F494073
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1453 | 402 | 2906 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300046463|Ga0495653_0101722|Ga0495653_0101722_395_1324 |
| Length | 309 |
| Sequence | MVTSVIGPYRIHRGPATSTCTRGGDPARDSVSDDGRINVTSTPVELHVVSDATGETAARLVQALEAQFPEQDFVEIRHPRVESEEDLHLAVQRMKGRPAVVVYTLVEPELRDVMRTLCRRAKLHYCDLLGQPIDAVARVSGMAARMTPGSRPPLNSAYFKRMEAIEFAVRFDDGVGRGLHDADLVLVGVSRTSKTPLSIYLGYLGHKSANVPVVKGIDPPAELFEVDARKIVGLTIDPNRLVEIRRARVRTMGARNRQYAELMEIYEELDQAGKLHRRLGCPVIDISELSIEETAHRVLRVLEERKSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 197 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 218 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 243 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 244 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 248 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 249 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 250 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 251 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 252 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 253 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 254 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 255 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 256 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 257 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 260 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 261 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 262 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 341 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 376 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 393 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 394 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 396 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 397 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 398 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 399 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 400 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 401 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
| 402 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.48 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.62 |
| Nodule | 0 |
| Rhizoplane | 7.36 |
| Rhizosphere | 91.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495653_0101722 | 3300046463 | Bacteria | 2081 |
| 2 | ARcpr5yngRDRAFT_c001560 | 3300000043 | Bacteria | 2512 |
| 3 | ARCol0yngRDRAFT_1001932 | 3300000652 | Bacteria | 1617 |
| 4 | JGI24738J21930_10006797 | 3300002075 | Bacteria | 2658 |
| 5 | JGI25406J46586_10004849 | 3300003203 | Bacteria | 6254 |
| 6 | Ga0070658_10013411 | 3300005327 | Bacteria | 6576 |
| 7 | Ga0070658_10018785 | 3300005327 | Bacteria | 5537 |
| 8 | Ga0070658_10043711 | 3300005327 | Bacteria | 3619 |
| 9 | Ga0070658_10061400 | 3300005327 | Bacteria | 3062 |
| 10 | Ga0070658_10445281 | 3300005327 | Bacteria | 1116 |
| 11 | Ga0070683_100007979 | 3300005329 | Bacteria | 8982 |
| 12 | Ga0070683_100023740 | 3300005329 | Bacteria | 5488 |
| 13 | Ga0070683_100026029 | 3300005329 | Bacteria | 5262 |
| 14 | Ga0070683_100027711 | 3300005329 | Bacteria | 5112 |
| 15 | Ga0070683_100031027 | 3300005329 | Bacteria | 4856 |
| 16 | Ga0070683_100048768 | 3300005329 | Bacteria | 3915 |
| 17 | Ga0070683_100062549 | 3300005329 | Bacteria | 3461 |
| 18 | Ga0070683_100074737 | 3300005329 | Bacteria | 3165 |
| 19 | Ga0070683_100074925 | 3300005329 | Bacteria | 3161 |
| 20 | Ga0070683_100075352 | 3300005329 | Bacteria | 3152 |
| 21 | Ga0070683_100116585 | 3300005329 | Bacteria | 2522 |
| 22 | Ga0070683_100162115 | 3300005329 | Bacteria | 2122 |
| 23 | Ga0068869_100061782 | 3300005334 | Bacteria | 2748 |
| 24 | Ga0068869_100089146 | 3300005334 | Bacteria | 2316 |
| 25 | Ga0070680_100012131 | 3300005336 | Bacteria | 6691 |
| 26 | Ga0070680_100013107 | 3300005336 | Bacteria | 6452 |
| 27 | Ga0070680_100025693 | 3300005336 | Bacteria | 4708 |
| 28 | Ga0070680_100028503 | 3300005336 | Bacteria | 4479 |
| 29 | Ga0070680_100039793 | 3300005336 | Bacteria | 3804 |
| 30 | Ga0070680_100240542 | 3300005336 | Bacteria | 1530 |
| 31 | Ga0070680_100436595 | 3300005336 | Bacteria | 1118 |
| 32 | Ga0070682_100018579 | 3300005337 | Bacteria | 4068 |
| 33 | Ga0070682_100084371 | 3300005337 | Bacteria | 2064 |
| 34 | Ga0070682_100373803 | 3300005337 | Bacteria | 1070 |
| 35 | Ga0068868_100016548 | 3300005338 | Bacteria | 5480 |
| 36 | Ga0068868_100045119 | 3300005338 | Bacteria | 3448 |
| 37 | Ga0068868_100093422 | 3300005338 | Bacteria | 2426 |
| 38 | Ga0068868_100108360 | 3300005338 | Bacteria | 2255 |
| 39 | Ga0070660_100001270 | 3300005339 | Bacteria | 17212 |
| 40 | Ga0070660_100002970 | 3300005339 | Bacteria | 11669 |
| 41 | Ga0070660_100004773 | 3300005339 | Bacteria | 9376 |
| 42 | Ga0070660_100008078 | 3300005339 | Bacteria | 7354 |
| 43 | Ga0070660_100019082 | 3300005339 | Bacteria | 5019 |
| 44 | Ga0070660_100026497 | 3300005339 | Bacteria | 4316 |
| 45 | Ga0070660_100049188 | 3300005339 | Bacteria | 3241 |
| 46 | Ga0070660_100242717 | 3300005339 | Bacteria | 1468 |
| 47 | Ga0070689_100051063 | 3300005340 | Bacteria | 3195 |
| 48 | Ga0070689_100318797 | 3300005340 | Bacteria | 1297 |
| 49 | Ga0070661_100014382 | 3300005344 | Bacteria | 5575 |
| 50 | Ga0070661_100021080 | 3300005344 | Bacteria | 4653 |
| 51 | Ga0070661_100079935 | 3300005344 | Bacteria | 2413 |
| 52 | Ga0070661_100152079 | 3300005344 | Bacteria | 1750 |
| 53 | Ga0070692_10022387 | 3300005345 | Bacteria | 3086 |
| 54 | Ga0070692_10133081 | 3300005345 | Bacteria | 1400 |
| 55 | Ga0070668_100178246 | 3300005347 | Bacteria | 1734 |
| 56 | Ga0070669_100276956 | 3300005353 | Bacteria | 1343 |
| 57 | Ga0070675_100019446 | 3300005354 | Bacteria | 5413 |
| 58 | Ga0070675_100049643 | 3300005354 | Bacteria | 3444 |
| 59 | Ga0070675_100059076 | 3300005354 | Bacteria | 3163 |
| 60 | Ga0070671_100525919 | 3300005355 | Bacteria | 1019 |
| 61 | Ga0070674_100009486 | 3300005356 | Bacteria | 5827 |
| 62 | Ga0070674_100018240 | 3300005356 | Bacteria | 4433 |
| 63 | Ga0070674_100022885 | 3300005356 | Bacteria | 4034 |
| 64 | Ga0070673_100131355 | 3300005364 | Bacteria | 2101 |
| 65 | Ga0070673_100155301 | 3300005364 | Bacteria | 1941 |
| 66 | Ga0070688_100033025 | 3300005365 | Bacteria | 3126 |
| 67 | Ga0070688_100067988 | 3300005365 | Bacteria | 2271 |
| 68 | Ga0070659_100004348 | 3300005366 | Bacteria | 10111 |
| 69 | Ga0070659_100059048 | 3300005366 | Bacteria | 3028 |
| 70 | Ga0070659_100073431 | 3300005366 | Bacteria | 2723 |
| 71 | Ga0070667_100273594 | 3300005367 | Bacteria | 1515 |
| 72 | Ga0070709_10019052 | 3300005434 | Bacteria | 3960 |
| 73 | Ga0070709_10164819 | 3300005434 | Bacteria | 1544 |
| 74 | Ga0070714_100006895 | 3300005435 | Bacteria | 8807 |
| 75 | Ga0070714_100048294 | 3300005435 | Bacteria | 3620 |
| 76 | Ga0070714_100063589 | 3300005435 | Bacteria | 3174 |
| 77 | Ga0070714_100091138 | 3300005435 | Bacteria | 2670 |
| 78 | Ga0070714_100121260 | 3300005435 | Bacteria | 2326 |
| 79 | Ga0070714_100189324 | 3300005435 | Bacteria | 1877 |
| 80 | Ga0070714_100636391 | 3300005435 | Bacteria | 1026 |
| 81 | Ga0070714_100683034 | 3300005435 | Bacteria | 990 |
| 82 | Ga0070713_100021324 | 3300005436 | Bacteria | 4980 |
| 83 | Ga0070713_100088924 | 3300005436 | Bacteria | 2652 |
| 84 | Ga0070713_100091943 | 3300005436 | Bacteria | 2611 |
| 85 | Ga0070713_100140398 | 3300005436 | Bacteria | 2139 |
| 86 | Ga0070713_100460947 | 3300005436 | Bacteria | 1195 |
| 87 | Ga0070710_10008029 | 3300005437 | Bacteria | 5131 |
| 88 | Ga0070710_10020278 | 3300005437 | Bacteria | 3446 |
| 89 | Ga0070701_10005086 | 3300005438 | Bacteria | 5400 |
| 90 | Ga0070701_10013945 | 3300005438 | Bacteria | 3671 |
| 91 | Ga0070711_100010821 | 3300005439 | Bacteria | 5656 |
| 92 | Ga0070711_100032405 | 3300005439 | Bacteria | 3474 |
| 93 | Ga0070705_100053749 | 3300005440 | Bacteria | 2359 |
| 94 | Ga0070705_100162481 | 3300005440 | Bacteria | 1494 |
| 95 | Ga0070700_100033017 | 3300005441 | Bacteria | 3115 |
| 96 | Ga0070700_100119688 | 3300005441 | Bacteria | 1762 |
| 97 | Ga0070700_100170488 | 3300005441 | Bacteria | 1507 |
| 98 | Ga0070700_100198483 | 3300005441 | Bacteria | 1408 |
| 99 | Ga0070700_100235615 | 3300005441 | Bacteria | 1305 |
| 100 | Ga0070694_100198247 | 3300005444 | Bacteria | 1495 |
| 101 | Ga0070694_100472233 | 3300005444 | Bacteria | 994 |
| 102 | Ga0070708_100008593 | 3300005445 | Bacteria | 8204 |
| 103 | Ga0070708_100249305 | 3300005445 | Bacteria | 1668 |
| 104 | Ga0070708_100316606 | 3300005445 | Bacteria | 1470 |
| 105 | Ga0070708_100339476 | 3300005445 | Bacteria | 1416 |
| 106 | Ga0070708_100380464 | 3300005445 | Bacteria | 1331 |
| 107 | Ga0070663_100534394 | 3300005455 | Bacteria | 978 |
| 108 | Ga0070678_100015134 | 3300005456 | Bacteria | 4892 |
| 109 | Ga0070678_100252796 | 3300005456 | Bacteria | 1478 |
| 110 | Ga0070678_100263824 | 3300005456 | Bacteria | 1450 |
| 111 | Ga0070662_100009840 | 3300005457 | Bacteria | 6264 |
| 112 | Ga0070681_10000752 | 3300005458 | Bacteria | 26939 |
| 113 | Ga0070681_10002017 | 3300005458 | Bacteria | 18379 |
| 114 | Ga0070681_10005681 | 3300005458 | Bacteria | 12054 |
| 115 | Ga0070681_10017532 | 3300005458 | Bacteria | 7157 |
| 116 | Ga0070681_10021069 | 3300005458 | Bacteria | 6531 |
| 117 | Ga0070681_10034642 | 3300005458 | Bacteria | 5070 |
| 118 | Ga0070681_10049180 | 3300005458 | Bacteria | 4212 |
| 119 | Ga0070681_10074259 | 3300005458 | Bacteria | 3361 |
| 120 | Ga0070681_10136638 | 3300005458 | Bacteria | 2382 |
| 121 | Ga0070681_10183804 | 3300005458 | Bacteria | 2011 |
| 122 | Ga0070681_10203641 | 3300005458 | Bacteria | 1897 |
| 123 | Ga0070681_10231856 | 3300005458 | Bacteria | 1761 |
| 124 | Ga0068867_100311158 | 3300005459 | Bacteria | 1302 |
| 125 | Ga0068867_100364188 | 3300005459 | Bacteria | 1210 |
| 126 | Ga0070685_10098142 | 3300005466 | Bacteria | 1784 |
| 127 | Ga0070685_10115425 | 3300005466 | Bacteria | 1660 |
| 128 | Ga0070706_100046490 | 3300005467 | Bacteria | 4007 |
| 129 | Ga0070707_100001941 | 3300005468 | Bacteria | 19855 |
| 130 | Ga0070698_100032412 | 3300005471 | Bacteria | 5413 |
| 131 | Ga0070698_100048670 | 3300005471 | Bacteria | 4332 |
| 132 | Ga0070698_100126618 | 3300005471 | Bacteria | 2511 |
| 133 | Ga0070698_100193803 | 3300005471 | Bacteria | 1969 |
| 134 | Ga0070699_100239827 | 3300005518 | Bacteria | 1618 |
| 135 | Ga0070679_100009888 | 3300005530 | Bacteria | 9024 |
| 136 | Ga0070679_100067836 | 3300005530 | Bacteria | 3558 |
| 137 | Ga0070679_100085797 | 3300005530 | Bacteria | 3135 |
| 138 | Ga0070679_100096997 | 3300005530 | Bacteria | 2936 |
| 139 | Ga0070679_100124849 | 3300005530 | Bacteria | 2557 |
| 140 | Ga0070679_100140712 | 3300005530 | Bacteria | 2393 |
| 141 | Ga0070679_100149211 | 3300005530 | Bacteria | 2316 |
| 142 | Ga0070679_100176236 | 3300005530 | Bacteria | 2111 |
| 143 | Ga0070679_100179857 | 3300005530 | Bacteria | 2087 |
| 144 | Ga0070684_100001782 | 3300005535 | Bacteria | 15731 |
| 145 | Ga0070684_100003376 | 3300005535 | Bacteria | 11964 |
| 146 | Ga0070684_100009691 | 3300005535 | Bacteria | 7599 |
| 147 | Ga0070684_100035656 | 3300005535 | Bacteria | 4259 |
| 148 | Ga0070684_100047239 | 3300005535 | Bacteria | 3730 |
| 149 | Ga0070684_100063523 | 3300005535 | Bacteria | 3237 |
| 150 | Ga0070684_100071670 | 3300005535 | Bacteria | 3049 |
| 151 | Ga0070684_100261980 | 3300005535 | Bacteria | 1582 |
| 152 | Ga0070684_100372737 | 3300005535 | Bacteria | 1314 |
| 153 | Ga0070684_100393035 | 3300005535 | Bacteria | 1278 |
| 154 | Ga0068853_100039110 | 3300005539 | Bacteria | 4045 |
| 155 | Ga0068853_100069845 | 3300005539 | Bacteria | 3057 |
| 156 | Ga0068853_100258566 | 3300005539 | Bacteria | 1600 |
| 157 | Ga0068853_100298428 | 3300005539 | Bacteria | 1489 |
| 158 | Ga0070672_100012805 | 3300005543 | Bacteria | 5905 |
| 159 | Ga0070672_100015600 | 3300005543 | Bacteria | 5416 |
| 160 | Ga0070672_100082732 | 3300005543 | Bacteria | 2575 |
| 161 | Ga0070686_100057330 | 3300005544 | Bacteria | 2502 |
| 162 | Ga0070686_100256980 | 3300005544 | Bacteria | 1279 |
| 163 | Ga0070695_100000023 | 3300005545 | Bacteria | 60293 |
| 164 | Ga0070695_100246276 | 3300005545 | Bacteria | 1299 |
| 165 | Ga0070693_100041430 | 3300005547 | Bacteria | 2591 |
| 166 | Ga0070665_100049773 | 3300005548 | Bacteria | 4204 |
| 167 | Ga0070665_100196199 | 3300005548 | Bacteria | 2020 |
| 168 | Ga0070665_100532895 | 3300005548 | Bacteria | 1186 |
| 169 | Ga0070704_100083154 | 3300005549 | Bacteria | 2363 |
| 170 | Ga0070704_100189513 | 3300005549 | Bacteria | 1652 |
| 171 | Ga0070704_100379892 | 3300005549 | Bacteria | 1200 |
| 172 | Ga0068855_100019546 | 3300005563 | Bacteria | 8137 |
| 173 | Ga0068855_100037023 | 3300005563 | Bacteria | 5805 |
| 174 | Ga0068855_100039368 | 3300005563 | Bacteria | 5612 |
| 175 | Ga0068855_100148972 | 3300005563 | Bacteria | 2661 |
| 176 | Ga0068855_100429807 | 3300005563 | Bacteria | 1444 |
| 177 | Ga0068855_100435032 | 3300005563 | Bacteria | 1433 |
| 178 | Ga0068855_100551088 | 3300005563 | Bacteria | 1248 |
| 179 | Ga0070664_100029659 | 3300005564 | Bacteria | 4562 |
| 180 | Ga0070664_100061027 | 3300005564 | Bacteria | 3212 |
| 181 | Ga0070664_100324830 | 3300005564 | Bacteria | 1395 |
| 182 | Ga0070664_100330458 | 3300005564 | Bacteria | 1383 |
| 183 | Ga0070664_100504061 | 3300005564 | Bacteria | 1116 |
| 184 | Ga0068857_100024365 | 3300005577 | Bacteria | 5326 |
| 185 | Ga0068857_100186917 | 3300005577 | Bacteria | 1886 |
| 186 | Ga0068857_100237857 | 3300005577 | Bacteria | 1667 |
| 187 | Ga0068857_100354762 | 3300005577 | Bacteria | 1358 |
| 188 | Ga0068854_100228497 | 3300005578 | Bacteria | 1476 |
| 189 | Ga0068856_100038589 | 3300005614 | Bacteria | 4688 |
| 190 | Ga0068856_100048431 | 3300005614 | Bacteria | 4188 |
| 191 | Ga0068856_100417581 | 3300005614 | Bacteria | 1362 |
| 192 | Ga0068856_100723401 | 3300005614 | Bacteria | 1016 |
| 193 | Ga0070702_100012658 | 3300005615 | Bacteria | 4236 |
| 194 | Ga0070702_100036693 | 3300005615 | Bacteria | 2717 |
| 195 | Ga0070702_100065963 | 3300005615 | Bacteria | 2121 |
| 196 | Ga0068852_100004659 | 3300005616 | Bacteria | 9722 |
| 197 | Ga0068852_100072151 | 3300005616 | Bacteria | 3034 |
| 198 | Ga0068852_100144118 | 3300005616 | Bacteria | 2208 |
| 199 | Ga0068852_100185191 | 3300005616 | Bacteria | 1960 |
| 200 | Ga0068852_100297929 | 3300005616 | Bacteria | 1560 |
| 201 | Ga0068852_100427408 | 3300005616 | Bacteria | 1307 |
| 202 | Ga0068859_100038770 | 3300005617 | Bacteria | 4780 |
| 203 | Ga0068864_100059174 | 3300005618 | Bacteria | 3314 |
| 204 | Ga0068864_100375601 | 3300005618 | Bacteria | 1346 |
| 205 | Ga0068861_100494376 | 3300005719 | Unclassified | 1104 |
| 206 | Ga0068851_10024703 | 3300005834 | Bacteria | 2943 |
| 207 | Ga0068851_10077983 | 3300005834 | Bacteria | 1725 |
| 208 | Ga0068870_10052517 | 3300005840 | Bacteria | 2161 |
| 209 | Ga0068870_10063406 | 3300005840 | Bacteria | 1993 |
| 210 | Ga0068863_100323597 | 3300005841 | Bacteria | 1498 |
| 211 | Ga0068858_100388864 | 3300005842 | Bacteria | 1339 |
| 212 | Ga0068858_100821870 | 3300005842 | Viruses | 907 |
| 213 | Ga0068862_100240533 | 3300005844 | Bacteria | 1646 |
| 214 | Ga0081455_10040530 | 3300005937 | Bacteria | 4105 |
| 215 | Ga0081455_10068251 | 3300005937 | Bacteria | 2960 |
| 216 | Ga0081455_10072222 | 3300005937 | Bacteria | 2858 |
| 217 | Ga0081538_10066949 | 3300005981 | Unclassified | 2009 |
| 218 | Ga0081539_10000041 | 3300005985 | Bacteria | 292660 |
| 219 | Ga0081539_10002453 | 3300005985 | Bacteria | 26142 |
| 220 | Ga0081539_10002628 | 3300005985 | Bacteria | 24558 |
| 221 | Ga0081539_10038724 | 3300005985 | Bacteria | 2821 |
| 222 | Ga0070717_10008772 | 3300006028 | Bacteria | 7569 |
| 223 | Ga0070717_10026780 | 3300006028 | Bacteria | 4603 |
| 224 | Ga0070717_10035751 | 3300006028 | Bacteria | 4025 |
| 225 | Ga0070717_10061585 | 3300006028 | Bacteria | 3110 |
| 226 | Ga0070717_10072567 | 3300006028 | Bacteria | 2874 |
| 227 | Ga0070717_10074096 | 3300006028 | Bacteria | 2845 |
| 228 | Ga0070717_10113236 | 3300006028 | Bacteria | 2316 |
| 229 | Ga0075365_10022759 | 3300006038 | Bacteria | 3931 |
| 230 | Ga0075364_10009313 | 3300006051 | Bacteria | 5885 |
| 231 | Ga0075432_10012221 | 3300006058 | Bacteria | 2919 |
| 232 | Ga0075432_10028172 | 3300006058 | Bacteria | 1937 |
| 233 | Ga0070712_100040492 | 3300006175 | Bacteria | 3195 |
| 234 | Ga0070712_100111583 | 3300006175 | Bacteria | 2042 |
| 235 | Ga0075367_10139092 | 3300006178 | Bacteria | 1504 |
| 236 | Ga0097621_100136874 | 3300006237 | Bacteria | 2090 |
| 237 | Ga0097621_100348369 | 3300006237 | Bacteria | 1317 |
| 238 | Ga0068871_100073973 | 3300006358 | Bacteria | 2810 |
| 239 | Ga0075428_100001880 | 3300006844 | Bacteria | 22518 |
| 240 | Ga0075428_100097985 | 3300006844 | Bacteria | 3196 |
| 241 | Ga0075428_100571757 | 3300006844 | Bacteria | 1208 |
| 242 | Ga0075428_100658881 | 3300006844 | Unclassified | 1116 |
| 243 | Ga0075428_100752410 | 3300006844 | Bacteria | 1037 |
| 244 | Ga0075430_100006634 | 3300006846 | Bacteria | 9758 |
| 245 | Ga0075430_100011301 | 3300006846 | Bacteria | 7571 |
| 246 | Ga0075431_100050926 | 3300006847 | Bacteria | 4270 |
| 247 | Ga0075431_100242987 | 3300006847 | Bacteria | 1831 |
| 248 | Ga0075433_10003720 | 3300006852 | Bacteria | 11807 |
| 249 | Ga0075433_10041277 | 3300006852 | Bacteria | 3996 |
| 250 | Ga0075433_10211594 | 3300006852 | Bacteria | 1723 |
| 251 | Ga0075434_100002257 | 3300006871 | Bacteria | 16857 |
| 252 | Ga0075434_100006179 | 3300006871 | Bacteria | 10965 |
| 253 | Ga0075434_100086779 | 3300006871 | Unclassified | 3130 |
| 254 | Ga0075429_100302782 | 3300006880 | Unclassified | 1399 |
| 255 | Ga0068865_100008889 | 3300006881 | Bacteria | 6216 |
| 256 | Ga0068865_100077185 | 3300006881 | Bacteria | 2380 |
| 257 | Ga0068865_100137542 | 3300006881 | Bacteria | 1838 |
| 258 | Ga0068865_100160025 | 3300006881 | Bacteria | 1717 |
| 259 | Ga0097620_100038771 | 3300006931 | Bacteria | 4780 |
| 260 | Ga0105240_10026332 | 3300009093 | Bacteria | 7630 |
| 261 | Ga0105240_10032019 | 3300009093 | Bacteria | 6810 |
| 262 | Ga0105240_10049190 | 3300009093 | Bacteria | 5323 |
| 263 | Ga0105240_10156264 | 3300009093 | Bacteria | 2712 |
| 264 | Ga0105240_10222520 | 3300009093 | Bacteria | 2198 |
| 265 | Ga0105240_10465486 | 3300009093 | Bacteria | 1412 |
| 266 | Ga0111539_10027469 | 3300009094 | Bacteria | 6951 |
| 267 | Ga0111539_10132647 | 3300009094 | Bacteria | 2917 |
| 268 | Ga0111539_10180174 | 3300009094 | Bacteria | 2468 |
| 269 | Ga0111539_10202140 | 3300009094 | Bacteria | 2317 |
| 270 | Ga0111539_10377886 | 3300009094 | Bacteria | 1649 |
| 271 | Ga0111539_10504323 | 3300009094 | Unclassified | 1409 |
| 272 | Ga0111539_10531028 | 3300009094 | Bacteria | 1371 |
| 273 | Ga0105245_10012463 | 3300009098 | Bacteria | 7398 |
| 274 | Ga0105245_10041920 | 3300009098 | Bacteria | 4082 |
| 275 | Ga0105245_10071158 | 3300009098 | Bacteria | 3158 |
| 276 | Ga0105245_10102280 | 3300009098 | Bacteria | 2653 |
| 277 | Ga0105245_10409154 | 3300009098 | Bacteria | 1357 |
| 278 | Ga0114129_10009794 | 3300009147 | Bacteria | 13667 |
| 279 | Ga0114129_10012617 | 3300009147 | Bacteria | 12031 |
| 280 | Ga0114129_10352007 | 3300009147 | Bacteria | 1951 |
| 281 | Ga0114129_10398914 | 3300009147 | Bacteria | 1813 |
| 282 | Ga0105243_10004975 | 3300009148 | Bacteria | 10419 |
| 283 | Ga0105243_10030521 | 3300009148 | Bacteria | 4150 |
| 284 | Ga0105243_10150105 | 3300009148 | Bacteria | 1998 |
| 285 | Ga0105243_10198560 | 3300009148 | Bacteria | 1757 |
| 286 | Ga0105243_10213015 | 3300009148 | Bacteria | 1702 |
| 287 | Ga0105243_10227638 | 3300009148 | Bacteria | 1652 |
| 288 | Ga0105243_10324685 | 3300009148 | Unclassified | 1404 |
| 289 | Ga0105243_10453114 | 3300009148 | Bacteria | 1204 |
| 290 | Ga0105241_10083627 | 3300009174 | Bacteria | 2504 |
| 291 | Ga0105241_10351046 | 3300009174 | Bacteria | 1281 |
| 292 | Ga0105242_10012764 | 3300009176 | Bacteria | 6470 |
| 293 | Ga0105242_10027204 | 3300009176 | Bacteria | 4539 |
| 294 | Ga0105248_10083024 | 3300009177 | Bacteria | 3604 |
| 295 | Ga0105248_10158946 | 3300009177 | Bacteria | 2550 |
| 296 | Ga0105248_10198029 | 3300009177 | Bacteria | 2263 |
| 297 | Ga0105237_10019801 | 3300009545 | Bacteria | 6948 |
| 298 | Ga0105237_10399339 | 3300009545 | Bacteria | 1379 |
| 299 | Ga0105237_10467088 | 3300009545 | Bacteria | 1268 |
| 300 | Ga0105238_10008930 | 3300009551 | Bacteria | 10031 |
| 301 | Ga0105249_10167999 | 3300009553 | Bacteria | 2125 |
| 302 | Ga0105249_10446111 | 3300009553 | Unclassified | 1332 |
| 303 | Ga0105239_10031224 | 3300010375 | Bacteria | 5860 |
| 304 | Ga0105239_10114954 | 3300010375 | Bacteria | 2985 |
| 305 | Ga0105239_10204940 | 3300010375 | Bacteria | 2210 |
| 306 | Ga0105246_10068750 | 3300011119 | Bacteria | 2485 |
| 307 | Ga0105246_10188411 | 3300011119 | Bacteria | 1595 |
| 308 | Ga0105246_10192987 | 3300011119 | Bacteria | 1578 |
| 309 | Ga0157373_10039361 | 3300013100 | Bacteria | 3385 |
| 310 | Ga0157373_10102298 | 3300013100 | Bacteria | 2016 |
| 311 | Ga0157373_10219677 | 3300013100 | Bacteria | 1340 |
| 312 | Ga0157371_10018805 | 3300013102 | Bacteria | 5104 |
| 313 | Ga0157371_10481985 | 3300013102 | Bacteria | 914 |
| 314 | Ga0157370_10013444 | 3300013104 | Bacteria | 8431 |
| 315 | Ga0157370_10165689 | 3300013104 | Bacteria | 2055 |
| 316 | Ga0157370_10175342 | 3300013104 | Bacteria | 1993 |
| 317 | Ga0157370_10176999 | 3300013104 | Bacteria | 1982 |
| 318 | Ga0157370_10197999 | 3300013104 | Unclassified | 1864 |
| 319 | Ga0157370_10292920 | 3300013104 | Bacteria | 1503 |
| 320 | Ga0157369_10002254 | 3300013105 | Bacteria | 23183 |
| 321 | Ga0157369_10003310 | 3300013105 | Bacteria | 19150 |
| 322 | Ga0157369_10036038 | 3300013105 | Bacteria | 5423 |
| 323 | Ga0157369_10085918 | 3300013105 | Bacteria | 3361 |
| 324 | Ga0157369_10114868 | 3300013105 | Bacteria | 2859 |
| 325 | Ga0157369_10144649 | 3300013105 | Bacteria | 2514 |
| 326 | Ga0157369_10202132 | 3300013105 | Bacteria | 2085 |
| 327 | Ga0157369_10673251 | 3300013105 | Bacteria | 1066 |
| 328 | Ga0157369_10907587 | 3300013105 | Bacteria | 903 |
| 329 | Ga0157374_10186668 | 3300013296 | Bacteria | 2027 |
| 330 | Ga0157378_10444291 | 3300013297 | Bacteria | 1286 |
| 331 | Ga0157378_10453109 | 3300013297 | Bacteria | 1274 |
| 332 | Ga0163162_10175701 | 3300013306 | Bacteria | 2267 |
| 333 | Ga0157372_10009212 | 3300013307 | Bacteria | 10495 |
| 334 | Ga0157372_10011672 | 3300013307 | Bacteria | 9353 |
| 335 | Ga0157372_10052151 | 3300013307 | Bacteria | 4554 |
| 336 | Ga0157372_10078327 | 3300013307 | Bacteria | 3734 |
| 337 | Ga0157372_10134440 | 3300013307 | Bacteria | 2847 |
| 338 | Ga0157372_10141729 | 3300013307 | Bacteria | 2770 |
| 339 | Ga0157372_10172119 | 3300013307 | Bacteria | 2505 |
| 340 | Ga0157372_10199540 | 3300013307 | Bacteria | 2317 |
| 341 | Ga0157372_10346660 | 3300013307 | Bacteria | 1730 |
| 342 | Ga0157375_10012073 | 3300013308 | Bacteria | 7651 |
| 343 | Ga0157375_10041504 | 3300013308 | Bacteria | 4443 |
| 344 | Ga0157375_10206595 | 3300013308 | Bacteria | 2120 |
| 345 | Ga0157375_10798551 | 3300013308 | Bacteria | 1092 |
| 346 | Ga0163163_10023740 | 3300014325 | Bacteria | 5825 |
| 347 | Ga0163163_10406745 | 3300014325 | Bacteria | 1419 |
| 348 | Ga0163163_10424123 | 3300014325 | Bacteria | 1389 |
| 349 | Ga0163163_10963334 | 3300014325 | Bacteria | 916 |
| 350 | Ga0157380_10009015 | 3300014326 | Bacteria | 7126 |
| 351 | Ga0157380_10245130 | 3300014326 | Bacteria | 1618 |
| 352 | Ga0157380_10517452 | 3300014326 | Bacteria | 1163 |
| 353 | Ga0182008_10006559 | 3300014497 | Bacteria | 6498 |
| 354 | Ga0157377_10135199 | 3300014745 | Bacteria | 1510 |
| 355 | Ga0157379_10398832 | 3300014968 | Bacteria | 1264 |
| 356 | Ga0157379_10566514 | 3300014968 | Bacteria | 1058 |
| 357 | Ga0157379_10717581 | 3300014968 | Bacteria | 939 |
| 358 | Ga0157376_10042942 | 3300014969 | Bacteria | 3709 |
| 359 | Ga0157376_10109271 | 3300014969 | Bacteria | 2431 |
| 360 | Ga0157376_10121033 | 3300014969 | Bacteria | 2319 |
| 361 | Ga0157376_10175331 | 3300014969 | Bacteria | 1955 |
| 362 | Ga0182007_10004120 | 3300015262 | Bacteria | 6673 |
| 363 | Ga0163161_10047334 | 3300017792 | Bacteria | 3106 |
| 364 | Ga0163161_10182995 | 3300017792 | Unclassified | 1608 |
| 365 | Ga0163161_10446385 | 3300017792 | Unclassified | 1045 |
| 366 | Ga0197907_11381384 | 3300020069 | Bacteria | 1471 |
| 367 | Ga0206356_11704696 | 3300020070 | Bacteria | 2083 |
| 368 | Ga0206353_10444029 | 3300020082 | Bacteria | 6434 |
| 369 | Ga0206353_10792442 | 3300020082 | Bacteria | 5196 |
| 370 | Ga0206353_11628412 | 3300020082 | Bacteria | 3434 |
| 371 | Ga0206353_11919948 | 3300020082 | Bacteria | 2754 |
| 372 | Ga0206353_12056300 | 3300020082 | Bacteria | 4331 |
| 373 | Ga0213876_10084567 | 3300021384 | Bacteria | 1679 |
| 374 | Ga0209675_1008561 | 3300025291 | Bacteria | 3738 |
| 375 | Ga0209025_1009986 | 3300025294 | Bacteria | 6506 |
| 376 | Ga0207656_10022214 | 3300025321 | Bacteria | 2543 |
| 377 | Ga0207692_10181249 | 3300025898 | Bacteria | 1227 |
| 378 | Ga0207642_10011450 | 3300025899 | Bacteria | 3165 |
| 379 | Ga0207688_10058884 | 3300025901 | Bacteria | 2162 |
| 380 | Ga0207685_10038664 | 3300025905 | Bacteria | 1766 |
| 381 | Ga0207699_10116782 | 3300025906 | Bacteria | 1719 |
| 382 | Ga0207699_10265645 | 3300025906 | Bacteria | 1187 |
| 383 | Ga0207643_10003437 | 3300025908 | Bacteria | 8518 |
| 384 | Ga0207643_10046494 | 3300025908 | Bacteria | 2454 |
| 385 | Ga0207643_10091724 | 3300025908 | Bacteria | 1772 |
| 386 | Ga0207705_10015230 | 3300025909 | Bacteria | 5524 |
| 387 | Ga0207705_10047775 | 3300025909 | Bacteria | 3078 |
| 388 | Ga0207705_10067379 | 3300025909 | Bacteria | 2590 |
| 389 | Ga0207705_10189102 | 3300025909 | Bacteria | 1556 |
| 390 | Ga0207705_10204340 | 3300025909 | Unclassified | 1497 |
| 391 | Ga0207705_10299831 | 3300025909 | Bacteria | 1232 |
| 392 | Ga0207684_10056734 | 3300025910 | Bacteria | 3323 |
| 393 | Ga0207654_10240471 | 3300025911 | Bacteria | 1210 |
| 394 | Ga0207707_10028744 | 3300025912 | Bacteria | 4858 |
| 395 | Ga0207707_10029462 | 3300025912 | Bacteria | 4799 |
| 396 | Ga0207707_10030859 | 3300025912 | Bacteria | 4688 |
| 397 | Ga0207707_10044254 | 3300025912 | Bacteria | 3882 |
| 398 | Ga0207707_10049108 | 3300025912 | Bacteria | 3676 |
| 399 | Ga0207707_10094757 | 3300025912 | Bacteria | 2609 |
| 400 | Ga0207707_10128936 | 3300025912 | Bacteria | 2212 |
| 401 | Ga0207707_10153119 | 3300025912 | Bacteria | 2016 |
| 402 | Ga0207707_10192254 | 3300025912 | Bacteria | 1780 |
| 403 | Ga0207707_10223533 | 3300025912 | Bacteria | 1639 |
| 404 | Ga0207707_10269011 | 3300025912 | Bacteria | 1477 |
| 405 | Ga0207707_10450330 | 3300025912 | Bacteria | 1102 |
| 406 | Ga0207695_10027775 | 3300025913 | Bacteria | 6295 |
| 407 | Ga0207695_10065253 | 3300025913 | Bacteria | 3743 |
| 408 | Ga0207695_10735808 | 3300025913 | Unclassified | 866 |
| 409 | Ga0207695_10745573 | 3300025913 | Bacteria | 860 |
| 410 | Ga0207693_10000945 | 3300025915 | Bacteria | 26054 |
| 411 | Ga0207693_10003076 | 3300025915 | Bacteria | 14390 |
| 412 | Ga0207693_10010892 | 3300025915 | Bacteria | 7376 |
| 413 | Ga0207663_10130380 | 3300025916 | Bacteria | 1736 |
| 414 | Ga0207663_10221507 | 3300025916 | Bacteria | 1377 |
| 415 | Ga0207660_10023887 | 3300025917 | Bacteria | 4133 |
| 416 | Ga0207660_10037361 | 3300025917 | Bacteria | 3383 |
| 417 | Ga0207660_10041411 | 3300025917 | Bacteria | 3227 |
| 418 | Ga0207660_10049435 | 3300025917 | Bacteria | 2981 |
| 419 | Ga0207660_10054308 | 3300025917 | Bacteria | 2859 |
| 420 | Ga0207660_10056165 | 3300025917 | Bacteria | 2816 |
| 421 | Ga0207660_10067458 | 3300025917 | Bacteria | 2591 |
| 422 | Ga0207660_10243537 | 3300025917 | Bacteria | 1417 |
| 423 | Ga0207662_10012577 | 3300025918 | Bacteria | 4715 |
| 424 | Ga0207662_10077167 | 3300025918 | Bacteria | 2026 |
| 425 | Ga0207662_10155322 | 3300025918 | Bacteria | 1458 |
| 426 | Ga0207662_10324935 | 3300025918 | Bacteria | 1028 |
| 427 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 428 | Ga0207657_10000651 | 3300025919 | Bacteria | 36939 |
| 429 | Ga0207657_10000941 | 3300025919 | Bacteria | 30830 |
| 430 | Ga0207657_10003420 | 3300025919 | Bacteria | 16946 |
| 431 | Ga0207657_10007679 | 3300025919 | Bacteria | 11024 |
| 432 | Ga0207657_10011480 | 3300025919 | Bacteria | 8795 |
| 433 | Ga0207657_10028514 | 3300025919 | Bacteria | 5091 |
| 434 | Ga0207657_10075509 | 3300025919 | Bacteria | 2844 |
| 435 | Ga0207657_10087118 | 3300025919 | Bacteria | 2613 |
| 436 | Ga0207657_10200218 | 3300025919 | Bacteria | 1607 |
| 437 | Ga0207649_10023773 | 3300025920 | Bacteria | 3553 |
| 438 | Ga0207649_10048373 | 3300025920 | Bacteria | 2622 |
| 439 | Ga0207649_10337633 | 3300025920 | Bacteria | 1111 |
| 440 | Ga0207652_10008146 | 3300025921 | Bacteria | 8415 |
| 441 | Ga0207652_10011668 | 3300025921 | Bacteria | 7089 |
| 442 | Ga0207652_10025098 | 3300025921 | Bacteria | 4952 |
| 443 | Ga0207652_10084158 | 3300025921 | Bacteria | 2786 |
| 444 | Ga0207652_10088562 | 3300025921 | Bacteria | 2716 |
| 445 | Ga0207652_10107482 | 3300025921 | Bacteria | 2471 |
| 446 | Ga0207652_10150283 | 3300025921 | Bacteria | 2085 |
| 447 | Ga0207652_10250250 | 3300025921 | Bacteria | 1598 |
| 448 | Ga0207646_10185298 | 3300025922 | Bacteria | 1880 |
| 449 | Ga0207694_10132985 | 3300025924 | Bacteria | 1995 |
| 450 | Ga0207650_10148446 | 3300025925 | Bacteria | 1848 |
| 451 | Ga0207659_10042506 | 3300025926 | Bacteria | 3187 |
| 452 | Ga0207659_10333485 | 3300025926 | Bacteria | 1255 |
| 453 | Ga0207687_10024068 | 3300025927 | Bacteria | 4064 |
| 454 | Ga0207687_10054803 | 3300025927 | Bacteria | 2791 |
| 455 | Ga0207687_10140152 | 3300025927 | Bacteria | 1834 |
| 456 | Ga0207700_10014992 | 3300025928 | Bacteria | 5095 |
| 457 | Ga0207700_10057152 | 3300025928 | Bacteria | 2941 |
| 458 | Ga0207700_10103980 | 3300025928 | Bacteria | 2271 |
| 459 | Ga0207700_10227987 | 3300025928 | Bacteria | 1582 |
| 460 | Ga0207700_10406349 | 3300025928 | Bacteria | 1194 |
| 461 | Ga0207664_10016621 | 3300025929 | Bacteria | 5373 |
| 462 | Ga0207664_10031203 | 3300025929 | Bacteria | 4076 |
| 463 | Ga0207664_10043861 | 3300025929 | Bacteria | 3500 |
| 464 | Ga0207664_10071700 | 3300025929 | Bacteria | 2791 |
| 465 | Ga0207664_10103770 | 3300025929 | Bacteria | 2353 |
| 466 | Ga0207664_10107472 | 3300025929 | Bacteria | 2315 |
| 467 | Ga0207664_10218969 | 3300025929 | Bacteria | 1650 |
| 468 | Ga0207664_10386387 | 3300025929 | Bacteria | 1243 |
| 469 | Ga0207644_10111211 | 3300025931 | Bacteria | 2072 |
| 470 | Ga0207644_10305694 | 3300025931 | Bacteria | 1283 |
| 471 | Ga0207690_10415490 | 3300025932 | Bacteria | 1075 |
| 472 | Ga0207706_10019795 | 3300025933 | Bacteria | 6050 |
| 473 | Ga0207706_10030969 | 3300025933 | Bacteria | 4769 |
| 474 | Ga0207686_10030300 | 3300025934 | Bacteria | 3201 |
| 475 | Ga0207686_10043788 | 3300025934 | Bacteria | 2745 |
| 476 | Ga0207686_10252095 | 3300025934 | Unclassified | 1290 |
| 477 | Ga0207709_10005525 | 3300025935 | Bacteria | 7171 |
| 478 | Ga0207709_10023230 | 3300025935 | Bacteria | 3527 |
| 479 | Ga0207709_10146909 | 3300025935 | Bacteria | 1628 |
| 480 | Ga0207670_10086416 | 3300025936 | Bacteria | 2207 |
| 481 | Ga0207669_10004592 | 3300025937 | Bacteria | 6094 |
| 482 | Ga0207669_10155017 | 3300025937 | Bacteria | 1610 |
| 483 | Ga0207669_10175806 | 3300025937 | Bacteria | 1529 |
| 484 | Ga0207669_10228737 | 3300025937 | Bacteria | 1370 |
| 485 | Ga0207669_10270898 | 3300025937 | Unclassified | 1275 |
| 486 | Ga0207704_10095032 | 3300025938 | Bacteria | 1970 |
| 487 | Ga0207704_10250984 | 3300025938 | Bacteria | 1328 |
| 488 | Ga0207665_10000197 | 3300025939 | Bacteria | 40246 |
| 489 | Ga0207665_10406097 | 3300025939 | Bacteria | 1038 |
| 490 | Ga0207691_10003481 | 3300025940 | Bacteria | 15326 |
| 491 | Ga0207691_10039570 | 3300025940 | Bacteria | 4361 |
| 492 | Ga0207691_10041699 | 3300025940 | Bacteria | 4236 |
| 493 | Ga0207691_10361930 | 3300025940 | Bacteria | 1240 |
| 494 | Ga0207711_10054853 | 3300025941 | Bacteria | 3421 |
| 495 | Ga0207711_10178001 | 3300025941 | Bacteria | 1933 |
| 496 | Ga0207711_10299756 | 3300025941 | Bacteria | 1482 |
| 497 | Ga0207711_10417577 | 3300025941 | Bacteria | 1248 |
| 498 | Ga0207689_10037755 | 3300025942 | Bacteria | 4004 |
| 499 | Ga0207689_10085743 | 3300025942 | Bacteria | 2589 |
| 500 | Ga0207661_10003452 | 3300025944 | Bacteria | 10972 |
| 501 | Ga0207661_10010909 | 3300025944 | Bacteria | 6560 |
| 502 | Ga0207661_10042119 | 3300025944 | Bacteria | 3599 |
| 503 | Ga0207661_10052106 | 3300025944 | Bacteria | 3268 |
| 504 | Ga0207661_10089150 | 3300025944 | Bacteria | 2565 |
| 505 | Ga0207661_10104997 | 3300025944 | Bacteria | 2380 |
| 506 | Ga0207661_10289643 | 3300025944 | Bacteria | 1465 |
| 507 | Ga0207679_10070915 | 3300025945 | Bacteria | 2627 |
| 508 | Ga0207679_10254826 | 3300025945 | Bacteria | 1494 |
| 509 | Ga0207679_10288637 | 3300025945 | Bacteria | 1410 |
| 510 | Ga0207667_10064335 | 3300025949 | Bacteria | 3830 |
| 511 | Ga0207667_10170277 | 3300025949 | Bacteria | 2238 |
| 512 | Ga0207667_10181639 | 3300025949 | Bacteria | 2160 |
| 513 | Ga0207667_10364629 | 3300025949 | Bacteria | 1473 |
| 514 | Ga0207651_10015042 | 3300025960 | Bacteria | 4485 |
| 515 | Ga0207712_10479766 | 3300025961 | Unclassified | 1060 |
| 516 | Ga0207668_10270192 | 3300025972 | Bacteria | 1390 |
| 517 | Ga0207640_10247489 | 3300025981 | Bacteria | 1381 |
| 518 | Ga0207658_10101190 | 3300025986 | Bacteria | 2258 |
| 519 | Ga0207677_10167841 | 3300026023 | Bacteria | 1713 |
| 520 | Ga0207677_10190043 | 3300026023 | Bacteria | 1623 |
| 521 | Ga0207703_10088798 | 3300026035 | Bacteria | 2595 |
| 522 | Ga0207678_10164022 | 3300026067 | Bacteria | 1897 |
| 523 | Ga0207678_10203479 | 3300026067 | Bacteria | 1693 |
| 524 | Ga0207708_10012056 | 3300026075 | Bacteria | 6443 |
| 525 | Ga0207708_10035717 | 3300026075 | Bacteria | 3782 |
| 526 | Ga0207708_10091858 | 3300026075 | Bacteria | 2341 |
| 527 | Ga0207708_10237858 | 3300026075 | Bacteria | 1464 |
| 528 | Ga0207702_10025541 | 3300026078 | Bacteria | 4904 |
| 529 | Ga0207702_10136192 | 3300026078 | Bacteria | 2216 |
| 530 | Ga0207702_10386350 | 3300026078 | Bacteria | 1347 |
| 531 | Ga0207641_10271733 | 3300026088 | Bacteria | 1591 |
| 532 | Ga0207648_10060466 | 3300026089 | Bacteria | 3304 |
| 533 | Ga0207648_10199573 | 3300026089 | Bacteria | 1774 |
| 534 | Ga0207676_10040863 | 3300026095 | Bacteria | 3557 |
| 535 | Ga0207674_10007806 | 3300026116 | Bacteria | 12443 |
| 536 | Ga0207674_10059480 | 3300026116 | Bacteria | 3866 |
| 537 | Ga0207674_10062121 | 3300026116 | Bacteria | 3773 |
| 538 | Ga0207674_10083993 | 3300026116 | Bacteria | 3183 |
| 539 | Ga0207674_10181180 | 3300026116 | Bacteria | 2058 |
| 540 | Ga0207674_10357134 | 3300026116 | Bacteria | 1413 |
| 541 | Ga0207674_10481678 | 3300026116 | Bacteria | 1199 |
| 542 | Ga0207683_10012269 | 3300026121 | Bacteria | 7314 |
| 543 | Ga0207683_10051997 | 3300026121 | Bacteria | 3589 |
| 544 | Ga0207683_10064686 | 3300026121 | Bacteria | 3223 |
| 545 | Ga0207683_10067965 | 3300026121 | Bacteria | 3144 |
| 546 | Ga0207683_10075870 | 3300026121 | Bacteria | 2976 |
| 547 | Ga0207683_10147150 | 3300026121 | Bacteria | 2125 |
| 548 | Ga0207683_10218442 | 3300026121 | Bacteria | 1736 |
| 549 | Ga0207683_10320280 | 3300026121 | Bacteria | 1420 |
| 550 | Ga0207683_10548550 | 3300026121 | Bacteria | 1069 |
| 551 | Ga0207698_10024923 | 3300026142 | Bacteria | 4204 |
| 552 | Ga0207698_10065002 | 3300026142 | Bacteria | 2862 |
| 553 | Ga0207698_10065032 | 3300026142 | Bacteria | 2862 |
| 554 | Ga0207698_10309576 | 3300026142 | Bacteria | 1474 |
| 555 | Ga0207428_10001345 | 3300027907 | Bacteria | 26175 |
| 556 | Ga0207428_10021309 | 3300027907 | Bacteria | 5489 |
| 557 | Ga0207428_10209318 | 3300027907 | Bacteria | 1466 |
| 558 | Ga0268266_10140235 | 3300028379 | Bacteria | 2169 |
| 559 | Ga0268266_10167876 | 3300028379 | Bacteria | 1990 |
| 560 | Ga0268265_10172190 | 3300028380 | Bacteria | 1852 |
| 561 | Ga0268264_10141833 | 3300028381 | Bacteria | 2143 |
| 562 | Ga0265337_1061408 | 3300028556 | Bacteria | 1041 |
| 563 | Ga0265319_1000592 | 3300028563 | Bacteria | 24262 |
| 564 | Ga0265319_1039322 | 3300028563 | Bacteria | 1604 |
| 565 | Ga0265334_10038841 | 3300028573 | Bacteria | 1870 |
| 566 | Ga0265334_10065932 | 3300028573 | Bacteria | 1356 |
| 567 | Ga0265318_10000219 | 3300028577 | Bacteria | 49788 |
| 568 | Ga0265318_10009436 | 3300028577 | Bacteria | 4291 |
| 569 | Ga0265318_10010276 | 3300028577 | Bacteria | 4085 |
| 570 | Ga0265318_10032204 | 3300028577 | Bacteria | 2030 |
| 571 | Ga0265318_10069439 | 3300028577 | Bacteria | 1306 |
| 572 | Ga0265318_10100064 | 3300028577 | Bacteria | 1067 |
| 573 | Ga0265323_10038956 | 3300028653 | Bacteria | 1734 |
| 574 | Ga0265322_10002803 | 3300028654 | Bacteria | 5324 |
| 575 | Ga0265322_10014176 | 3300028654 | Bacteria | 2305 |
| 576 | Ga0265336_10003156 | 3300028666 | Bacteria | 6557 |
| 577 | Ga0265336_10023958 | 3300028666 | Bacteria | 1932 |
| 578 | Ga0265338_10003549 | 3300028800 | Bacteria | 21805 |
| 579 | Ga0265338_10017781 | 3300028800 | Bacteria | 7643 |
| 580 | Ga0265338_10036006 | 3300028800 | Bacteria | 4745 |
| 581 | Ga0265338_10059739 | 3300028800 | Bacteria | 3356 |
| 582 | Ga0265338_10070945 | 3300028800 | Bacteria | 2983 |
| 583 | Ga0265338_10104127 | 3300028800 | Bacteria | 2303 |
| 584 | Ga0265338_10408001 | 3300028800 | Bacteria | 967 |
| 585 | Ga0265324_10005981 | 3300029957 | Bacteria | 5151 |
| 586 | Ga0265330_10036426 | 3300031235 | Bacteria | 2193 |
| 587 | Ga0265332_10019305 | 3300031238 | Bacteria | 3008 |
| 588 | Ga0265328_10005682 | 3300031239 | Bacteria | 5327 |
| 589 | Ga0265320_10029161 | 3300031240 | Bacteria | 2857 |
| 590 | Ga0265325_10000443 | 3300031241 | Bacteria | 29809 |
| 591 | Ga0265325_10035895 | 3300031241 | Bacteria | 2629 |
| 592 | Ga0265329_10017899 | 3300031242 | Bacteria | 2431 |
| 593 | Ga0265340_10001255 | 3300031247 | Bacteria | 14573 |
| 594 | Ga0265340_10020769 | 3300031247 | Bacteria | 3371 |
| 595 | Ga0265340_10070179 | 3300031247 | Bacteria | 1662 |
| 596 | Ga0265340_10120106 | 3300031247 | Bacteria | 1210 |
| 597 | Ga0265340_10126452 | 3300031247 | Unclassified | 1174 |
| 598 | Ga0265339_10017400 | 3300031249 | Bacteria | 4259 |
| 599 | Ga0265331_10038599 | 3300031250 | Bacteria | 2334 |
| 600 | Ga0265331_10085512 | 3300031250 | Bacteria | 1461 |
| 601 | Ga0265327_10007162 | 3300031251 | Bacteria | 8694 |
| 602 | Ga0265327_10009396 | 3300031251 | Bacteria | 7060 |
| 603 | Ga0265327_10103559 | 3300031251 | Bacteria | 1369 |
| 604 | Ga0265316_10004108 | 3300031344 | Bacteria | 14573 |
| 605 | Ga0265316_10019150 | 3300031344 | Bacteria | 5861 |
| 606 | Ga0265316_10024864 | 3300031344 | Bacteria | 5005 |
| 607 | Ga0265316_10059063 | 3300031344 | Bacteria | 2984 |
| 608 | Ga0307408_100022016 | 3300031548 | Bacteria | 4324 |
| 609 | Ga0307408_100471827 | 3300031548 | Bacteria | 1093 |
| 610 | Ga0265313_10006965 | 3300031595 | Bacteria | 7844 |
| 611 | Ga0265313_10013100 | 3300031595 | Bacteria | 5004 |
| 612 | Ga0265314_10004663 | 3300031711 | Bacteria | 12592 |
| 613 | Ga0265314_10028527 | 3300031711 | Bacteria | 4160 |
| 614 | Ga0265314_10308812 | 3300031711 | Unclassified | 884 |
| 615 | Ga0307405_10191883 | 3300031731 | Bacteria | 1476 |
| 616 | Ga0307405_10232169 | 3300031731 | Unclassified | 1361 |
| 617 | Ga0307413_10212974 | 3300031824 | Unclassified | 1405 |
| 618 | Ga0307413_10239100 | 3300031824 | Bacteria | 1339 |
| 619 | Ga0307410_10257359 | 3300031852 | Unclassified | 1360 |
| 620 | Ga0307406_10023579 | 3300031901 | Bacteria | 3663 |
| 621 | Ga0307406_10065311 | 3300031901 | Bacteria | 2365 |
| 622 | Ga0307412_10030495 | 3300031911 | Bacteria | 3396 |
| 623 | Ga0307409_100070066 | 3300031995 | Bacteria | 2782 |
| 624 | Ga0307416_100004274 | 3300032002 | Bacteria | 8578 |
| 625 | Ga0307411_10084052 | 3300032005 | Bacteria | 2201 |
| 626 | Ga0307415_100000048 | 3300032126 | Bacteria | 51694 |
| 627 | Ga0307415_100028119 | 3300032126 | Bacteria | 3572 |
| 628 | Ga0307415_100055652 | 3300032126 | Bacteria | 2708 |
| 629 | Ga0307415_100097749 | 3300032126 | Unclassified | 2144 |
| 630 | Ga0316583_10020213 | 3300032133 | Bacteria | 2386 |
| 631 | Ga0373944_0006564 | 3300035089 | Bacteria | 3091 |
| 632 | Ga0373949_0015995 | 3300035090 | Bacteria | 1680 |
| 633 | Ga0373936_0066570 | 3300035113 | Bacteria | 1479 |
| 634 | Ga0373941_0080140 | 3300035115 | Bacteria | 1101 |
| 635 | Ga0373945_0002311 | 3300035116 | Bacteria | 5968 |
| 636 | Ga0373956_0034778 | 3300035119 | Bacteria | 2220 |
| 637 | Ga0373956_0072900 | 3300035119 | Bacteria | 1569 |
| 638 | Ga0373956_0121223 | 3300035119 | Unclassified | 1221 |
| 639 | Ga0373943_0000101 | 3300035170 | Bacteria | 31609 |
| 640 | Ga0373943_0000290 | 3300035170 | Bacteria | 20818 |
| 641 | Ga0373946_0002224 | 3300035171 | Bacteria | 6842 |
| 642 | Ga0373946_0023494 | 3300035171 | Bacteria | 2409 |
| 643 | Ga0373955_0165172 | 3300035172 | Bacteria | 1308 |
| 644 | Ga0373942_0057547 | 3300035207 | Bacteria | 1106 |
| 645 | Ga0373924_0029322 | 3300035410 | Bacteria | 2199 |
| 646 | Ga0373931_0043124 | 3300035691 | Bacteria | 2374 |
| 647 | Ga0373931_0103259 | 3300035691 | Bacteria | 1607 |
| 648 | Ga0373931_0103957 | 3300035691 | Bacteria | 1602 |
| 649 | Ga0373931_0257601 | 3300035691 | Bacteria | 1063 |
| 650 | Ga0373931_0300488 | 3300035691 | Bacteria | 991 |
| 651 | Ga0373935_0045791 | 3300035692 | Bacteria | 2761 |
| 652 | Ga0373935_0086737 | 3300035692 | Bacteria | 2043 |
| 653 | Ga0373927_0038068 | 3300035695 | Bacteria | 3124 |
| 654 | Ga0373933_0033168 | 3300035724 | Bacteria | 3002 |
| 655 | Ga0373947_0000237 | 3300035725 | Bacteria | 31058 |
| 656 | Ga0373947_0015162 | 3300035725 | Bacteria | 4424 |
| 657 | Ga0373947_0346265 | 3300035725 | Bacteria | 997 |
| 658 | Ga0373937_0000548 | 3300036401 | Bacteria | 33475 |
| 659 | Ga0373937_0032610 | 3300036401 | Bacteria | 4725 |
| 660 | Ga0373937_0211832 | 3300036401 | Bacteria | 1823 |
| 661 | Ga0373937_0425928 | 3300036401 | Unclassified | 1260 |
| 662 | Ga0373937_0665559 | 3300036401 | Bacteria | 987 |
| 663 | Ga0373937_0668637 | 3300036401 | Bacteria | 984 |
| 664 | Ga0373925_0004494 | 3300037068 | Bacteria | 10537 |
| 665 | Ga0373925_0004710 | 3300037068 | Bacteria | 10292 |
| 666 | Ga0373925_0012524 | 3300037068 | Bacteria | 6144 |
| 667 | Ga0395899_0009288 | 3300037312 | Bacteria | 7550 |
| 668 | Ga0395899_0016395 | 3300037312 | Bacteria | 5647 |
| 669 | Ga0395899_0021226 | 3300037312 | Bacteria | 4925 |
| 670 | Ga0395899_0072221 | 3300037312 | Bacteria | 2525 |
| 671 | Ga0395900_0004141 | 3300037418 | Bacteria | 15439 |
| 672 | Ga0395900_0004314 | 3300037418 | Bacteria | 15077 |
| 673 | Ga0395900_0004353 | 3300037418 | Bacteria | 15021 |
| 674 | Ga0395900_0006681 | 3300037418 | Bacteria | 11985 |
| 675 | Ga0395900_0007485 | 3300037418 | Bacteria | 11277 |
| 676 | Ga0395900_0015954 | 3300037418 | Bacteria | 7654 |
| 677 | Ga0395900_0029652 | 3300037418 | Bacteria | 5613 |
| 678 | Ga0395900_0063165 | 3300037418 | Bacteria | 3806 |
| 679 | Ga0395900_0066196 | 3300037418 | Bacteria | 3713 |
| 680 | Ga0395900_0073557 | 3300037418 | Bacteria | 3514 |
| 681 | Ga0395900_0077425 | 3300037418 | Bacteria | 3416 |
| 682 | Ga0395900_0115519 | 3300037418 | Bacteria | 2754 |
| 683 | Ga0395900_0173198 | 3300037418 | Unclassified | 2196 |
| 684 | Ga0395900_0211315 | 3300037418 | Bacteria | 1959 |
| 685 | Ga0395900_0231688 | 3300037418 | Bacteria | 1857 |
| 686 | Ga0395900_0304692 | 3300037418 | Bacteria | 1578 |
| 687 | Ga0395898_0001584 | 3300037466 | Bacteria | 31082 |
| 688 | Ga0395898_0004730 | 3300037466 | Bacteria | 14819 |
| 689 | Ga0395898_0030989 | 3300037466 | Bacteria | 5348 |
| 690 | Ga0395898_0034010 | 3300037466 | Bacteria | 5083 |
| 691 | Ga0395898_0035798 | 3300037466 | Bacteria | 4933 |
| 692 | Ga0395898_0050552 | 3300037466 | Bacteria | 4068 |
| 693 | Ga0395898_0082396 | 3300037466 | Bacteria | 3101 |
| 694 | Ga0395898_0086021 | 3300037466 | Bacteria | 3030 |
| 695 | Ga0395898_0088036 | 3300037466 | Bacteria | 2990 |
| 696 | Ga0395898_0109773 | 3300037466 | Bacteria | 2644 |
| 697 | Ga0395898_0187118 | 3300037466 | Bacteria | 1979 |
| 698 | Ga0395898_0233904 | 3300037466 | Bacteria | 1752 |
| 699 | Ga0395898_0252552 | 3300037466 | Bacteria | 1682 |
| 700 | Ga0395898_0267801 | 3300037466 | Bacteria | 1629 |
| 701 | Ga0395898_0334803 | 3300037466 | Bacteria | 1443 |
| 702 | Ga0395898_0420055 | 3300037466 | Bacteria | 1274 |
| 703 | Ga0395898_0450759 | 3300037466 | Bacteria | 1225 |
| 704 | Ga0395898_0814776 | 3300037466 | Bacteria | 874 |
| 705 | Ga0395905_0005694 | 3300037471 | Bacteria | 12659 |
| 706 | Ga0395905_0009706 | 3300037471 | Bacteria | 9393 |
| 707 | Ga0395905_0013717 | 3300037471 | Bacteria | 7759 |
| 708 | Ga0395905_0024820 | 3300037471 | Bacteria | 5657 |
| 709 | Ga0395905_0044481 | 3300037471 | Bacteria | 4168 |
| 710 | Ga0395905_0089378 | 3300037471 | Bacteria | 2887 |
| 711 | Ga0395905_0101749 | 3300037471 | Bacteria | 2697 |
| 712 | Ga0395905_0117239 | 3300037471 | Bacteria | 2502 |
| 713 | Ga0395905_0350016 | 3300037471 | Bacteria | 1369 |
| 714 | Ga0395905_0357893 | 3300037471 | Bacteria | 1352 |
| 715 | Ga0395905_0426103 | 3300037471 | Bacteria | 1223 |
| 716 | Ga0395901_0001414 | 3300038443 | Bacteria | 25054 |
| 717 | Ga0395901_0005323 | 3300038443 | Bacteria | 13005 |
| 718 | Ga0395901_0007183 | 3300038443 | Bacteria | 11231 |
| 719 | Ga0395901_0007401 | 3300038443 | Bacteria | 11076 |
| 720 | Ga0395901_0013699 | 3300038443 | Bacteria | 8242 |
| 721 | Ga0395901_0086046 | 3300038443 | Bacteria | 3286 |
| 722 | Ga0395901_0116682 | 3300038443 | Bacteria | 2804 |
| 723 | Ga0395901_0121536 | 3300038443 | Bacteria | 2744 |
| 724 | Ga0395901_0187619 | 3300038443 | Bacteria | 2168 |
| 725 | Ga0395901_0188533 | 3300038443 | Bacteria | 2163 |
| 726 | Ga0395901_0233911 | 3300038443 | Bacteria | 1918 |
| 727 | Ga0395901_0244858 | 3300038443 | Bacteria | 1869 |
| 728 | Ga0395901_0351393 | 3300038443 | Bacteria | 1521 |
| 729 | Ga0395901_0414855 | 3300038443 | Bacteria | 1381 |
| 730 | Ga0395901_0417370 | 3300038443 | Bacteria | 1377 |
| 731 | Ga0436365_0146920 | 3300039437 | Unclassified | 1438 |
| 732 | Ga0439438_053703 | 3300041405 | Bacteria | 1019 |
| 733 | Ga0439453_0003323 | 3300041408 | Bacteria | 2307 |
| 734 | Ga0439465_0095657 | 3300041413 | Bacteria | 1021 |
| 735 | Ga0451807_0309110 | 3300041486 | Bacteria | 2882 |
| 736 | Ga0451853_0818869 | 3300041512 | Bacteria | 3653 |
| 737 | Ga0451853_3865135 | 3300041512 | Unclassified | 1656 |
| 738 | Ga0439437_007421 | 3300042000 | Bacteria | 1224 |
| 739 | Ga0439448_0029428 | 3300042005 | Bacteria | 1739 |
| 740 | Ga0439454_015131 | 3300042011 | Bacteria | 1077 |
| 741 | Ga0450920_009778 | 3300042122 | Bacteria | 1770 |
| 742 | Ga0450920_031767 | 3300042122 | Bacteria | 1041 |
| 743 | Ga0450907_014605 | 3300042146 | Bacteria | 1311 |
| 744 | Ga0439446_0017662 | 3300042156 | Bacteria | 1995 |
| 745 | Ga0439434_0049300 | 3300042435 | Bacteria | 1303 |
| 746 | Ga0450916_019243 | 3300042530 | Bacteria | 926 |
| 747 | Ga0466969_0001545 | 3300044656 | Bacteria | 12372 |
| 748 | Ga0466969_0067851 | 3300044656 | Bacteria | 1720 |
| 749 | Ga0466969_0183464 | 3300044656 | Bacteria | 957 |
| 750 | Ga0466972_0066247 | 3300044658 | Bacteria | 1727 |
| 751 | Ga0466965_0027247 | 3300044683 | Bacteria | 2773 |
| 752 | Ga0466966_0007472 | 3300044684 | Bacteria | 7244 |
| 753 | Ga0466966_0017745 | 3300044684 | Bacteria | 4698 |
| 754 | Ga0466966_0033212 | 3300044684 | Bacteria | 3341 |
| 755 | Ga0466966_0072772 | 3300044684 | Bacteria | 2151 |
| 756 | Ga0466966_0076834 | 3300044684 | Bacteria | 2084 |
| 757 | Ga0466961_0009349 | 3300044693 | Bacteria | 6244 |
| 758 | Ga0466961_0011374 | 3300044693 | Bacteria | 5691 |
| 759 | Ga0466961_0013407 | 3300044693 | Bacteria | 5248 |
| 760 | Ga0466961_0029298 | 3300044693 | Bacteria | 3539 |
| 761 | Ga0466961_0053522 | 3300044693 | Bacteria | 2575 |
| 762 | Ga0466961_0056569 | 3300044693 | Bacteria | 2500 |
| 763 | Ga0466961_0061136 | 3300044693 | Archaea | 2394 |
| 764 | Ga0466961_0081319 | 3300044693 | Bacteria | 2050 |
| 765 | Ga0466961_0086091 | 3300044693 | Bacteria | 1986 |
| 766 | Ga0466961_0114395 | 3300044693 | Bacteria | 1696 |
| 767 | Ga0466961_0178265 | 3300044693 | Bacteria | 1320 |
| 768 | Ga0466961_0254087 | 3300044693 | Bacteria | 1079 |
| 769 | Ga0466963_0000451 | 3300044694 | Bacteria | 19022 |
| 770 | Ga0466963_0001783 | 3300044694 | Bacteria | 11714 |
| 771 | Ga0466963_0004649 | 3300044694 | Bacteria | 8008 |
| 772 | Ga0466963_0005272 | 3300044694 | Bacteria | 7549 |
| 773 | Ga0466963_0008370 | 3300044694 | Bacteria | 6197 |
| 774 | Ga0466963_0008664 | 3300044694 | Bacteria | 6105 |
| 775 | Ga0466963_0015488 | 3300044694 | Bacteria | 4723 |
| 776 | Ga0466963_0015753 | 3300044694 | Bacteria | 4690 |
| 777 | Ga0466963_0022821 | 3300044694 | Bacteria | 3967 |
| 778 | Ga0466963_0023721 | 3300044694 | Bacteria | 3899 |
| 779 | Ga0466963_0026808 | 3300044694 | Bacteria | 3687 |
| 780 | Ga0466963_0050622 | 3300044694 | Bacteria | 2749 |
| 781 | Ga0466963_0072120 | 3300044694 | Bacteria | 2326 |
| 782 | Ga0466963_0099061 | 3300044694 | Bacteria | 1993 |
| 783 | Ga0466963_0105604 | 3300044694 | Bacteria | 1930 |
| 784 | Ga0466963_0117852 | 3300044694 | Bacteria | 1825 |
| 785 | Ga0466963_0130194 | 3300044694 | Bacteria | 1737 |
| 786 | Ga0466963_0176210 | 3300044694 | Unclassified | 1492 |
| 787 | Ga0466963_0184670 | 3300044694 | Bacteria | 1456 |
| 788 | Ga0466963_0268813 | 3300044694 | Bacteria | 1198 |
| 789 | Ga0466963_0369935 | 3300044694 | Unclassified | 1010 |
| 790 | Ga0466964_0000404 | 3300044706 | Bacteria | 13083 |
| 791 | Ga0466964_0000824 | 3300044706 | Bacteria | 10138 |
| 792 | Ga0466964_0002750 | 3300044706 | Bacteria | 6310 |
| 793 | Ga0466964_0018060 | 3300044706 | Bacteria | 2703 |
| 794 | Ga0466964_0037965 | 3300044706 | Bacteria | 1936 |
| 795 | Ga0466964_0051495 | 3300044706 | Bacteria | 1691 |
| 796 | Ga0466964_0102256 | 3300044706 | Bacteria | 1265 |
| 797 | Ga0466964_0108795 | 3300044706 | Unclassified | 1233 |
| 798 | Ga0466964_0159663 | 3300044706 | Bacteria | 1052 |
| 799 | Ga0466971_0001469 | 3300044719 | Bacteria | 9951 |
| 800 | Ga0466971_0002972 | 3300044719 | Bacteria | 7200 |
| 801 | Ga0466971_0005645 | 3300044719 | Bacteria | 5439 |
| 802 | Ga0466971_0032261 | 3300044719 | Bacteria | 2347 |
| 803 | Ga0466971_0034659 | 3300044719 | Bacteria | 2262 |
| 804 | Ga0466971_0054704 | 3300044719 | Bacteria | 1798 |
| 805 | Ga0466968_0038554 | 3300044735 | Bacteria | 2008 |
| 806 | Ga0466968_0045954 | 3300044735 | Bacteria | 1854 |
| 807 | Ga0466968_0146967 | 3300044735 | Bacteria | 1081 |
| 808 | Ga0466970_0079233 | 3300044765 | Bacteria | 1773 |
| 809 | Ga0466957_0001760 | 3300044842 | Bacteria | 11390 |
| 810 | Ga0466957_0005697 | 3300044842 | Bacteria | 7003 |
| 811 | Ga0466957_0007116 | 3300044842 | Bacteria | 6327 |
| 812 | Ga0466957_0007547 | 3300044842 | Bacteria | 6147 |
| 813 | Ga0466957_0015118 | 3300044842 | Bacteria | 4505 |
| 814 | Ga0466957_0015472 | 3300044842 | Bacteria | 4456 |
| 815 | Ga0466957_0018383 | 3300044842 | Bacteria | 4104 |
| 816 | Ga0466957_0028975 | 3300044842 | Bacteria | 3298 |
| 817 | Ga0466957_0138564 | 3300044842 | Bacteria | 1566 |
| 818 | Ga0466957_0230241 | 3300044842 | Bacteria | 1227 |
| 819 | Ga0466957_0337816 | 3300044842 | Bacteria | 1019 |
| 820 | Ga0466957_0446378 | 3300044842 | Bacteria | 891 |
| 821 | Ga0466960_0005817 | 3300044901 | Bacteria | 4913 |
| 822 | Ga0466960_0112623 | 3300044901 | Bacteria | 1415 |
| 823 | Ga0466959_0002872 | 3300045049 | Bacteria | 11108 |
| 824 | Ga0466959_0008231 | 3300045049 | Bacteria | 7359 |
| 825 | Ga0466959_0020641 | 3300045049 | Bacteria | 4854 |
| 826 | Ga0466959_0031400 | 3300045049 | Bacteria | 3930 |
| 827 | Ga0466959_0080432 | 3300045049 | Bacteria | 2349 |
| 828 | Ga0466959_0100915 | 3300045049 | Bacteria | 2065 |
| 829 | Ga0466959_0134735 | 3300045049 | Bacteria | 1749 |
| 830 | Ga0466959_0216182 | 3300045049 | Bacteria | 1331 |
| 831 | Ga0466959_0276535 | 3300045049 | Bacteria | 1153 |
| 832 | Ga0466959_0284828 | 3300045049 | Bacteria | 1134 |
| 833 | Ga0466958_0002810 | 3300045836 | Bacteria | 8861 |
| 834 | Ga0466958_0005731 | 3300045836 | Bacteria | 6711 |
| 835 | Ga0466958_0023422 | 3300045836 | Bacteria | 3625 |
| 836 | Ga0466958_0047999 | 3300045836 | Bacteria | 2578 |
| 837 | Ga0466958_0053328 | 3300045836 | Bacteria | 2451 |
| 838 | Ga0466958_0105107 | 3300045836 | Bacteria | 1759 |
| 839 | Ga0466958_0114939 | 3300045836 | Bacteria | 1681 |
| 840 | Ga0466958_0129224 | 3300045836 | Bacteria | 1585 |
| 841 | Ga0466958_0280397 | 3300045836 | Bacteria | 1068 |
| 842 | Ga0466958_0346304 | 3300045836 | Bacteria | 956 |
| 843 | Ga0466967_0000367 | 3300045976 | Bacteria | 20993 |
| 844 | Ga0466967_0000476 | 3300045976 | Bacteria | 19415 |
| 845 | Ga0466967_0001912 | 3300045976 | Bacteria | 12588 |
| 846 | Ga0466967_0007863 | 3300045976 | Bacteria | 7747 |
| 847 | Ga0466967_0007918 | 3300045976 | Bacteria | 7728 |
| 848 | Ga0466967_0010856 | 3300045976 | Bacteria | 6861 |
| 849 | Ga0466967_0013309 | 3300045976 | Bacteria | 6350 |
| 850 | Ga0466967_0019148 | 3300045976 | Bacteria | 5496 |
| 851 | Ga0466967_0021497 | 3300045976 | Bacteria | 5243 |
| 852 | Ga0466967_0022439 | 3300045976 | Bacteria | 5150 |
| 853 | Ga0466967_0028453 | 3300045976 | Bacteria | 4665 |
| 854 | Ga0466967_0029794 | 3300045976 | Bacteria | 4573 |
| 855 | Ga0466967_0035711 | 3300045976 | Bacteria | 4235 |
| 856 | Ga0466967_0037310 | 3300045976 | Bacteria | 4157 |
| 857 | Ga0466967_0039737 | 3300045976 | Bacteria | 4047 |
| 858 | Ga0466967_0040711 | 3300045976 | Bacteria | 4001 |
| 859 | Ga0466967_0044360 | 3300045976 | Bacteria | 3857 |
| 860 | Ga0466967_0049196 | 3300045976 | Bacteria | 3685 |
| 861 | Ga0466967_0049252 | 3300045976 | Bacteria | 3683 |
| 862 | Ga0466967_0063783 | 3300045976 | Bacteria | 3275 |
| 863 | Ga0466967_0066589 | 3300045976 | Bacteria | 3210 |
| 864 | Ga0466967_0074556 | 3300045976 | Bacteria | 3048 |
| 865 | Ga0466967_0075728 | 3300045976 | Bacteria | 3025 |
| 866 | Ga0466967_0078831 | 3300045976 | Bacteria | 2968 |
| 867 | Ga0466967_0109257 | 3300045976 | Bacteria | 2539 |
| 868 | Ga0466967_0122556 | 3300045976 | Bacteria | 2404 |
| 869 | Ga0466967_0160054 | 3300045976 | Bacteria | 2112 |
| 870 | Ga0466967_0180828 | 3300045976 | Bacteria | 1989 |
| 871 | Ga0466967_0190781 | 3300045976 | Bacteria | 1936 |
| 872 | Ga0466967_0200556 | 3300045976 | Bacteria | 1889 |
| 873 | Ga0466967_0482133 | 3300045976 | Bacteria | 1215 |
| 874 | Ga0466967_0620238 | 3300045976 | Bacteria | 1068 |
| 875 | Ga0495592_0000100 | 3300046454 | Bacteria | 76535 |
| 876 | Ga0495592_0051197 | 3300046454 | Bacteria | 3067 |
| 877 | Ga0495592_0104002 | 3300046454 | Bacteria | 2019 |
| 878 | Ga0495592_0116305 | 3300046454 | Bacteria | 1887 |
| 879 | Ga0495592_0168836 | 3300046454 | Bacteria | 1499 |
| 880 | Ga0495592_0187708 | 3300046454 | Bacteria | 1403 |
| 881 | Ga0495603_0005524 | 3300046455 | Bacteria | 7543 |
| 882 | Ga0495603_0218837 | 3300046455 | Bacteria | 1099 |
| 883 | Ga0495629_0000670 | 3300046459 | Bacteria | 27725 |
| 884 | Ga0495629_0258249 | 3300046459 | Bacteria | 1198 |
| 885 | Ga0495629_0350017 | 3300046459 | Unclassified | 1008 |
| 886 | Ga0495641_0000374 | 3300046461 | Bacteria | 37120 |
| 887 | Ga0495641_0047922 | 3300046461 | Bacteria | 1960 |
| 888 | Ga0495641_0051708 | 3300046461 | Bacteria | 1874 |
| 889 | Ga0495641_0062443 | 3300046461 | Bacteria | 1680 |
| 890 | Ga0495641_0081439 | 3300046461 | Bacteria | 1450 |
| 891 | Ga0495641_0128237 | 3300046461 | Bacteria | 1132 |
| 892 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 893 | Ga0495651_0056843 | 3300046462 | Bacteria | 3004 |
| 894 | Ga0495653_0000830 | 3300046463 | Bacteria | 23812 |
| 895 | Ga0495653_0009970 | 3300046463 | Bacteria | 7772 |
| 896 | Ga0495653_0036706 | 3300046463 | Bacteria | 3858 |
| 897 | Ga0495653_0075173 | 3300046463 | Bacteria | 2515 |
| 898 | Ga0495653_0093240 | 3300046463 | Bacteria | 2197 |
| 899 | Ga0495653_0138464 | 3300046463 | Bacteria | 1714 |
| 900 | Ga0495653_0179312 | 3300046463 | Bacteria | 1455 |
| 901 | Ga0495653_0189073 | 3300046463 | Bacteria | 1406 |
| 902 | Ga0495653_0201912 | 3300046463 | Bacteria | 1349 |
| 903 | Ga0495580_0028903 | 3300046472 | Bacteria | 4027 |
| 904 | Ga0495582_0000124 | 3300046473 | Bacteria | 41197 |
| 905 | Ga0495582_0094583 | 3300046473 | Bacteria | 1668 |
| 906 | Ga0495605_0025052 | 3300046474 | Bacteria | 3113 |
| 907 | Ga0495639_0000658 | 3300046475 | Bacteria | 15965 |
| 908 | Ga0495639_0005468 | 3300046475 | Bacteria | 5471 |
| 909 | Ga0495662_0011001 | 3300046476 | Bacteria | 4424 |
| 910 | Ga0495662_0096158 | 3300046476 | Bacteria | 1447 |
| 911 | Ga0495664_0007042 | 3300046477 | Bacteria | 6228 |
| 912 | Ga0495664_0015816 | 3300046477 | Bacteria | 4292 |
| 913 | Ga0495664_0015935 | 3300046477 | Bacteria | 4278 |
| 914 | Ga0495584_0022907 | 3300046491 | Bacteria | 3169 |
| 915 | Ga0495584_0147529 | 3300046491 | Unclassified | 1195 |
| 916 | Ga0495585_0203215 | 3300046492 | Bacteria | 1008 |
| 917 | Ga0495594_0100993 | 3300046499 | Bacteria | 1623 |
| 918 | Ga0495594_0256556 | 3300046499 | Bacteria | 996 |
| 919 | Ga0495607_0071983 | 3300046501 | Bacteria | 1926 |
| 920 | Ga0495608_0012255 | 3300046511 | Bacteria | 5955 |
| 921 | Ga0495608_0012509 | 3300046511 | Bacteria | 5888 |
| 922 | Ga0495608_0015878 | 3300046511 | Bacteria | 5211 |
| 923 | Ga0495608_0051568 | 3300046511 | Bacteria | 2726 |
| 924 | Ga0495608_0065202 | 3300046511 | Bacteria | 2386 |
| 925 | Ga0495608_0076007 | 3300046511 | Bacteria | 2188 |
| 926 | Ga0495608_0288892 | 3300046511 | Unclassified | 1017 |
| 927 | Ga0495618_0021996 | 3300046514 | Bacteria | 3935 |
| 928 | Ga0495618_0055186 | 3300046514 | Bacteria | 2515 |
| 929 | Ga0495618_0065421 | 3300046514 | Bacteria | 2311 |
| 930 | Ga0495618_0157216 | 3300046514 | Bacteria | 1450 |
| 931 | Ga0495628_0000105 | 3300046516 | Bacteria | 68159 |
| 932 | Ga0495628_0045019 | 3300046516 | Bacteria | 3509 |
| 933 | Ga0495628_0092435 | 3300046516 | Bacteria | 2340 |
| 934 | Ga0495628_0164650 | 3300046516 | Bacteria | 1684 |
| 935 | Ga0495628_0268952 | 3300046516 | Bacteria | 1268 |
| 936 | Ga0495630_0004511 | 3300046517 | Bacteria | 9752 |
| 937 | Ga0495630_0005800 | 3300046517 | Bacteria | 8724 |
| 938 | Ga0495630_0007613 | 3300046517 | Bacteria | 7743 |
| 939 | Ga0495630_0021342 | 3300046517 | Bacteria | 4782 |
| 940 | Ga0495630_0046561 | 3300046517 | Bacteria | 3242 |
| 941 | Ga0495630_0051146 | 3300046517 | Bacteria | 3092 |
| 942 | Ga0495630_0051959 | 3300046517 | Bacteria | 3068 |
| 943 | Ga0495630_0093001 | 3300046517 | Bacteria | 2279 |
| 944 | Ga0495630_0114474 | 3300046517 | Bacteria | 2044 |
| 945 | Ga0495644_0004583 | 3300046523 | Bacteria | 5432 |
| 946 | Ga0495644_0047705 | 3300046523 | Bacteria | 1609 |
| 947 | Ga0495644_0137156 | 3300046523 | Bacteria | 934 |
| 948 | Ga0495666_0008076 | 3300046526 | Bacteria | 5277 |
| 949 | Ga0495652_0000588 | 3300046529 | Bacteria | 42490 |
| 950 | Ga0495652_0029631 | 3300046529 | Bacteria | 4807 |
| 951 | Ga0495652_0033829 | 3300046529 | Bacteria | 4459 |
| 952 | Ga0495652_0077028 | 3300046529 | Bacteria | 2765 |
| 953 | Ga0495652_0098795 | 3300046529 | Bacteria | 2372 |
| 954 | Ga0495652_0136257 | 3300046529 | Bacteria | 1937 |
| 955 | Ga0495652_0163924 | 3300046529 | Bacteria | 1722 |
| 956 | Ga0495652_0170234 | 3300046529 | Bacteria | 1682 |
| 957 | Ga0495652_0264595 | 3300046529 | Bacteria | 1267 |
| 958 | Ga0495652_0363063 | 3300046529 | Bacteria | 1034 |
| 959 | Ga0495665_0000249 | 3300046531 | Bacteria | 27073 |
| 960 | Ga0495665_0020544 | 3300046531 | Bacteria | 3545 |
| 961 | Ga0495665_0128681 | 3300046531 | Bacteria | 1326 |
| 962 | Ga0495640_0014648 | 3300046533 | Bacteria | 5923 |
| 963 | Ga0495640_0046649 | 3300046533 | Bacteria | 3000 |
| 964 | Ga0495640_0046657 | 3300046533 | Bacteria | 3000 |
| 965 | Ga0495640_0049145 | 3300046533 | Bacteria | 2910 |
| 966 | Ga0495640_0058446 | 3300046533 | Bacteria | 2630 |
| 967 | Ga0495640_0111938 | 3300046533 | Bacteria | 1783 |
| 968 | Ga0495640_0134297 | 3300046533 | Bacteria | 1599 |
| 969 | Ga0495640_0206309 | 3300046533 | Bacteria | 1244 |
| 970 | Ga0495586_0009598 | 3300046535 | Bacteria | 5155 |
| 971 | Ga0495586_0075375 | 3300046535 | Bacteria | 1846 |
| 972 | Ga0495587_0000048 | 3300046536 | Bacteria | 105358 |
| 973 | Ga0495587_0005708 | 3300046536 | Bacteria | 8108 |
| 974 | Ga0495587_0054833 | 3300046536 | Bacteria | 2348 |
| 975 | Ga0495587_0107345 | 3300046536 | Bacteria | 1605 |
| 976 | Ga0495645_0000029 | 3300046543 | Bacteria | 113119 |
| 977 | Ga0495645_0064579 | 3300046543 | Bacteria | 2648 |
| 978 | Ga0495667_0021726 | 3300046559 | Bacteria | 4330 |
| 979 | Ga0495667_0041701 | 3300046559 | Bacteria | 3043 |
| 980 | Ga0495667_0048646 | 3300046559 | Bacteria | 2799 |
| 981 | Ga0495667_0141654 | 3300046559 | Bacteria | 1549 |
| 982 | Ga0495667_0215174 | 3300046559 | Bacteria | 1227 |
| 983 | Ga0495656_0007343 | 3300046615 | Bacteria | 3891 |
| 984 | Ga0495656_0091885 | 3300046615 | Bacteria | 1389 |
| 985 | Ga0495656_0129386 | 3300046615 | Bacteria | 1200 |
| 986 | Ga0495668_0152672 | 3300046616 | Bacteria | 1265 |
| 987 | Ga0495634_0023767 | 3300046642 | Bacteria | 4305 |
| 988 | Ga0495634_0036619 | 3300046642 | Bacteria | 3355 |
| 989 | Ga0495634_0146874 | 3300046642 | Unclassified | 1493 |
| 990 | Ga0495634_0169159 | 3300046642 | Unclassified | 1374 |
| 991 | Ga0495611_0096841 | 3300046648 | Bacteria | 1367 |
| 992 | Ga0495635_0017173 | 3300046663 | Bacteria | 5053 |
| 993 | Ga0495635_0032237 | 3300046663 | Bacteria | 3636 |
| 994 | Ga0495635_0038085 | 3300046663 | Bacteria | 3329 |
| 995 | Ga0495659_0042807 | 3300046664 | Bacteria | 1622 |
| 996 | Ga0495588_0039230 | 3300046674 | Unclassified | 2412 |
| 997 | Ga0495588_0171852 | 3300046674 | Unclassified | 1146 |
| 998 | Ga0495657_0005214 | 3300046675 | Bacteria | 10289 |
| 999 | Ga0495657_0014570 | 3300046675 | Bacteria | 5769 |
| 1000 | Ga0495657_0019054 | 3300046675 | Bacteria | 4958 |
| 1001 | Ga0495657_0084400 | 3300046675 | Bacteria | 2049 |
| 1002 | Ga0495599_0000110 | 3300046678 | Bacteria | 55240 |
| 1003 | Ga0495599_0014783 | 3300046678 | Bacteria | 4833 |
| 1004 | Ga0495599_0050379 | 3300046678 | Bacteria | 2609 |
| 1005 | Ga0495599_0128363 | 3300046678 | Bacteria | 1575 |
| 1006 | Ga0495599_0164621 | 3300046678 | Bacteria | 1370 |
| 1007 | Ga0495623_0000383 | 3300046679 | Bacteria | 29016 |
| 1008 | Ga0495623_0029228 | 3300046679 | Bacteria | 3547 |
| 1009 | Ga0495623_0047992 | 3300046679 | Bacteria | 2709 |
| 1010 | Ga0495623_0132642 | 3300046679 | Bacteria | 1490 |
| 1011 | Ga0495646_0005246 | 3300046680 | Bacteria | 8172 |
| 1012 | Ga0495646_0021841 | 3300046680 | Bacteria | 4042 |
| 1013 | Ga0495646_0187752 | 3300046680 | Bacteria | 1131 |
| 1014 | Ga0495647_0000147 | 3300046681 | Bacteria | 18079 |
| 1015 | Ga0495647_0008233 | 3300046681 | Bacteria | 3503 |
| 1016 | Ga0495647_0030300 | 3300046681 | Bacteria | 2006 |
| 1017 | Ga0495647_0066509 | 3300046681 | Bacteria | 1434 |
| 1018 | Ga0495658_0000882 | 3300046683 | Bacteria | 16096 |
| 1019 | Ga0495658_0013052 | 3300046683 | Bacteria | 4224 |
| 1020 | Ga0495658_0078152 | 3300046683 | Bacteria | 1936 |
| 1021 | Ga0495613_0001393 | 3300046689 | Bacteria | 18401 |
| 1022 | Ga0495613_0046142 | 3300046689 | Bacteria | 3222 |
| 1023 | Ga0495613_0095545 | 3300046689 | Bacteria | 2149 |
| 1024 | Ga0495613_0124527 | 3300046689 | Bacteria | 1849 |
| 1025 | Ga0495613_0351097 | 3300046689 | Bacteria | 1013 |
| 1026 | Ga0495624_0004712 | 3300046690 | Bacteria | 9922 |
| 1027 | Ga0495624_0006866 | 3300046690 | Bacteria | 8035 |
| 1028 | Ga0495624_0054385 | 3300046690 | Bacteria | 2524 |
| 1029 | Ga0495624_0107045 | 3300046690 | Bacteria | 1720 |
| 1030 | Ga0495671_0108727 | 3300046692 | Unclassified | 1354 |
| 1031 | Ga0495600_0024907 | 3300046809 | Bacteria | 3853 |
| 1032 | Ga0495600_0034378 | 3300046809 | Bacteria | 3290 |
| 1033 | Ga0495600_0059702 | 3300046809 | Bacteria | 2491 |
| 1034 | Ga0495600_0234874 | 3300046809 | Bacteria | 1169 |
| 1035 | Ga0495600_0248458 | 3300046809 | Unclassified | 1132 |
| 1036 | Ga0495581_0003286 | 3300047315 | Bacteria | 9280 |
| 1037 | Ga0495581_0011603 | 3300047315 | Bacteria | 5099 |
| 1038 | Ga0495581_0017225 | 3300047315 | Bacteria | 4198 |
| 1039 | Ga0495581_0140907 | 3300047315 | Bacteria | 1406 |
| 1040 | Ga0495581_0312196 | 3300047315 | Unclassified | 919 |
| 1041 | Ga0495604_0000238 | 3300047317 | Bacteria | 49191 |
| 1042 | Ga0495604_0008809 | 3300047317 | Bacteria | 7973 |
| 1043 | Ga0495604_0011159 | 3300047317 | Bacteria | 7134 |
| 1044 | Ga0495604_0031423 | 3300047317 | Bacteria | 4210 |
| 1045 | Ga0495604_0073391 | 3300047317 | Bacteria | 2583 |
| 1046 | Ga0495674_0006233 | 3300047319 | Bacteria | 11443 |
| 1047 | Ga0495674_0035810 | 3300047319 | Bacteria | 4474 |
| 1048 | Ga0495674_0035918 | 3300047319 | Bacteria | 4467 |
| 1049 | Ga0495674_0040358 | 3300047319 | Bacteria | 4175 |
| 1050 | Ga0495674_0105545 | 3300047319 | Bacteria | 2393 |
| 1051 | Ga0495674_0141716 | 3300047319 | Bacteria | 2020 |
| 1052 | Ga0495674_0172422 | 3300047319 | Unclassified | 1804 |
| 1053 | Ga0495674_0246378 | 3300047319 | Bacteria | 1471 |
| 1054 | Ga0495676_0000583 | 3300047321 | Bacteria | 30065 |
| 1055 | Ga0495676_0017863 | 3300047321 | Bacteria | 6261 |
| 1056 | Ga0495676_0024350 | 3300047321 | Bacteria | 5242 |
| 1057 | Ga0495676_0142404 | 3300047321 | Bacteria | 1717 |
| 1058 | Ga0495676_0172366 | 3300047321 | Bacteria | 1522 |
| 1059 | Ga0495676_0181240 | 3300047321 | Bacteria | 1476 |
| 1060 | Ga0495676_0267822 | 3300047321 | Unclassified | 1160 |
| 1061 | Ga0495680_0000743 | 3300047322 | Bacteria | 36546 |
| 1062 | Ga0495680_0009403 | 3300047322 | Bacteria | 8791 |
| 1063 | Ga0495680_0012692 | 3300047322 | Bacteria | 7397 |
| 1064 | Ga0495680_0013269 | 3300047322 | Bacteria | 7198 |
| 1065 | Ga0495680_0019364 | 3300047322 | Bacteria | 5745 |
| 1066 | Ga0495680_0037819 | 3300047322 | Bacteria | 3864 |
| 1067 | Ga0495680_0119905 | 3300047322 | Bacteria | 1943 |
| 1068 | Ga0495675_0000262 | 3300047444 | Bacteria | 38243 |
| 1069 | Ga0495684_0010320 | 3300047471 | Bacteria | 7224 |
| 1070 | Ga0495684_0015381 | 3300047471 | Bacteria | 5889 |
| 1071 | Ga0495684_0022426 | 3300047471 | Bacteria | 4858 |
| 1072 | Ga0495684_0036779 | 3300047471 | Bacteria | 3753 |
| 1073 | Ga0495684_0059844 | 3300047471 | Bacteria | 2900 |
| 1074 | Ga0495684_0170160 | 3300047471 | Bacteria | 1621 |
| 1075 | Ga0495593_0015229 | 3300047673 | Bacteria | 4362 |
| 1076 | Ga0495593_0149929 | 3300047673 | Unclassified | 1179 |
| 1077 | Ga0495602_0014431 | 3300048088 | Bacteria | 8018 |
| 1078 | Ga0495602_0042482 | 3300048088 | Bacteria | 4142 |
| 1079 | Ga0495602_0045157 | 3300048088 | Bacteria | 3989 |
| 1080 | Ga0495602_0072991 | 3300048088 | Bacteria | 2923 |
| 1081 | Ga0495602_0215661 | 3300048088 | Bacteria | 1453 |
| 1082 | Ga0495614_0000634 | 3300048089 | Bacteria | 14685 |
| 1083 | Ga0495614_0008520 | 3300048089 | Bacteria | 4558 |
| 1084 | Ga0496100_0002369 | 3300048903 | Bacteria | 9534 |
| 1085 | Ga0496100_0002548 | 3300048903 | Bacteria | 9285 |
| 1086 | Ga0496100_0039076 | 3300048903 | Bacteria | 3011 |
| 1087 | Ga0496100_0075712 | 3300048903 | Bacteria | 2258 |
| 1088 | Ga0496100_0077538 | 3300048903 | Bacteria | 2234 |
| 1089 | Ga0496100_0083106 | 3300048903 | Bacteria | 2167 |
| 1090 | Ga0496101_0001864 | 3300048904 | Bacteria | 12730 |
| 1091 | Ga0496101_0003449 | 3300048904 | Bacteria | 9861 |
| 1092 | Ga0496101_0009945 | 3300048904 | Bacteria | 6268 |
| 1093 | Ga0496101_0018885 | 3300048904 | Bacteria | 4695 |
| 1094 | Ga0496101_0027974 | 3300048904 | Bacteria | 3933 |
| 1095 | Ga0496102_0005509 | 3300048905 | Bacteria | 10749 |
| 1096 | Ga0496102_0028898 | 3300048905 | Bacteria | 4956 |
| 1097 | Ga0496102_0052813 | 3300048905 | Bacteria | 3704 |
| 1098 | Ga0496102_0108642 | 3300048905 | Bacteria | 2584 |
| 1099 | Ga0496103_0014172 | 3300048906 | Bacteria | 4732 |
| 1100 | Ga0496103_0080734 | 3300048906 | Bacteria | 2045 |
| 1101 | Ga0496103_0089403 | 3300048906 | Bacteria | 1943 |
| 1102 | Ga0496104_0002544 | 3300048907 | Bacteria | 15709 |
| 1103 | Ga0496104_0004726 | 3300048907 | Bacteria | 11856 |
| 1104 | Ga0496104_0046151 | 3300048907 | Bacteria | 4101 |
| 1105 | Ga0496104_0084558 | 3300048907 | Bacteria | 3028 |
| 1106 | Ga0496104_0105065 | 3300048907 | Bacteria | 2706 |
| 1107 | Ga0496104_0108905 | 3300048907 | Bacteria | 2655 |
| 1108 | Ga0496104_0364572 | 3300048907 | Bacteria | 1357 |
| 1109 | Ga0496105_0004487 | 3300048908 | Bacteria | 10507 |
| 1110 | Ga0496105_0005400 | 3300048908 | Bacteria | 9698 |
| 1111 | Ga0496105_0013818 | 3300048908 | Bacteria | 6412 |
| 1112 | Ga0496105_0023914 | 3300048908 | Bacteria | 4961 |
| 1113 | Ga0496105_0044386 | 3300048908 | Bacteria | 3666 |
| 1114 | Ga0496105_0141024 | 3300048908 | Bacteria | 1984 |
| 1115 | Ga0496105_0253371 | 3300048908 | Bacteria | 1425 |
| 1116 | Ga0496106_0003054 | 3300048909 | Bacteria | 12476 |
| 1117 | Ga0496106_0005293 | 3300048909 | Bacteria | 9563 |
| 1118 | Ga0496106_0006016 | 3300048909 | Bacteria | 8976 |
| 1119 | Ga0496106_0070861 | 3300048909 | Bacteria | 2663 |
| 1120 | Ga0496106_0586857 | 3300048909 | Bacteria | 893 |
| 1121 | Ga0496107_0001510 | 3300048910 | Bacteria | 14450 |
| 1122 | Ga0496107_0003341 | 3300048910 | Bacteria | 10716 |
| 1123 | Ga0496107_0004985 | 3300048910 | Bacteria | 9037 |
| 1124 | Ga0496107_0100218 | 3300048910 | Bacteria | 2123 |
| 1125 | Ga0496107_0316887 | 3300048910 | Bacteria | 1161 |
| 1126 | Ga0496107_0393303 | 3300048910 | Bacteria | 1031 |
| 1127 | Ga0496108_0003870 | 3300048911 | Bacteria | 12019 |
| 1128 | Ga0496108_0006796 | 3300048911 | Bacteria | 9262 |
| 1129 | Ga0496108_0032441 | 3300048911 | Bacteria | 4338 |
| 1130 | Ga0496108_0084645 | 3300048911 | Bacteria | 2691 |
| 1131 | Ga0496108_0116468 | 3300048911 | Bacteria | 2289 |
| 1132 | Ga0496108_0192777 | 3300048911 | Bacteria | 1766 |
| 1133 | Ga0496108_0306976 | 3300048911 | Bacteria | 1382 |
| 1134 | Ga0496109_0000993 | 3300048912 | Bacteria | 23393 |
| 1135 | Ga0496109_0001712 | 3300048912 | Bacteria | 18294 |
| 1136 | Ga0496109_0002841 | 3300048912 | Bacteria | 14513 |
| 1137 | Ga0496109_0012043 | 3300048912 | Bacteria | 7450 |
| 1138 | Ga0496109_0036481 | 3300048912 | Bacteria | 4437 |
| 1139 | Ga0496109_0138506 | 3300048912 | Unclassified | 2275 |
| 1140 | Ga0496109_0239089 | 3300048912 | Bacteria | 1709 |
| 1141 | Ga0496109_0248628 | 3300048912 | Bacteria | 1674 |
| 1142 | Ga0496110_0001621 | 3300048913 | Bacteria | 16499 |
| 1143 | Ga0496110_0003582 | 3300048913 | Bacteria | 11933 |
| 1144 | Ga0496110_0065596 | 3300048913 | Bacteria | 3210 |
| 1145 | Ga0496110_0101489 | 3300048913 | Bacteria | 2579 |
| 1146 | Ga0496110_0196034 | 3300048913 | Bacteria | 1834 |
| 1147 | Ga0496110_0208757 | 3300048913 | Bacteria | 1775 |
| 1148 | Ga0496110_0260470 | 3300048913 | Bacteria | 1578 |
| 1149 | Ga0496111_0009608 | 3300048914 | Bacteria | 6461 |
| 1150 | Ga0496111_0029567 | 3300048914 | Bacteria | 3892 |
| 1151 | Ga0496111_0038009 | 3300048914 | Bacteria | 3447 |
| 1152 | Ga0496111_0073063 | 3300048914 | Bacteria | 2497 |
| 1153 | Ga0496111_0172454 | 3300048914 | Bacteria | 1607 |
| 1154 | Ga0496111_0177093 | 3300048914 | Bacteria | 1585 |
| 1155 | Ga0496111_0189753 | 3300048914 | Bacteria | 1528 |
| 1156 | Ga0496112_0004702 | 3300048915 | Bacteria | 11627 |
| 1157 | Ga0496112_0004906 | 3300048915 | Bacteria | 11445 |
| 1158 | Ga0496112_0024534 | 3300048915 | Bacteria | 5776 |
| 1159 | Ga0496112_0028701 | 3300048915 | Bacteria | 5374 |
| 1160 | Ga0496112_0030500 | 3300048915 | Bacteria | 5219 |
| 1161 | Ga0496112_0046008 | 3300048915 | Bacteria | 4279 |
| 1162 | Ga0496112_0048226 | 3300048915 | Bacteria | 4176 |
| 1163 | Ga0496112_0179707 | 3300048915 | Bacteria | 2080 |
| 1164 | Ga0496112_0413800 | 3300048915 | Bacteria | 1287 |
| 1165 | Ga0496113_0008006 | 3300048916 | Bacteria | 6852 |
| 1166 | Ga0496113_0011179 | 3300048916 | Bacteria | 5974 |
| 1167 | Ga0496113_0197862 | 3300048916 | Bacteria | 1597 |
| 1168 | Ga0496113_0212370 | 3300048916 | Bacteria | 1541 |
| 1169 | Ga0496113_0212969 | 3300048916 | Bacteria | 1538 |
| 1170 | Ga0496113_0218449 | 3300048916 | Bacteria | 1519 |
| 1171 | Ga0496114_0001845 | 3300048917 | Bacteria | 16042 |
| 1172 | Ga0496114_0011611 | 3300048917 | Bacteria | 7043 |
| 1173 | Ga0496114_0012916 | 3300048917 | Bacteria | 6689 |
| 1174 | Ga0496114_0016123 | 3300048917 | Bacteria | 6013 |
| 1175 | Ga0496114_0020427 | 3300048917 | Bacteria | 5376 |
| 1176 | Ga0496114_0021695 | 3300048917 | Bacteria | 5226 |
| 1177 | Ga0496114_0039727 | 3300048917 | Bacteria | 3894 |
| 1178 | Ga0496114_0046702 | 3300048917 | Bacteria | 3599 |
| 1179 | Ga0496114_0085319 | 3300048917 | Bacteria | 2674 |
| 1180 | Ga0496114_0139776 | 3300048917 | Bacteria | 2096 |
| 1181 | Ga0496114_0201116 | 3300048917 | Bacteria | 1745 |
| 1182 | Ga0496114_0227093 | 3300048917 | Bacteria | 1640 |
| 1183 | Ga0496115_0005564 | 3300048918 | Bacteria | 9166 |
| 1184 | Ga0496115_0006406 | 3300048918 | Bacteria | 8625 |
| 1185 | Ga0496115_0021447 | 3300048918 | Bacteria | 4992 |
| 1186 | Ga0496115_0047810 | 3300048918 | Bacteria | 3421 |
| 1187 | Ga0496115_0059551 | 3300048918 | Bacteria | 3075 |
| 1188 | Ga0496115_0209938 | 3300048918 | Bacteria | 1608 |
| 1189 | Ga0496115_0240291 | 3300048918 | Bacteria | 1493 |
| 1190 | Ga0496116_0042494 | 3300048919 | Bacteria | 3106 |
| 1191 | Ga0501031_0002279 | 3300049568 | Bacteria | 12154 |
| 1192 | Ga0501031_0018735 | 3300049568 | Bacteria | 4507 |
| 1193 | Ga0501031_0029452 | 3300049568 | Bacteria | 3581 |
| 1194 | Ga0501031_0034082 | 3300049568 | Bacteria | 3322 |
| 1195 | Ga0501031_0054167 | 3300049568 | Bacteria | 2614 |
| 1196 | Ga0501032_0062500 | 3300049569 | Bacteria | 2495 |
| 1197 | Ga0501032_0062540 | 3300049569 | Bacteria | 2494 |
| 1198 | Ga0501032_0096167 | 3300049569 | Bacteria | 1963 |
| 1199 | Ga0501033_0013055 | 3300049570 | Bacteria | 6332 |
| 1200 | Ga0501033_0051067 | 3300049570 | Bacteria | 3065 |
| 1201 | Ga0501033_0070588 | 3300049570 | Bacteria | 2566 |
| 1202 | Ga0501034_0014853 | 3300049571 | Bacteria | 8012 |
| 1203 | Ga0501034_0325826 | 3300049571 | Bacteria | 1468 |
| 1204 | Ga0501036_0006686 | 3300049572 | Bacteria | 9371 |
| 1205 | Ga0501036_0010774 | 3300049572 | Bacteria | 7556 |
| 1206 | Ga0501036_0026283 | 3300049572 | Bacteria | 4912 |
| 1207 | Ga0501036_0028689 | 3300049572 | Bacteria | 4703 |
| 1208 | Ga0501036_0095697 | 3300049572 | Bacteria | 2510 |
| 1209 | Ga0501036_0146628 | 3300049572 | Bacteria | 1991 |
| 1210 | Ga0501037_0051675 | 3300049573 | Bacteria | 3006 |
| 1211 | Ga0501037_0055596 | 3300049573 | Bacteria | 2894 |
| 1212 | Ga0501037_0108705 | 3300049573 | Bacteria | 1998 |
| 1213 | Ga0501038_0045892 | 3300049574 | Bacteria | 3791 |
| 1214 | Ga0501038_0053632 | 3300049574 | Bacteria | 3470 |
| 1215 | Ga0501038_0095652 | 3300049574 | Bacteria | 2481 |
| 1216 | Ga0501038_0117636 | 3300049574 | Bacteria | 2195 |
| 1217 | Ga0501039_0012542 | 3300049575 | Bacteria | 6473 |
| 1218 | Ga0501039_0032959 | 3300049575 | Bacteria | 3996 |
| 1219 | Ga0501039_0137543 | 3300049575 | Bacteria | 1918 |
| 1220 | Ga0501039_0141408 | 3300049575 | Bacteria | 1890 |
| 1221 | Ga0501039_0148076 | 3300049575 | Bacteria | 1845 |
| 1222 | Ga0501040_0010312 | 3300049576 | Bacteria | 6110 |
| 1223 | Ga0501040_0010725 | 3300049576 | Bacteria | 5992 |
| 1224 | Ga0501040_0015564 | 3300049576 | Bacteria | 5026 |
| 1225 | Ga0501040_0096856 | 3300049576 | Bacteria | 2055 |
| 1226 | Ga0501040_0144581 | 3300049576 | Unclassified | 1676 |
| 1227 | Ga0501041_0013911 | 3300049577 | Bacteria | 4771 |
| 1228 | Ga0501041_0039050 | 3300049577 | Bacteria | 2880 |
| 1229 | Ga0501041_0052377 | 3300049577 | Bacteria | 2488 |
| 1230 | Ga0501042_0002782 | 3300049578 | Bacteria | 10813 |
| 1231 | Ga0501042_0003754 | 3300049578 | Bacteria | 9595 |
| 1232 | Ga0501042_0009378 | 3300049578 | Bacteria | 6521 |
| 1233 | Ga0501042_0013162 | 3300049578 | Bacteria | 5631 |
| 1234 | Ga0501042_0016630 | 3300049578 | Bacteria | 5054 |
| 1235 | Ga0501042_0075133 | 3300049578 | Bacteria | 2418 |
| 1236 | Ga0501042_0246790 | 3300049578 | Unclassified | 1288 |
| 1237 | Ga0501042_0307127 | 3300049578 | Unclassified | 1146 |
| 1238 | Ga0501043_0036949 | 3300049579 | Bacteria | 3842 |
| 1239 | Ga0501043_0180989 | 3300049579 | Bacteria | 1642 |
| 1240 | Ga0501046_0017224 | 3300049580 | Bacteria | 6037 |
| 1241 | Ga0501047_0055549 | 3300049581 | Bacteria | 3829 |
| 1242 | Ga0501047_0075472 | 3300049581 | Bacteria | 3244 |
| 1243 | Ga0501048_0004669 | 3300049582 | Bacteria | 10427 |
| 1244 | Ga0501048_0005952 | 3300049582 | Bacteria | 9284 |
| 1245 | Ga0501048_0023296 | 3300049582 | Bacteria | 4527 |
| 1246 | Ga0501048_0050900 | 3300049582 | Bacteria | 2949 |
| 1247 | Ga0501048_0054248 | 3300049582 | Bacteria | 2847 |
| 1248 | Ga0501048_0111661 | 3300049582 | Bacteria | 1930 |
| 1249 | Ga0501048_0385352 | 3300049582 | Bacteria | 1001 |
| 1250 | Ga0501067_0001730 | 3300049583 | Bacteria | 12002 |
| 1251 | Ga0501067_0012207 | 3300049583 | Bacteria | 4763 |
| 1252 | Ga0501067_0023421 | 3300049583 | Bacteria | 3422 |
| 1253 | Ga0501067_0048409 | 3300049583 | Bacteria | 2357 |
| 1254 | Ga0501068_0006921 | 3300049584 | Bacteria | 6273 |
| 1255 | Ga0501068_0016612 | 3300049584 | Bacteria | 4244 |
| 1256 | Ga0501068_0060930 | 3300049584 | Bacteria | 2292 |
| 1257 | Ga0501069_0001302 | 3300049585 | Bacteria | 12240 |
| 1258 | Ga0501069_0022740 | 3300049585 | Bacteria | 3414 |
| 1259 | Ga0501069_0026464 | 3300049585 | Bacteria | 3176 |
| 1260 | Ga0501069_0074217 | 3300049585 | Bacteria | 1908 |
| 1261 | Ga0501069_0109002 | 3300049585 | Bacteria | 1576 |
| 1262 | Ga0501069_0113077 | 3300049585 | Bacteria | 1547 |
| 1263 | Ga0501069_0264582 | 3300049585 | Unclassified | 1004 |
| 1264 | Ga0501069_0398015 | 3300049585 | Bacteria | 815 |
| 1265 | Ga0501070_0011798 | 3300049586 | Bacteria | 7381 |
| 1266 | Ga0501070_0040217 | 3300049586 | Bacteria | 3899 |
| 1267 | Ga0501070_0103024 | 3300049586 | Bacteria | 2360 |
| 1268 | Ga0501070_0268935 | 3300049586 | Bacteria | 1392 |
| 1269 | Ga0501071_0000767 | 3300049587 | Bacteria | 17035 |
| 1270 | Ga0501071_0004938 | 3300049587 | Bacteria | 8517 |
| 1271 | Ga0501071_0014033 | 3300049587 | Bacteria | 5473 |
| 1272 | Ga0501071_0031539 | 3300049587 | Bacteria | 3757 |
| 1273 | Ga0501071_0088616 | 3300049587 | Bacteria | 2270 |
| 1274 | Ga0501071_0336031 | 3300049587 | Bacteria | 1148 |
| 1275 | Ga0501072_0001670 | 3300049588 | Bacteria | 16511 |
| 1276 | Ga0501072_0003982 | 3300049588 | Bacteria | 11174 |
| 1277 | Ga0501072_0005076 | 3300049588 | Bacteria | 10020 |
| 1278 | Ga0501072_0006101 | 3300049588 | Bacteria | 9192 |
| 1279 | Ga0501072_0008342 | 3300049588 | Bacteria | 7867 |
| 1280 | Ga0501072_0031237 | 3300049588 | Bacteria | 4167 |
| 1281 | Ga0501072_0053731 | 3300049588 | Bacteria | 3173 |
| 1282 | Ga0501072_0126006 | 3300049588 | Bacteria | 2041 |
| 1283 | Ga0501072_0247912 | 3300049588 | Unclassified | 1418 |
| 1284 | Ga0501072_0323324 | 3300049588 | Bacteria | 1226 |
| 1285 | Ga0501072_0328046 | 3300049588 | Bacteria | 1216 |
| 1286 | Ga0501073_0012097 | 3300049589 | Bacteria | 6301 |
| 1287 | Ga0501073_0022512 | 3300049589 | Bacteria | 4537 |
| 1288 | Ga0501073_0067571 | 3300049589 | Bacteria | 2492 |
| 1289 | Ga0501073_0217243 | 3300049589 | Bacteria | 1321 |
| 1290 | Ga0501074_0007371 | 3300049590 | Bacteria | 7954 |
| 1291 | Ga0501074_0007570 | 3300049590 | Bacteria | 7856 |
| 1292 | Ga0501075_0004427 | 3300049591 | Bacteria | 9504 |
| 1293 | Ga0501075_0011326 | 3300049591 | Bacteria | 6309 |
| 1294 | Ga0501075_0044022 | 3300049591 | Bacteria | 3348 |
| 1295 | Ga0501075_0053464 | 3300049591 | Bacteria | 3037 |
| 1296 | Ga0501075_0078466 | 3300049591 | Bacteria | 2499 |
| 1297 | Ga0501075_0131106 | 3300049591 | Unclassified | 1910 |
| 1298 | Ga0501075_0194682 | 3300049591 | Bacteria | 1546 |
| 1299 | Ga0501075_0269954 | 3300049591 | Bacteria | 1296 |
| 1300 | Ga0501075_0382160 | 3300049591 | Bacteria | 1073 |
| 1301 | Ga0501076_0004402 | 3300049592 | Bacteria | 10009 |
| 1302 | Ga0501076_0019237 | 3300049592 | Bacteria | 5216 |
| 1303 | Ga0501076_0019525 | 3300049592 | Bacteria | 5181 |
| 1304 | Ga0501076_0025634 | 3300049592 | Bacteria | 4566 |
| 1305 | Ga0501076_0036609 | 3300049592 | Bacteria | 3845 |
| 1306 | Ga0501076_0131835 | 3300049592 | Bacteria | 2027 |
| 1307 | Ga0501076_0226451 | 3300049592 | Bacteria | 1528 |
| 1308 | Ga0501076_0406644 | 3300049592 | Bacteria | 1119 |
| 1309 | Ga0501077_0001272 | 3300049593 | Bacteria | 15228 |
| 1310 | Ga0501077_0001755 | 3300049593 | Bacteria | 13074 |
| 1311 | Ga0501077_0019979 | 3300049593 | Bacteria | 4238 |
| 1312 | Ga0501077_0024745 | 3300049593 | Bacteria | 3812 |
| 1313 | Ga0501077_0033416 | 3300049593 | Bacteria | 3274 |
| 1314 | Ga0501077_0041172 | 3300049593 | Bacteria | 2942 |
| 1315 | Ga0501077_0271037 | 3300049593 | Bacteria | 1080 |
| 1316 | Ga0501079_0018412 | 3300049741 | Bacteria | 5337 |
| 1317 | Ga0501079_0037877 | 3300049741 | Bacteria | 3718 |
| 1318 | Ga0501079_0048059 | 3300049741 | Bacteria | 3292 |
| 1319 | Ga0501079_0051223 | 3300049741 | Bacteria | 3187 |
| 1320 | Ga0501079_0072176 | 3300049741 | Bacteria | 2668 |
| 1321 | Ga0501079_0183331 | 3300049741 | Unclassified | 1634 |
| 1322 | Ga0501079_0215164 | 3300049741 | Unclassified | 1501 |
| 1323 | Ga0501079_0286663 | 3300049741 | Bacteria | 1287 |
| 1324 | Ga0501079_0340816 | 3300049741 | Bacteria | 1174 |
| 1325 | Ga0501080_0003263 | 3300049742 | Bacteria | 14314 |
| 1326 | Ga0501080_0012564 | 3300049742 | Bacteria | 7765 |
| 1327 | Ga0501080_0020808 | 3300049742 | Bacteria | 6073 |
| 1328 | Ga0501080_0035070 | 3300049742 | Bacteria | 4683 |
| 1329 | Ga0501080_0087607 | 3300049742 | Bacteria | 2892 |
| 1330 | Ga0501080_0089139 | 3300049742 | Bacteria | 2865 |
| 1331 | Ga0501080_0103423 | 3300049742 | Bacteria | 2641 |
| 1332 | Ga0501080_0121162 | 3300049742 | Bacteria | 2424 |
| 1333 | Ga0501080_0165391 | 3300049742 | Bacteria | 2041 |
| 1334 | Ga0501080_0535637 | 3300049742 | Bacteria | 1044 |
| 1335 | Ga0501081_0001452 | 3300049743 | Bacteria | 14515 |
| 1336 | Ga0501081_0001716 | 3300049743 | Bacteria | 13600 |
| 1337 | Ga0501081_0013344 | 3300049743 | Bacteria | 5404 |
| 1338 | Ga0501081_0021429 | 3300049743 | Bacteria | 4312 |
| 1339 | Ga0501081_0024542 | 3300049743 | Bacteria | 4048 |
| 1340 | Ga0501081_0197903 | 3300049743 | Bacteria | 1457 |
| 1341 | Ga0501081_0255687 | 3300049743 | Bacteria | 1279 |
| 1342 | Ga0501081_0281270 | 3300049743 | Unclassified | 1218 |
| 1343 | Ga0501081_0316488 | 3300049743 | Bacteria | 1146 |
| 1344 | Ga0501081_0398315 | 3300049743 | Bacteria | 1019 |
| 1345 | Ga0501083_0000421 | 3300049744 | Bacteria | 27178 |
| 1346 | Ga0501083_0005164 | 3300049744 | Bacteria | 9237 |
| 1347 | Ga0501083_0009254 | 3300049744 | Bacteria | 6954 |
| 1348 | Ga0501083_0306213 | 3300049744 | Bacteria | 1033 |
| 1349 | Ga0501035_0015511 | 3300049822 | Bacteria | 7029 |
| 1350 | Ga0501035_0274153 | 3300049822 | Bacteria | 1427 |
| 1351 | Ga0501035_0514175 | 3300049822 | Bacteria | 984 |
| 1352 | Ga0501044_0039843 | 3300049823 | Bacteria | 4899 |
| 1353 | Ga0501044_0187437 | 3300049823 | Bacteria | 2033 |
| 1354 | Ga0501045_0002387 | 3300049824 | Bacteria | 12753 |
| 1355 | Ga0501045_0009285 | 3300049824 | Bacteria | 6879 |
| 1356 | Ga0501045_0016554 | 3300049824 | Bacteria | 5238 |
| 1357 | Ga0501045_0022487 | 3300049824 | Bacteria | 4515 |
| 1358 | Ga0501045_0025337 | 3300049824 | Bacteria | 4263 |
| 1359 | Ga0501045_0036081 | 3300049824 | Bacteria | 3590 |
| 1360 | Ga0501045_0251226 | 3300049824 | Unclassified | 1316 |
| 1361 | nmdc:mga00v17_4057_c1 | 3300050491 | Bacteria | 7572 |
| 1362 | nmdc:mga0yw44_15682_c1 | 3300050492 | Bacteria | 4067 |
| 1363 | nmdc:mga0yw44_229949_c1 | 3300050492 | Bacteria | 1231 |
| 1364 | nmdc:mga06z11_158047_c1 | 3300050494 | Bacteria | 1294 |
| 1365 | nmdc:mga05p37_107064_c1 | 3300050507 | Bacteria | 3439 |
| 1366 | nmdc:mga05p37_116409_c1 | 3300050507 | Bacteria | 3285 |
| 1367 | nmdc:mga05p37_172647_c1 | 3300050507 | Bacteria | 2636 |
| 1368 | nmdc:mga05p37_2744_c1 | 3300050507 | Bacteria | 20453 |
| 1369 | nmdc:mga09592_5343_c1 | 3300050508 | Bacteria | 10439 |
| 1370 | nmdc:mga0qj67_29024_c1 | 3300050509 | Bacteria | 4295 |
| 1371 | nmdc:mga06r32_107860_c1 | 3300050510 | Bacteria | 2737 |
| 1372 | nmdc:mga06r32_521881_c1 | 3300050510 | Bacteria | 1163 |
| 1373 | nmdc:mga08y16_146065_c1 | 3300050511 | Bacteria | 2459 |
| 1374 | nmdc:mga08y16_288619_c1 | 3300050511 | Bacteria | 1692 |
| 1375 | nmdc:mga08y16_36423_c1 | 3300050511 | Bacteria | 5168 |
| 1376 | nmdc:mga08y16_59021_c1 | 3300050511 | Bacteria | 4008 |
| 1377 | nmdc:mga0n895_13347_c1 | 3300050512 | Bacteria | 7407 |
| 1378 | nmdc:mga0n895_191714_c1 | 3300050512 | Bacteria | 2075 |
| 1379 | nmdc:mga0n895_2272_c1 | 3300050512 | Bacteria | 14899 |
| 1380 | nmdc:mga0n895_261597_c1 | 3300050512 | Unclassified | 1756 |
| 1381 | nmdc:mga0rr50_4902_c1 | 3300050513 | Bacteria | 7917 |
| 1382 | nmdc:mga0rr50_73940_c1 | 3300050513 | Bacteria | 2607 |
| 1383 | nmdc:mga0a205_1210_c2 | 3300050515 | Bacteria | 10418 |
| 1384 | nmdc:mga0a205_30584_c1 | 3300050515 | Bacteria | 5156 |
| 1385 | nmdc:mga0a205_30714_c1 | 3300050515 | Bacteria | 5146 |
| 1386 | Ga0495601_0000174 | 3300053077 | Bacteria | 34055 |
| 1387 | Ga0495601_0024368 | 3300053077 | Bacteria | 3726 |
| 1388 | Ga0495601_0047394 | 3300053077 | Bacteria | 2705 |
| 1389 | Ga0495601_0074577 | 3300053077 | Bacteria | 2170 |
| 1390 | Ga0495601_0092909 | 3300053077 | Bacteria | 1943 |
| 1391 | Ga0495601_0101500 | 3300053077 | Bacteria | 1858 |
| 1392 | Ga0495601_0119310 | 3300053077 | Bacteria | 1712 |
| 1393 | Ga0495601_0138281 | 3300053077 | Bacteria | 1588 |
| 1394 | Ga0495601_0252243 | 3300053077 | Bacteria | 1152 |
| 1395 | Ga0495612_0013698 | 3300053078 | Bacteria | 3266 |
| 1396 | Ga0495612_0077071 | 3300053078 | Bacteria | 1397 |
| 1397 | Ga0495612_0105785 | 3300053078 | Bacteria | 1201 |
| 1398 | Ga0495612_0121795 | 3300053078 | Unclassified | 1122 |
| 1399 | Ga0495655_0089751 | 3300053083 | Bacteria | 893 |
| 1400 | Ga0495595_0001301 | 3300053084 | Bacteria | 9721 |
| 1401 | Ga0495595_0025633 | 3300053084 | Bacteria | 2615 |
| 1402 | Ga0495595_0039555 | 3300053084 | Bacteria | 2152 |
| 1403 | Ga0495595_0050896 | 3300053084 | Bacteria | 1919 |
| 1404 | Ga0495595_0051338 | 3300053084 | Bacteria | 1911 |
| 1405 | Ga0495595_0064590 | 3300053084 | Bacteria | 1721 |
| 1406 | Ga0495619_0009042 | 3300053085 | Bacteria | 6284 |
| 1407 | Ga0495619_0019509 | 3300053085 | Bacteria | 4312 |
| 1408 | Ga0495619_0023001 | 3300053085 | Bacteria | 3991 |
| 1409 | Ga0495619_0085659 | 3300053085 | Bacteria | 2129 |
| 1410 | Ga0495619_0108434 | 3300053085 | Bacteria | 1895 |
| 1411 | Ga0495619_0157170 | 3300053085 | Bacteria | 1569 |
| 1412 | Ga0495619_0242197 | 3300053085 | Bacteria | 1250 |
| 1413 | Ga0495619_0396997 | 3300053085 | Bacteria | 953 |
| 1414 | Ga0501084_0005378 | 3300054114 | Bacteria | 10496 |
| 1415 | Ga0501084_0030953 | 3300054114 | Bacteria | 4474 |
| 1416 | Ga0501084_0041480 | 3300054114 | Bacteria | 3850 |
| 1417 | Ga0501084_0056706 | 3300054114 | Bacteria | 3277 |
| 1418 | Ga0501084_0237300 | 3300054114 | Unclassified | 1539 |
| 1419 | Ga0590075_024231 | 3300059424 | Bacteria | 1523 |
| 1420 | Ga0590077_038844 | 3300059426 | Bacteria | 1054 |
| 1421 | Ga0501082_0003280 | 3300060353 | Bacteria | 14126 |
| 1422 | Ga0501082_0005105 | 3300060353 | Bacteria | 11435 |
| 1423 | Ga0501082_0017311 | 3300060353 | Bacteria | 6209 |
| 1424 | Ga0501082_0023600 | 3300060353 | Bacteria | 5306 |
| 1425 | Ga0501082_0026514 | 3300060353 | Bacteria | 4995 |
| 1426 | Ga0501082_0034614 | 3300060353 | Bacteria | 4353 |
| 1427 | Ga0501082_0038515 | 3300060353 | Bacteria | 4125 |
| 1428 | Ga0501082_0104102 | 3300060353 | Bacteria | 2455 |
| 1429 | Ga0501082_0237817 | 3300060353 | Bacteria | 1585 |
| 1430 | Ga0466962_0000598 | 3300061719 | Bacteria | 15926 |
| 1431 | Ga0466962_0001195 | 3300061719 | Bacteria | 11922 |
| 1432 | Ga0466962_0001492 | 3300061719 | Bacteria | 10912 |
| 1433 | Ga0466962_0003173 | 3300061719 | Bacteria | 7811 |
| 1434 | Ga0466962_0014519 | 3300061719 | Bacteria | 3796 |
| 1435 | Ga0466962_0018735 | 3300061719 | Bacteria | 3328 |
| 1436 | Ga0466962_0058202 | 3300061719 | Bacteria | 1845 |
| 1437 | Ga0466962_0063098 | 3300061719 | Bacteria | 1769 |
| 1438 | Ga0466962_0119325 | 3300061719 | Bacteria | 1272 |
| 1439 | Ga0530510_0003679 | 3300061734 | Bacteria | 10550 |
| 1440 | Ga0530510_0027904 | 3300061734 | Bacteria | 4046 |
| 1441 | Ga0530510_0079431 | 3300061734 | Unclassified | 2386 |
| 1442 | Ga0530510_0111812 | 3300061734 | Bacteria | 2001 |
| 1443 | Ga0530510_0150560 | 3300061734 | Bacteria | 1718 |
| 1444 | Ga0530510_0164160 | 3300061734 | Bacteria | 1643 |
| 1445 | Ga0530510_0180493 | 3300061734 | Bacteria | 1565 |
| 1446 | Ga0530510_0285603 | 3300061734 | Bacteria | 1233 |
| 1447 | Ga0530510_0362678 | 3300061734 | Bacteria | 1089 |
| 1448 | 2595319965 | 2593339198 | Bacteria | 7267884 |
| 1449 | 2865002812 | 2865002811 | Bacteria | 6333767 |
| 1450 | 2980127689 | 2980125574 | Bacteria | 5567337 |
| 1451 | 2980189383 | 2980182181 | Bacteria | 9454109 |
| 1452 | 8057737171 | 8057733483 | Bacteria | 6578323 |
| 1453 | 8057980897 | 8057977335 | Bacteria | 5694872 |
| 1454 | Ga0495653_0101722 | |||
| 1455 | ARcpr5yngRDRAFT_c001560 | |||
| 1456 | ARCol0yngRDRAFT_1001932 | |||
| 1457 | JGI24738J21930_10006797 | |||
| 1458 | JGI25406J46586_10004849 | |||
| 1459 | Ga0070658_10013411 | |||
| 1460 | Ga0070658_10018785 | |||
| 1461 | Ga0070658_10043711 | |||
| 1462 | Ga0070658_10061400 | |||
| 1463 | Ga0070658_10445281 | |||
| 1464 | Ga0070683_100007979 | |||
| 1465 | Ga0070683_100023740 | |||
| 1466 | Ga0070683_100026029 | |||
| 1467 | Ga0070683_100027711 | |||
| 1468 | Ga0070683_100031027 | |||
| 1469 | Ga0070683_100048768 | |||
| 1470 | Ga0070683_100062549 | |||
| 1471 | Ga0070683_100074737 | |||
| 1472 | Ga0070683_100074925 | |||
| 1473 | Ga0070683_100075352 | |||
| 1474 | Ga0070683_100116585 | |||
| 1475 | Ga0070683_100162115 | |||
| 1476 | Ga0068869_100061782 | |||
| 1477 | Ga0068869_100089146 | |||
| 1478 | Ga0070680_100012131 | |||
| 1479 | Ga0070680_100013107 | |||
| 1480 | Ga0070680_100025693 | |||
| 1481 | Ga0070680_100028503 | |||
| 1482 | Ga0070680_100039793 | |||
| 1483 | Ga0070680_100240542 | |||
| 1484 | Ga0070680_100436595 | |||
| 1485 | Ga0070682_100018579 | |||
| 1486 | Ga0070682_100084371 | |||
| 1487 | Ga0070682_100373803 | |||
| 1488 | Ga0068868_100016548 | |||
| 1489 | Ga0068868_100045119 | |||
| 1490 | Ga0068868_100093422 | |||
| 1491 | Ga0068868_100108360 | |||
| 1492 | Ga0070660_100001270 | |||
| 1493 | Ga0070660_100002970 | |||
| 1494 | Ga0070660_100004773 | |||
| 1495 | Ga0070660_100008078 | |||
| 1496 | Ga0070660_100019082 | |||
| 1497 | Ga0070660_100026497 | |||
| 1498 | Ga0070660_100049188 | |||
| 1499 | Ga0070660_100242717 | |||
| 1500 | Ga0070689_100051063 | |||
| 1501 | Ga0070689_100318797 | |||
| 1502 | Ga0070661_100014382 | |||
| 1503 | Ga0070661_100021080 | |||
| 1504 | Ga0070661_100079935 | |||
| 1505 | Ga0070661_100152079 | |||
| 1506 | Ga0070692_10022387 | |||
| 1507 | Ga0070692_10133081 | |||
| 1508 | Ga0070668_100178246 | |||
| 1509 | Ga0070669_100276956 | |||
| 1510 | Ga0070675_100019446 | |||
| 1511 | Ga0070675_100049643 | |||
| 1512 | Ga0070675_100059076 | |||
| 1513 | Ga0070671_100525919 | |||
| 1514 | Ga0070674_100009486 | |||
| 1515 | Ga0070674_100018240 | |||
| 1516 | Ga0070674_100022885 | |||
| 1517 | Ga0070673_100131355 | |||
| 1518 | Ga0070673_100155301 | |||
| 1519 | Ga0070688_100033025 | |||
| 1520 | Ga0070688_100067988 | |||
| 1521 | Ga0070659_100004348 | |||
| 1522 | Ga0070659_100059048 | |||
| 1523 | Ga0070659_100073431 | |||
| 1524 | Ga0070667_100273594 | |||
| 1525 | Ga0070709_10019052 | |||
| 1526 | Ga0070709_10164819 | |||
| 1527 | Ga0070714_100006895 | |||
| 1528 | Ga0070714_100048294 | |||
| 1529 | Ga0070714_100063589 | |||
| 1530 | Ga0070714_100091138 | |||
| 1531 | Ga0070714_100121260 | |||
| 1532 | Ga0070714_100189324 | |||
| 1533 | Ga0070714_100636391 | |||
| 1534 | Ga0070714_100683034 | |||
| 1535 | Ga0070713_100021324 | |||
| 1536 | Ga0070713_100088924 | |||
| 1537 | Ga0070713_100091943 | |||
| 1538 | Ga0070713_100140398 | |||
| 1539 | Ga0070713_100460947 | |||
| 1540 | Ga0070710_10008029 | |||
| 1541 | Ga0070710_10020278 | |||
| 1542 | Ga0070701_10005086 | |||
| 1543 | Ga0070701_10013945 | |||
| 1544 | Ga0070711_100010821 | |||
| 1545 | Ga0070711_100032405 | |||
| 1546 | Ga0070705_100053749 | |||
| 1547 | Ga0070705_100162481 | |||
| 1548 | Ga0070700_100033017 | |||
| 1549 | Ga0070700_100119688 | |||
| 1550 | Ga0070700_100170488 | |||
| 1551 | Ga0070700_100198483 | |||
| 1552 | Ga0070700_100235615 | |||
| 1553 | Ga0070694_100198247 | |||
| 1554 | Ga0070694_100472233 | |||
| 1555 | Ga0070708_100008593 | |||
| 1556 | Ga0070708_100249305 | |||
| 1557 | Ga0070708_100316606 | |||
| 1558 | Ga0070708_100339476 | |||
| 1559 | Ga0070708_100380464 | |||
| 1560 | Ga0070663_100534394 | |||
| 1561 | Ga0070678_100015134 | |||
| 1562 | Ga0070678_100252796 | |||
| 1563 | Ga0070678_100263824 | |||
| 1564 | Ga0070662_100009840 | |||
| 1565 | Ga0070681_10000752 | |||
| 1566 | Ga0070681_10002017 | |||
| 1567 | Ga0070681_10005681 | |||
| 1568 | Ga0070681_10017532 | |||
| 1569 | Ga0070681_10021069 | |||
| 1570 | Ga0070681_10034642 | |||
| 1571 | Ga0070681_10049180 | |||
| 1572 | Ga0070681_10074259 | |||
| 1573 | Ga0070681_10136638 | |||
| 1574 | Ga0070681_10183804 | |||
| 1575 | Ga0070681_10203641 | |||
| 1576 | Ga0070681_10231856 | |||
| 1577 | Ga0068867_100311158 | |||
| 1578 | Ga0068867_100364188 | |||
| 1579 | Ga0070685_10098142 | |||
| 1580 | Ga0070685_10115425 | |||
| 1581 | Ga0070706_100046490 | |||
| 1582 | Ga0070707_100001941 | |||
| 1583 | Ga0070698_100032412 | |||
| 1584 | Ga0070698_100048670 | |||
| 1585 | Ga0070698_100126618 | |||
| 1586 | Ga0070698_100193803 | |||
| 1587 | Ga0070699_100239827 | |||
| 1588 | Ga0070679_100009888 | |||
| 1589 | Ga0070679_100067836 | |||
| 1590 | Ga0070679_100085797 | |||
| 1591 | Ga0070679_100096997 | |||
| 1592 | Ga0070679_100124849 | |||
| 1593 | Ga0070679_100140712 | |||
| 1594 | Ga0070679_100149211 | |||
| 1595 | Ga0070679_100176236 | |||
| 1596 | Ga0070679_100179857 | |||
| 1597 | Ga0070684_100001782 | |||
| 1598 | Ga0070684_100003376 | |||
| 1599 | Ga0070684_100009691 | |||
| 1600 | Ga0070684_100035656 | |||
| 1601 | Ga0070684_100047239 | |||
| 1602 | Ga0070684_100063523 | |||
| 1603 | Ga0070684_100071670 | |||
| 1604 | Ga0070684_100261980 | |||
| 1605 | Ga0070684_100372737 | |||
| 1606 | Ga0070684_100393035 | |||
| 1607 | Ga0068853_100039110 | |||
| 1608 | Ga0068853_100069845 | |||
| 1609 | Ga0068853_100258566 | |||
| 1610 | Ga0068853_100298428 | |||
| 1611 | Ga0070672_100012805 | |||
| 1612 | Ga0070672_100015600 | |||
| 1613 | Ga0070672_100082732 | |||
| 1614 | Ga0070686_100057330 | |||
| 1615 | Ga0070686_100256980 | |||
| 1616 | Ga0070695_100000023 | |||
| 1617 | Ga0070695_100246276 | |||
| 1618 | Ga0070693_100041430 | |||
| 1619 | Ga0070665_100049773 | |||
| 1620 | Ga0070665_100196199 | |||
| 1621 | Ga0070665_100532895 | |||
| 1622 | Ga0070704_100083154 | |||
| 1623 | Ga0070704_100189513 | |||
| 1624 | Ga0070704_100379892 | |||
| 1625 | Ga0068855_100019546 | |||
| 1626 | Ga0068855_100037023 | |||
| 1627 | Ga0068855_100039368 | |||
| 1628 | Ga0068855_100148972 | |||
| 1629 | Ga0068855_100429807 | |||
| 1630 | Ga0068855_100435032 | |||
| 1631 | Ga0068855_100551088 | |||
| 1632 | Ga0070664_100029659 | |||
| 1633 | Ga0070664_100061027 | |||
| 1634 | Ga0070664_100324830 | |||
| 1635 | Ga0070664_100330458 | |||
| 1636 | Ga0070664_100504061 | |||
| 1637 | Ga0068857_100024365 | |||
| 1638 | Ga0068857_100186917 | |||
| 1639 | Ga0068857_100237857 | |||
| 1640 | Ga0068857_100354762 | |||
| 1641 | Ga0068854_100228497 | |||
| 1642 | Ga0068856_100038589 | |||
| 1643 | Ga0068856_100048431 | |||
| 1644 | Ga0068856_100417581 | |||
| 1645 | Ga0068856_100723401 | |||
| 1646 | Ga0070702_100012658 | |||
| 1647 | Ga0070702_100036693 | |||
| 1648 | Ga0070702_100065963 | |||
| 1649 | Ga0068852_100004659 | |||
| 1650 | Ga0068852_100072151 | |||
| 1651 | Ga0068852_100144118 | |||
| 1652 | Ga0068852_100185191 | |||
| 1653 | Ga0068852_100297929 | |||
| 1654 | Ga0068852_100427408 | |||
| 1655 | Ga0068859_100038770 | |||
| 1656 | Ga0068864_100059174 | |||
| 1657 | Ga0068864_100375601 | |||
| 1658 | Ga0068861_100494376 | |||
| 1659 | Ga0068851_10024703 | |||
| 1660 | Ga0068851_10077983 | |||
| 1661 | Ga0068870_10052517 | |||
| 1662 | Ga0068870_10063406 | |||
| 1663 | Ga0068863_100323597 | |||
| 1664 | Ga0068858_100388864 | |||
| 1665 | Ga0068858_100821870 | |||
| 1666 | Ga0068862_100240533 | |||
| 1667 | Ga0081455_10040530 | |||
| 1668 | Ga0081455_10068251 | |||
| 1669 | Ga0081455_10072222 | |||
| 1670 | Ga0081538_10066949 | |||
| 1671 | Ga0081539_10000041 | |||
| 1672 | Ga0081539_10002453 | |||
| 1673 | Ga0081539_10002628 | |||
| 1674 | Ga0081539_10038724 | |||
| 1675 | Ga0070717_10008772 | |||
| 1676 | Ga0070717_10026780 | |||
| 1677 | Ga0070717_10035751 | |||
| 1678 | Ga0070717_10061585 | |||
| 1679 | Ga0070717_10072567 | |||
| 1680 | Ga0070717_10074096 | |||
| 1681 | Ga0070717_10113236 | |||
| 1682 | Ga0075365_10022759 | |||
| 1683 | Ga0075364_10009313 | |||
| 1684 | Ga0075432_10012221 | |||
| 1685 | Ga0075432_10028172 | |||
| 1686 | Ga0070712_100040492 | |||
| 1687 | Ga0070712_100111583 | |||
| 1688 | Ga0075367_10139092 | |||
| 1689 | Ga0097621_100136874 | |||
| 1690 | Ga0097621_100348369 | |||
| 1691 | Ga0068871_100073973 | |||
| 1692 | Ga0075428_100001880 | |||
| 1693 | Ga0075428_100097985 | |||
| 1694 | Ga0075428_100571757 | |||
| 1695 | Ga0075428_100658881 | |||
| 1696 | Ga0075428_100752410 | |||
| 1697 | Ga0075430_100006634 | |||
| 1698 | Ga0075430_100011301 | |||
| 1699 | Ga0075431_100050926 | |||
| 1700 | Ga0075431_100242987 | |||
| 1701 | Ga0075433_10003720 | |||
| 1702 | Ga0075433_10041277 | |||
| 1703 | Ga0075433_10211594 | |||
| 1704 | Ga0075434_100002257 | |||
| 1705 | Ga0075434_100006179 | |||
| 1706 | Ga0075434_100086779 | |||
| 1707 | Ga0075429_100302782 | |||
| 1708 | Ga0068865_100008889 | |||
| 1709 | Ga0068865_100077185 | |||
| 1710 | Ga0068865_100137542 | |||
| 1711 | Ga0068865_100160025 | |||
| 1712 | Ga0097620_100038771 | |||
| 1713 | Ga0105240_10026332 | |||
| 1714 | Ga0105240_10032019 | |||
| 1715 | Ga0105240_10049190 | |||
| 1716 | Ga0105240_10156264 | |||
| 1717 | Ga0105240_10222520 | |||
| 1718 | Ga0105240_10465486 | |||
| 1719 | Ga0111539_10027469 | |||
| 1720 | Ga0111539_10132647 | |||
| 1721 | Ga0111539_10180174 | |||
| 1722 | Ga0111539_10202140 | |||
| 1723 | Ga0111539_10377886 | |||
| 1724 | Ga0111539_10504323 | |||
| 1725 | Ga0111539_10531028 | |||
| 1726 | Ga0105245_10012463 | |||
| 1727 | Ga0105245_10041920 | |||
| 1728 | Ga0105245_10071158 | |||
| 1729 | Ga0105245_10102280 | |||
| 1730 | Ga0105245_10409154 | |||
| 1731 | Ga0114129_10009794 | |||
| 1732 | Ga0114129_10012617 | |||
| 1733 | Ga0114129_10352007 | |||
| 1734 | Ga0114129_10398914 | |||
| 1735 | Ga0105243_10004975 | |||
| 1736 | Ga0105243_10030521 | |||
| 1737 | Ga0105243_10150105 | |||
| 1738 | Ga0105243_10198560 | |||
| 1739 | Ga0105243_10213015 | |||
| 1740 | Ga0105243_10227638 | |||
| 1741 | Ga0105243_10324685 | |||
| 1742 | Ga0105243_10453114 | |||
| 1743 | Ga0105241_10083627 | |||
| 1744 | Ga0105241_10351046 | |||
| 1745 | Ga0105242_10012764 | |||
| 1746 | Ga0105242_10027204 | |||
| 1747 | Ga0105248_10083024 | |||
| 1748 | Ga0105248_10158946 | |||
| 1749 | Ga0105248_10198029 | |||
| 1750 | Ga0105237_10019801 | |||
| 1751 | Ga0105237_10399339 | |||
| 1752 | Ga0105237_10467088 | |||
| 1753 | Ga0105238_10008930 | |||
| 1754 | Ga0105249_10167999 | |||
| 1755 | Ga0105249_10446111 | |||
| 1756 | Ga0105239_10031224 | |||
| 1757 | Ga0105239_10114954 | |||
| 1758 | Ga0105239_10204940 | |||
| 1759 | Ga0105246_10068750 | |||
| 1760 | Ga0105246_10188411 | |||
| 1761 | Ga0105246_10192987 | |||
| 1762 | Ga0157373_10039361 | |||
| 1763 | Ga0157373_10102298 | |||
| 1764 | Ga0157373_10219677 | |||
| 1765 | Ga0157371_10018805 | |||
| 1766 | Ga0157371_10481985 | |||
| 1767 | Ga0157370_10013444 | |||
| 1768 | Ga0157370_10165689 | |||
| 1769 | Ga0157370_10175342 | |||
| 1770 | Ga0157370_10176999 | |||
| 1771 | Ga0157370_10197999 | |||
| 1772 | Ga0157370_10292920 | |||
| 1773 | Ga0157369_10002254 | |||
| 1774 | Ga0157369_10003310 | |||
| 1775 | Ga0157369_10036038 | |||
| 1776 | Ga0157369_10085918 | |||
| 1777 | Ga0157369_10114868 | |||
| 1778 | Ga0157369_10144649 | |||
| 1779 | Ga0157369_10202132 | |||
| 1780 | Ga0157369_10673251 | |||
| 1781 | Ga0157369_10907587 | |||
| 1782 | Ga0157374_10186668 | |||
| 1783 | Ga0157378_10444291 | |||
| 1784 | Ga0157378_10453109 | |||
| 1785 | Ga0163162_10175701 | |||
| 1786 | Ga0157372_10009212 | |||
| 1787 | Ga0157372_10011672 | |||
| 1788 | Ga0157372_10052151 | |||
| 1789 | Ga0157372_10078327 | |||
| 1790 | Ga0157372_10134440 | |||
| 1791 | Ga0157372_10141729 | |||
| 1792 | Ga0157372_10172119 | |||
| 1793 | Ga0157372_10199540 | |||
| 1794 | Ga0157372_10346660 | |||
| 1795 | Ga0157375_10012073 | |||
| 1796 | Ga0157375_10041504 | |||
| 1797 | Ga0157375_10206595 | |||
| 1798 | Ga0157375_10798551 | |||
| 1799 | Ga0163163_10023740 | |||
| 1800 | Ga0163163_10406745 | |||
| 1801 | Ga0163163_10424123 | |||
| 1802 | Ga0163163_10963334 | |||
| 1803 | Ga0157380_10009015 | |||
| 1804 | Ga0157380_10245130 | |||
| 1805 | Ga0157380_10517452 | |||
| 1806 | Ga0182008_10006559 | |||
| 1807 | Ga0157377_10135199 | |||
| 1808 | Ga0157379_10398832 | |||
| 1809 | Ga0157379_10566514 | |||
| 1810 | Ga0157379_10717581 | |||
| 1811 | Ga0157376_10042942 | |||
| 1812 | Ga0157376_10109271 | |||
| 1813 | Ga0157376_10121033 | |||
| 1814 | Ga0157376_10175331 | |||
| 1815 | Ga0182007_10004120 | |||
| 1816 | Ga0163161_10047334 | |||
| 1817 | Ga0163161_10182995 | |||
| 1818 | Ga0163161_10446385 | |||
| 1819 | Ga0197907_11381384 | |||
| 1820 | Ga0206356_11704696 | |||
| 1821 | Ga0206353_10444029 | |||
| 1822 | Ga0206353_10792442 | |||
| 1823 | Ga0206353_11628412 | |||
| 1824 | Ga0206353_11919948 | |||
| 1825 | Ga0206353_12056300 | |||
| 1826 | Ga0213876_10084567 | |||
| 1827 | Ga0209675_1008561 | |||
| 1828 | Ga0209025_1009986 | |||
| 1829 | Ga0207656_10022214 | |||
| 1830 | Ga0207692_10181249 | |||
| 1831 | Ga0207642_10011450 | |||
| 1832 | Ga0207688_10058884 | |||
| 1833 | Ga0207685_10038664 | |||
| 1834 | Ga0207699_10116782 | |||
| 1835 | Ga0207699_10265645 | |||
| 1836 | Ga0207643_10003437 | |||
| 1837 | Ga0207643_10046494 | |||
| 1838 | Ga0207643_10091724 | |||
| 1839 | Ga0207705_10015230 | |||
| 1840 | Ga0207705_10047775 | |||
| 1841 | Ga0207705_10067379 | |||
| 1842 | Ga0207705_10189102 | |||
| 1843 | Ga0207705_10204340 | |||
| 1844 | Ga0207705_10299831 | |||
| 1845 | Ga0207684_10056734 | |||
| 1846 | Ga0207654_10240471 | |||
| 1847 | Ga0207707_10028744 | |||
| 1848 | Ga0207707_10029462 | |||
| 1849 | Ga0207707_10030859 | |||
| 1850 | Ga0207707_10044254 | |||
| 1851 | Ga0207707_10049108 | |||
| 1852 | Ga0207707_10094757 | |||
| 1853 | Ga0207707_10128936 | |||
| 1854 | Ga0207707_10153119 | |||
| 1855 | Ga0207707_10192254 | |||
| 1856 | Ga0207707_10223533 | |||
| 1857 | Ga0207707_10269011 | |||
| 1858 | Ga0207707_10450330 | |||
| 1859 | Ga0207695_10027775 | |||
| 1860 | Ga0207695_10065253 | |||
| 1861 | Ga0207695_10735808 | |||
| 1862 | Ga0207695_10745573 | |||
| 1863 | Ga0207693_10000945 | |||
| 1864 | Ga0207693_10003076 | |||
| 1865 | Ga0207693_10010892 | |||
| 1866 | Ga0207663_10130380 | |||
| 1867 | Ga0207663_10221507 | |||
| 1868 | Ga0207660_10023887 | |||
| 1869 | Ga0207660_10037361 | |||
| 1870 | Ga0207660_10041411 | |||
| 1871 | Ga0207660_10049435 | |||
| 1872 | Ga0207660_10054308 | |||
| 1873 | Ga0207660_10056165 | |||
| 1874 | Ga0207660_10067458 | |||
| 1875 | Ga0207660_10243537 | |||
| 1876 | Ga0207662_10012577 | |||
| 1877 | Ga0207662_10077167 | |||
| 1878 | Ga0207662_10155322 | |||
| 1879 | Ga0207662_10324935 | |||
| 1880 | Ga0207657_10000054 | |||
| 1881 | Ga0207657_10000651 | |||
| 1882 | Ga0207657_10000941 | |||
| 1883 | Ga0207657_10003420 | |||
| 1884 | Ga0207657_10007679 | |||
| 1885 | Ga0207657_10011480 | |||
| 1886 | Ga0207657_10028514 | |||
| 1887 | Ga0207657_10075509 | |||
| 1888 | Ga0207657_10087118 | |||
| 1889 | Ga0207657_10200218 | |||
| 1890 | Ga0207649_10023773 | |||
| 1891 | Ga0207649_10048373 | |||
| 1892 | Ga0207649_10337633 | |||
| 1893 | Ga0207652_10008146 | |||
| 1894 | Ga0207652_10011668 | |||
| 1895 | Ga0207652_10025098 | |||
| 1896 | Ga0207652_10084158 | |||
| 1897 | Ga0207652_10088562 | |||
| 1898 | Ga0207652_10107482 | |||
| 1899 | Ga0207652_10150283 | |||
| 1900 | Ga0207652_10250250 | |||
| 1901 | Ga0207646_10185298 | |||
| 1902 | Ga0207694_10132985 | |||
| 1903 | Ga0207650_10148446 | |||
| 1904 | Ga0207659_10042506 | |||
| 1905 | Ga0207659_10333485 | |||
| 1906 | Ga0207687_10024068 | |||
| 1907 | Ga0207687_10054803 | |||
| 1908 | Ga0207687_10140152 | |||
| 1909 | Ga0207700_10014992 | |||
| 1910 | Ga0207700_10057152 | |||
| 1911 | Ga0207700_10103980 | |||
| 1912 | Ga0207700_10227987 | |||
| 1913 | Ga0207700_10406349 | |||
| 1914 | Ga0207664_10016621 | |||
| 1915 | Ga0207664_10031203 | |||
| 1916 | Ga0207664_10043861 | |||
| 1917 | Ga0207664_10071700 | |||
| 1918 | Ga0207664_10103770 | |||
| 1919 | Ga0207664_10107472 | |||
| 1920 | Ga0207664_10218969 | |||
| 1921 | Ga0207664_10386387 | |||
| 1922 | Ga0207644_10111211 | |||
| 1923 | Ga0207644_10305694 | |||
| 1924 | Ga0207690_10415490 | |||
| 1925 | Ga0207706_10019795 | |||
| 1926 | Ga0207706_10030969 | |||
| 1927 | Ga0207686_10030300 | |||
| 1928 | Ga0207686_10043788 | |||
| 1929 | Ga0207686_10252095 | |||
| 1930 | Ga0207709_10005525 | |||
| 1931 | Ga0207709_10023230 | |||
| 1932 | Ga0207709_10146909 | |||
| 1933 | Ga0207670_10086416 | |||
| 1934 | Ga0207669_10004592 | |||
| 1935 | Ga0207669_10155017 | |||
| 1936 | Ga0207669_10175806 | |||
| 1937 | Ga0207669_10228737 | |||
| 1938 | Ga0207669_10270898 | |||
| 1939 | Ga0207704_10095032 | |||
| 1940 | Ga0207704_10250984 | |||
| 1941 | Ga0207665_10000197 | |||
| 1942 | Ga0207665_10406097 | |||
| 1943 | Ga0207691_10003481 | |||
| 1944 | Ga0207691_10039570 | |||
| 1945 | Ga0207691_10041699 | |||
| 1946 | Ga0207691_10361930 | |||
| 1947 | Ga0207711_10054853 | |||
| 1948 | Ga0207711_10178001 | |||
| 1949 | Ga0207711_10299756 | |||
| 1950 | Ga0207711_10417577 | |||
| 1951 | Ga0207689_10037755 | |||
| 1952 | Ga0207689_10085743 | |||
| 1953 | Ga0207661_10003452 | |||
| 1954 | Ga0207661_10010909 | |||
| 1955 | Ga0207661_10042119 | |||
| 1956 | Ga0207661_10052106 | |||
| 1957 | Ga0207661_10089150 | |||
| 1958 | Ga0207661_10104997 | |||
| 1959 | Ga0207661_10289643 | |||
| 1960 | Ga0207679_10070915 | |||
| 1961 | Ga0207679_10254826 | |||
| 1962 | Ga0207679_10288637 | |||
| 1963 | Ga0207667_10064335 | |||
| 1964 | Ga0207667_10170277 | |||
| 1965 | Ga0207667_10181639 | |||
| 1966 | Ga0207667_10364629 | |||
| 1967 | Ga0207651_10015042 | |||
| 1968 | Ga0207712_10479766 | |||
| 1969 | Ga0207668_10270192 | |||
| 1970 | Ga0207640_10247489 | |||
| 1971 | Ga0207658_10101190 | |||
| 1972 | Ga0207677_10167841 | |||
| 1973 | Ga0207677_10190043 | |||
| 1974 | Ga0207703_10088798 | |||
| 1975 | Ga0207678_10164022 | |||
| 1976 | Ga0207678_10203479 | |||
| 1977 | Ga0207708_10012056 | |||
| 1978 | Ga0207708_10035717 | |||
| 1979 | Ga0207708_10091858 | |||
| 1980 | Ga0207708_10237858 | |||
| 1981 | Ga0207702_10025541 | |||
| 1982 | Ga0207702_10136192 | |||
| 1983 | Ga0207702_10386350 | |||
| 1984 | Ga0207641_10271733 | |||
| 1985 | Ga0207648_10060466 | |||
| 1986 | Ga0207648_10199573 | |||
| 1987 | Ga0207676_10040863 | |||
| 1988 | Ga0207674_10007806 | |||
| 1989 | Ga0207674_10059480 | |||
| 1990 | Ga0207674_10062121 | |||
| 1991 | Ga0207674_10083993 | |||
| 1992 | Ga0207674_10181180 | |||
| 1993 | Ga0207674_10357134 | |||
| 1994 | Ga0207674_10481678 | |||
| 1995 | Ga0207683_10012269 | |||
| 1996 | Ga0207683_10051997 | |||
| 1997 | Ga0207683_10064686 | |||
| 1998 | Ga0207683_10067965 | |||
| 1999 | Ga0207683_10075870 | |||
| 2000 | Ga0207683_10147150 | |||
| 2001 | Ga0207683_10218442 | |||
| 2002 | Ga0207683_10320280 | |||
| 2003 | Ga0207683_10548550 | |||
| 2004 | Ga0207698_10024923 | |||
| 2005 | Ga0207698_10065002 | |||
| 2006 | Ga0207698_10065032 | |||
| 2007 | Ga0207698_10309576 | |||
| 2008 | Ga0207428_10001345 | |||
| 2009 | Ga0207428_10021309 | |||
| 2010 | Ga0207428_10209318 | |||
| 2011 | Ga0268266_10140235 | |||
| 2012 | Ga0268266_10167876 | |||
| 2013 | Ga0268265_10172190 | |||
| 2014 | Ga0268264_10141833 | |||
| 2015 | Ga0265337_1061408 | |||
| 2016 | Ga0265319_1000592 | |||
| 2017 | Ga0265319_1039322 | |||
| 2018 | Ga0265334_10038841 | |||
| 2019 | Ga0265334_10065932 | |||
| 2020 | Ga0265318_10000219 | |||
| 2021 | Ga0265318_10009436 | |||
| 2022 | Ga0265318_10010276 | |||
| 2023 | Ga0265318_10032204 | |||
| 2024 | Ga0265318_10069439 | |||
| 2025 | Ga0265318_10100064 | |||
| 2026 | Ga0265323_10038956 | |||
| 2027 | Ga0265322_10002803 | |||
| 2028 | Ga0265322_10014176 | |||
| 2029 | Ga0265336_10003156 | |||
| 2030 | Ga0265336_10023958 | |||
| 2031 | Ga0265338_10003549 | |||
| 2032 | Ga0265338_10017781 | |||
| 2033 | Ga0265338_10036006 | |||
| 2034 | Ga0265338_10059739 | |||
| 2035 | Ga0265338_10070945 | |||
| 2036 | Ga0265338_10104127 | |||
| 2037 | Ga0265338_10408001 | |||
| 2038 | Ga0265324_10005981 | |||
| 2039 | Ga0265330_10036426 | |||
| 2040 | Ga0265332_10019305 | |||
| 2041 | Ga0265328_10005682 | |||
| 2042 | Ga0265320_10029161 | |||
| 2043 | Ga0265325_10000443 | |||
| 2044 | Ga0265325_10035895 | |||
| 2045 | Ga0265329_10017899 | |||
| 2046 | Ga0265340_10001255 | |||
| 2047 | Ga0265340_10020769 | |||
| 2048 | Ga0265340_10070179 | |||
| 2049 | Ga0265340_10120106 | |||
| 2050 | Ga0265340_10126452 | |||
| 2051 | Ga0265339_10017400 | |||
| 2052 | Ga0265331_10038599 | |||
| 2053 | Ga0265331_10085512 | |||
| 2054 | Ga0265327_10007162 | |||
| 2055 | Ga0265327_10009396 | |||
| 2056 | Ga0265327_10103559 | |||
| 2057 | Ga0265316_10004108 | |||
| 2058 | Ga0265316_10019150 | |||
| 2059 | Ga0265316_10024864 | |||
| 2060 | Ga0265316_10059063 | |||
| 2061 | Ga0307408_100022016 | |||
| 2062 | Ga0307408_100471827 | |||
| 2063 | Ga0265313_10006965 | |||
| 2064 | Ga0265313_10013100 | |||
| 2065 | Ga0265314_10004663 | |||
| 2066 | Ga0265314_10028527 | |||
| 2067 | Ga0265314_10308812 | |||
| 2068 | Ga0307405_10191883 | |||
| 2069 | Ga0307405_10232169 | |||
| 2070 | Ga0307413_10212974 | |||
| 2071 | Ga0307413_10239100 | |||
| 2072 | Ga0307410_10257359 | |||
| 2073 | Ga0307406_10023579 | |||
| 2074 | Ga0307406_10065311 | |||
| 2075 | Ga0307412_10030495 | |||
| 2076 | Ga0307409_100070066 | |||
| 2077 | Ga0307416_100004274 | |||
| 2078 | Ga0307411_10084052 | |||
| 2079 | Ga0307415_100000048 | |||
| 2080 | Ga0307415_100028119 | |||
| 2081 | Ga0307415_100055652 | |||
| 2082 | Ga0307415_100097749 | |||
| 2083 | Ga0316583_10020213 | |||
| 2084 | Ga0373944_0006564 | |||
| 2085 | Ga0373949_0015995 | |||
| 2086 | Ga0373936_0066570 | |||
| 2087 | Ga0373941_0080140 | |||
| 2088 | Ga0373945_0002311 | |||
| 2089 | Ga0373956_0034778 | |||
| 2090 | Ga0373956_0072900 | |||
| 2091 | Ga0373956_0121223 | |||
| 2092 | Ga0373943_0000101 | |||
| 2093 | Ga0373943_0000290 | |||
| 2094 | Ga0373946_0002224 | |||
| 2095 | Ga0373946_0023494 | |||
| 2096 | Ga0373955_0165172 | |||
| 2097 | Ga0373942_0057547 | |||
| 2098 | Ga0373924_0029322 | |||
| 2099 | Ga0373931_0043124 | |||
| 2100 | Ga0373931_0103259 | |||
| 2101 | Ga0373931_0103957 | |||
| 2102 | Ga0373931_0257601 | |||
| 2103 | Ga0373931_0300488 | |||
| 2104 | Ga0373935_0045791 | |||
| 2105 | Ga0373935_0086737 | |||
| 2106 | Ga0373927_0038068 | |||
| 2107 | Ga0373933_0033168 | |||
| 2108 | Ga0373947_0000237 | |||
| 2109 | Ga0373947_0015162 | |||
| 2110 | Ga0373947_0346265 | |||
| 2111 | Ga0373937_0000548 | |||
| 2112 | Ga0373937_0032610 | |||
| 2113 | Ga0373937_0211832 | |||
| 2114 | Ga0373937_0425928 | |||
| 2115 | Ga0373937_0665559 | |||
| 2116 | Ga0373937_0668637 | |||
| 2117 | Ga0373925_0004494 | |||
| 2118 | Ga0373925_0004710 | |||
| 2119 | Ga0373925_0012524 | |||
| 2120 | Ga0395899_0009288 | |||
| 2121 | Ga0395899_0016395 | |||
| 2122 | Ga0395899_0021226 | |||
| 2123 | Ga0395899_0072221 | |||
| 2124 | Ga0395900_0004141 | |||
| 2125 | Ga0395900_0004314 | |||
| 2126 | Ga0395900_0004353 | |||
| 2127 | Ga0395900_0006681 | |||
| 2128 | Ga0395900_0007485 | |||
| 2129 | Ga0395900_0015954 | |||
| 2130 | Ga0395900_0029652 | |||
| 2131 | Ga0395900_0063165 | |||
| 2132 | Ga0395900_0066196 | |||
| 2133 | Ga0395900_0073557 | |||
| 2134 | Ga0395900_0077425 | |||
| 2135 | Ga0395900_0115519 | |||
| 2136 | Ga0395900_0173198 | |||
| 2137 | Ga0395900_0211315 | |||
| 2138 | Ga0395900_0231688 | |||
| 2139 | Ga0395900_0304692 | |||
| 2140 | Ga0395898_0001584 | |||
| 2141 | Ga0395898_0004730 | |||
| 2142 | Ga0395898_0030989 | |||
| 2143 | Ga0395898_0034010 | |||
| 2144 | Ga0395898_0035798 | |||
| 2145 | Ga0395898_0050552 | |||
| 2146 | Ga0395898_0082396 | |||
| 2147 | Ga0395898_0086021 | |||
| 2148 | Ga0395898_0088036 | |||
| 2149 | Ga0395898_0109773 | |||
| 2150 | Ga0395898_0187118 | |||
| 2151 | Ga0395898_0233904 | |||
| 2152 | Ga0395898_0252552 | |||
| 2153 | Ga0395898_0267801 | |||
| 2154 | Ga0395898_0334803 | |||
| 2155 | Ga0395898_0420055 | |||
| 2156 | Ga0395898_0450759 | |||
| 2157 | Ga0395898_0814776 | |||
| 2158 | Ga0395905_0005694 | |||
| 2159 | Ga0395905_0009706 | |||
| 2160 | Ga0395905_0013717 | |||
| 2161 | Ga0395905_0024820 | |||
| 2162 | Ga0395905_0044481 | |||
| 2163 | Ga0395905_0089378 | |||
| 2164 | Ga0395905_0101749 | |||
| 2165 | Ga0395905_0117239 | |||
| 2166 | Ga0395905_0350016 | |||
| 2167 | Ga0395905_0357893 | |||
| 2168 | Ga0395905_0426103 | |||
| 2169 | Ga0395901_0001414 | |||
| 2170 | Ga0395901_0005323 | |||
| 2171 | Ga0395901_0007183 | |||
| 2172 | Ga0395901_0007401 | |||
| 2173 | Ga0395901_0013699 | |||
| 2174 | Ga0395901_0086046 | |||
| 2175 | Ga0395901_0116682 | |||
| 2176 | Ga0395901_0121536 | |||
| 2177 | Ga0395901_0187619 | |||
| 2178 | Ga0395901_0188533 | |||
| 2179 | Ga0395901_0233911 | |||
| 2180 | Ga0395901_0244858 | |||
| 2181 | Ga0395901_0351393 | |||
| 2182 | Ga0395901_0414855 | |||
| 2183 | Ga0395901_0417370 | |||
| 2184 | Ga0436365_0146920 | |||
| 2185 | Ga0439438_053703 | |||
| 2186 | Ga0439453_0003323 | |||
| 2187 | Ga0439465_0095657 | |||
| 2188 | Ga0451807_0309110 | |||
| 2189 | Ga0451853_0818869 | |||
| 2190 | Ga0451853_3865135 | |||
| 2191 | Ga0439437_007421 | |||
| 2192 | Ga0439448_0029428 | |||
| 2193 | Ga0439454_015131 | |||
| 2194 | Ga0450920_009778 | |||
| 2195 | Ga0450920_031767 | |||
| 2196 | Ga0450907_014605 | |||
| 2197 | Ga0439446_0017662 | |||
| 2198 | Ga0439434_0049300 | |||
| 2199 | Ga0450916_019243 | |||
| 2200 | Ga0466969_0001545 | |||
| 2201 | Ga0466969_0067851 | |||
| 2202 | Ga0466969_0183464 | |||
| 2203 | Ga0466972_0066247 | |||
| 2204 | Ga0466965_0027247 | |||
| 2205 | Ga0466966_0007472 | |||
| 2206 | Ga0466966_0017745 | |||
| 2207 | Ga0466966_0033212 | |||
| 2208 | Ga0466966_0072772 | |||
| 2209 | Ga0466966_0076834 | |||
| 2210 | Ga0466961_0009349 | |||
| 2211 | Ga0466961_0011374 | |||
| 2212 | Ga0466961_0013407 | |||
| 2213 | Ga0466961_0029298 | |||
| 2214 | Ga0466961_0053522 | |||
| 2215 | Ga0466961_0056569 | |||
| 2216 | Ga0466961_0061136 | |||
| 2217 | Ga0466961_0081319 | |||
| 2218 | Ga0466961_0086091 | |||
| 2219 | Ga0466961_0114395 | |||
| 2220 | Ga0466961_0178265 | |||
| 2221 | Ga0466961_0254087 | |||
| 2222 | Ga0466963_0000451 | |||
| 2223 | Ga0466963_0001783 | |||
| 2224 | Ga0466963_0004649 | |||
| 2225 | Ga0466963_0005272 | |||
| 2226 | Ga0466963_0008370 | |||
| 2227 | Ga0466963_0008664 | |||
| 2228 | Ga0466963_0015488 | |||
| 2229 | Ga0466963_0015753 | |||
| 2230 | Ga0466963_0022821 | |||
| 2231 | Ga0466963_0023721 | |||
| 2232 | Ga0466963_0026808 | |||
| 2233 | Ga0466963_0050622 | |||
| 2234 | Ga0466963_0072120 | |||
| 2235 | Ga0466963_0099061 | |||
| 2236 | Ga0466963_0105604 | |||
| 2237 | Ga0466963_0117852 | |||
| 2238 | Ga0466963_0130194 | |||
| 2239 | Ga0466963_0176210 | |||
| 2240 | Ga0466963_0184670 | |||
| 2241 | Ga0466963_0268813 | |||
| 2242 | Ga0466963_0369935 | |||
| 2243 | Ga0466964_0000404 | |||
| 2244 | Ga0466964_0000824 | |||
| 2245 | Ga0466964_0002750 | |||
| 2246 | Ga0466964_0018060 | |||
| 2247 | Ga0466964_0037965 | |||
| 2248 | Ga0466964_0051495 | |||
| 2249 | Ga0466964_0102256 | |||
| 2250 | Ga0466964_0108795 | |||
| 2251 | Ga0466964_0159663 | |||
| 2252 | Ga0466971_0001469 | |||
| 2253 | Ga0466971_0002972 | |||
| 2254 | Ga0466971_0005645 | |||
| 2255 | Ga0466971_0032261 | |||
| 2256 | Ga0466971_0034659 | |||
| 2257 | Ga0466971_0054704 | |||
| 2258 | Ga0466968_0038554 | |||
| 2259 | Ga0466968_0045954 | |||
| 2260 | Ga0466968_0146967 | |||
| 2261 | Ga0466970_0079233 | |||
| 2262 | Ga0466957_0001760 | |||
| 2263 | Ga0466957_0005697 | |||
| 2264 | Ga0466957_0007116 | |||
| 2265 | Ga0466957_0007547 | |||
| 2266 | Ga0466957_0015118 | |||
| 2267 | Ga0466957_0015472 | |||
| 2268 | Ga0466957_0018383 | |||
| 2269 | Ga0466957_0028975 | |||
| 2270 | Ga0466957_0138564 | |||
| 2271 | Ga0466957_0230241 | |||
| 2272 | Ga0466957_0337816 | |||
| 2273 | Ga0466957_0446378 | |||
| 2274 | Ga0466960_0005817 | |||
| 2275 | Ga0466960_0112623 | |||
| 2276 | Ga0466959_0002872 | |||
| 2277 | Ga0466959_0008231 | |||
| 2278 | Ga0466959_0020641 | |||
| 2279 | Ga0466959_0031400 | |||
| 2280 | Ga0466959_0080432 | |||
| 2281 | Ga0466959_0100915 | |||
| 2282 | Ga0466959_0134735 | |||
| 2283 | Ga0466959_0216182 | |||
| 2284 | Ga0466959_0276535 | |||
| 2285 | Ga0466959_0284828 | |||
| 2286 | Ga0466958_0002810 | |||
| 2287 | Ga0466958_0005731 | |||
| 2288 | Ga0466958_0023422 | |||
| 2289 | Ga0466958_0047999 | |||
| 2290 | Ga0466958_0053328 | |||
| 2291 | Ga0466958_0105107 | |||
| 2292 | Ga0466958_0114939 | |||
| 2293 | Ga0466958_0129224 | |||
| 2294 | Ga0466958_0280397 | |||
| 2295 | Ga0466958_0346304 | |||
| 2296 | Ga0466967_0000367 | |||
| 2297 | Ga0466967_0000476 | |||
| 2298 | Ga0466967_0001912 | |||
| 2299 | Ga0466967_0007863 | |||
| 2300 | Ga0466967_0007918 | |||
| 2301 | Ga0466967_0010856 | |||
| 2302 | Ga0466967_0013309 | |||
| 2303 | Ga0466967_0019148 | |||
| 2304 | Ga0466967_0021497 | |||
| 2305 | Ga0466967_0022439 | |||
| 2306 | Ga0466967_0028453 | |||
| 2307 | Ga0466967_0029794 | |||
| 2308 | Ga0466967_0035711 | |||
| 2309 | Ga0466967_0037310 | |||
| 2310 | Ga0466967_0039737 | |||
| 2311 | Ga0466967_0040711 | |||
| 2312 | Ga0466967_0044360 | |||
| 2313 | Ga0466967_0049196 | |||
| 2314 | Ga0466967_0049252 | |||
| 2315 | Ga0466967_0063783 | |||
| 2316 | Ga0466967_0066589 | |||
| 2317 | Ga0466967_0074556 | |||
| 2318 | Ga0466967_0075728 | |||
| 2319 | Ga0466967_0078831 | |||
| 2320 | Ga0466967_0109257 | |||
| 2321 | Ga0466967_0122556 | |||
| 2322 | Ga0466967_0160054 | |||
| 2323 | Ga0466967_0180828 | |||
| 2324 | Ga0466967_0190781 | |||
| 2325 | Ga0466967_0200556 | |||
| 2326 | Ga0466967_0482133 | |||
| 2327 | Ga0466967_0620238 | |||
| 2328 | Ga0495592_0000100 | |||
| 2329 | Ga0495592_0051197 | |||
| 2330 | Ga0495592_0104002 | |||
| 2331 | Ga0495592_0116305 | |||
| 2332 | Ga0495592_0168836 | |||
| 2333 | Ga0495592_0187708 | |||
| 2334 | Ga0495603_0005524 | |||
| 2335 | Ga0495603_0218837 | |||
| 2336 | Ga0495629_0000670 | |||
| 2337 | Ga0495629_0258249 | |||
| 2338 | Ga0495629_0350017 | |||
| 2339 | Ga0495641_0000374 | |||
| 2340 | Ga0495641_0047922 | |||
| 2341 | Ga0495641_0051708 | |||
| 2342 | Ga0495641_0062443 | |||
| 2343 | Ga0495641_0081439 | |||
| 2344 | Ga0495641_0128237 | |||
| 2345 | Ga0495651_0000008 | |||
| 2346 | Ga0495651_0056843 | |||
| 2347 | Ga0495653_0000830 | |||
| 2348 | Ga0495653_0009970 | |||
| 2349 | Ga0495653_0036706 | |||
| 2350 | Ga0495653_0075173 | |||
| 2351 | Ga0495653_0093240 | |||
| 2352 | Ga0495653_0138464 | |||
| 2353 | Ga0495653_0179312 | |||
| 2354 | Ga0495653_0189073 | |||
| 2355 | Ga0495653_0201912 | |||
| 2356 | Ga0495580_0028903 | |||
| 2357 | Ga0495582_0000124 | |||
| 2358 | Ga0495582_0094583 | |||
| 2359 | Ga0495605_0025052 | |||
| 2360 | Ga0495639_0000658 | |||
| 2361 | Ga0495639_0005468 | |||
| 2362 | Ga0495662_0011001 | |||
| 2363 | Ga0495662_0096158 | |||
| 2364 | Ga0495664_0007042 | |||
| 2365 | Ga0495664_0015816 | |||
| 2366 | Ga0495664_0015935 | |||
| 2367 | Ga0495584_0022907 | |||
| 2368 | Ga0495584_0147529 | |||
| 2369 | Ga0495585_0203215 | |||
| 2370 | Ga0495594_0100993 | |||
| 2371 | Ga0495594_0256556 | |||
| 2372 | Ga0495607_0071983 | |||
| 2373 | Ga0495608_0012255 | |||
| 2374 | Ga0495608_0012509 | |||
| 2375 | Ga0495608_0015878 | |||
| 2376 | Ga0495608_0051568 | |||
| 2377 | Ga0495608_0065202 | |||
| 2378 | Ga0495608_0076007 | |||
| 2379 | Ga0495608_0288892 | |||
| 2380 | Ga0495618_0021996 | |||
| 2381 | Ga0495618_0055186 | |||
| 2382 | Ga0495618_0065421 | |||
| 2383 | Ga0495618_0157216 | |||
| 2384 | Ga0495628_0000105 | |||
| 2385 | Ga0495628_0045019 | |||
| 2386 | Ga0495628_0092435 | |||
| 2387 | Ga0495628_0164650 | |||
| 2388 | Ga0495628_0268952 | |||
| 2389 | Ga0495630_0004511 | |||
| 2390 | Ga0495630_0005800 | |||
| 2391 | Ga0495630_0007613 | |||
| 2392 | Ga0495630_0021342 | |||
| 2393 | Ga0495630_0046561 | |||
| 2394 | Ga0495630_0051146 | |||
| 2395 | Ga0495630_0051959 | |||
| 2396 | Ga0495630_0093001 | |||
| 2397 | Ga0495630_0114474 | |||
| 2398 | Ga0495644_0004583 | |||
| 2399 | Ga0495644_0047705 | |||
| 2400 | Ga0495644_0137156 | |||
| 2401 | Ga0495666_0008076 | |||
| 2402 | Ga0495652_0000588 | |||
| 2403 | Ga0495652_0029631 | |||
| 2404 | Ga0495652_0033829 | |||
| 2405 | Ga0495652_0077028 | |||
| 2406 | Ga0495652_0098795 | |||
| 2407 | Ga0495652_0136257 | |||
| 2408 | Ga0495652_0163924 | |||
| 2409 | Ga0495652_0170234 | |||
| 2410 | Ga0495652_0264595 | |||
| 2411 | Ga0495652_0363063 | |||
| 2412 | Ga0495665_0000249 | |||
| 2413 | Ga0495665_0020544 | |||
| 2414 | Ga0495665_0128681 | |||
| 2415 | Ga0495640_0014648 | |||
| 2416 | Ga0495640_0046649 | |||
| 2417 | Ga0495640_0046657 | |||
| 2418 | Ga0495640_0049145 | |||
| 2419 | Ga0495640_0058446 | |||
| 2420 | Ga0495640_0111938 | |||
| 2421 | Ga0495640_0134297 | |||
| 2422 | Ga0495640_0206309 | |||
| 2423 | Ga0495586_0009598 | |||
| 2424 | Ga0495586_0075375 | |||
| 2425 | Ga0495587_0000048 | |||
| 2426 | Ga0495587_0005708 | |||
| 2427 | Ga0495587_0054833 | |||
| 2428 | Ga0495587_0107345 | |||
| 2429 | Ga0495645_0000029 | |||
| 2430 | Ga0495645_0064579 | |||
| 2431 | Ga0495667_0021726 | |||
| 2432 | Ga0495667_0041701 | |||
| 2433 | Ga0495667_0048646 | |||
| 2434 | Ga0495667_0141654 | |||
| 2435 | Ga0495667_0215174 | |||
| 2436 | Ga0495656_0007343 | |||
| 2437 | Ga0495656_0091885 | |||
| 2438 | Ga0495656_0129386 | |||
| 2439 | Ga0495668_0152672 | |||
| 2440 | Ga0495634_0023767 | |||
| 2441 | Ga0495634_0036619 | |||
| 2442 | Ga0495634_0146874 | |||
| 2443 | Ga0495634_0169159 | |||
| 2444 | Ga0495611_0096841 | |||
| 2445 | Ga0495635_0017173 | |||
| 2446 | Ga0495635_0032237 | |||
| 2447 | Ga0495635_0038085 | |||
| 2448 | Ga0495659_0042807 | |||
| 2449 | Ga0495588_0039230 | |||
| 2450 | Ga0495588_0171852 | |||
| 2451 | Ga0495657_0005214 | |||
| 2452 | Ga0495657_0014570 | |||
| 2453 | Ga0495657_0019054 | |||
| 2454 | Ga0495657_0084400 | |||
| 2455 | Ga0495599_0000110 | |||
| 2456 | Ga0495599_0014783 | |||
| 2457 | Ga0495599_0050379 | |||
| 2458 | Ga0495599_0128363 | |||
| 2459 | Ga0495599_0164621 | |||
| 2460 | Ga0495623_0000383 | |||
| 2461 | Ga0495623_0029228 | |||
| 2462 | Ga0495623_0047992 | |||
| 2463 | Ga0495623_0132642 | |||
| 2464 | Ga0495646_0005246 | |||
| 2465 | Ga0495646_0021841 | |||
| 2466 | Ga0495646_0187752 | |||
| 2467 | Ga0495647_0000147 | |||
| 2468 | Ga0495647_0008233 | |||
| 2469 | Ga0495647_0030300 | |||
| 2470 | Ga0495647_0066509 | |||
| 2471 | Ga0495658_0000882 | |||
| 2472 | Ga0495658_0013052 | |||
| 2473 | Ga0495658_0078152 | |||
| 2474 | Ga0495613_0001393 | |||
| 2475 | Ga0495613_0046142 | |||
| 2476 | Ga0495613_0095545 | |||
| 2477 | Ga0495613_0124527 | |||
| 2478 | Ga0495613_0351097 | |||
| 2479 | Ga0495624_0004712 | |||
| 2480 | Ga0495624_0006866 | |||
| 2481 | Ga0495624_0054385 | |||
| 2482 | Ga0495624_0107045 | |||
| 2483 | Ga0495671_0108727 | |||
| 2484 | Ga0495600_0024907 | |||
| 2485 | Ga0495600_0034378 | |||
| 2486 | Ga0495600_0059702 | |||
| 2487 | Ga0495600_0234874 | |||
| 2488 | Ga0495600_0248458 | |||
| 2489 | Ga0495581_0003286 | |||
| 2490 | Ga0495581_0011603 | |||
| 2491 | Ga0495581_0017225 | |||
| 2492 | Ga0495581_0140907 | |||
| 2493 | Ga0495581_0312196 | |||
| 2494 | Ga0495604_0000238 | |||
| 2495 | Ga0495604_0008809 | |||
| 2496 | Ga0495604_0011159 | |||
| 2497 | Ga0495604_0031423 | |||
| 2498 | Ga0495604_0073391 | |||
| 2499 | Ga0495674_0006233 | |||
| 2500 | Ga0495674_0035810 | |||
| 2501 | Ga0495674_0035918 | |||
| 2502 | Ga0495674_0040358 | |||
| 2503 | Ga0495674_0105545 | |||
| 2504 | Ga0495674_0141716 | |||
| 2505 | Ga0495674_0172422 | |||
| 2506 | Ga0495674_0246378 | |||
| 2507 | Ga0495676_0000583 | |||
| 2508 | Ga0495676_0017863 | |||
| 2509 | Ga0495676_0024350 | |||
| 2510 | Ga0495676_0142404 | |||
| 2511 | Ga0495676_0172366 | |||
| 2512 | Ga0495676_0181240 | |||
| 2513 | Ga0495676_0267822 | |||
| 2514 | Ga0495680_0000743 | |||
| 2515 | Ga0495680_0009403 | |||
| 2516 | Ga0495680_0012692 | |||
| 2517 | Ga0495680_0013269 | |||
| 2518 | Ga0495680_0019364 | |||
| 2519 | Ga0495680_0037819 | |||
| 2520 | Ga0495680_0119905 | |||
| 2521 | Ga0495675_0000262 | |||
| 2522 | Ga0495684_0010320 | |||
| 2523 | Ga0495684_0015381 | |||
| 2524 | Ga0495684_0022426 | |||
| 2525 | Ga0495684_0036779 | |||
| 2526 | Ga0495684_0059844 | |||
| 2527 | Ga0495684_0170160 | |||
| 2528 | Ga0495593_0015229 | |||
| 2529 | Ga0495593_0149929 | |||
| 2530 | Ga0495602_0014431 | |||
| 2531 | Ga0495602_0042482 | |||
| 2532 | Ga0495602_0045157 | |||
| 2533 | Ga0495602_0072991 | |||
| 2534 | Ga0495602_0215661 | |||
| 2535 | Ga0495614_0000634 | |||
| 2536 | Ga0495614_0008520 | |||
| 2537 | Ga0496100_0002369 | |||
| 2538 | Ga0496100_0002548 | |||
| 2539 | Ga0496100_0039076 | |||
| 2540 | Ga0496100_0075712 | |||
| 2541 | Ga0496100_0077538 | |||
| 2542 | Ga0496100_0083106 | |||
| 2543 | Ga0496101_0001864 | |||
| 2544 | Ga0496101_0003449 | |||
| 2545 | Ga0496101_0009945 | |||
| 2546 | Ga0496101_0018885 | |||
| 2547 | Ga0496101_0027974 | |||
| 2548 | Ga0496102_0005509 | |||
| 2549 | Ga0496102_0028898 | |||
| 2550 | Ga0496102_0052813 | |||
| 2551 | Ga0496102_0108642 | |||
| 2552 | Ga0496103_0014172 | |||
| 2553 | Ga0496103_0080734 | |||
| 2554 | Ga0496103_0089403 | |||
| 2555 | Ga0496104_0002544 | |||
| 2556 | Ga0496104_0004726 | |||
| 2557 | Ga0496104_0046151 | |||
| 2558 | Ga0496104_0084558 | |||
| 2559 | Ga0496104_0105065 | |||
| 2560 | Ga0496104_0108905 | |||
| 2561 | Ga0496104_0364572 | |||
| 2562 | Ga0496105_0004487 | |||
| 2563 | Ga0496105_0005400 | |||
| 2564 | Ga0496105_0013818 | |||
| 2565 | Ga0496105_0023914 | |||
| 2566 | Ga0496105_0044386 | |||
| 2567 | Ga0496105_0141024 | |||
| 2568 | Ga0496105_0253371 | |||
| 2569 | Ga0496106_0003054 | |||
| 2570 | Ga0496106_0005293 | |||
| 2571 | Ga0496106_0006016 | |||
| 2572 | Ga0496106_0070861 | |||
| 2573 | Ga0496106_0586857 | |||
| 2574 | Ga0496107_0001510 | |||
| 2575 | Ga0496107_0003341 | |||
| 2576 | Ga0496107_0004985 | |||
| 2577 | Ga0496107_0100218 | |||
| 2578 | Ga0496107_0316887 | |||
| 2579 | Ga0496107_0393303 | |||
| 2580 | Ga0496108_0003870 | |||
| 2581 | Ga0496108_0006796 | |||
| 2582 | Ga0496108_0032441 | |||
| 2583 | Ga0496108_0084645 | |||
| 2584 | Ga0496108_0116468 | |||
| 2585 | Ga0496108_0192777 | |||
| 2586 | Ga0496108_0306976 | |||
| 2587 | Ga0496109_0000993 | |||
| 2588 | Ga0496109_0001712 | |||
| 2589 | Ga0496109_0002841 | |||
| 2590 | Ga0496109_0012043 | |||
| 2591 | Ga0496109_0036481 | |||
| 2592 | Ga0496109_0138506 | |||
| 2593 | Ga0496109_0239089 | |||
| 2594 | Ga0496109_0248628 | |||
| 2595 | Ga0496110_0001621 | |||
| 2596 | Ga0496110_0003582 | |||
| 2597 | Ga0496110_0065596 | |||
| 2598 | Ga0496110_0101489 | |||
| 2599 | Ga0496110_0196034 | |||
| 2600 | Ga0496110_0208757 | |||
| 2601 | Ga0496110_0260470 | |||
| 2602 | Ga0496111_0009608 | |||
| 2603 | Ga0496111_0029567 | |||
| 2604 | Ga0496111_0038009 | |||
| 2605 | Ga0496111_0073063 | |||
| 2606 | Ga0496111_0172454 | |||
| 2607 | Ga0496111_0177093 | |||
| 2608 | Ga0496111_0189753 | |||
| 2609 | Ga0496112_0004702 | |||
| 2610 | Ga0496112_0004906 | |||
| 2611 | Ga0496112_0024534 | |||
| 2612 | Ga0496112_0028701 | |||
| 2613 | Ga0496112_0030500 | |||
| 2614 | Ga0496112_0046008 | |||
| 2615 | Ga0496112_0048226 | |||
| 2616 | Ga0496112_0179707 | |||
| 2617 | Ga0496112_0413800 | |||
| 2618 | Ga0496113_0008006 | |||
| 2619 | Ga0496113_0011179 | |||
| 2620 | Ga0496113_0197862 | |||
| 2621 | Ga0496113_0212370 | |||
| 2622 | Ga0496113_0212969 | |||
| 2623 | Ga0496113_0218449 | |||
| 2624 | Ga0496114_0001845 | |||
| 2625 | Ga0496114_0011611 | |||
| 2626 | Ga0496114_0012916 | |||
| 2627 | Ga0496114_0016123 | |||
| 2628 | Ga0496114_0020427 | |||
| 2629 | Ga0496114_0021695 | |||
| 2630 | Ga0496114_0039727 | |||
| 2631 | Ga0496114_0046702 | |||
| 2632 | Ga0496114_0085319 | |||
| 2633 | Ga0496114_0139776 | |||
| 2634 | Ga0496114_0201116 | |||
| 2635 | Ga0496114_0227093 | |||
| 2636 | Ga0496115_0005564 | |||
| 2637 | Ga0496115_0006406 | |||
| 2638 | Ga0496115_0021447 | |||
| 2639 | Ga0496115_0047810 | |||
| 2640 | Ga0496115_0059551 | |||
| 2641 | Ga0496115_0209938 | |||
| 2642 | Ga0496115_0240291 | |||
| 2643 | Ga0496116_0042494 | |||
| 2644 | Ga0501031_0002279 | |||
| 2645 | Ga0501031_0018735 | |||
| 2646 | Ga0501031_0029452 | |||
| 2647 | Ga0501031_0034082 | |||
| 2648 | Ga0501031_0054167 | |||
| 2649 | Ga0501032_0062500 | |||
| 2650 | Ga0501032_0062540 | |||
| 2651 | Ga0501032_0096167 | |||
| 2652 | Ga0501033_0013055 | |||
| 2653 | Ga0501033_0051067 | |||
| 2654 | Ga0501033_0070588 | |||
| 2655 | Ga0501034_0014853 | |||
| 2656 | Ga0501034_0325826 | |||
| 2657 | Ga0501036_0006686 | |||
| 2658 | Ga0501036_0010774 | |||
| 2659 | Ga0501036_0026283 | |||
| 2660 | Ga0501036_0028689 | |||
| 2661 | Ga0501036_0095697 | |||
| 2662 | Ga0501036_0146628 | |||
| 2663 | Ga0501037_0051675 | |||
| 2664 | Ga0501037_0055596 | |||
| 2665 | Ga0501037_0108705 | |||
| 2666 | Ga0501038_0045892 | |||
| 2667 | Ga0501038_0053632 | |||
| 2668 | Ga0501038_0095652 | |||
| 2669 | Ga0501038_0117636 | |||
| 2670 | Ga0501039_0012542 | |||
| 2671 | Ga0501039_0032959 | |||
| 2672 | Ga0501039_0137543 | |||
| 2673 | Ga0501039_0141408 | |||
| 2674 | Ga0501039_0148076 | |||
| 2675 | Ga0501040_0010312 | |||
| 2676 | Ga0501040_0010725 | |||
| 2677 | Ga0501040_0015564 | |||
| 2678 | Ga0501040_0096856 | |||
| 2679 | Ga0501040_0144581 | |||
| 2680 | Ga0501041_0013911 | |||
| 2681 | Ga0501041_0039050 | |||
| 2682 | Ga0501041_0052377 | |||
| 2683 | Ga0501042_0002782 | |||
| 2684 | Ga0501042_0003754 | |||
| 2685 | Ga0501042_0009378 | |||
| 2686 | Ga0501042_0013162 | |||
| 2687 | Ga0501042_0016630 | |||
| 2688 | Ga0501042_0075133 | |||
| 2689 | Ga0501042_0246790 | |||
| 2690 | Ga0501042_0307127 | |||
| 2691 | Ga0501043_0036949 | |||
| 2692 | Ga0501043_0180989 | |||
| 2693 | Ga0501046_0017224 | |||
| 2694 | Ga0501047_0055549 | |||
| 2695 | Ga0501047_0075472 | |||
| 2696 | Ga0501048_0004669 | |||
| 2697 | Ga0501048_0005952 | |||
| 2698 | Ga0501048_0023296 | |||
| 2699 | Ga0501048_0050900 | |||
| 2700 | Ga0501048_0054248 | |||
| 2701 | Ga0501048_0111661 | |||
| 2702 | Ga0501048_0385352 | |||
| 2703 | Ga0501067_0001730 | |||
| 2704 | Ga0501067_0012207 | |||
| 2705 | Ga0501067_0023421 | |||
| 2706 | Ga0501067_0048409 | |||
| 2707 | Ga0501068_0006921 | |||
| 2708 | Ga0501068_0016612 | |||
| 2709 | Ga0501068_0060930 | |||
| 2710 | Ga0501069_0001302 | |||
| 2711 | Ga0501069_0022740 | |||
| 2712 | Ga0501069_0026464 | |||
| 2713 | Ga0501069_0074217 | |||
| 2714 | Ga0501069_0109002 | |||
| 2715 | Ga0501069_0113077 | |||
| 2716 | Ga0501069_0264582 | |||
| 2717 | Ga0501069_0398015 | |||
| 2718 | Ga0501070_0011798 | |||
| 2719 | Ga0501070_0040217 | |||
| 2720 | Ga0501070_0103024 | |||
| 2721 | Ga0501070_0268935 | |||
| 2722 | Ga0501071_0000767 | |||
| 2723 | Ga0501071_0004938 | |||
| 2724 | Ga0501071_0014033 | |||
| 2725 | Ga0501071_0031539 | |||
| 2726 | Ga0501071_0088616 | |||
| 2727 | Ga0501071_0336031 | |||
| 2728 | Ga0501072_0001670 | |||
| 2729 | Ga0501072_0003982 | |||
| 2730 | Ga0501072_0005076 | |||
| 2731 | Ga0501072_0006101 | |||
| 2732 | Ga0501072_0008342 | |||
| 2733 | Ga0501072_0031237 | |||
| 2734 | Ga0501072_0053731 | |||
| 2735 | Ga0501072_0126006 | |||
| 2736 | Ga0501072_0247912 | |||
| 2737 | Ga0501072_0323324 | |||
| 2738 | Ga0501072_0328046 | |||
| 2739 | Ga0501073_0012097 | |||
| 2740 | Ga0501073_0022512 | |||
| 2741 | Ga0501073_0067571 | |||
| 2742 | Ga0501073_0217243 | |||
| 2743 | Ga0501074_0007371 | |||
| 2744 | Ga0501074_0007570 | |||
| 2745 | Ga0501075_0004427 | |||
| 2746 | Ga0501075_0011326 | |||
| 2747 | Ga0501075_0044022 | |||
| 2748 | Ga0501075_0053464 | |||
| 2749 | Ga0501075_0078466 | |||
| 2750 | Ga0501075_0131106 | |||
| 2751 | Ga0501075_0194682 | |||
| 2752 | Ga0501075_0269954 | |||
| 2753 | Ga0501075_0382160 | |||
| 2754 | Ga0501076_0004402 | |||
| 2755 | Ga0501076_0019237 | |||
| 2756 | Ga0501076_0019525 | |||
| 2757 | Ga0501076_0025634 | |||
| 2758 | Ga0501076_0036609 | |||
| 2759 | Ga0501076_0131835 | |||
| 2760 | Ga0501076_0226451 | |||
| 2761 | Ga0501076_0406644 | |||
| 2762 | Ga0501077_0001272 | |||
| 2763 | Ga0501077_0001755 | |||
| 2764 | Ga0501077_0019979 | |||
| 2765 | Ga0501077_0024745 | |||
| 2766 | Ga0501077_0033416 | |||
| 2767 | Ga0501077_0041172 | |||
| 2768 | Ga0501077_0271037 | |||
| 2769 | Ga0501079_0018412 | |||
| 2770 | Ga0501079_0037877 | |||
| 2771 | Ga0501079_0048059 | |||
| 2772 | Ga0501079_0051223 | |||
| 2773 | Ga0501079_0072176 | |||
| 2774 | Ga0501079_0183331 | |||
| 2775 | Ga0501079_0215164 | |||
| 2776 | Ga0501079_0286663 | |||
| 2777 | Ga0501079_0340816 | |||
| 2778 | Ga0501080_0003263 | |||
| 2779 | Ga0501080_0012564 | |||
| 2780 | Ga0501080_0020808 | |||
| 2781 | Ga0501080_0035070 | |||
| 2782 | Ga0501080_0087607 | |||
| 2783 | Ga0501080_0089139 | |||
| 2784 | Ga0501080_0103423 | |||
| 2785 | Ga0501080_0121162 | |||
| 2786 | Ga0501080_0165391 | |||
| 2787 | Ga0501080_0535637 | |||
| 2788 | Ga0501081_0001452 | |||
| 2789 | Ga0501081_0001716 | |||
| 2790 | Ga0501081_0013344 | |||
| 2791 | Ga0501081_0021429 | |||
| 2792 | Ga0501081_0024542 | |||
| 2793 | Ga0501081_0197903 | |||
| 2794 | Ga0501081_0255687 | |||
| 2795 | Ga0501081_0281270 | |||
| 2796 | Ga0501081_0316488 | |||
| 2797 | Ga0501081_0398315 | |||
| 2798 | Ga0501083_0000421 | |||
| 2799 | Ga0501083_0005164 | |||
| 2800 | Ga0501083_0009254 | |||
| 2801 | Ga0501083_0306213 | |||
| 2802 | Ga0501035_0015511 | |||
| 2803 | Ga0501035_0274153 | |||
| 2804 | Ga0501035_0514175 | |||
| 2805 | Ga0501044_0039843 | |||
| 2806 | Ga0501044_0187437 | |||
| 2807 | Ga0501045_0002387 | |||
| 2808 | Ga0501045_0009285 | |||
| 2809 | Ga0501045_0016554 | |||
| 2810 | Ga0501045_0022487 | |||
| 2811 | Ga0501045_0025337 | |||
| 2812 | Ga0501045_0036081 | |||
| 2813 | Ga0501045_0251226 | |||
| 2814 | nmdc:mga00v17_4057_c1 | |||
| 2815 | nmdc:mga0yw44_15682_c1 | |||
| 2816 | nmdc:mga0yw44_229949_c1 | |||
| 2817 | nmdc:mga06z11_158047_c1 | |||
| 2818 | nmdc:mga05p37_107064_c1 | |||
| 2819 | nmdc:mga05p37_116409_c1 | |||
| 2820 | nmdc:mga05p37_172647_c1 | |||
| 2821 | nmdc:mga05p37_2744_c1 | |||
| 2822 | nmdc:mga09592_5343_c1 | |||
| 2823 | nmdc:mga0qj67_29024_c1 | |||
| 2824 | nmdc:mga06r32_107860_c1 | |||
| 2825 | nmdc:mga06r32_521881_c1 | |||
| 2826 | nmdc:mga08y16_146065_c1 | |||
| 2827 | nmdc:mga08y16_288619_c1 | |||
| 2828 | nmdc:mga08y16_36423_c1 | |||
| 2829 | nmdc:mga08y16_59021_c1 | |||
| 2830 | nmdc:mga0n895_13347_c1 | |||
| 2831 | nmdc:mga0n895_191714_c1 | |||
| 2832 | nmdc:mga0n895_2272_c1 | |||
| 2833 | nmdc:mga0n895_261597_c1 | |||
| 2834 | nmdc:mga0rr50_4902_c1 | |||
| 2835 | nmdc:mga0rr50_73940_c1 | |||
| 2836 | nmdc:mga0a205_1210_c2 | |||
| 2837 | nmdc:mga0a205_30584_c1 | |||
| 2838 | nmdc:mga0a205_30714_c1 | |||
| 2839 | Ga0495601_0000174 | |||
| 2840 | Ga0495601_0024368 | |||
| 2841 | Ga0495601_0047394 | |||
| 2842 | Ga0495601_0074577 | |||
| 2843 | Ga0495601_0092909 | |||
| 2844 | Ga0495601_0101500 | |||
| 2845 | Ga0495601_0119310 | |||
| 2846 | Ga0495601_0138281 | |||
| 2847 | Ga0495601_0252243 | |||
| 2848 | Ga0495612_0013698 | |||
| 2849 | Ga0495612_0077071 | |||
| 2850 | Ga0495612_0105785 | |||
| 2851 | Ga0495612_0121795 | |||
| 2852 | Ga0495655_0089751 | |||
| 2853 | Ga0495595_0001301 | |||
| 2854 | Ga0495595_0025633 | |||
| 2855 | Ga0495595_0039555 | |||
| 2856 | Ga0495595_0050896 | |||
| 2857 | Ga0495595_0051338 | |||
| 2858 | Ga0495595_0064590 | |||
| 2859 | Ga0495619_0009042 | |||
| 2860 | Ga0495619_0019509 | |||
| 2861 | Ga0495619_0023001 | |||
| 2862 | Ga0495619_0085659 | |||
| 2863 | Ga0495619_0108434 | |||
| 2864 | Ga0495619_0157170 | |||
| 2865 | Ga0495619_0242197 | |||
| 2866 | Ga0495619_0396997 | |||
| 2867 | Ga0501084_0005378 | |||
| 2868 | Ga0501084_0030953 | |||
| 2869 | Ga0501084_0041480 | |||
| 2870 | Ga0501084_0056706 | |||
| 2871 | Ga0501084_0237300 | |||
| 2872 | Ga0590075_024231 | |||
| 2873 | Ga0590077_038844 | |||
| 2874 | Ga0501082_0003280 | |||
| 2875 | Ga0501082_0005105 | |||
| 2876 | Ga0501082_0017311 | |||
| 2877 | Ga0501082_0023600 | |||
| 2878 | Ga0501082_0026514 | |||
| 2879 | Ga0501082_0034614 | |||
| 2880 | Ga0501082_0038515 | |||
| 2881 | Ga0501082_0104102 | |||
| 2882 | Ga0501082_0237817 | |||
| 2883 | Ga0466962_0000598 | |||
| 2884 | Ga0466962_0001195 | |||
| 2885 | Ga0466962_0001492 | |||
| 2886 | Ga0466962_0003173 | |||
| 2887 | Ga0466962_0014519 | |||
| 2888 | Ga0466962_0018735 | |||
| 2889 | Ga0466962_0058202 | |||
| 2890 | Ga0466962_0063098 | |||
| 2891 | Ga0466962_0119325 | |||
| 2892 | Ga0530510_0003679 | |||
| 2893 | Ga0530510_0027904 | |||
| 2894 | Ga0530510_0079431 | |||
| 2895 | Ga0530510_0111812 | |||
| 2896 | Ga0530510_0150560 | |||
| 2897 | Ga0530510_0164160 | |||
| 2898 | Ga0530510_0180493 | |||
| 2899 | Ga0530510_0285603 | |||
| 2900 | Ga0530510_0362678 | |||
| 2901 | 2595319965 | |||
| 2902 | 2865002812 | |||
| 2903 | 2980127689 | |||
| 2904 | 2980189383 | |||
| 2905 | 8057737171 | |||
| 2906 | 8057980897 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5d0n-assembly1.cif.gz_A | crystal structure of maize pdrp bound with amp | 0.8661 | 1 | 269 |
| 5d0n-assembly1.cif.gz_A | crystal structure of maize pdrp bound with amp | 0.8236 | 1 | 269 |
| 4y7j-assembly1.cif.gz_E | structure of an archaeal mechanosensitive channel in expanded state | 0.6792 | 6 | 91 |
| 3evz-assembly1.cif.gz_A | crystal structure of methyltransferase from pyrococcus furiosus | 0.6767 | 52 | 88 |
| 7erq-assembly1.cif.gz_B | the regulatory domain of yeie, a sulfite sensing lysr-type transcriptional regulator from cronobacter sakazakii (ligand-free form) | 0.6657 | 1 | 56 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ipcA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6564 | 5 | 88 | 3.40.50.2300 |
| af_P0A6E1_1_171_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6541 | 145 | 267 | 3.40.50.300 |
| 6hl7B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.6527 | 4 | 88 | 3.40.50.1370 |
| 3cfzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6464 | 5 | 56 | 3.40.190.10 |
| af_O94431_46_286_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.6438 | 6 | 88 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645HR73-F1-model_v4 | Putative pyruvate, phosphate dikinase regulatory protein (EC 2.7.11.32) | 0.9748 | 142 | 270 |
GO:0004674
GO:0005524 |
| AF-A0A844EF38-F1-model_v4 | Phosphoenolpyruvate synthase regulatory protein | 0.9729 | 118 | 266 |
GO:0004674
GO:0005524 |
| AF-X0Q9U2-F1-model_v4 | ATP/GTP-binding protein | 0.9685 | 149 | 266 |
GO:0004674
GO:0005524 |
| AF-A0A3D0MRX8-F1-model_v4 | Phosphoenolpyruvate synthase regulatory protein | 0.968 | 121 | 266 |
GO:0004674
GO:0005524 |
| AF-A0A351HUY0-F1-model_v4 | Phosphoenolpyruvate synthase regulatory protein | 0.9669 | 150 | 267 |
GO:0004674
GO:0005524 |