga0495657_0034867 3300046675 Bacteria 3492
1084 Ga0495599_0004220 3300046678 Bacteria 8490
1085 Ga0495623_0001907 3300046679 Bacteria 13995
1086 Ga0495646_0005159 3300046680 Bacteria 8241
1087 Ga0495647_0148177 3300046681 Bacteria 1005
1088 Ga0495647_0323102 3300046681 Bacteria 699
1089 Ga0495613_0038952 3300046689 Bacteria 3524
1090 Ga0495613_0046018 3300046689 Bacteria 3227
1091 Ga0495613_0434073 3300046689 Bacteria 892
1092 Ga0495624_0147637 3300046690 Bacteria 1439
1093 Ga0495600_0013933 3300046809 Bacteria 5066
1094 Ga0495581_0120594 3300047315 Bacteria 1526
1095 Ga0495581_0628137 3300047315 Bacteria 621
1096 Ga0495604_0000972 3300047317 Bacteria 23909
1097 Ga0495674_0000794 3300047319 Bacteria 29966
1098 Ga0495674_0009055 3300047319 Bacteria 9455
1099 Ga0495674_0031840 3300047319 Bacteria 4785
1100 Ga0495674_1218225 3300047319 Bacteria 568
1101 Ga0495676_0003977 3300047321 Bacteria 13458
1102 Ga0495676_0030408 3300047321 Bacteria 4584
1103 Ga0495680_0038540 3300047322 Bacteria 3818
1104 Ga0495680_0108359 3300047322 Bacteria 2062
1105 Ga0495680_0133996 3300047322 Bacteria 1818
1106 Ga0495680_0324271 3300047322 Bacteria 1077
1107 Ga0495680_0414552 3300047322 Bacteria 928
1108 Ga0495675_0003250 3300047444 Bacteria 9763
1109 Ga0495602_0002877 3300048088 Bacteria 17634
1110 Ga0496100_0092489 3300048903 Bacteria 2067
1111 Ga0496100_0289827 3300048903 Bacteria 1223
1112 Ga0496101_0010734 3300048904 Bacteria 6057
1113 Ga0496101_0027488 3300048904 Bacteria 3964
1114 Ga0496101_0177952 3300048904 Bacteria 1637
1115 Ga0496101_1197310 3300048904 Bacteria 595
1116 Ga0496101_1600073 3300048904 Bacteria 506
1117 Ga0496102_0405159 3300048905 Bacteria 1282
1118 Ga0496102_0849946 3300048905 Bacteria 835
1119 Ga0496102_1277333 3300048905 Bacteria 653
1120 Ga0496102_1551061 3300048905 Bacteria 581
1121 Ga0496104_0006037 3300048907 Bacteria 10624
1122 Ga0496104_0029328 3300048907 Bacteria 5103
1123 Ga0496104_0200827 3300048907 Bacteria 1906
1124 Ga0496104_0551223 3300048907 Bacteria 1064
1125 Ga0496104_0663416 3300048907 Bacteria 952
1126 Ga0496105_0126084 3300048908 Bacteria 2111
1127 Ga0496105_0318189 3300048908 Bacteria 1248
1128 Ga0496105_0471461 3300048908 Bacteria 989
1129 Ga0496106_0089817 3300048909 Bacteria 2370
1130 Ga0496106_0588382 3300048909 Bacteria 892
1131 Ga0496107_0148931 3300048910 Bacteria 1731
1132 Ga0496107_0164274 3300048910 Bacteria 1646
1133 Ga0496107_0597950 3300048910 Bacteria 815
1134 Ga0496108_0018851 3300048911 Bacteria 5658
1135 Ga0496108_0306006 3300048911 Bacteria 1385
1136 Ga0496109_0080539 3300048912 Bacteria 3000
1137 Ga0496109_1204842 3300048912 Bacteria 694
1138 Ga0496109_1259607 3300048912 Bacteria 676
1139 Ga0496109_1494100 3300048912 Bacteria 611
1140 Ga0496110_1495194 3300048913 Bacteria 585
1141 Ga0496112_0144189 3300048915 Bacteria 2350
1142 Ga0496112_0659158 3300048915 Bacteria 976
1143 Ga0496114_0000692 3300048917 Bacteria 25119
1144 Ga0496114_0018457 3300048917 Bacteria 5639
1145 Ga0496114_0094991 3300048917 Bacteria 2536
1146 Ga0496114_0269421 3300048917 Bacteria 1500
1147 Ga0496115_0014290 3300048918 Bacteria 6011
1148 Ga0496115_0023739 3300048918 Bacteria 4760
1149 Ga0496115_0400262 3300048918 Bacteria 1114
1150 Ga0496115_0406273 3300048918 Bacteria 1104
1151 Ga0496116_0052029 3300048919 Bacteria 2716
1152 Ga0496121_0016881 3300048924 Bacteria 7506
1153 Ga0496121_0396663 3300048924 Bacteria 905
1154 Ga0496122_0000033 3300048925 Bacteria 324104
1155 Ga0496122_0178195 3300048925 Bacteria 1271
1156 Ga0496123_0001288 3300048926 Bacteria 35785
1157 Ga0496124_0104999 3300048927 Bacteria 2283
1158 Ga0496125_0076706 3300048928 Bacteria 2579
1159 Ga0496125_0346203 3300048928 Bacteria 890
1160 Ga0496126_0080482 3300048929 Bacteria 2883
1161 Ga0496126_1244478 3300048929 Bacteria 545
1162 Ga0501292_129782 3300049515 Bacteria 520
1163 Ga0501031_0000794 3300049568 Bacteria 18986
1164 Ga0501031_0009384 3300049568 Bacteria 6360
1165 Ga0501031_0030953 3300049568 Bacteria 3491
1166 Ga0501031_0043485 3300049568 Bacteria 2931
1167 Ga0501031_0091029 3300049568 Bacteria 1989
1168 Ga0501032_0000452 3300049569 Bacteria 33341
1169 Ga0501032_0015323 3300049569 Bacteria 5411
1170 Ga0501032_0036934 3300049569 Bacteria 3333
1171 Ga0501032_0186755 3300049569 Bacteria 1356
1172 Ga0501032_0387006 3300049569 Bacteria 899
1173 Ga0501032_0405716 3300049569 Bacteria 875
1174 Ga0501032_0419677 3300049569 Bacteria 858
1175 Ga0501032_0898940 3300049569 Bacteria 558
1176 Ga0501033_0000002 3300049570 Bacteria 668574
1177 Ga0501033_0000047 3300049570 Bacteria 122884
1178 Ga0501033_0012368 3300049570 Bacteria 6514
1179 Ga0501033_0031661 3300049570 Bacteria 3972
1180 Ga0501034_0000037 3300049571 Bacteria 239254
1181 Ga0501034_0022604 3300049571 Bacteria 6406
1182 Ga0501034_0045667 3300049571 Bacteria 4426
1183 Ga0501034_0180281 3300049571 Bacteria 2077
1184 Ga0501034_0190313 3300049571 Bacteria 2014
1185 Ga0501034_0190567 3300049571 Bacteria 2013
1186 Ga0501034_0232724 3300049571 Bacteria 1791
1187 Ga0501034_0241274 3300049571 Bacteria 1753
1188 Ga0501034_1121876 3300049571 Bacteria 667
1189 Ga0501034_1130912 3300049571 Bacteria 663
1190 Ga0501036_0004348 3300049572 Bacteria 11433
1191 Ga0501036_0012199 3300049572 Bacteria 7120
1192 Ga0501036_0023743 3300049572 Bacteria 5167
1193 Ga0501036_0038730 3300049572 Bacteria 4035
1194 Ga0501036_0243882 3300049572 Bacteria 1507
1195 Ga0501036_0624664 3300049572 Bacteria 893
1196 Ga0501036_1372976 3300049572 Bacteria 573
1197 Ga0501037_0000062 3300049573 Bacteria 97779
1198 Ga0501037_0002406 3300049573 Bacteria 13524
1199 Ga0501037_0016989 3300049573 Bacteria 5354
1200 Ga0501037_0040539 3300049573 Bacteria 3427
1201 Ga0501037_0130081 3300049573 Bacteria 1805
1202 Ga0501037_0337086 3300049573 Bacteria 1042
1203 Ga0501038_0002285 3300049574 Bacteria 17825
1204 Ga0501038_0017420 3300049574 Bacteria 6494
1205 Ga0501038_0032242 3300049574 Bacteria 4624
1206 Ga0501038_0057491 3300049574 Bacteria 3339
1207 Ga0501038_0268723 3300049574 Bacteria 1345
1208 Ga0501039_0008291 3300049575 Bacteria 7919
1209 Ga0501039_0070100 3300049575 Bacteria 2723
1210 Ga0501039_0082292 3300049575 Bacteria 2506
1211 Ga0501039_0328142 3300049575 Bacteria 1203
1212 Ga0501039_1089868 3300049575 Bacteria 619
1213 Ga0501040_0000563 3300049576 Bacteria 22467
1214 Ga0501040_0182522 3300049576 Bacteria 1488
1215 Ga0501041_0010892 3300049577 Bacteria 5366
1216 Ga0501042_0004644 3300049578 Bacteria 8766
1217 Ga0501042_0311889 3300049578 Bacteria 1136
1218 Ga0501043_0009436 3300049579 Bacteria 7657
1219 Ga0501043_0032969 3300049579 Bacteria 4073
1220 Ga0501043_0043062 3300049579 Bacteria 3548
1221 Ga0501043_0082598 3300049579 Bacteria 2526
1222 Ga0501043_0178962 3300049579 Bacteria 1653
1223 Ga0501043_0266065 3300049579 Bacteria 1317
1224 Ga0501043_0463265 3300049579 Bacteria 951
1225 Ga0501046_0001437 3300049580 Bacteria 22916
1226 Ga0501046_0002418 3300049580 Bacteria 17510
1227 Ga0501046_0168014 3300049580 Bacteria 1647
1228 Ga0501046_0285606 3300049580 Bacteria 1208
1229 Ga0501046_0359852 3300049580 Bacteria 1055
1230 Ga0501046_0630260 3300049580 Bacteria 759
1231 Ga0501047_0000196 3300049581 Bacteria 73284
1232 Ga0501047_0006607 3300049581 Bacteria 10910
1233 Ga0501047_0086353 3300049581 Bacteria 3015
1234 Ga0501047_0134699 3300049581 Bacteria 2351
1235 Ga0501047_0141632 3300049581 Bacteria 2283
1236 Ga0501047_0149352 3300049581 Bacteria 2213
1237 Ga0501047_0180467 3300049581 Bacteria 1978
1238 Ga0501047_0229035 3300049581 Bacteria 1712
1239 Ga0501047_1020609 3300049581 Bacteria 640
1240 Ga0501048_0003354 3300049582 Bacteria 12184
1241 Ga0501048_0035217 3300049582 Bacteria 3604
1242 Ga0501048_0049380 3300049582 Bacteria 2998
1243 Ga0501048_0125951 3300049582 Bacteria 1811
1244 Ga0501067_0000136 3300049583 Bacteria 40150
1245 Ga0501067_0002058 3300049583 Bacteria 11093
1246 Ga0501067_0031592 3300049583 Bacteria 2937
1247 Ga0501067_0035197 3300049583 Bacteria 2780
1248 Ga0501067_0044332 3300049583 Bacteria 2471
1249 Ga0501067_0054602 3300049583 Bacteria 2213
1250 Ga0501067_0069227 3300049583 Bacteria 1954
1251 Ga0501068_0001264 3300049584 Bacteria 13424
1252 Ga0501068_0002516 3300049584 Bacteria 9733
1253 Ga0501068_0021786 3300049584 Bacteria 3745
1254 Ga0501068_0066828 3300049584 Bacteria 2190
1255 Ga0501068_0132669 3300049584 Bacteria 1558
1256 Ga0501068_0242817 3300049584 Bacteria 1146
1257 Ga0501068_0574553 3300049584 Bacteria 734
1258 Ga0501068_0722885 3300049584 Bacteria 651
1259 Ga0501068_1139207 3300049584 Bacteria 516
1260 Ga0501069_0019936 3300049585 Bacteria 3628
1261 Ga0501069_0025853 3300049585 Bacteria 3211
1262 Ga0501069_0052493 3300049585 Bacteria 2270
1263 Ga0501069_0111610 3300049585 Bacteria 1557
1264 Ga0501069_0369879 3300049585 Bacteria 846
1265 Ga0501070_0000061 3300049586 Bacteria 92432
1266 Ga0501070_0000512 3300049586 Bacteria 35492
1267 Ga0501070_0000879 3300049586 Bacteria 27249
1268 Ga0501070_0002718 3300049586 Bacteria 15436
1269 Ga0501070_0021671 3300049586 Bacteria 5388
1270 Ga0501070_0040516 3300049586 Bacteria 3884
1271 Ga0501070_0084981 3300049586 Bacteria 2620
1272 Ga0501070_0114030 3300049586 Bacteria 2233
1273 Ga0501070_0127555 3300049586 Bacteria 2102
1274 Ga0501070_0150756 3300049586 Bacteria 1918
1275 Ga0501070_0195633 3300049586 Bacteria 1661
1276 Ga0501070_0205693 3300049586 Bacteria 1616
1277 Ga0501070_0690935 3300049586 Bacteria 807
1278 Ga0501071_0220422 3300049587 Bacteria 1427
1279 Ga0501071_0414866 3300049587 Bacteria 1029
1280 Ga0501071_0778895 3300049587 Bacteria 737
1281 Ga0501071_1264820 3300049587 Bacteria 570
1282 Ga0501072_0000056 3300049588 Bacteria 80824
1283 Ga0501072_0211242 3300049588 Bacteria 1546
1284 Ga0501072_0581205 3300049588 Bacteria 884
1285 Ga0501072_0634131 3300049588 Bacteria 842
1286 Ga0501072_1031680 3300049588 Bacteria 641
1287 Ga0501073_0004075 3300049589 Bacteria 10956
1288 Ga0501073_0004822 3300049589 Bacteria 10126
1289 Ga0501073_0007233 3300049589 Bacteria 8265
1290 Ga0501073_0008138 3300049589 Bacteria 7779
1291 Ga0501073_0011070 3300049589 Bacteria 6598
1292 Ga0501073_0011649 3300049589 Bacteria 6424
1293 Ga0501073_0019426 3300049589 Bacteria 4907
1294 Ga0501073_0027784 3300049589 Bacteria 4043
1295 Ga0501073_0038022 3300049589 Bacteria 3415
1296 Ga0501073_0060571 3300049589 Bacteria 2641
1297 Ga0501073_0300338 3300049589 Bacteria 1108
1298 Ga0501073_0485602 3300049589 Bacteria 854
1299 Ga0501073_0608519 3300049589 Bacteria 754
1300 Ga0501073_1070245 3300049589 Bacteria 554
1301 Ga0501074_0001374 3300049590 Bacteria 16135
1302 Ga0501074_0020736 3300049590 Bacteria 4774
1303 Ga0501074_0025498 3300049590 Bacteria 4293
1304 Ga0501074_0028177 3300049590 Bacteria 4070
1305 Ga0501074_0337092 3300049590 Bacteria 1070
1306 Ga0501074_0637317 3300049590 Bacteria 753
1307 Ga0501075_0002074 3300049591 Bacteria 13228
1308 Ga0501075_0009705 3300049591 Bacteria 6745
1309 Ga0501075_0156125 3300049591 Bacteria 1740
1310 Ga0501076_0019636 3300049592 Bacteria 5166
1311 Ga0501076_0094759 3300049592 Bacteria 2404
1312 Ga0501076_1153810 3300049592 Bacteria 638
1313 Ga0501077_0005722 3300049593 Bacteria 7568
1314 Ga0501257_042582 3300049686 Bacteria 1117
1315 Ga0501261_010538 3300049690 Bacteria 1219
1316 Ga0501079_0000667 3300049741 Bacteria 22986
1317 Ga0501079_0001786 3300049741 Bacteria 15350
1318 Ga0501079_0010702 3300049741 Bacteria 6986
1319 Ga0501079_0079896 3300049741 Bacteria 2529
1320 Ga0501079_0957268 3300049741 Bacteria 674
1321 Ga0501079_1335188 3300049741 Bacteria 564
1322 Ga0501080_0000918 3300049742 Bacteria 24125
1323 Ga0501080_0004727 3300049742 Bacteria 12140
1324 Ga0501080_0007246 3300049742 Bacteria 10008
1325 Ga0501080_0009445 3300049742 Bacteria 8895
1326 Ga0501080_0019975 3300049742 Bacteria 6201
1327 Ga0501080_0028886 3300049742 Bacteria 5162
1328 Ga0501080_0043113 3300049742 Bacteria 4200
1329 Ga0501080_0160234 3300049742 Bacteria 2078
1330 Ga0501080_0361791 3300049742 Bacteria 1309
1331 Ga0501080_1571893 3300049742 Bacteria 557
1332 Ga0501080_1623738 3300049742 Bacteria 547
1333 Ga0501081_0002255 3300049743 Bacteria 12128
1334 Ga0501081_0124541 3300049743 Bacteria 1838
1335 Ga0501081_0167350 3300049743 Bacteria 1586
1336 Ga0501083_0004962 3300049744 Bacteria 9428
1337 Ga0501083_0012182 3300049744 Bacteria 6020
1338 Ga0501083_0018307 3300049744 Bacteria 4881
1339 Ga0501083_0035312 3300049744 Bacteria 3415
1340 Ga0501083_0181286 3300049744 Bacteria 1375
1341 Ga0501083_0198180 3300049744 Bacteria 1310
1342 Ga0501083_0251858 3300049744 Bacteria 1149
1343 Ga0501083_0280144 3300049744 Bacteria 1085
1344 Ga0501083_0600726 3300049744 Bacteria 716
1345 Ga0501273_061016 3300049770 Bacteria 594
1346 Ga0501035_0000004 3300049822 Bacteria 403650
1347 Ga0501035_0014804 3300049822 Bacteria 7199
1348 Ga0501035_0015102 3300049822 Bacteria 7126
1349 Ga0501035_0016208 3300049822 Bacteria 6878
1350 Ga0501035_0053797 3300049822 Bacteria 3598
1351 Ga0501035_0221044 3300049822 Bacteria 1617
1352 Ga0501035_0302317 3300049822 Bacteria 1348
1353 Ga0501044_0001842 3300049823 Bacteria 24647
1354 Ga0501044_0003422 3300049823 Bacteria 17882
1355 Ga0501044_0018367 3300049823 Bacteria 7493
1356 Ga0501044_0041848 3300049823 Bacteria 4769
1357 Ga0501044_0297746 3300049823 Bacteria 1543
1358 Ga0501044_0418236 3300049823 Bacteria 1251
1359 Ga0501044_0660314 3300049823 Bacteria 934
1360 Ga0501044_1302007 3300049823 Bacteria 593
1361 Ga0501044_1453271 3300049823 Bacteria 551
1362 Ga0501044_1665581 3300049823 Bacteria 503
1363 Ga0501045_0004093 3300049824 Bacteria 10065
1364 Ga0501045_0352186 3300049824 Bacteria 1096
1365 Ga0501045_1009827 3300049824 Bacteria 610
1366 nmdc:mga03683_314502_c1 3300050489 Bacteria 736
1367 nmdc:mga03683_419792_c1 3300050489 Bacteria 641
1368 nmdc:mga03683_88_c3 3300050489 Bacteria 4001
1369 nmdc:mga03n38_146491_c1 3300050490 Bacteria 1184
1370 nmdc:mga03n38_2587_c1 3300050490 Bacteria 5631
1371 nmdc:mga00v17_386360_c1 3300050491 Bacteria 910
1372 nmdc:mga0k408_170717_c1 3300050493 Bacteria 1296
1373 nmdc:mga0k408_1872_c1 3300050493 Bacteria 11278
1374 nmdc:mga0k408_528900_c1 3300050493 Bacteria 698
1375 nmdc:mga0k408_7601_c1 3300050493 Bacteria 5788
1376 nmdc:mga07m45_3477_c2 3300050496 Bacteria 6526
1377 nmdc:mga05p37_1253825_c1 3300050507 Bacteria 760
1378 nmdc:mga05p37_944370_c1 3300050507 Bacteria 924
1379 nmdc:mga09592_1218876_c1 3300050508 Bacteria 621
1380 nmdc:mga09592_42047_c1 3300050508 Bacteria 3844
1381 nmdc:mga09592_495402_c1 3300050508 Bacteria 1052
1382 nmdc:mga0qj67_13329_c1 3300050509 Bacteria 5837
1383 nmdc:mga06r32_80572_c1 3300050510 Bacteria 3169
1384 nmdc:mga08y16_1038150_c1 3300050511 Bacteria 798
1385 nmdc:mga08y16_1165_c1 3300050511 Bacteria 25911
1386 nmdc:mga08y16_128186_c1 3300050511 Bacteria 2639
1387 nmdc:mga08y16_1438360_c1 3300050511 Bacteria 651
1388 nmdc:mga08y16_4368_c1 3300050511 Bacteria 14770
1389 nmdc:mga08y16_639304_c1 3300050511 Bacteria 1069
1390 nmdc:mga0n895_275031_c1 3300050512 Bacteria 1708
1391 nmdc:mga0n895_750370_c1 3300050512 Bacteria 969
1392 nmdc:mga08x19_250758_c1 3300050514 Bacteria 1222
1393 nmdc:mga08x19_38494_c1 3300050514 Bacteria 3038
1394 nmdc:mga08x19_569890_c1 3300050514 Bacteria 802
1395 nmdc:mga0a205_625493_c1 3300050515 Bacteria 929
1396 nmdc:mga0a205_853177_c1 3300050515 Bacteria 758
1397 Ga0495601_0001493 3300053077 Bacteria 12895
1398 Ga0495601_0086291 3300053077 Bacteria 2017
1399 Ga0495601_0204424 3300053077 Bacteria 1290
1400 Ga0495601_0411743 3300053077 Bacteria 876
1401 Ga0495601_0434103 3300053077 Bacteria 850
1402 Ga0495612_0069407 3300053078 Bacteria 1467
1403 Ga0500610_0032474 3300053079 Bacteria 2658
1404 Ga0495595_0004500 3300053084 Bacteria 5606
1405 Ga0495595_0576303 3300053084 Bacteria 575
1406 Ga0495619_0000426 3300053085 Bacteria 28605
1407 Ga0495619_0242014 3300053085 Bacteria 1250
1408 Ga0495619_0551485 3300053085 Bacteria 791
1409 Ga0495619_1077370 3300053085 Bacteria 535
1410 Ga0500650_0068730 3300053098 Bacteria 1655
1411 Ga0500555_000343 3300053103 Bacteria 19817
1412 Ga0500556_0000010 3300053104 Bacteria 258288
1413 Ga0500556_0180298 3300053104 Bacteria 834
1414 Ga0500593_000072 3300053117 Bacteria 37884
1415 Ga0500642_0029459 3300053130 Bacteria 2275
1416 Ga0500642_0060231 3300053130 Bacteria 1702
1417 Ga0500655_019853 3300053133 Bacteria 1253
1418 Ga0500655_032811 3300053133 Bacteria 1003
1419 Ga0500616_0002331 3300053153 Bacteria 16017
1420 Ga0500616_0023759 3300053153 Bacteria 3412
1421 Ga0500645_065720 3300053730 Bacteria 1045
1422 Ga0501084_0000544 3300054114 Bacteria 28733
1423 Ga0501084_0006037 3300054114 Bacteria 9962
1424 Ga0501084_0029390 3300054114 Bacteria 4598
1425 Ga0501084_0374514 3300054114 Bacteria 1203
1426 Ga0501084_0485450 3300054114 Bacteria 1044
1427 Ga0587080_003782 3300059503 Bacteria 1915
1428 Ga0587080_033958 3300059503 Bacteria 902
1429 Ga0587083_0045829 3300059505 Bacteria 935
1430 Ga0587067_053055 3300059640 Bacteria 827
1431 Ga0587076_117983 3300059645 Bacteria 612
1432 Ga0587079_050777 3300059647 Bacteria 870
1433 Ga0587071_005154 3300060344 Bacteria 1987
1434 Ga0587111_0063772 3300060346 Bacteria 844
1435 Ga0501082_0005564 3300060353 Bacteria 10939
1436 Ga0501082_0011143 3300060353 Bacteria 7729
1437 Ga0501082_0017087 3300060353 Bacteria 6251
1438 Ga0501082_0037852 3300060353 Bacteria 4160
1439 Ga0501082_0039727 3300060353 Bacteria 4059
1440 Ga0501082_0041755 3300060353 Bacteria 3955
1441 Ga0501082_0124040 3300060353 Bacteria 2239
1442 Ga0501082_0136997 3300060353 Bacteria 2124
1443 Ga0501082_0801022 3300060353 Bacteria 824
1444 Ga0501082_0972126 3300060353 Bacteria 742
1445 Ga0466962_0017640 3300061719 Bacteria 3437
1446 Ga0466962_0036578 3300061719 Bacteria 2350
1447 Ga0466962_0109327 3300061719 Bacteria 1330
1448 Ga0530510_0027093 3300061734 Bacteria 4105
1449 Ga0530510_0066938 3300061734 Bacteria 2605
1450 Ga0530510_0395563 3300061734 Bacteria 1041
1451 2787508105 2786546548 Bacteria 4745694
1452 rootH2_10009508
1453 JGI24033J14998_100040
1454 JGI24743J22301_10000046
1455 JGI24033J26618_1000022
1456 Ga0006767J43181_102738
1457 Ga0006763J43179_103811
1458 Ga0006765J45826_107625
1459 Ga0006778J45830_1033904
1460 Ga0006758J48902_1014192
1461 rootH2_10000766
1462 rootH2_10087759
1463 rootH1_10236075
1464 Ga0032354_1004574
1465 Ga0055540_1081610
1466 Ga0058859_10017652
1467 Ga0058863_10089126
1468 Ga0058863_11301227
1469 Ga0058863_11859074
1470 Ga0058861_10043227
1471 Ga0058860_11878483
1472 Ga0058860_12243724
1473 Ga0058862_10016066
1474 Ga0058862_12245081
1475 Ga0058862_12869646
1476 Ga0065704_10200999
1477 Ga0065704_10735280
1478 Ga0065712_10404380
1479 Ga0065712_10758685
1480 Ga0065715_10435202
1481 Ga0065707_10638827
1482 Ga0070658_10548068
1483 Ga0070676_10008133
1484 Ga0070676_10164732
1485 Ga0070676_10818777
1486 Ga0070683_101093001
1487 Ga0070683_101144020
1488 Ga0070690_100013678
1489 Ga0070690_100030194
1490 Ga0070690_100231082
1491 Ga0070690_100842158
1492 Ga0070690_101084178
1493 Ga0070670_100083169
1494 Ga0070670_100100107
1495 Ga0068869_100425265
1496 Ga0070666_10027445
1497 Ga0070666_10031114
1498 Ga0070666_10273089
1499 Ga0070680_100442456
1500 Ga0070680_100737881
1501 Ga0070680_101198018
1502 Ga0070682_100903533
1503 Ga0068868_100537999
1504 Ga0068868_101613712
1505 Ga0070689_100043362
1506 Ga0070689_100062309
1507 Ga0070691_10020450
1508 Ga0070691_10178271
1509 Ga0070687_100040520
1510 Ga0070687_100040693
1511 Ga0070687_100123528
1512 Ga0070687_100145104
1513 Ga0070687_100185739
1514 Ga0070661_100007296
1515 Ga0070692_10025468
1516 Ga0070692_10418555
1517 Ga0070668_100012673
1518 Ga0070668_100596076
1519 Ga0070669_100031851
1520 Ga0070675_100024404
1521 Ga0070675_100100099
1522 Ga0070675_101813484
1523 Ga0070675_102101375
1524 Ga0070671_100050450
1525 Ga0070671_100086977
1526 Ga0070674_100164066
1527 Ga0070674_100238508
1528 Ga0070674_100586647
1529 Ga0070674_100722096
1530 Ga0070674_100782098
1531 Ga0070673_100006487
1532 Ga0070673_100191763
1533 Ga0070673_100247337
1534 Ga0070673_100249130
1535 Ga0070673_100345424
1536 Ga0070673_100408817
1537 Ga0070688_100107250
1538 Ga0070688_100435253
1539 Ga0070688_100529926
1540 Ga0070688_100673592
1541 Ga0070659_100044632
1542 Ga0070659_100173439
1543 Ga0070659_100263635
1544 Ga0070659_100633316
1545 Ga0070659_101077065
1546 Ga0070667_100169238
1547 Ga0070667_100266709
1548 Ga0070667_100414487
1549 Ga0070667_100627854
1550 Ga0070667_101018261
1551 Ga0070667_101055686
1552 Ga0070709_10076963
1553 Ga0070714_100154716
1554 Ga0070713_100058956
1555 Ga0070713_100405479
1556 Ga0070713_100546412
1557 Ga0070713_101104026
1558 Ga0070710_10034913
1559 Ga0070710_10119604
1560 Ga0070710_11176075
1561 Ga0070710_11306267
1562 Ga0070701_10026586
1563 Ga0070701_10085744
1564 Ga0070701_10142610
1565 Ga0070711_100106782
1566 Ga0070711_100150550
1567 Ga0070711_100489861
1568 Ga0070711_100549541
1569 Ga0070711_100719610
1570 Ga0070705_100107580
1571 Ga0070705_100127856
1572 Ga0070700_100015700
1573 Ga0070694_100281997
1574 Ga0070708_100098299
1575 Ga0070708_100111862
1576 Ga0070708_100122017
1577 Ga0070708_100870280
1578 Ga0070663_100429790
1579 Ga0070663_101035743
1580 Ga0070678_100343124
1581 Ga0070678_100419539
1582 Ga0070678_100880205
1583 Ga0070678_101038601
1584 Ga0070678_101823022
1585 Ga0070662_100300526
1586 Ga0070662_100308505
1587 Ga0070662_100681474
1588 Ga0070681_10062942
1589 Ga0070681_10277019
1590 Ga0070681_11566054
1591 Ga0068867_100023122
1592 Ga0068867_100127791
1593 Ga0068867_100763851
1594 Ga0070685_10067144
1595 Ga0070685_10189451
1596 Ga0070685_10255044
1597 Ga0070685_10319772
1598 Ga0070685_10555633
1599 Ga0070685_11195342
1600 Ga0070706_100001357
1601 Ga0070706_100209453
1602 Ga0070706_100222379
1603 Ga0070706_100681534
1604 Ga0070706_101168525
1605 Ga0070707_100058669
1606 Ga0070707_100164467
1607 Ga0070698_100000876
1608 Ga0070698_100005165
1609 Ga0070698_100040114
1610 Ga0070698_100047454
1611 Ga0070698_100050679
1612 Ga0070699_100044930
1613 Ga0070699_100354791
1614 Ga0070699_100825658
1615 Ga0070699_101276977
1616 Ga0070679_100073713
1617 Ga0070684_100570786
1618 Ga0070684_100933251
1619 Ga0070684_100966346
1620 Ga0070684_101863506
1621 Ga0070697_100069934
1622 Ga0070697_100130084
1623 Ga0070697_100278191
1624 Ga0070697_100563599
1625 Ga0070697_100610921
1626 Ga0070697_100756096
1627 Ga0068853_100192614
1628 Ga0068853_100204469
1629 Ga0068853_100751632
1630 Ga0068853_100975898
1631 Ga0068853_101377014
1632 Ga0070672_100016466
1633 Ga0070672_100334037
1634 Ga0070672_100450402
1635 Ga0070672_100815382
1636 Ga0070686_100010762
1637 Ga0070686_100053860
1638 Ga0070686_100058785
1639 Ga0070686_100106937
1640 Ga0070686_100376312
1641 Ga0070686_100855265
1642 Ga0070696_101046924
1643 Ga0070693_100506555
1644 Ga0070693_100510972
1645 Ga0070665_100736200
1646 Ga0070665_100779741
1647 Ga0068855_100002380
1648 Ga0068855_100025181
1649 Ga0068855_100058765
1650 Ga0068855_100517297
1651 Ga0070664_101662120
1652 Ga0068857_100230538
1653 Ga0068857_100279929
1654 Ga0068857_101150734
1655 Ga0068857_101547501
1656 Ga0068854_100650572
1657 Ga0068856_100000034
1658 Ga0068856_100008797
1659 Ga0068856_100140681
1660 Ga0068856_100149613
1661 Ga0068856_100218977
1662 Ga0068856_100337427
1663 Ga0070702_100133662
1664 Ga0070702_100223846
1665 Ga0070702_100350529
1666 Ga0070702_100462953
1667 Ga0070702_100548616
1668 Ga0070702_100692048
1669 Ga0070702_101066393
1670 Ga0068852_100096637
1671 Ga0068852_102121910
1672 Ga0068859_100001788
1673 Ga0068859_100096940
1674 Ga0068859_100537309
1675 Ga0068859_100617739
1676 Ga0068864_100208362
1677 Ga0068866_10008221
1678 Ga0068866_10215792
1679 Ga0068861_100017078
1680 Ga0068861_100257834
1681 Ga0068861_101713826
1682 Ga0068863_100191523
1683 Ga0068863_100520471
1684 Ga0068863_100988477
1685 Ga0068858_100043912
1686 Ga0068858_100233399
1687 Ga0068858_100367273
1688 Ga0068858_101325732
1689 Ga0068860_100348643
1690 Ga0068860_100857988
1691 Ga0068862_100214943
1692 Ga0068862_100669840
1693 Ga0068862_101245344
1694 Ga0081455_10069915
1695 Ga0081455_10109655
1696 Ga0081455_10121526
1697 Ga0081455_10197461
1698 Ga0081455_10924447
1699 Ga0081540_1040002
1700 Ga0081540_1091687
1701 Ga0081540_1155738
1702 Ga0070717_10147478
1703 Ga0070717_11817011
1704 Ga0075363_100031796
1705 Ga0075363_100274519
1706 Ga0075364_10387748
1707 Ga0070715_10217187
1708 Ga0070716_100037586
1709 Ga0070712_100811185
1710 Ga0075362_10016318
1711 Ga0075362_10030032
1712 Ga0075362_10573166
1713 Ga0075369_10461562
1714 Ga0075366_10027432
1715 Ga0075366_10033077
1716 Ga0075366_10459969
1717 Ga0075366_10611606
1718 Ga0097621_100117829
1719 Ga0097621_100194261
1720 Ga0097621_100479555
1721 Ga0097621_100683581
1722 Ga0097621_100698579
1723 Ga0075370_10014773
1724 Ga0068871_100313458
1725 Ga0068871_100514088
1726 Ga0068871_100706500
1727 Ga0068871_100801531
1728 Ga0068871_101147191
1729 Ga0068871_101518087
1730 Ga0075428_100180570
1731 Ga0075428_101442071
1732 Ga0075430_100006122
1733 Ga0075430_101413212
1734 Ga0075431_100001910
1735 Ga0075431_101035980
1736 Ga0075434_100377933
1737 Ga0075434_101125048
1738 Ga0075434_101820037
1739 Ga0075429_100093338
1740 Ga0075429_100737722
1741 Ga0075429_101636026
1742 Ga0075429_101748042
1743 Ga0068865_100003577
1744 Ga0068865_100190591
1745 Ga0068865_100567651
1746 Ga0068865_100677466
1747 Ga0097620_100001788
1748 Ga0097620_100096939
1749 Ga0097620_100537285
1750 Ga0097620_100617772
1751 Ga0097620_101233198
1752 Ga0075435_100863079
1753 Ga0099794_10259303
1754 Ga0105240_10072975
1755 Ga0105240_10094834
1756 Ga0105240_10144397
1757 Ga0105240_10616903
1758 Ga0105240_10758954
1759 Ga0105240_11307838
1760 Ga0111539_10004360
1761 Ga0111539_10071139
1762 Ga0111539_10151426
1763 Ga0111539_10737832
1764 Ga0105245_10072219
1765 Ga0105245_10365918
1766 Ga0105245_11118502
1767 Ga0105245_11573338
1768 Ga0105245_12435506
1769 Ga0105247_10000590
1770 Ga0114129_10266953
1771 Ga0114129_10606398
1772 Ga0105243_10055115
1773 Ga0105243_10731056
1774 Ga0105241_10255970
1775 Ga0105241_10823495
1776 Ga0105242_10248790
1777 Ga0105242_11300956
1778 Ga0105242_11358261
1779 Ga0105242_12015693
1780 Ga0105242_12042347
1781 Ga0105248_10126121
1782 Ga0105248_10279060
1783 Ga0105248_11359649
1784 Ga0105248_11631718
1785 Ga0105248_12647586
1786 Ga0105237_10274327
1787 Ga0105237_10505112
1788 Ga0105237_12464750
1789 Ga0105238_10034529
1790 Ga0105238_11030754
1791 Ga0105249_10368153
1792 Ga0105249_10394076
1793 Ga0105249_10628614
1794 Ga0105249_11148941
1795 Ga0105239_10028406
1796 Ga0105239_10154764
1797 Ga0105239_10436599
1798 Ga0105239_10522178
1799 Ga0105239_10605720
1800 Ga0105239_10945482
1801 Ga0105239_13338008
1802 Ga0105246_10351452
1803 Ga0105246_10499939
1804 Ga0105246_10968531
1805 Ga0105246_11196104
1806 Ga0105246_11263828
1807 Ga0157373_11387752
1808 Ga0157369_10691266
1809 Ga0157369_10695868
1810 Ga0157374_10000476
1811 Ga0157374_10014770
1812 Ga0157374_10944328
1813 Ga0157374_11001294
1814 Ga0157374_11146442
1815 Ga0157374_11176428
1816 Ga0157374_11209700
1817 Ga0157374_12491035
1818 Ga0157374_12844696
1819 Ga0157378_10006080
1820 Ga0157378_10155646
1821 Ga0157378_10362479
1822 Ga0157378_10611103
1823 Ga0157378_12250546
1824 Ga0157378_12303738
1825 Ga0157378_12398023
1826 Ga0163162_10280142
1827 Ga0163162_10386433
1828 Ga0163162_10587386
1829 Ga0163162_11078568
1830 Ga0163162_11087494
1831 Ga0163162_11900160
1832 Ga0163162_12395262
1833 Ga0157372_10867715
1834 Ga0157372_10907575
1835 Ga0157372_11323291
1836 Ga0157375_10001065
1837 Ga0157375_10356481
1838 Ga0157375_10504949
1839 Ga0157375_12261829
1840 Ga0163163_10337011
1841 Ga0163163_10545874
1842 Ga0163163_10632201
1843 Ga0163163_10742859
1844 Ga0163163_10987885
1845 Ga0163163_11026736
1846 Ga0163163_11702931
1847 Ga0163163_12261561
1848 Ga0157380_10294262
1849 Ga0157380_11398424
1850 Ga0157377_10235855
1851 Ga0157379_10551871
1852 Ga0157379_11216972
1853 Ga0157376_10298912
1854 Ga0157376_10628629
1855 Ga0157376_10750764
1856 Ga0157376_10874435
1857 Ga0157376_11011883
1858 Ga0157376_11638140
1859 Ga0157376_11658422
1860 Ga0157376_11996883
1861 Ga0163161_10122320
1862 Ga0163161_10821559
1863 Ga0206356_10010424
1864 Ga0206356_10602174
1865 Ga0206356_11494082
1866 Ga0206351_10933183
1867 Ga0206352_10724423
1868 Ga0206352_11328313
1869 Ga0206350_11274299
1870 Ga0154015_1418828
1871 Ga0213873_10113755
1872 Ga0213873_10152581
1873 Ga0213873_10209344
1874 Ga0213872_10000347
1875 Ga0213872_10019579
1876 Ga0213872_10036356
1877 Ga0213872_10143099
1878 Ga0213872_10170234
1879 Ga0213872_10235976
1880 Ga0213874_10246725
1881 Ga0213876_10000625
1882 Ga0213876_10020022
1883 Ga0213876_10022119
1884 Ga0213876_10046119
1885 Ga0213876_10080950
1886 Ga0213876_10157327
1887 Ga0213876_10241588
1888 Ga0213876_10459308
1889 Ga0213875_10209791
1890 Ga0213875_10338228
1891 Ga0213871_10013545
1892 Ga0213871_10032464
1893 Ga0213871_10047268
1894 Ga0213871_10063925
1895 Ga0207638_1004678
1896 Ga0209675_1002886
1897 Ga0209676_1007618
1898 Ga0209676_1098937
1899 Ga0209025_1000026
1900 Ga0209050_1019384
1901 Ga0209051_1013568
1902 Ga0207697_10060121
1903 Ga0207697_10157045
1904 Ga0207697_10245407
1905 Ga0207692_10118544
1906 Ga0207692_10729359
1907 Ga0207692_11167786
1908 Ga0207642_10009878
1909 Ga0207642_10495476
1910 Ga0207710_10002562
1911 Ga0207710_10720868
1912 Ga0207688_10299895
1913 Ga0207688_10363132
1914 Ga0207680_10262503
1915 Ga0207685_10172230
1916 Ga0207699_10065974
1917 Ga0207699_10923927
1918 Ga0207699_11252521
1919 Ga0207699_11353766
1920 Ga0207645_10000728
1921 Ga0207645_10169569
1922 Ga0207645_10359290
1923 Ga0207645_10502135
1924 Ga0207643_10294026
1925 Ga0207705_11448403
1926 Ga0207684_10002013
1927 Ga0207684_10127191
1928 Ga0207684_10259174
1929 Ga0207684_10456915
1930 Ga0207684_11099042
1931 Ga0207654_11326221
1932 Ga0207707_10615079
1933 Ga0207707_10841728
1934 Ga0207707_11320105
1935 Ga0207695_10000061
1936 Ga0207695_10132686
1937 Ga0207695_10175100
1938 Ga0207695_10324365
1939 Ga0207695_10478153
1940 Ga0207671_10119846
1941 Ga0207671_10269415
1942 Ga0207671_10339380
1943 Ga0207693_10651742
1944 Ga0207693_10658091
1945 Ga0207693_10795636
1946 Ga0207693_10868223
1947 Ga0207663_10048355
1948 Ga0207663_10130938
1949 Ga0207663_10274511
1950 Ga0207663_10577325
1951 Ga0207663_10905079
1952 Ga0207663_11222733
1953 Ga0207660_10308001
1954 Ga0207662_10074152
1955 Ga0207662_10104235
1956 Ga0207662_10171787
1957 Ga0207657_10085546
1958 Ga0207657_10195509
1959 Ga0207649_10000838
1960 Ga0207649_11611782
1961 Ga0207652_10160801
1962 Ga0207652_10760992
1963 Ga0207646_10038118
1964 Ga0207646_10050397
1965 Ga0207681_10026963
1966 Ga0207694_10003577
1967 Ga0207694_10481798
1968 Ga0207650_10401362
1969 Ga0207650_10472503
1970 Ga0207659_10049016
1971 Ga0207659_10195247
1972 Ga0207659_10262652
1973 Ga0207659_10302387
1974 Ga0207659_10780224
1975 Ga0207687_10041006
1976 Ga0207687_10523574
1977 Ga0207700_10019741
1978 Ga0207700_10106933
1979 Ga0207700_10640169
1980 Ga0207700_11612209
1981 Ga0207664_10493183
1982 Ga0207644_10055737
1983 Ga0207644_10364252
1984 Ga0207644_10458496
1985 Ga0207690_10076447
1986 Ga0207690_11063486
1987 Ga0207706_10034212
1988 Ga0207706_10066355
1989 Ga0207706_11011891
1990 Ga0207706_11038423
1991 Ga0207686_10144004
1992 Ga0207686_10886872
1993 Ga0207686_11186516
1994 Ga0207709_11156999
1995 Ga0207670_10005563
1996 Ga0207670_10016581
1997 Ga0207670_10021302
1998 Ga0207670_10033461
1999 Ga0207670_10042944
2000 Ga0207670_10262812
2001 Ga0207670_10686585
2002 Ga0207670_10881485
2003 Ga0207670_10943865
2004 Ga0207670_11191073
2005 Ga0207669_10012954
2006 Ga0207669_10022419
2007 Ga0207669_10131760
2008 Ga0207669_10372883
2009 Ga0207669_10442314
2010 Ga0207704_10002756
2011 Ga0207704_10029724
2012 Ga0207704_10177326
2013 Ga0207704_10479434
2014 Ga0207665_10138887
2015 Ga0207691_10052873
2016 Ga0207691_10257678
2017 Ga0207691_10307684
2018 Ga0207691_10364123
2019 Ga0207691_10668268
2020 Ga0207691_10737533
2021 Ga0207711_10053329
2022 Ga0207711_10574550
2023 Ga0207711_11104317
2024 Ga0207711_11615385
2025 Ga0207711_11814378
2026 Ga0207689_10021711
2027 Ga0207689_10031998
2028 Ga0207661_10238366
2029 Ga0207661_10511164
2030 Ga0207661_10921126
2031 Ga0207661_10990171
2032 Ga0207667_10107153
2033 Ga0207667_10122989
2034 Ga0207667_10408090
2035 Ga0207667_10708120
2036 Ga0207651_10102955
2037 Ga0207651_10127381
2038 Ga0207651_10217392
2039 Ga0207651_10546257
2040 Ga0207651_10787973
2041 Ga0207651_11162062
2042 Ga0207712_10291528
2043 Ga0207668_10113654
2044 Ga0207668_10135439
2045 Ga0207668_10574599
2046 Ga0207658_10138332
2047 Ga0207658_10181976
2048 Ga0207658_11221042
2049 Ga0207658_11623548
2050 Ga0207677_10261590
2051 Ga0207677_10279578
2052 Ga0207677_10485780
2053 Ga0207677_10573767
2054 Ga0207677_10612541
2055 Ga0207703_10005872
2056 Ga0207703_10082836
2057 Ga0207703_10222118
2058 Ga0207703_10269954
2059 Ga0207703_10711853
2060 Ga0207703_11045353
2061 Ga0207703_12010368
2062 Ga0207639_10236408
2063 Ga0207639_10617932
2064 Ga0207639_10863396
2065 Ga0207639_11151236
2066 Ga0207639_11177816
2067 Ga0207639_11324974
2068 Ga0207678_10434915
2069 Ga0207708_10003243
2070 Ga0207708_10010463
2071 Ga0207708_11776870
2072 Ga0207702_10002417
2073 Ga0207702_10005944
2074 Ga0207702_10185488
2075 Ga0207702_10652421
2076 Ga0207702_11019409
2077 Ga0207702_12408616
2078 Ga0207641_10196832
2079 Ga0207641_10199610
2080 Ga0207641_10657978
2081 Ga0207641_11502248
2082 Ga0207641_11842806
2083 Ga0207648_10016763
2084 Ga0207648_10031685
2085 Ga0207648_10600952
2086 Ga0207676_10168259
2087 Ga0207676_10592493
2088 Ga0207674_10163375
2089 Ga0207674_10233428
2090 Ga0207674_10449031
2091 Ga0207674_11907965
2092 Ga0207675_100006962
2093 Ga0207675_100016985
2094 Ga0207675_100083691
2095 Ga0207675_101039728
2096 Ga0207675_101492464
2097 Ga0207683_10017435
2098 Ga0207683_10045829
2099 Ga0207683_10146235
2100 Ga0207683_10596257
2101 Ga0207698_10050458
2102 Ga0207698_11089511
2103 Ga0207698_12179782
2104 Ga0209983_1040734
2105 Ga0209588_1140098
2106 Ga0209998_10077241
2107 Ga0209974_10022976
2108 Ga0209974_10127129
2109 Ga0207428_10012269
2110 Ga0207428_10037670
2111 Ga0207428_10111835
2112 Ga0268266_10454658
2113 Ga0268266_10720316
2114 Ga0268266_11397925
2115 Ga0268265_10110452
2116 Ga0268265_10663912
2117 Ga0268265_11211332
2118 Ga0268265_11420923
2119 Ga0268264_10000241
2120 Ga0268264_10001424
2121 Ga0268264_10167723
2122 Ga0268264_10277451
2123 Ga0268264_11074583
2124 Ga0265337_1060117
2125 Ga0265337_1176762
2126 Ga0265326_10040365
2127 Ga0265319_1001620
2128 Ga0265319_1031555
2129 Ga0265319_1140748
2130 Ga0265334_10140820
2131 Ga0265322_10023498
2132 Ga0265336_10032425
2133 Ga0265338_10000009
2134 Ga0265338_10001990
2135 Ga0265338_10017031
2136 Ga0265338_10027181
2137 Ga0265338_10115482
2138 Ga0265338_10163503
2139 Ga0265338_10285466
2140 Ga0265324_10024450
2141 Ga0265330_10006098
2142 Ga0265330_10024000
2143 Ga0265330_10362708
2144 Ga0265332_10218663
2145 Ga0265328_10005804
2146 Ga0265328_10023332
2147 Ga0265328_10320851
2148 Ga0265320_10000369
2149 Ga0265320_10008183
2150 Ga0265320_10012918
2151 Ga0265320_10494902
2152 Ga0265325_10079405
2153 Ga0265325_10096260
2154 Ga0265329_10002718
2155 Ga0265329_10092165
2156 Ga0265339_10003100
2157 Ga0265339_10326923
2158 Ga0265339_10605753
2159 Ga0265331_10212373
2160 Ga0265327_10000041
2161 Ga0265327_10001257
2162 Ga0265327_10005146
2163 Ga0265327_10034602
2164 Ga0265327_10439375
2165 Ga0265327_10445285
2166 Ga0265316_10003266
2167 Ga0265316_10034662
2168 Ga0265316_10202846
2169 Ga0265316_10269131
2170 Ga0265316_10333779
2171 Ga0265316_10888215
2172 Ga0307509_10104457
2173 Ga0265313_10193778
2174 Ga0265313_10233522
2175 Ga0265313_10257067
2176 Ga0265313_10365564
2177 Ga0316575_10004516
2178 Ga0316575_10005680
2179 Ga0316575_10015125
2180 Ga0316575_10020547
2181 Ga0316575_10084277
2182 Ga0316579_10009041
2183 Ga0316579_10145806
2184 Ga0316579_10430158
2185 Ga0316579_10599621
2186 Ga0265314_10000148
2187 Ga0265314_10017491
2188 Ga0265314_10028511
2189 Ga0265314_10060329
2190 Ga0265314_10149754
2191 Ga0265314_10213728
2192 Ga0265314_10611379
2193 Ga0265342_10000349
2194 Ga0265342_10001028
2195 Ga0265342_10033034
2196 Ga0265342_10110950
2197 Ga0316576_10043253
2198 Ga0316576_10063255
2199 Ga0316576_10246837
2200 Ga0316576_10332649
2201 Ga0316576_11079216
2202 Ga0316578_10006308
2203 Ga0316578_10006710
2204 Ga0316578_10016820
2205 Ga0316578_10042621
2206 Ga0316578_10061021
2207 Ga0316578_10178287
2208 Ga0316578_10269987
2209 Ga0316578_10375520
2210 Ga0316578_10686774
2211 Ga0316577_10001918
2212 Ga0316577_10002629
2213 Ga0316577_10025378
2214 Ga0316577_10026096
2215 Ga0307413_11161364
2216 Ga0307413_11860371
2217 Ga0307412_10002918
2218 Ga0307412_10123518
2219 Ga0307414_10556360
2220 Ga0307414_10869105
2221 Ga0316583_10000030
2222 Ga0316583_10002908
2223 Ga0316583_10009435
2224 Ga0316583_10025438
2225 Ga0316583_10060757
2226 Ga0316585_10014221
2227 Ga0316585_10017349
2228 Ga0316585_10035443
2229 Ga0316585_10063295
2230 Ga0316585_10147499
2231 Ga0316580_10005240
2232 Ga0316580_10018717
2233 Ga0316580_10031690
2234 Ga0316580_10044287
2235 Ga0316593_10005354
2236 Ga0316593_10267274
2237 Ga0316593_10307580
2238 Ga0316592_1004708
2239 Ga0316592_1013427
2240 Ga0316592_1027484
2241 Ga0316592_1050351
2242 Ga0316592_1082859
2243 Ga0316588_1005235
2244 Ga0316588_1006103
2245 Ga0316588_1116139
2246 Ga0316587_1083935
2247 Ga0316596_1007916
2248 Ga0316596_1009308
2249 Ga0316596_1042388
2250 Ga0316596_1062418
2251 Ga0316596_1081329
2252 Ga0316596_1203839
2253 Ga0373950_0000002
2254 Ga0373950_0000026
2255 Ga0373958_0007737
2256 Ga0373938_0001010
2257 Ga0373934_0062749
2258 Ga0373934_0112143
2259 Ga0373951_0057760
2260 Ga0373951_0175527
2261 Ga0373923_0101442
2262 Ga0373923_0150450
2263 Ga0373923_0276514
2264 Ga0373923_0499737
2265 Ga0373936_0122540
2266 Ga0373941_0105082
2267 Ga0373945_0194670
2268 Ga0373953_0037507
2269 Ga0373953_0074966
2270 Ga0373953_0127241
2271 Ga0373953_0142337
2272 Ga0373953_0152677
2273 Ga0373954_0004984
2274 Ga0373954_0040047
2275 Ga0373954_0073899
2276 Ga0373954_0227229
2277 Ga0373954_0508358
2278 Ga0373956_0049218
2279 Ga0373956_0117087
2280 Ga0373956_0183271
2281 Ga0373957_0046906
2282 Ga0373957_0051440
2283 Ga0373957_0062022
2284 Ga0373957_0115858
2285 Ga0373960_0432649
2286 Ga0373943_0025906
2287 Ga0373943_0170342
2288 Ga0373943_0229603
2289 Ga0373946_0014057
2290 Ga0373946_0076428
2291 Ga0373946_0274006
2292 Ga0373955_0000754
2293 Ga0373955_0098735
2294 Ga0373955_0386105
2295 Ga0373955_0435761
2296 Ga0373955_0563855
2297 Ga0373962_0218612
2298 Ga0316574_0015507
2299 Ga0316574_0025721
2300 Ga0316574_0062173
2301 Ga0316574_0078142
2302 Ga0316574_0154579
2303 Ga0316574_0204007
2304 Ga0316574_0369056
2305 Ga0316574_0389402
2306 Ga0316574_0522627
2307 Ga0373924_0055117
2308 Ga0373924_0301814
2309 Ga0373931_0367101
2310 Ga0373931_0614013
2311 Ga0373935_0028070
2312 Ga0373935_0227235
2313 Ga0373935_0271431
2314 Ga0373935_1034846
2315 Ga0373927_0228044
2316 Ga0373927_0449265
2317 Ga0373927_0465497
2318 Ga0373933_0000883
2319 Ga0373933_0006884
2320 Ga0373933_0011595
2321 Ga0373933_0049749
2322 Ga0373933_0050335
2323 Ga0373933_0060584
2324 Ga0373933_0112721
2325 Ga0373933_0356001
2326 Ga0373947_0009334
2327 Ga0373947_0036740
2328 Ga0373937_0004251
2329 Ga0373937_0006344
2330 Ga0373937_0007260
2331 Ga0373937_0011768
2332 Ga0373937_0028426
2333 Ga0373937_0110279
2334 Ga0373937_0226779
2335 Ga0373937_0303505
2336 Ga0373937_0404561
2337 Ga0373937_0456312
2338 Ga0373937_0534093
2339 Ga0373937_0634940
2340 Ga0373937_0876066
2341 Ga0373937_1009271
2342 Ga0373937_1193304
2343 Ga0316582_0000230
2344 Ga0316582_0109941
2345 Ga0316582_0117801
2346 Ga0316582_0196120
2347 Ga0316582_0989928
2348 Ga0316584_0002826
2349 Ga0316584_0053677
2350 Ga0316584_0057370
2351 Ga0316584_0185225
2352 Ga0316584_0309741
2353 Ga0316584_0887899
2354 Ga0316584_1072491
2355 Ga0373925_0042455
2356 Ga0373925_0089006
2357 Ga0373925_0390815
2358 Ga0373925_0727278
2359 Ga0395899_0000032
2360 Ga0395899_0005190
2361 Ga0395899_0751147
2362 Ga0395900_0002835
2363 Ga0395900_0076723
2364 Ga0395900_0877620
2365 Ga0395898_0000562
2366 Ga0395898_0016837
2367 Ga0395898_0283538
2368 Ga0395898_0376812
2369 Ga0316581_0020456
2370 Ga0316581_0034511
2371 Ga0316581_0087721
2372 Ga0316581_0247040
2373 Ga0436364_0122589
2374 Ga0436364_0538743
2375 Ga0436364_0771622
2376 Ga0436364_1465714
2377 Ga0436364_1553130
2378 Ga0395901_0006379
2379 Ga0395901_0980363
2380 Ga0242419_003318
2381 Ga0400483_278692
2382 Ga0436365_0001915
2383 Ga0436365_0042250
2384 Ga0436365_0774506
2385 Ga0436365_1013589
2386 Ga0436365_1150834
2387 Ga0436365_1245734
2388 Ga0436365_1370865
2389 Ga0436365_1801148
2390 Ga0436360_0220038
2391 Ga0436360_0223987
2392 Ga0436360_0469231
2393 Ga0436360_0877820
2394 Ga0436360_0997829
2395 Ga0436360_1036060
2396 Ga0436360_1224017
2397 Ga0436360_1290733
2398 Ga0436360_1324996
2399 Ga0436361_0052711
2400 Ga0436361_0192763
2401 Ga0436361_0274613
2402 Ga0436361_0300980
2403 Ga0436361_0398359
2404 Ga0436361_0422889
2405 Ga0436361_0506622
2406 Ga0436361_0516043
2407 Ga0436361_0573040
2408 Ga0436361_0645805
2409 Ga0436361_0663171
2410 Ga0436361_1140903
2411 Ga0436361_1200325
2412 Ga0436363_0298872
2413 Ga0436363_0401838
2414 Ga0436363_0971820
2415 Ga0436363_1173897
2416 Ga0436363_1239685
2417 Ga0436362_0110575
2418 Ga0436362_0439444
2419 Ga0436362_0474002
2420 Ga0436362_0490626
2421 Ga0436362_0589333
2422 Ga0436362_1019744
2423 Ga0436362_1102436
2424 Ga0436362_1136023
2425 Ga0436362_1191246
2426 Ga0439436_0043232
2427 Ga0451791_0684006
2428 Ga0451797_1064022
2429 Ga0451798_0071854
2430 Ga0451802_1233454
2431 Ga0451807_2627768
2432 Ga0451807_2723892
2433 Ga0451835_0622584
2434 Ga0451841_1289628
2435 Ga0451847_0951203
2436 Ga0451853_2232771
2437 Ga0451853_3240533
2438 Ga0451853_3276329
2439 Ga0439441_087476
2440 Ga0439460_0046463
2441 Ga0451577_0001201
2442 Ga0451577_0004733
2443 Ga0451577_0449550
2444 Ga0451577_0952751
2445 Ga0466965_0020889
2446 Ga0466966_0098676
2447 Ga0466961_0029200
2448 Ga0466961_0573313
2449 Ga0466961_0878286
2450 Ga0466963_0031403
2451 Ga0466963_0085006
2452 Ga0466963_0136287
2453 Ga0466963_0256581
2454 Ga0466963_0546748
2455 Ga0466964_0302165
2456 Ga0453684_0000204
2457 Ga0453684_0000233
2458 Ga0453684_0000395
2459 Ga0453684_0003538
2460 Ga0453684_0044880
2461 Ga0453684_0104885
2462 Ga0453684_0358166
2463 Ga0453684_0370191
2464 Ga0453684_0517930
2465 Ga0466971_0000143
2466 Ga0466971_0043904
2467 Ga0466971_0482601
2468 Ga0466970_0493080
2469 Ga0466957_0001616
2470 Ga0466957_0037279
2471 Ga0466957_0110031
2472 Ga0466957_0212539
2473 Ga0466957_0503713
2474 Ga0466957_0534802
2475 Ga0466957_0625089
2476 Ga0466959_0137962
2477 Ga0451576_0115142
2478 Ga0451576_0170285
2479 Ga0451576_0397455
2480 Ga0451576_0404911
2481 Ga0451576_2333027
2482 Ga0451576_2369268
2483 Ga0466958_0074504
2484 Ga0466958_0697350
2485 Ga0466967_0017019
2486 Ga0466967_0023166
2487 Ga0466967_0170693
2488 Ga0466967_0225603
2489 Ga0466967_0248949
2490 Ga0466967_0378829
2491 Ga0466967_0582840
2492 Ga0466967_1899630
2493 Ga0495592_0002231
2494 Ga0495592_0168792
2495 Ga0495629_0005400
2496 Ga0495641_0070658
2497 Ga0495641_0197697
2498 Ga0495651_0000479
2499 Ga0495651_0133267
2500 Ga0495651_0195293
2501 Ga0495653_0000553
2502 Ga0495653_0882418
2503 Ga0495580_0383728
2504 Ga0495639_0171251
2505 Ga0495662_0094115
2506 Ga0495664_0272233
2507 Ga0495608_0041940
2508 Ga0495618_0018351
2509 Ga0495628_0304617
2510 Ga0495630_0000031
2511 Ga0495630_0051241
2512 Ga0495630_0090765
2513 Ga0495630_0750831
2514 Ga0495666_0109132
2515 Ga0495666_0309863
2516 Ga0495652_0006143
2517 Ga0495665_0191214
2518 Ga0495665_0191530
2519 Ga0495640_0010403
2520 Ga0495640_0094391
2521 Ga0495640_0106640
2522 Ga0495586_0000016
2523 Ga0495586_0505815
2524 Ga0495587_0001125
2525 Ga0495587_0725446
2526 Ga0495645_0085446
2527 Ga0495667_0000294
2528 Ga0495667_0260068
2529 Ga0495634_0005533
2530 Ga0495634_0009460
2531 Ga0495634_0014530
2532 Ga0495635_0043029
2533 Ga0495659_0463799
2534 Ga0495657_0034867
2535 Ga0495599_0004220
2536 Ga0495623_0001907
2537 Ga0495646_0005159
2538 Ga0495647_0148177
2539 Ga0495647_0323102
2540 Ga0495613_0038952
2541 Ga0495613_0046018
2542 Ga0495613_0434073
2543 Ga0495624_0147637
2544 Ga0495600_0013933
2545 Ga0495581_0120594
2546 Ga0495581_0628137
2547 Ga0495604_0000972
2548 Ga0495674_0000794
2549 Ga0495674_0009055
2550 Ga0495674_0031840
2551 Ga0495674_1218225
2552 Ga0495676_0003977
2553 Ga0495676_0030408
2554 Ga0495680_0038540
2555 Ga0495680_0108359
2556 Ga0495680_0133996
2557 Ga0495680_0324271
2558 Ga0495680_0414552
2559 Ga0495675_0003250
2560 Ga0495602_0002877
2561 Ga0496100_0092489
2562 Ga0496100_0289827
2563 Ga0496101_0010734
2564 Ga0496101_0027488
2565 Ga0496101_0177952
2566 Ga0496101_1197310
2567 Ga0496101_1600073
2568 Ga0496102_0405159
2569 Ga0496102_0849946
2570 Ga0496102_1277333
2571 Ga0496102_1551061
2572 Ga0496104_0006037
2573 Ga0496104_0029328
2574 Ga0496104_0200827
2575 Ga0496104_0551223
2576 Ga0496104_0663416
2577 Ga0496105_0126084
2578 Ga0496105_0318189
2579 Ga0496105_0471461
2580 Ga0496106_0089817
2581 Ga0496106_0588382
2582 Ga0496107_0148931
2583 Ga0496107_0164274
2584 Ga0496107_0597950
2585 Ga0496108_0018851
2586 Ga0496108_0306006
2587 Ga0496109_0080539
2588 Ga0496109_1204842
2589 Ga0496109_1259607
2590 Ga0496109_1494100
2591 Ga0496110_1495194
2592 Ga0496112_0144189
2593 Ga0496112_0659158
2594 Ga0496114_0000692
2595 Ga0496114_0018457
2596 Ga0496114_0094991
2597 Ga0496114_0269421
2598 Ga0496115_0014290
2599 Ga0496115_0023739
2600 Ga0496115_0400262
2601 Ga0496115_0406273
2602 Ga0496116_0052029
2603 Ga0496121_0016881
2604 Ga0496121_0396663
2605 Ga0496122_0000033
2606 Ga0496122_0178195
2607 Ga0496123_0001288
2608 Ga0496124_0104999
2609 Ga0496125_0076706
2610 Ga0496125_0346203
2611 Ga0496126_0080482
2612 Ga0496126_1244478
2613 Ga0501292_129782
2614 Ga0501031_0000794
2615 Ga0501031_0009384
2616 Ga0501031_0030953
2617 Ga0501031_0043485
2618 Ga0501031_0091029
2619 Ga0501032_0000452
2620 Ga0501032_0015323
2621 Ga0501032_0036934
2622 Ga0501032_0186755
2623 Ga0501032_0387006
2624 Ga0501032_0405716
2625 Ga0501032_0419677
2626 Ga0501032_0898940
2627 Ga0501033_0000002
2628 Ga0501033_0000047
2629 Ga0501033_0012368
2630 Ga0501033_0031661
2631 Ga0501034_0000037
2632 Ga0501034_0022604
2633 Ga0501034_0045667
2634 Ga0501034_0180281
2635 Ga0501034_0190313
2636 Ga0501034_0190567
2637 Ga0501034_0232724
2638 Ga0501034_0241274
2639 Ga0501034_1121876
2640 Ga0501034_1130912
2641 Ga0501036_0004348
2642 Ga0501036_0012199
2643 Ga0501036_0023743
2644 Ga0501036_0038730
2645 Ga0501036_0243882
2646 Ga0501036_0624664
2647 Ga0501036_1372976
2648 Ga0501037_0000062
2649 Ga0501037_0002406
2650 Ga0501037_0016989
2651 Ga0501037_0040539
2652 Ga0501037_0130081
2653 Ga0501037_0337086
2654 Ga0501038_0002285
2655 Ga0501038_0017420
2656 Ga0501038_0032242
2657 Ga0501038_0057491
2658 Ga0501038_0268723
2659 Ga0501039_0008291
2660 Ga0501039_0070100
2661 Ga0501039_0082292
2662 Ga0501039_0328142
2663 Ga0501039_1089868
2664 Ga0501040_0000563
2665 Ga0501040_0182522
2666 Ga0501041_0010892
2667 Ga0501042_0004644
2668 Ga0501042_0311889
2669 Ga0501043_0009436
2670 Ga0501043_0032969
2671 Ga0501043_0043062
2672 Ga0501043_0082598
2673 Ga0501043_0178962
2674 Ga0501043_0266065
2675 Ga0501043_0463265
2676 Ga0501046_0001437
2677 Ga0501046_0002418
2678 Ga0501046_0168014
2679 Ga0501046_0285606
2680 Ga0501046_0359852
2681 Ga0501046_0630260
2682 Ga0501047_0000196
2683 Ga0501047_0006607
2684 Ga0501047_0086353
2685 Ga0501047_0134699
2686 Ga0501047_0141632
2687 Ga0501047_0149352
2688 Ga0501047_0180467
2689 Ga0501047_0229035
2690 Ga0501047_1020609
2691 Ga0501048_0003354
2692 Ga0501048_0035217
2693 Ga0501048_0049380
2694 Ga0501048_0125951
2695 Ga0501067_0000136
2696 Ga0501067_0002058
2697 Ga0501067_0031592
2698 Ga0501067_0035197
2699 Ga0501067_0044332
2700 Ga0501067_0054602
2701 Ga0501067_0069227
2702 Ga0501068_0001264
2703 Ga0501068_0002516
2704 Ga0501068_0021786
2705 Ga0501068_0066828
2706 Ga0501068_0132669
2707 Ga0501068_0242817
2708 Ga0501068_0574553
2709 Ga0501068_0722885
2710 Ga0501068_1139207
2711 Ga0501069_0019936
2712 Ga0501069_0025853
2713 Ga0501069_0052493
2714 Ga0501069_0111610
2715 Ga0501069_0369879
2716 Ga0501070_0000061
2717 Ga0501070_0000512
2718 Ga0501070_0000879
2719 Ga0501070_0002718
2720 Ga0501070_0021671
2721 Ga0501070_0040516
2722 Ga0501070_0084981
2723 Ga0501070_0114030
2724 Ga0501070_0127555
2725 Ga0501070_0150756
2726 Ga0501070_0195633
2727 Ga0501070_0205693
2728 Ga0501070_0690935
2729 Ga0501071_0220422
2730 Ga0501071_0414866
2731 Ga0501071_0778895
2732 Ga0501071_1264820
2733 Ga0501072_0000056
2734 Ga0501072_0211242
2735 Ga0501072_0581205
2736 Ga0501072_0634131
2737 Ga0501072_1031680
2738 Ga0501073_0004075
2739 Ga0501073_0004822
2740 Ga0501073_0007233
2741 Ga0501073_0008138
2742 Ga0501073_0011070
2743 Ga0501073_0011649
2744 Ga0501073_0019426
2745 Ga0501073_0027784
2746 Ga0501073_0038022
2747 Ga0501073_0060571
2748 Ga0501073_0300338
2749 Ga0501073_0485602
2750 Ga0501073_0608519
2751 Ga0501073_1070245
2752 Ga0501074_0001374
2753 Ga0501074_0020736
2754 Ga0501074_0025498
2755 Ga0501074_0028177
2756 Ga0501074_0337092
2757 Ga0501074_0637317
2758 Ga0501075_0002074
2759 Ga0501075_0009705
2760 Ga0501075_0156125
2761 Ga0501076_0019636
2762 Ga0501076_0094759
2763 Ga0501076_1153810
2764 Ga0501077_0005722
2765 Ga0501257_042582
2766 Ga0501261_010538
2767 Ga0501079_0000667
2768 Ga0501079_0001786
2769 Ga0501079_0010702
2770 Ga0501079_0079896
2771 Ga0501079_0957268
2772 Ga0501079_1335188
2773 Ga0501080_0000918
2774 Ga0501080_0004727
2775 Ga0501080_0007246
2776 Ga0501080_0009445
2777 Ga0501080_0019975
2778 Ga0501080_0028886
2779 Ga0501080_0043113
2780 Ga0501080_0160234
2781 Ga0501080_0361791
2782 Ga0501080_1571893
2783 Ga0501080_1623738
2784 Ga0501081_0002255
2785 Ga0501081_0124541
2786 Ga0501081_0167350
2787 Ga0501083_0004962
2788 Ga0501083_0012182
2789 Ga0501083_0018307
2790 Ga0501083_0035312
2791 Ga0501083_0181286
2792 Ga0501083_0198180
2793 Ga0501083_0251858
2794 Ga0501083_0280144
2795 Ga0501083_0600726
2796 Ga0501273_061016
2797 Ga0501035_0000004
2798 Ga0501035_0014804
2799 Ga0501035_0015102
2800 Ga0501035_0016208
2801 Ga0501035_0053797
2802 Ga0501035_0221044
2803 Ga0501035_0302317
2804 Ga0501044_0001842
2805 Ga0501044_0003422
2806 Ga0501044_0018367
2807 Ga0501044_0041848
2808 Ga0501044_0297746
2809 Ga0501044_0418236
2810 Ga0501044_0660314
2811 Ga0501044_1302007
2812 Ga0501044_1453271
2813 Ga0501044_1665581
2814 Ga0501045_0004093
2815 Ga0501045_0352186
2816 Ga0501045_1009827
2817 nmdc:mga03683_314502_c1
2818 nmdc:mga03683_419792_c1
2819 nmdc:mga03683_88_c3
2820 nmdc:mga03n38_146491_c1
2821 nmdc:mga03n38_2587_c1
2822 nmdc:mga00v17_386360_c1
2823 nmdc:mga0k408_170717_c1
2824 nmdc:mga0k408_1872_c1
2825 nmdc:mga0k408_528900_c1
2826 nmdc:mga0k408_7601_c1
2827 nmdc:mga07m45_3477_c2
2828 nmdc:mga05p37_1253825_c1
2829 nmdc:mga05p37_944370_c1
2830 nmdc:mga09592_1218876_c1
2831 nmdc:mga09592_42047_c1
2832 nmdc:mga09592_495402_c1
2833 nmdc:mga0qj67_13329_c1
2834 nmdc:mga06r32_80572_c1
2835 nmdc:mga08y16_1038150_c1
2836 nmdc:mga08y16_1165_c1
2837 nmdc:mga08y16_128186_c1
2838 nmdc:mga08y16_1438360_c1
2839 nmdc:mga08y16_4368_c1
2840 nmdc:mga08y16_639304_c1
2841 nmdc:mga0n895_275031_c1
2842 nmdc:mga0n895_750370_c1
2843 nmdc:mga08x19_250758_c1
2844 nmdc:mga08x19_38494_c1
2845 nmdc:mga08x19_569890_c1
2846 nmdc:mga0a205_625493_c1
2847 nmdc:mga0a205_853177_c1
2848 Ga0495601_0001493
2849 Ga0495601_0086291
2850 Ga0495601_0204424
2851 Ga0495601_0411743
2852 Ga0495601_0434103
2853 Ga0495612_0069407
2854 Ga0500610_0032474
2855 Ga0495595_0004500
2856 Ga0495595_0576303
2857 Ga0495619_0000426
2858 Ga0495619_0242014
2859 Ga0495619_0551485
2860 Ga0495619_1077370
2861 Ga0500650_0068730
2862 Ga0500555_000343
2863 Ga0500556_0000010
2864 Ga0500556_0180298
2865 Ga0500593_000072
2866 Ga0500642_0029459
2867 Ga0500642_0060231
2868 Ga0500655_019853
2869 Ga0500655_032811
2870 Ga0500616_0002331
2871 Ga0500616_0023759
2872 Ga0500645_065720
2873 Ga0501084_0000544
2874 Ga0501084_0006037
2875 Ga0501084_0029390
2876 Ga0501084_0374514
2877 Ga0501084_0485450
2878 Ga0587080_003782
2879 Ga0587080_033958
2880 Ga0587083_0045829
2881 Ga0587067_053055
2882 Ga0587076_117983
2883 Ga0587079_050777
2884 Ga0587071_005154
2885 Ga0587111_0063772
2886 Ga0501082_0005564
2887 Ga0501082_0011143
2888 Ga0501082_0017087
2889 Ga0501082_0037852
2890 Ga0501082_0039727
2891 Ga0501082_0041755
2892 Ga0501082_0124040
2893 Ga0501082_0136997
2894 Ga0501082_0801022
2895 Ga0501082_0972126
2896 Ga0466962_0017640
2897 Ga0466962_0036578
2898 Ga0466962_0109327
2899 Ga0530510_0027093
2900 Ga0530510_0066938
2901 Ga0530510_0395563
2902 2787508105

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

1

109

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l9n-assembly1.cif.gz_A structure of uridylylated glnb from escherichia coli bound to atp 0.9957 1 108
6yc7-assembly1.cif.gz_F structure of adenylylated c. glutamicum glnk 0.9921 1 112
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9902 1 108
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9895 1 112
7p4y-assembly4.cif.gz_K glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a 0.9883 2 112
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9782 1 111 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9697 2 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9683 1 111 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9412 2 108 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9368 2 112 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A2U1T6E6-F1-model_v4 P-II family nitrogen regulator 0.9565 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9443 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1F7F2C5-F1-model_v4 Transcriptional regulator 0.9386 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.935 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A517TUK5-F1-model_v4 Nitrogen regulatory protein P-II 0.9303 1 107 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Map