F494075

General Info

Members Datasets Scaffolds Average Seq Length
1453 1083 2906 306

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355253|2793280315
Length 308
Sequence HVAVLMGGFSSERPVSLSSGEACAAALEGEGYRVTRVDVGRDVSAVLSALRPDVAFNALHGPFGEDGTIQGVLEYLEIPYTHSGILASSLAMDKIQAKRVAAAVGIPVAPSRLLNRHEIGHQHPLPPPYVIKPVREGSSFGIVIVKEDQSHPPQIVSSPEWRYGDLVMAERYVAGRELTCGVIGAGEEARALGVTEIVPLGHAFYDYESKYVKGGSQHILPAQILPEIYQTVQELAVAAHRAIGCRGASRSDFRLDDGEGGTGELIWLEVNTQPGMTPTSLLPEIAAHAGMPFGKFLSWLVEDASCLR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
30 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
75 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
76 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
77 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
81 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
82 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
120 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
138 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
159 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
253 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
254 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
255 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
256 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
257 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
258 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
259 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
260 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
263 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
264 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
265 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
271 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
272 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
273 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
274 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
277 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
278 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
279 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
280 2509276019 Ensifer aridi TW10 Isolate Nodule
281 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
282 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
283 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
284 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
285 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
286 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
287 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
288 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
289 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
290 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
291 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
292 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
293 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
294 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
295 2512875024
296 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
297 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
298 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
299 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
300 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
301 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
302 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
303 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
304 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
305 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
306 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
307 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
308 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
309 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
310 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
311 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
312 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
313 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
314 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
315 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
316 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
317 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
318 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
319 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
320 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
321 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
322 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
323 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
324 2516143018 Ensifer sp. BR816 Isolate Nodule
325 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
326 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
327 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
328 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
329 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
330 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
331 2519899620 Rhizobium sp. Pop5 Isolate Nodule
332 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
333 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
334 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
335 2534681786 Brucella suis 92/29 Isolate Unclassified
336 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
337 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
338 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
339 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
340 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
341 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
342 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
343 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
344 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
345 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
346 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
347 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
348 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
349 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
350 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
351 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
352 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
353 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
354 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
355 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
356 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
357 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
358 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
359 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
360 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
361 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
362 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
363 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
364 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
365 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
366 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
367 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
368 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
369 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
370 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
371 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
372 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
373 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
374 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
375 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
376 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
377 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
378 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
379 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
380 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
381 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
382 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
383 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
384 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
385 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
386 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
387 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
388 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
389 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
390 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
391 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
392 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
393 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
394 2643221557 Ensifer sp. Root558 Isolate Unclassified
395 2643221558 Rhizobium sp. Root149 Isolate Unclassified
396 2643221568 Rhizobium sp. Root564 Isolate Unclassified
397 2643221582 Rhizobium sp. Root651 Isolate Unclassified
398 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
399 2643221599 Rhizobium sp. Root708 Isolate Unclassified
400 2643221607 Rhizobium sp. Root73 Isolate Unclassified
401 2643221610 Ensifer sp. Root74 Isolate Unclassified
402 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
403 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
404 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
405 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
406 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
407 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
408 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
409 2643221668 Ensifer sp. Root423 Isolate Unclassified
410 2643221675 Ensifer sp. Root1298 Isolate Unclassified
411 2643221680 Ensifer sp. Root1312 Isolate Unclassified
412 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
413 2643221688 Rhizobium sp. Root482 Isolate Unclassified
414 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
415 2643221693 Rhizobium sp. Root491 Isolate Unclassified
416 2643221718 Rhizobium sp. Root268 Isolate Unclassified
417 2643221719 Rhizobium sp. Root274 Isolate Unclassified
418 2643221723 Ensifer sp. Root278 Isolate Unclassified
419 2643221726 Ensifer sp. Root954 Isolate Unclassified
420 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
421 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
422 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
423 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
424 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
425 2718217882 Rhizobium sp. N741 Isolate Nodule
426 2718217927 Rhizobium sp. N324 Isolate Nodule
427 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
428 2718218009 Rhizobium sp. N561 Isolate Nodule
429 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
430 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
431 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
432 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
433 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
434 2718218363 Rhizobium sp. N113 Isolate Nodule
435 2718218365 Rhizobium sp. N731 Isolate Nodule
436 2718218366 Rhizobium sp. N621 Isolate Nodule
437 2718218423 Rhizobium sp. N941 Isolate Nodule
438 2721755514 Rhizobium sp. N6212 Isolate Nodule
439 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
440 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
441 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
442 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
443 2721755809 Rhizobium sp. N541 Isolate Nodule
444 2721755810 Rhizobium sp. N871 Isolate Nodule
445 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
446 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
447 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
448 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
449 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
450 2728369365 Rhizobium sp. N1341 Isolate Nodule
451 2728369397 Rhizobium sp. N1314 Isolate Nodule
452 2738541293 Rhizobium sp. GV031 Isolate Unclassified
453 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
454 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
455 2738543024 Aminobacter sp. AP02 Isolate Unclassified
456 2751185800 Brucella pituitosa AA2 Isolate Unclassified
457 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
458 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
459 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
460 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
461 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
462 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
463 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
464 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
465 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
466 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
467 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
468 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
469 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
470 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
471 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
472 2791355256 Rhizobium sp. M10 Isolate Nodule
473 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
474 2791355260 Rhizobium sp. L9 Isolate Nodule
475 2791355262 Rhizobium sp. M1 Isolate Nodule
476 2791355263 Rhizobium chutanense C5 Isolate Nodule
477 2791355264 Rhizobium sp. S9 Isolate Nodule
478 2791355265 Rhizobium sp. H4 Isolate Nodule
479 2791355266 Rhizobium sp. L43 Isolate Nodule
480 2791355267 Rhizobium sp. L18 Isolate Nodule
481 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
482 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
483 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
484 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
485 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
486 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
487 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
488 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
489 2802429633 Rhizobium anhuiense J3 Isolate Nodule
490 2802429634 Rhizobium anhuiense S10 Isolate Nodule
491 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
492 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
493 2802429637 Rhizobium anhuiense C15 Isolate Nodule
494 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
495 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
496 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
497 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
498 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
499 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
500 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
501 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
502 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
503 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
504 2838048938 Rhizobium pisi 27/80 Isolate Nodule
505 2838061910 Rhizobium phaseoli L15 Isolate Nodule
506 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
507 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
508 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
509 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
510 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
511 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
512 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
513 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
514 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
515 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
516 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
517 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
518 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
519 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
520 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
521 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
522 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
523 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
524 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
525 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
526 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
527 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
528 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
529 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
530 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
531 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
532 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
533 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
534 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
535 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
536 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
537 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
538 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
539 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
540 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
541 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
542 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
543 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
544 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
545 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
546 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
547 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
548 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
549 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
550 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
551 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
552 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
553 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
554 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
555 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
556 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
557 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
558 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
559 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
560 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
561 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
562 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
563 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
564 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
565 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
566 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
567 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
568 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
569 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
570 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
571 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
572 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
573 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
574 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
575 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
576 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
577 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
578 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
579 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
580 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
581 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
582 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
583 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
584 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
585 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
586 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
587 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
588 2844163670 Ensifer sp. 1H6 Isolate Unclassified
589 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
590 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
591 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
592 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
593 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
594 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
595 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
596 2854911287 Brucella lupini LUP21 Isolate Unclassified
597 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
598 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
599 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
600 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
601 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
602 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
603 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
604 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
605 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
606 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
607 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
608 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
609 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
610 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
611 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
612 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
613 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
614 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
615 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
616 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
617 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
618 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
619 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
620 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
621 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
622 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
623 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
624 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
625 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
626 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
627 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
628 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
629 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
630 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
631 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
632 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
633 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
634 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
635 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
636 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
637 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
638 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
639 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
640 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
641 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
642 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
643 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
644 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
645 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
646 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
647 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
648 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
649 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
650 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
651 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
652 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
653 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
654 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
655 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
656 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
657 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
658 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
659 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
660 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
661 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
662 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
663 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
664 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
665 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
666 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
667 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
668 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
669 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
670 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
671 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
672 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
673 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
674 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
675 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
676 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
677 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
678 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
679 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
680 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
681 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
682 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
683 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
684 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
685 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
686 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
687 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
688 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
689 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
690 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
691 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
692 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
693 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
694 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
695 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
696 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
697 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
698 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
699 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
700 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
701 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
702 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
703 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
704 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
705 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
706 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
707 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
708 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
709 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
710 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
711 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
712 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
713 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
714 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
715 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
716 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
717 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
718 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
719 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
720 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
721 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
722 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
723 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
724 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
725 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
726 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
727 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
728 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
729 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
730 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
731 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
732 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
733 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
734 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
735 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
736 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
737 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
738 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
739 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
740 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
741 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
742 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
743 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
744 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
745 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
746 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
747 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
748 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
749 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
750 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
751 2933599457 Rhizobium phaseoli M3 Isolate Nodule
752 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
753 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
754 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
755 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
756 2936381700 Rhizobium chutanense C16 Isolate Unclassified
757 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
758 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
759 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
760 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
761 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
762 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
763 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
764 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
765 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
766 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
767 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
768 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
769 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
770 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
771 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
772 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
773 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
774 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
775 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
776 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
777 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
778 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
779 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
780 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
781 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
782 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
783 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
784 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
785 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
786 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
787 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
788 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
789 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
790 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
791 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
792 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
793 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
794 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
795 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
796 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
797 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
798 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
799 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
800 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
801 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
802 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
803 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
804 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
805 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
806 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
807 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
808 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
809 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
810 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
811 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
812 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
813 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
814 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
815 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
816 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
817 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
818 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
819 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
820 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
821 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
822 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
823 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
824 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
825 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
826 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
827 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
828 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
829 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
830 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
831 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
832 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
833 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
834 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
835 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
836 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
837 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
838 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
839 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
840 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
841 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
842 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
843 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
844 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
845 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
846 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
847 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
848 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
849 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
850 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
851 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
852 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
853 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
854 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
855 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
856 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
857 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
858 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
859 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
860 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
861 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
862 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
863 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
864 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
865 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
866 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
867 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
868 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
869 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
870 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
871 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
872 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
873 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
874 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
875 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
876 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
877 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
878 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
879 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
880 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
881 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
882 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
883 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
884 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
885 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
886 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
887 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
888 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
889 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
890 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
891 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
892 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
893 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
894 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
895 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
896 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
897 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
898 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
899 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
900 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
901 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
902 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
903 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
904 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
905 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
906 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
907 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
908 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
909 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
910 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
911 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
912 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
913 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
914 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
915 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
916 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
917 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
918 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
919 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
920 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
921 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
922 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
923 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
924 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
925 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
926 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
927 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
928 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
929 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
930 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
931 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
932 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
933 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
934 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
935 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
936 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
937 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
938 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
939 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
940 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
941 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
942 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
943 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
944 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
945 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
946 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
947 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
948 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
949 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
950 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
951 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
952 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
953 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
954 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
955 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
956 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
957 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
958 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
959 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
960 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
961 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
962 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
963 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
964 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
965 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
966 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
967 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
968 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
969 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
970 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
971 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
972 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
973 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
974 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
975 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
976 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
977 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
978 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
979 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
980 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
981 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
982 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
983 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
984 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
985 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
986 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
987 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
988 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
989 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
990 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
991 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
992 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
993 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
994 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
995 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
996 2996887358 Rhizobium sp. R711 Isolate Nodule
997 2996893221 Rhizobium sp. R635 Isolate Nodule
998 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
999 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1000 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1001 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1002 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1003 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1004 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1005 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1006 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1007 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
1008 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1009 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1010 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1011 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1012 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1013 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
1014 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1015 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
1016 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1017 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1018 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1019 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1020 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1021 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1022 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
1023 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1024 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1025 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1026 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1027 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1028 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1029 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1030 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1031 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1032 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1033 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1034 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1035 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1036 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1037 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1038 8005258706 Rhizobium sp. R693 Isolate Nodule
1039 8005275841 Rhizobium sp. N4311 Isolate Nodule
1040 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1041 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1042 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1043 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1044 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1045 8005321885 Rhizobium sp. R72 Isolate Nodule
1046 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1047 8005382845 Rhizobium sp. R634 Isolate Nodule
1048 8005395548 Rhizobium sp. R339 Isolate Nodule
1049 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1050 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1051 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1052 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1053 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1054 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1055 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1056 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1057 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1058 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1059 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1060 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1061 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1062 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1063 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1064 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1065 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1066 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1067 8018176218 Rhizobium sp. N122 Isolate Nodule
1068 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1069 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1070 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1071 8024501048 Rhizobium sp. H4 Isolate Nodule
1072 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
1073 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1074 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1075 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1076 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1077 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
1078 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1079 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1080 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1081 8056382006 Rhizobium croatiense 13T Isolate Nodule
1082 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1083 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.05
Metatranscriptomes 0.07
Isolates 55.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 15.9
Nodule 43.77
Rhizoplane 2.06
Rhizosphere 22.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000015 3300001979 Bacteria 58951
2 JGI24739J22299_10055546 3300001989 Bacteria 1265
3 JGI25155J39150_1000001 3300002704 Bacteria 354543
4 JGI25156J39149_1000001 3300002705 Bacteria 354557
5 JGI25156J39149_1004314 3300002705 Bacteria 4366
6 JGI25162J39368_1000366 3300002737 Bacteria 38535
7 JGI25162J39368_1000368 3300002737 Bacteria 38495
8 JGI25154J39366_1000122 3300002738 Bacteria 61892
9 JGI25154J39366_1000150 3300002738 Bacteria 54544
10 JGI25157J39369_1000044 3300002741 Bacteria 122466
11 JGI25157J39369_1000787 3300002741 Bacteria 16220
12 JGI25152J39213_1001384 3300002773 Bacteria 10513
13 JGI25152J39213_1006279 3300002773 Bacteria 3280
14 JGI25152J39213_1013363 3300002773 Bacteria 1714
15 JGI25150J39212_1000107 3300002774 Bacteria 48306
16 JGI25150J39212_1001349 3300002774 Bacteria 6963
17 JGI25159J45721_1000014 3300002987 Bacteria 147809
18 JGI25159J45721_1000154 3300002987 Bacteria 32025
19 JGI25159J45721_1002719 3300002987 Bacteria 6564
20 JGI25151J46595_10000374 3300003187 Bacteria 46807
21 JGI25151J46595_10000839 3300003187 Bacteria 24488
22 JGI25151J46595_10016569 3300003187 Bacteria 3219
23 JGI25151J46595_10019149 3300003187 Bacteria 2916
24 JGI25151J46595_10021827 3300003187 Bacteria 2670
25 JGI25406J46586_10020113 3300003203 Bacteria 2706
26 JGI25165J46597_1000015 3300003214 Bacteria 380891
27 JGI25165J46597_1000516 3300003214 Bacteria 36635
28 JGI25165J46597_1001042 3300003214 Bacteria 18102
29 JGI25153J46596_10000696 3300003215 Bacteria 20557
30 JGI25153J46596_10003704 3300003215 Bacteria 8448
31 JGI25153J46596_10016985 3300003215 Bacteria 2886
32 rootH1_10079874 3300003316 Bacteria 4242
33 rootH2_10088276 3300003320 Bacteria 3631
34 rootL2_10014282 3300003322 Bacteria 4633
35 rootH1_10021547 3300003323 Bacteria 2849
36 rootH1_10070355 3300003323 Bacteria 3020
37 JGI25160J50197_1000001 3300003354 Bacteria 782301
38 JGI25160J50197_1000020 3300003354 Bacteria 232739
39 JGI25160J50197_1000633 3300003354 Bacteria 19629
40 JGI25160J50197_1001815 3300003354 Bacteria 10310
41 JGI25160J50197_1011442 3300003354 Bacteria 3148
42 JGI25161J50226_1000001 3300003374 Bacteria 655036
43 JGI25161J50226_1000174 3300003374 Bacteria 43080
44 JGI25161J50226_1000917 3300003374 Bacteria 10583
45 Ga0006562J51391_1006521 3300003578 Bacteria 11948
46 Ga0055542_1002379 3300003762 Bacteria 6356
47 Ga0055526_1000597 3300003771 Bacteria 28415
48 Ga0055526_1003626 3300003771 Bacteria 9665
49 Ga0055526_1005475 3300003771 Bacteria 7287
50 Ga0055526_1017907 3300003771 Bacteria 2675
51 Ga0055524_1001814 3300003775 Bacteria 11704
52 Ga0055524_1002206 3300003775 Bacteria 10222
53 Ga0055524_1011881 3300003775 Bacteria 3373
54 Ga0055536_1000497 3300003781 Bacteria 27238
55 Ga0055536_1015139 3300003781 Bacteria 2660
56 Ga0055528_1001645 3300003790 Bacteria 13155
57 Ga0055528_1002181 3300003790 Bacteria 10723
58 Ga0055528_1006108 3300003790 Bacteria 5502
59 Ga0055530_10013931 3300003791 Bacteria 2712
60 Ga0055540_1000929 3300003792 Bacteria 19079
61 Ga0055540_1014190 3300003792 Bacteria 2389
62 Ga0055540_1017573 3300003792 Bacteria 1991
63 Ga0055540_1029357 3300003792 Bacteria 1288
64 Ga0058692_1006490 3300003856 Bacteria 3203
65 Ga0055543_1000003 3300004625 Bacteria 358656
66 Ga0055543_1000047 3300004625 Bacteria 111073
67 Ga0055543_1000350 3300004625 Bacteria 31311
68 Ga0055543_1000500 3300004625 Bacteria 22620
69 Ga0065165_1000013 3300005262 Bacteria 301887
70 Ga0065165_1000068 3300005262 Bacteria 170609
71 Ga0065165_1003143 3300005262 Bacteria 12194
72 Ga0065165_1005056 3300005262 Bacteria 7684
73 Ga0065165_1013367 3300005262 Bacteria 3269
74 Ga0065165_1018479 3300005262 Bacteria 2522
75 Ga0070658_10252063 3300005327 Bacteria 1498
76 Ga0070670_100019742 3300005331 Bacteria 5787
77 Ga0070660_100107609 3300005339 Bacteria 2215
78 Ga0070660_100236797 3300005339 Bacteria 1486
79 Ga0070661_100360162 3300005344 Bacteria 1143
80 Ga0070668_100065942 3300005347 Bacteria 2809
81 Ga0070669_100128150 3300005353 Bacteria 1944
82 Ga0070667_100198458 3300005367 Bacteria 1780
83 Ga0070663_100016027 3300005455 Bacteria 4854
84 Ga0070663_100039204 3300005455 Bacteria 3309
85 Ga0068867_100224642 3300005459 Bacteria 1515
86 Ga0068853_100033685 3300005539 Bacteria 4346
87 Ga0070665_100005019 3300005548 Bacteria 13728
88 Ga0070665_100026286 3300005548 Bacteria 5862
89 Ga0070665_100058445 3300005548 Bacteria 3866
90 Ga0070665_100096450 3300005548 Bacteria 2962
91 Ga0070665_100386929 3300005548 Bacteria 1406
92 Ga0068854_100243268 3300005578 Bacteria 1434
93 Ga0068856_100231879 3300005614 Bacteria 1861
94 Ga0068852_100064870 3300005616 Bacteria 3185
95 Ga0068851_10086460 3300005834 Bacteria 1645
96 Ga0068851_10133838 3300005834 Bacteria 1343
97 Ga0081455_10121923 3300005937 Bacteria 2053
98 Ga0081539_10001091 3300005985 Bacteria 49336
99 Ga0075365_10001386 3300006038 Bacteria 10911
100 Ga0075365_10032112 3300006038 Bacteria 3372
101 Ga0075368_10011243 3300006042 Bacteria 3254
102 Ga0075368_10032524 3300006042 Bacteria 2027
103 Ga0075363_100007263 3300006048 Bacteria 5081
104 Ga0075363_100010076 3300006048 Bacteria 4468
105 Ga0075363_100141628 3300006048 Bacteria 1354
106 Ga0075364_10004656 3300006051 Bacteria 7912
107 Ga0075364_10036635 3300006051 Bacteria 3172
108 Ga0075364_10041343 3300006051 Bacteria 2993
109 Ga0075364_10064431 3300006051 Bacteria 2406
110 Ga0075364_10096237 3300006051 Bacteria 1968
111 Ga0075364_10191399 3300006051 Bacteria 1385
112 Ga0075362_10001497 3300006177 Bacteria 7509
113 Ga0075362_10015468 3300006177 Bacteria 3103
114 Ga0075362_10088881 3300006177 Bacteria 1432
115 Ga0075367_10005926 3300006178 Bacteria 6130
116 Ga0075369_10020288 3300006186 Bacteria 2721
117 Ga0075369_10023231 3300006186 Bacteria 2562
118 Ga0075369_10062478 3300006186 Bacteria 1627
119 Ga0075366_10063536 3300006195 Bacteria 2194
120 Ga0075366_10103558 3300006195 Bacteria 1709
121 Ga0075370_10020449 3300006353 Bacteria 3619
122 Ga0075370_10030359 3300006353 Bacteria 3015
123 Ga0075370_10040526 3300006353 Bacteria 2627
124 Ga0075370_10072756 3300006353 Bacteria 1968
125 Ga0075370_10226606 3300006353 Bacteria 1105
126 Ga0079104_1000193 3300006946 Bacteria 85489
127 Ga0079104_1005252 3300006946 Bacteria 5224
128 Ga0105240_10000076 3300009093 Bacteria 198848
129 Ga0105240_10452746 3300009093 Bacteria 1436
130 Ga0105243_10252166 3300009148 Bacteria 1576
131 Ga0105248_10019832 3300009177 Bacteria 7446
132 Ga0105237_10000226 3300009545 Bacteria 79798
133 Ga0105237_10109722 3300009545 Bacteria 2751
134 Ga0105238_10001971 3300009551 Bacteria 20670
135 Ga0105249_10171141 3300009553 Bacteria 2106
136 Ga0123342_1008456 3300009766 Bacteria 12935
137 Ga0123342_1027287 3300009766 Bacteria 3216
138 Ga0105239_10000641 3300010375 Bacteria 49765
139 Ga0105239_10088037 3300010375 Bacteria 3423
140 Ga0157371_10000017 3300013102 Bacteria 320830
141 Ga0157371_10004510 3300013102 Bacteria 12131
142 Ga0157370_10000455 3300013104 Bacteria 51231
143 Ga0157370_10000461 3300013104 Bacteria 50850
144 Ga0157369_10031883 3300013105 Bacteria 5799
145 Ga0157369_10125254 3300013105 Bacteria 2725
146 Ga0157369_10346555 3300013105 Bacteria 1543
147 Ga0171463_1003 3300013249 Bacteria 695693
148 Ga0157372_10485652 3300013307 Bacteria 1440
149 Ga0182008_10079872 3300014497 Bacteria 1609
150 Ga0182007_10001815 3300015262 Bacteria 11146
151 Ga0182007_10026809 3300015262 Bacteria 1993
152 Ga0183363_1025 3300015690 Bacteria 53844
153 Ga0214544_1001800 3300021320 Bacteria 45046
154 Ga0214542_1000012 3300021321 Bacteria 235800
155 Ga0214542_1023017 3300021321 Bacteria 3837
156 Ga0214543_1000024 3300021327 Bacteria 235745
157 Ga0214543_1000038 3300021327 Bacteria 182106
158 Ga0213874_10009440 3300021377 Bacteria 2412
159 Ga0213876_10021274 3300021384 Bacteria 3431
160 Ga0213876_10058321 3300021384 Bacteria 2038
161 Ga0228711_1000008 3300022739 Bacteria 169893
162 Ga0228710_1000009 3300022740 Bacteria 169770
163 Ga0209435_100012 3300025206 Bacteria 401621
164 Ga0209436_100192 3300025208 Bacteria 28415
165 Ga0209436_102637 3300025208 Bacteria 5235
166 Ga0209437_100051 3300025233 Bacteria 392523
167 Ga0209437_100098 3300025233 Bacteria 229766
168 Ga0207425_1000075 3300025245 Bacteria 107452
169 Ga0207425_1001337 3300025245 Bacteria 10584
170 Ga0207425_1003914 3300025245 Bacteria 4613
171 Ga0207425_1007562 3300025245 Bacteria 2854
172 Ga0209646_1000026 3300025246 Bacteria 401621
173 Ga0209646_1001199 3300025246 Bacteria 7491
174 Ga0209646_1005840 3300025246 Bacteria 2114
175 Ga0209026_1000014 3300025250 Bacteria 401621
176 Ga0209026_1000025 3300025250 Bacteria 352548
177 Ga0209677_102022 3300025253 Bacteria 8058
178 Ga0209148_1000128 3300025254 Bacteria 179154
179 Ga0209759_1000012 3300025256 Bacteria 401621
180 Ga0209759_1000121 3300025256 Bacteria 138469
181 Ga0209129_1000156 3300025258 Bacteria 107484
182 Ga0209129_1000524 3300025258 Bacteria 26835
183 Ga0209129_1000903 3300025258 Bacteria 18159
184 Ga0209129_1001820 3300025258 Bacteria 11302
185 Ga0209129_1003415 3300025258 Bacteria 6942
186 Ga0209129_1004539 3300025258 Bacteria 5363
187 Ga0209129_1006394 3300025258 Bacteria 3820
188 Ga0209233_1000010 3300025261 Bacteria 1194329
189 Ga0209233_1000095 3300025261 Bacteria 303783
190 Ga0209233_1000113 3300025261 Bacteria 253455
191 Ga0209233_1000427 3300025261 Bacteria 30799
192 Ga0209565_1020818 3300025263 Bacteria 1380
193 Ga0209455_1000127 3300025272 Bacteria 162518
194 Ga0209455_1005019 3300025272 Bacteria 4192
195 Ga0209673_1000010 3300025273 Bacteria 596656
196 Ga0209673_1000117 3300025273 Bacteria 172081
197 Ga0209673_1000151 3300025273 Bacteria 148103
198 Ga0209673_1000863 3300025273 Bacteria 39346
199 Ga0209673_1001685 3300025273 Bacteria 18869
200 Ga0209673_1001808 3300025273 Bacteria 17597
201 Ga0209673_1006523 3300025273 Bacteria 5610
202 Ga0209673_1006586 3300025273 Bacteria 5564
203 Ga0209673_1015833 3300025273 Bacteria 2844
204 Ga0209673_1020454 3300025273 Bacteria 2343
205 Ga0209130_1000003 3300025284 Bacteria 677988
206 Ga0209130_1000020 3300025284 Bacteria 379297
207 Ga0209130_1000034 3300025284 Bacteria 302439
208 Ga0209130_1007341 3300025284 Bacteria 3415
209 Ga0209130_1008071 3300025284 Bacteria 3154
210 Ga0209130_1023618 3300025284 Bacteria 1353
211 Ga0209676_1000482 3300025292 Bacteria 65372
212 Ga0209676_1006339 3300025292 Bacteria 5866
213 Ga0209025_1000070 3300025294 Bacteria 287776
214 Ga0209025_1000140 3300025294 Bacteria 184765
215 Ga0209025_1000314 3300025294 Bacteria 107720
216 Ga0209025_1000506 3300025294 Bacteria 74798
217 Ga0209025_1001869 3300025294 Bacteria 24674
218 Ga0209025_1003183 3300025294 Bacteria 15930
219 Ga0209025_1005091 3300025294 Bacteria 10936
220 Ga0209025_1005402 3300025294 Bacteria 10443
221 Ga0209025_1012522 3300025294 Bacteria 5427
222 Ga0209025_1032235 3300025294 Bacteria 2456
223 Ga0209564_1000013 3300025295 Bacteria 775755
224 Ga0209564_1000647 3300025295 Bacteria 52658
225 Ga0209564_1001780 3300025295 Bacteria 19956
226 Ga0209564_1001993 3300025295 Bacteria 17874
227 Ga0209564_1006943 3300025295 Bacteria 5950
228 Ga0209758_1000413 3300025297 Bacteria 72744
229 Ga0209758_1000655 3300025297 Bacteria 52188
230 Ga0209758_1000758 3300025297 Bacteria 46817
231 Ga0209758_1001882 3300025297 Bacteria 22974
232 Ga0209758_1002154 3300025297 Bacteria 20718
233 Ga0209758_1003547 3300025297 Bacteria 14035
234 Ga0209758_1008206 3300025297 Bacteria 6841
235 Ga0209758_1011955 3300025297 Bacteria 4935
236 Ga0209758_1012454 3300025297 Bacteria 4759
237 Ga0209758_1039819 3300025297 Bacteria 1782
238 Ga0209050_1000646 3300025298 Bacteria 54050
239 Ga0209050_1005467 3300025298 Bacteria 7967
240 Ga0209050_1009095 3300025298 Bacteria 5154
241 Ga0209256_1002424 3300025299 Bacteria 15263
242 Ga0209256_1003084 3300025299 Bacteria 12230
243 Ga0209256_1003214 3300025299 Bacteria 11800
244 Ga0209256_1003882 3300025299 Bacteria 9914
245 Ga0209256_1004240 3300025299 Bacteria 9186
246 Ga0209256_1009377 3300025299 Bacteria 4305
247 Ga0209256_1028220 3300025299 Bacteria 1587
248 Ga0207426_1000006 3300025302 Bacteria 1025969
249 Ga0207426_1000008 3300025302 Bacteria 848730
250 Ga0207426_1000011 3300025302 Bacteria 791203
251 Ga0207426_1000221 3300025302 Bacteria 134756
252 Ga0207426_1000958 3300025302 Bacteria 28428
253 Ga0209051_1000097 3300025303 Bacteria 167378
254 Ga0209051_1000314 3300025303 Bacteria 74316
255 Ga0209051_1002962 3300025303 Bacteria 11565
256 Ga0209051_1009257 3300025303 Bacteria 5093
257 Ga0209051_1009905 3300025303 Bacteria 4865
258 Ga0209051_1013215 3300025303 Bacteria 3944
259 Ga0209257_1001142 3300025304 Bacteria 33931
260 Ga0209257_1002032 3300025304 Bacteria 21575
261 Ga0209257_1002070 3300025304 Bacteria 21158
262 Ga0207656_10078482 3300025321 Bacteria 1480
263 Ga0207647_10004029 3300025904 Bacteria 10951
264 Ga0207654_10045317 3300025911 Bacteria 2502
265 Ga0207695_10000011 3300025913 Bacteria 910221
266 Ga0207695_10191763 3300025913 Bacteria 1961
267 Ga0207695_10395515 3300025913 Bacteria 1267
268 Ga0207671_10000093 3300025914 Bacteria 138939
269 Ga0207671_10079253 3300025914 Bacteria 2461
270 Ga0207681_10123911 3300025923 Bacteria 1900
271 Ga0207694_10486840 3300025924 Bacteria 1032
272 Ga0207711_10216317 3300025941 Bacteria 1751
273 Ga0207668_10292067 3300025972 Bacteria 1342
274 Ga0207668_10443303 3300025972 Bacteria 1106
275 Ga0207640_10049482 3300025981 Bacteria 2722
276 Ga0207639_10153167 3300026041 Bacteria 1933
277 Ga0207678_10034321 3300026067 Bacteria 4419
278 Ga0207678_10035878 3300026067 Bacteria 4317
279 Ga0207678_10204455 3300026067 Bacteria 1689
280 Ga0207674_10172476 3300026116 Bacteria 2116
281 Ga0209281_1000034 3300027111 Bacteria 382562
282 Ga0209281_1000106 3300027111 Bacteria 219666
283 Ga0209281_1000318 3300027111 Bacteria 85039
284 Ga0209371_1000022 3300027312 Bacteria 536342
285 Ga0209371_1000993 3300027312 Bacteria 21806
286 Ga0209371_1001019 3300027312 Bacteria 21271
287 Ga0209282_1000024 3300027666 Bacteria 170348
288 Ga0209282_1000531 3300027666 Bacteria 18489
289 Ga0209813_10007694 3300027866 Bacteria 2692
290 Ga0268266_10008843 3300028379 Bacteria 8918
291 Ga0268266_10022262 3300028379 Bacteria 5401
292 Ga0268266_10358749 3300028379 Bacteria 1371
293 Ga0268266_10518521 3300028379 Bacteria 1139
294 Ga0268264_10470411 3300028381 Bacteria 1221
295 Ga0307515_10001559 3300028794 Bacteria 51153
296 Ga0307515_10001978 3300028794 Bacteria 45366
297 Ga0307515_10007368 3300028794 Bacteria 21770
298 Ga0307515_10081682 3300028794 Bacteria 4194
299 Ga0307515_10267194 3300028794 Bacteria 1437
300 Ga0268256_1000019 3300030500 Bacteria 587949
301 Ga0268256_1002326 3300030500 Bacteria 9822
302 Ga0268256_1003018 3300030500 Bacteria 7944
303 Ga0265328_10013731 3300031239 Bacteria 3199
304 Ga0265328_10053131 3300031239 Bacteria 1486
305 Ga0265331_10000057 3300031250 Bacteria 175827
306 Ga0265327_10006578 3300031251 Bacteria 9239
307 Ga0307513_10083892 3300031456 Bacteria 3275
308 Ga0307408_100012234 3300031548 Bacteria 5680
309 Ga0307408_100214803 3300031548 Bacteria 1566
310 Ga0307405_10005824 3300031731 Bacteria 5998
311 Ga0307406_10018709 3300031901 Bacteria 4052
312 Ga0307412_10004908 3300031911 Bacteria 7470
313 Ga0315914_1000012 3300031967 Bacteria 169896
314 Ga0307414_10146426 3300032004 Bacteria 1856
315 Ga0315913_1000006 3300033430 Bacteria 169893
316 Ga0315915_1000010 3300033464 Bacteria 240214
317 Ga0373927_0000955 3300035695 Bacteria 22028
318 Ga0316584_0076972 3300036712 Bacteria 2500
319 Ga0373925_0014806 3300037068 Bacteria 5638
320 Ga0395900_0000020 3300037418 Bacteria 353500
321 Ga0395900_0191807 3300037418 Bacteria 2072
322 Ga0395900_0216437 3300037418 Bacteria 1933
323 Ga0395898_0000259 3300037466 Bacteria 130131
324 Ga0395898_0103703 3300037466 Bacteria 2728
325 Ga0395905_0000019 3300037471 Bacteria 353500
326 Ga0395905_0000867 3300037471 Bacteria 39452
327 Ga0395905_0073574 3300037471 Bacteria 3203
328 Ga0395905_0144708 3300037471 Bacteria 2236
329 Ga0395901_0000016 3300038443 Bacteria 354008
330 Ga0395901_0119019 3300038443 Bacteria 2775
331 Ga0395901_0235389 3300038443 Bacteria 1911
332 Ga0395901_0289363 3300038443 Bacteria 1701
333 Ga0436365_1049263 3300039437 Bacteria 2297
334 Ga0436363_0081839 3300039450 Bacteria 14994
335 Ga0439465_0004711 3300041413 Bacteria 4400
336 Ga0439465_0025296 3300041413 Bacteria 1873
337 Ga0439465_0040303 3300041413 Bacteria 1509
338 Ga0451789_1234995 3300041443 Bacteria 2319
339 Ga0451791_0106417 3300041451 Bacteria 1490
340 Ga0451797_0983970 3300041453 Bacteria 1552
341 Ga0451798_1147850 3300041458 Bacteria 1891
342 Ga0451802_1569334 3300041460 Bacteria 1788
343 Ga0451837_0283088 3300041494 Bacteria 2609
344 Ga0451853_0516212 3300041512 Bacteria 5562
345 Ga0439449_0023481 3300042007 Bacteria 2306
346 Ga0439449_0047297 3300042007 Bacteria 1594
347 Ga0439462_0015493 3300042015 Bacteria 1966
348 Ga0450908_008881 3300042184 Bacteria 1877
349 Ga0450918_001951 3300042531 Bacteria 3985
350 Ga0466972_0053970 3300044658 Bacteria 1934
351 Ga0466965_0064119 3300044683 Bacteria 1839
352 Ga0466960_0043787 3300044901 Bacteria 2131
353 Ga0495592_0046344 3300046454 Bacteria 3241
354 Ga0495629_0114623 3300046459 Bacteria 1878
355 Ga0495638_0007419 3300046460 Bacteria 7864
356 Ga0495638_0042408 3300046460 Bacteria 2874
357 Ga0495605_0005651 3300046474 Bacteria 7267
358 Ga0495585_0019624 3300046492 Bacteria 3897
359 Ga0495596_0031401 3300046500 Bacteria 2122
360 Ga0495583_0022782 3300046506 Bacteria 3185
361 Ga0495583_0042806 3300046506 Bacteria 2112
362 Ga0495606_0009491 3300046507 Bacteria 8218
363 Ga0495606_0022266 3300046507 Bacteria 4621
364 Ga0495610_0014176 3300046512 Bacteria 4698
365 Ga0495610_0016624 3300046512 Bacteria 4226
366 Ga0495610_0050394 3300046512 Bacteria 2033
367 Ga0495616_0011762 3300046513 Bacteria 4999
368 Ga0495620_0044389 3300046515 Bacteria 1931
369 Ga0495631_0016293 3300046518 Bacteria 3546
370 Ga0495631_0018448 3300046518 Bacteria 3284
371 Ga0495632_0029781 3300046519 Bacteria 2839
372 Ga0495643_0002725 3300046522 Bacteria 13593
373 Ga0495654_0005762 3300046530 Bacteria 7138
374 Ga0495640_0159007 3300046533 Bacteria 1449
375 Ga0495609_0014268 3300046538 Bacteria 3740
376 Ga0495622_0069496 3300046557 Bacteria 1626
377 Ga0495633_0020890 3300046558 Bacteria 3284
378 Ga0495633_0039490 3300046558 Bacteria 2252
379 Ga0495668_0008493 3300046616 Bacteria 6400
380 Ga0495634_0099334 3300046642 Bacteria 1882
381 Ga0495611_0014639 3300046648 Bacteria 3353
382 Ga0495625_0009309 3300046660 Bacteria 8231
383 Ga0495625_0064997 3300046660 Bacteria 2572
384 Ga0495635_0033782 3300046663 Bacteria 3548
385 Ga0495671_0085212 3300046692 Bacteria 1548
386 Ga0495649_0038536 3300046694 Bacteria 2622
387 Ga0495600_0096111 3300046809 Bacteria 1931
388 Ga0495660_0055134 3300046810 Bacteria 2152
389 Ga0495604_0031380 3300047317 Bacteria 4213
390 Ga0495672_0069188 3300047320 Bacteria 2005
391 Ga0495681_0020691 3300047470 Bacteria 3563
392 Ga0495684_0029589 3300047471 Bacteria 4204
393 Ga0495686_0002729 3300047472 Bacteria 16131
394 Ga0495686_0018186 3300047472 Bacteria 4721
395 Ga0496100_0181870 3300048903 Bacteria 1521
396 Ga0496102_0014149 3300048905 Bacteria 6931
397 Ga0496104_0000102 3300048907 Bacteria 81318
398 Ga0496105_0000066 3300048908 Bacteria 83056
399 Ga0496105_0437165 3300048908 Bacteria 1034
400 Ga0496106_0000982 3300048909 Bacteria 20805
401 Ga0496108_0222004 3300048911 Bacteria 1642
402 Ga0496109_0449760 3300048912 Bacteria 1217
403 Ga0496111_0018337 3300048914 Bacteria 4848
404 Ga0496112_0019571 3300048915 Bacteria 6392
405 Ga0496112_0054190 3300048915 Bacteria 3940
406 Ga0496113_0102058 3300048916 Bacteria 2224
407 Ga0496113_0315618 3300048916 Bacteria 1252
408 Ga0496116_0000142 3300048919 Bacteria 150342
409 Ga0496116_0016593 3300048919 Bacteria 5753
410 Ga0496116_0018820 3300048919 Bacteria 5307
411 Ga0496116_0038533 3300048919 Bacteria 3317
412 Ga0496116_0080222 3300048919 Bacteria 2027
413 Ga0496117_0000002 3300048920 Bacteria 2483758
414 Ga0496117_0001574 3300048920 Bacteria 32408
415 Ga0496117_0021729 3300048920 Bacteria 5178
416 Ga0496117_0022590 3300048920 Bacteria 5041
417 Ga0496117_0061476 3300048920 Bacteria 2581
418 Ga0496118_0000087 3300048921 Bacteria 176693
419 Ga0496118_0008894 3300048921 Bacteria 10262
420 Ga0496118_0016932 3300048921 Bacteria 6657
421 Ga0496118_0044870 3300048921 Bacteria 3457
422 Ga0496118_0057268 3300048921 Bacteria 2923
423 Ga0496119_0009049 3300048922 Bacteria 8628
424 Ga0496119_0027308 3300048922 Bacteria 3926
425 Ga0496119_0062555 3300048922 Bacteria 2217
426 Ga0496119_0091169 3300048922 Bacteria 1731
427 Ga0496120_0000180 3300048923 Bacteria 107518
428 Ga0496120_0001104 3300048923 Bacteria 35202
429 Ga0496120_0013595 3300048923 Bacteria 5470
430 Ga0496120_0019812 3300048923 Bacteria 4291
431 Ga0496120_0060418 3300048923 Bacteria 2120
432 Ga0496121_0000003 3300048924 Bacteria 1191431
433 Ga0496121_0001116 3300048924 Bacteria 47237
434 Ga0496121_0015656 3300048924 Bacteria 7912
435 Ga0496121_0032152 3300048924 Bacteria 4776
436 Ga0496121_0061938 3300048924 Bacteria 3067
437 Ga0496121_0135598 3300048924 Bacteria 1834
438 Ga0496121_0144693 3300048924 Bacteria 1758
439 Ga0496121_0195615 3300048924 Bacteria 1445
440 Ga0496122_0000004 3300048925 Bacteria 645283
441 Ga0496122_0000190 3300048925 Bacteria 140376
442 Ga0496122_0000215 3300048925 Bacteria 128810
443 Ga0496122_0026140 3300048925 Bacteria 5046
444 Ga0496122_0037339 3300048925 Bacteria 3912
445 Ga0496122_0048183 3300048925 Bacteria 3280
446 Ga0496122_0079153 3300048925 Bacteria 2298
447 Ga0496122_0079175 3300048925 Bacteria 2298
448 Ga0496122_0134204 3300048925 Bacteria 1564
449 Ga0496122_0243851 3300048925 Bacteria 1010
450 Ga0496123_0000007 3300048926 Bacteria 645283
451 Ga0496123_0000306 3300048926 Bacteria 95266
452 Ga0496123_0000336 3300048926 Bacteria 89161
453 Ga0496123_0018187 3300048926 Bacteria 5605
454 Ga0496123_0019973 3300048926 Bacteria 5258
455 Ga0496123_0036749 3300048926 Bacteria 3466
456 Ga0496123_0052666 3300048926 Bacteria 2698
457 Ga0496123_0066775 3300048926 Bacteria 2276
458 Ga0496124_0001040 3300048927 Bacteria 43813
459 Ga0496124_0009838 3300048927 Bacteria 9779
460 Ga0496124_0011540 3300048927 Bacteria 8817
461 Ga0496124_0012175 3300048927 Bacteria 8513
462 Ga0496124_0019650 3300048927 Bacteria 6276
463 Ga0496124_0031448 3300048927 Bacteria 4697
464 Ga0496124_0062166 3300048927 Bacteria 3126
465 Ga0496124_0097222 3300048927 Bacteria 2391
466 Ga0496124_0179023 3300048927 Bacteria 1633
467 Ga0496125_0000039 3300048928 Bacteria 318665
468 Ga0496125_0000248 3300048928 Bacteria 110840
469 Ga0496125_0021378 3300048928 Bacteria 6038
470 Ga0496125_0037107 3300048928 Bacteria 4242
471 Ga0496125_0050022 3300048928 Bacteria 3465
472 Ga0496126_0000866 3300048929 Bacteria 53241
473 Ga0496126_0001294 3300048929 Bacteria 39967
474 Ga0496126_0033922 3300048929 Bacteria 4800
475 Ga0496126_0042795 3300048929 Bacteria 4181
476 Ga0495678_056734 3300049459 Bacteria 1487
477 Ga0501031_0000036 3300049568 Bacteria 73760
478 Ga0501031_0047685 3300049568 Bacteria 2793
479 Ga0501031_0149743 3300049568 Bacteria 1524
480 Ga0501031_0161025 3300049568 Bacteria 1467
481 Ga0501032_0000075 3300049569 Bacteria 84153
482 Ga0501032_0000100 3300049569 Bacteria 73505
483 Ga0501032_0001737 3300049569 Bacteria 17232
484 Ga0501032_0082069 3300049569 Bacteria 2145
485 Ga0501032_0143661 3300049569 Bacteria 1571
486 Ga0501033_0000088 3300049570 Bacteria 87638
487 Ga0501033_0001862 3300049570 Bacteria 18338
488 Ga0501033_0002110 3300049570 Bacteria 17214
489 Ga0501033_0005265 3300049570 Bacteria 10266
490 Ga0501033_0232168 3300049570 Bacteria 1310
491 Ga0501034_0000397 3300049571 Bacteria 73511
492 Ga0501034_0001558 3300049571 Bacteria 30010
493 Ga0501034_0003857 3300049571 Bacteria 16894
494 Ga0501034_0048012 3300049571 Bacteria 4308
495 Ga0501034_0118490 3300049571 Bacteria 2634
496 Ga0501034_0150276 3300049571 Bacteria 2305
497 Ga0501034_0191432 3300049571 Bacteria 2007
498 Ga0501036_0000056 3300049572 Bacteria 73511
499 Ga0501036_0000398 3300049572 Bacteria 30616
500 Ga0501036_0080999 3300049572 Bacteria 2744
501 Ga0501036_0122861 3300049572 Bacteria 2192
502 Ga0501037_0000021 3300049573 Bacteria 150037
503 Ga0501037_0000119 3300049573 Bacteria 73510
504 Ga0501037_0000181 3300049573 Bacteria 58438
505 Ga0501037_0078621 3300049573 Bacteria 2393
506 Ga0501038_0000032 3300049574 Bacteria 131432
507 Ga0501038_0000098 3300049574 Bacteria 73471
508 Ga0501038_0036751 3300049574 Bacteria 4298
509 Ga0501038_0070868 3300049574 Bacteria 2958
510 Ga0501038_0076793 3300049574 Bacteria 2821
511 Ga0501038_0092381 3300049574 Bacteria 2534
512 Ga0501038_0175688 3300049574 Bacteria 1731
513 Ga0501038_0205028 3300049574 Bacteria 1580
514 Ga0501039_0000013 3300049575 Bacteria 234418
515 Ga0501039_0000025 3300049575 Bacteria 152236
516 Ga0501039_0205470 3300049575 Bacteria 1548
517 Ga0501040_0009534 3300049576 Bacteria 6334
518 Ga0501041_0187182 3300049577 Bacteria 1296
519 Ga0501043_0000008 3300049579 Bacteria 223654
520 Ga0501043_0002291 3300049579 Bacteria 16234
521 Ga0501043_0004109 3300049579 Bacteria 11886
522 Ga0501043_0007295 3300049579 Bacteria 8775
523 Ga0501043_0051244 3300049579 Bacteria 3243
524 Ga0501043_0083993 3300049579 Bacteria 2503
525 Ga0501046_0013314 3300049580 Bacteria 6967
526 Ga0501046_0037975 3300049580 Bacteria 3868
527 Ga0501046_0202761 3300049580 Bacteria 1475
528 Ga0501047_0001349 3300049581 Bacteria 24106
529 Ga0501047_0017967 3300049581 Bacteria 6778
530 Ga0501047_0039511 3300049581 Bacteria 4563
531 Ga0501047_0062535 3300049581 Bacteria 3590
532 Ga0501047_0101722 3300049581 Bacteria 2753
533 Ga0501047_0102827 3300049581 Bacteria 2736
534 Ga0501047_0192369 3300049581 Bacteria 1903
535 Ga0501048_0016682 3300049582 Bacteria 5414
536 Ga0501067_0141085 3300049583 Bacteria 1342
537 Ga0501068_0006998 3300049584 Bacteria 6239
538 Ga0501068_0026901 3300049584 Bacteria 3393
539 Ga0501069_0000028 3300049585 Bacteria 106038
540 Ga0501069_0007284 3300049585 Bacteria 5802
541 Ga0501069_0022986 3300049585 Bacteria 3395
542 Ga0501069_0228373 3300049585 Bacteria 1083
543 Ga0501070_0000264 3300049586 Bacteria 49510
544 Ga0501070_0002017 3300049586 Bacteria 17837
545 Ga0501070_0015537 3300049586 Bacteria 6403
546 Ga0501070_0063027 3300049586 Bacteria 3071
547 Ga0501070_0136689 3300049586 Bacteria 2023
548 Ga0501071_0003907 3300049587 Bacteria 9391
549 Ga0501073_0008365 3300049589 Bacteria 7674
550 Ga0501073_0362324 3300049589 Bacteria 1001
551 Ga0501073_0386024 3300049589 Bacteria 967
552 Ga0501074_0000016 3300049590 Bacteria 78666
553 Ga0501074_0042820 3300049590 Bacteria 3275
554 Ga0501238_002902 3300049671 Bacteria 2082
555 Ga0501080_0000065 3300049742 Bacteria 69171
556 Ga0501080_0000515 3300049742 Bacteria 30480
557 Ga0501080_0031280 3300049742 Bacteria 4959
558 Ga0501080_0079199 3300049742 Bacteria 3055
559 Ga0501080_0295474 3300049742 Bacteria 1470
560 Ga0501083_0000482 3300049744 Bacteria 25555
561 Ga0501083_0013677 3300049744 Bacteria 5675
562 Ga0501083_0064806 3300049744 Bacteria 2434
563 Ga0501083_0156097 3300049744 Bacteria 1494
564 Ga0501035_0000011 3300049822 Bacteria 305794
565 Ga0501035_0000053 3300049822 Bacteria 142860
566 Ga0501035_0000085 3300049822 Bacteria 116189
567 Ga0501035_0002030 3300049822 Bacteria 20177
568 Ga0501035_0032479 3300049822 Bacteria 4748
569 Ga0501035_0063203 3300049822 Bacteria 3293
570 Ga0501035_0078397 3300049822 Bacteria 2918
571 Ga0501035_0124226 3300049822 Bacteria 2254
572 Ga0501035_0204797 3300049822 Bacteria 1690
573 Ga0501035_0405270 3300049822 Bacteria 1134
574 Ga0501044_0000011 3300049823 Bacteria 257385
575 Ga0501044_0000214 3300049823 Bacteria 73483
576 Ga0501044_0030366 3300049823 Bacteria 5696
577 Ga0501044_0040188 3300049823 Bacteria 4876
578 Ga0501044_0043769 3300049823 Bacteria 4650
579 Ga0501044_0050307 3300049823 Bacteria 4301
580 Ga0501044_0053203 3300049823 Bacteria 4166
581 Ga0501044_0108582 3300049823 Bacteria 2784
582 Ga0501044_0203480 3300049823 Bacteria 1937
583 Ga0501045_0005924 3300049824 Bacteria 8454
584 Ga0501045_0128842 3300049824 Bacteria 1881
585 nmdc:mga03683_118784_c1 3300050489 Bacteria 1174
586 nmdc:mga03n38_46787_c1 3300050490 Bacteria 1912
587 nmdc:mga00v17_122353_c1 3300050491 Bacteria 1658
588 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
589 nmdc:mga00v17_274724_c1 3300050491 Bacteria 1094
590 nmdc:mga00v17_639_c1 3300050491 Bacteria 19367
591 nmdc:mga00v17_72484_c1 3300050491 Bacteria 2137
592 nmdc:mga00v17_88947_c1 3300050491 Bacteria 1937
593 nmdc:mga0yw44_131384_c1 3300050492 Bacteria 1621
594 nmdc:mga0yw44_281182_c1 3300050492 Bacteria 1112
595 nmdc:mga0yw44_5378_c1 3300050492 Bacteria 6035
596 nmdc:mga0yw44_76030_c1 3300050492 Bacteria 2095
597 nmdc:mga0yw44_7667_c1 3300050492 Bacteria 5326
598 nmdc:mga0yw44_78460_c1 3300050492 Bacteria 2065
599 nmdc:mga0k408_53778_c1 3300050493 Bacteria 2334
600 nmdc:mga0k408_69712_c1 3300050493 Bacteria 2052
601 nmdc:mga06z11_26657_c1 3300050494 Bacteria 2753
602 nmdc:mga07m45_111570_c1 3300050496 Bacteria 1575
603 nmdc:mga07m45_143377_c1 3300050496 Bacteria 1384
604 nmdc:mga07m45_221463_c1 3300050496 Bacteria 1101
605 nmdc:mga07m45_43873_c1 3300050496 Bacteria 2508
606 nmdc:mga0sz30_346_c1 3300050516 Bacteria 17737
607 Ga0500578_0023373 3300053086 Bacteria 3968
608 Ga0500651_0102592 3300053093 Bacteria 1753
609 Ga0500654_052296 3300053099 Bacteria 2185
610 Ga0500556_0068597 3300053104 Bacteria 1321
611 Ga0500557_014969 3300053105 Bacteria 2085
612 Ga0500569_005171 3300053109 Bacteria 2791
613 Ga0500607_045902 3300053121 Bacteria 2344
614 Ga0500618_000677 3300053125 Bacteria 20060
615 Ga0500618_001651 3300053125 Bacteria 9605
616 Ga0500618_017165 3300053125 Bacteria 1803
617 Ga0500658_0003010 3300053134 Bacteria 6469
618 Ga0500658_0014807 3300053134 Bacteria 2890
619 Ga0500559_0006770 3300053136 Bacteria 5144
620 Ga0500559_0007013 3300053136 Bacteria 5036
621 Ga0500568_0000093 3300053139 Bacteria 83403
622 Ga0500568_0004654 3300053139 Bacteria 7297
623 Ga0500568_0008573 3300053139 Bacteria 4917
624 Ga0500573_0010216 3300053140 Bacteria 5233
625 Ga0500590_003639 3300053148 Bacteria 7150
626 Ga0500604_0026214 3300053151 Bacteria 1680
627 Ga0500616_0000277 3300053153 Bacteria 76399
628 Ga0500616_0004617 3300053153 Bacteria 9730
629 Ga0500616_0102257 3300053153 Bacteria 1398
630 Ga0500620_002880 3300053155 Bacteria 3573
631 Ga0500622_0000458 3300053156 Bacteria 38693
632 Ga0500622_0001719 3300053156 Bacteria 16947
633 Ga0500622_0047293 3300053156 Bacteria 2223
634 Ga0500624_001212 3300053157 Bacteria 4631
635 Ga0500627_0109936 3300053158 Bacteria 1240
636 Ga0500633_0002864 3300053160 Bacteria 3648
637 Ga0500634_0017227 3300053161 Bacteria 3867
638 Ga0500636_0001459 3300053177 Bacteria 12853
639 Ga0500636_0170223 3300053177 Bacteria 1179
640 Ga0501082_0020558 3300060353 Bacteria 5690
641 Ga0501082_0233321 3300060353 Bacteria 1601
642 2793280315 2791355253 Bacteria 5171699
643 2509108407 2508501122 Bacteria 6292184
644 2509113177 2508501123 Bacteria 6283661
645 2509143264 2508501127 Bacteria 7037543
646 2509376460 2509276019 Bacteria 6802256
647 2509392068 2509276021 Bacteria 7634384
648 2509445659 2509276033 Bacteria 7180565
649 2509447040 2509276033 Bacteria 7180565
650 2510133941 2510065019 Bacteria 6903379
651 2510306443 2510065057 Bacteria 6649661
652 2510315459 2510065059 Bacteria 6847884
653 2510895359 2510461076 Bacteria 8618824
654 2511135389 2510917022 Bacteria 6504556
655 2511173655 2510917026 Bacteria 7046020
656 2511187043 2510917028 Bacteria 6185411
657 2511199015 2510917030 Bacteria 7460662
658 2511389844 2511231027 Bacteria 5013807
659 2511502233 2511231052 Bacteria 6974333
660 2512533606 2512047086 Bacteria 6850303
661 2512931452 2512875016 Bacteria 6529530
662 2512959284 2512875024 Bacteria 7195110
663 2512970705 2512875026 Bacteria 6861065
664 2513567986 2513237084 Bacteria 7231967
665 2513576928 2513237085 Bacteria 7695351
666 2513584395 2513237086 Bacteria 7265287
667 2513596463 2513237088 Bacteria 6927906
668 2513604251 2513237089 Bacteria 6553624
669 2513612763 2513237090 Bacteria 7096802
670 2513618793 2513237091 Bacteria 6900273
671 2513633400 2513237093 Bacteria 7545552
672 2513708062 2513237103 Bacteria 7647401
673 2513865586 2513237138 Bacteria 7368160
674 2513884416 2513237140 Bacteria 7076289
675 2513904997 2513237143 Bacteria 6664116
676 2513909014 2513237144 Bacteria 7530820
677 2513925397 2513237146 Bacteria 7166346
678 2513986836 2513237156 Bacteria 6402557
679 2514001514 2513237159 Bacteria 6810126
680 2514006400 2513237160 Bacteria 6650282
681 2514020021 2513237162 Bacteria 7468464
682 2514033668 2513237164 Bacteria 7563725
683 2514421519 2513237305 Bacteria 7293571
684 2514589226 2513237351 Bacteria 6968952
685 2515112984 2515075009 Bacteria 7288508
686 2515609009 2515154107 Bacteria 6795637
687 2515637396 2515154113 Bacteria 7807172
688 2515640949 2515154114 Bacteria 7848616
689 2515655369 2515154116 Bacteria 7552979
690 2515739468 2515154134 Bacteria 7220242
691 2516204135 2516143018 Bacteria 6951533
692 2516893612 2516653046 Bacteria 6989037
693 2517036690 2516653077 Bacteria 7555578
694 2517077049 2516653085 Bacteria 7346596
695 2517095817 2517093000 Bacteria 7412387
696 2517407389 2517287029 Bacteria 6905599
697 2517570324 2517487022 Bacteria 7227575
698 2520377203 2519899620 Bacteria 6499161
699 2524448567 2524023207 Bacteria 6813453
700 2524459576 2524023209 Bacteria 6679728
701 2530645966 2529292951 Bacteria 6916614
702 2535485128 2534681786 Bacteria 3308809
703 2535516854 2534681796 Bacteria 7146037
704 2537875446 2537561587 Bacteria 5425293
705 2551674556 2551306084 Bacteria 8942552
706 2551677937 2551306084 Bacteria 8942552
707 2551687749 2551306085 Bacteria 7347181
708 2551691438 2551306086 Bacteria 6843938
709 2551697662 2551306087 Bacteria 7351905
710 2551715567 2551306089 Bacteria 7162724
711 2551715891 2551306090 Bacteria 7953713
712 2551725523 2551306091 Bacteria 7086830
713 2551737920 2551306092 Bacteria 6992595
714 2551741377 2551306093 Bacteria 7064773
715 2554248220 2554235003 Bacteria 5877155
716 2558864473 2558860100 Bacteria 8458965
717 2559295336 2558860242 Bacteria 5568029
718 2561468382 2558860983 Bacteria 4133860
719 2585166336 2582581283 Bacteria 6030556
720 2585200594 2582581294 Bacteria 6626667
721 2585222818 2582581298 Bacteria 7315509
722 2585231729 2582581299 Bacteria 6518058
723 2585255071 2582581304 Bacteria 5831370
724 2585267437 2582581306 Bacteria 6450535
725 2585271126 2582581307 Bacteria 6597605
726 2585277470 2582581308 Bacteria 7413247
727 2585323346 2582581315 Bacteria 7318924
728 2585331488 2582581316 Bacteria 7774528
729 2585386505 2582581865 Bacteria 6644329
730 2585393243 2582581866 Bacteria 6859583
731 2585402411 2582581867 Bacteria 7184437
732 2585527429 2585427526 Bacteria 7258840
733 2585535097 2585427527 Bacteria 7273426
734 2585538170 2585427528 Bacteria 6842387
735 2585545401 2585427529 Bacteria 7395659
736 2585555947 2585427530 Bacteria 7383882
737 2585558850 2585427531 Bacteria 6992870
738 2585822902 2585427590 Bacteria 6824633
739 2585836119 2585427593 Bacteria 7141551
740 2585843214 2585427594 Bacteria 6180594
741 2585898232 2585427608 Bacteria 6544331
742 2585904180 2585427609 Bacteria 6667127
743 2585996192 2585427633 Bacteria 6413184
744 2586000802 2585427634 Bacteria 6455027
745 2587980703 2585428125 Bacteria 6662905
746 2588517292 2588253730 Bacteria 6881675
747 2599331740 2599185156 Bacteria 5403036
748 2599417313 2599185170 Bacteria 7295545
749 2599601648 2599185210 Bacteria 5624189
750 2599721926 2599185236 Bacteria 6875203
751 2599936711 2599185301 Bacteria 6161860
752 2600194380 2599185352 Bacteria 7228948
753 2600374372 2600254933 Bacteria 4750527
754 2601610092 2600255279 Bacteria 5605316
755 2601746867 2600255308 Bacteria 5611129
756 2616293376 2615840624 Bacteria 6557588
757 2616308945 2615840626 Bacteria 7921970
758 2616554216 2615840698 Bacteria 7319877
759 2617384730 2617270742 Bacteria 6808054
760 2643776083 2643221551 Bacteria 3750538
761 2643794530 2643221555 Bacteria 3749717
762 2643803101 2643221557 Bacteria 7184309
763 2643811543 2643221558 Bacteria 5460675
764 2643856782 2643221568 Bacteria 5187270
765 2643920357 2643221582 Bacteria 5804683
766 2643984441 2643221595 Bacteria 6565519
767 2644003171 2643221599 Bacteria 6292121
768 2644050531 2643221607 Bacteria 6314006
769 2644063463 2643221610 Bacteria 7480339
770 2644129344 2643221623 Bacteria 5239945
771 2644153298 2643221627 Bacteria 6761570
772 2644193495 2643221634 Bacteria 6705461
773 2644205759 2643221636 Bacteria 6583769
774 2644209041 2643221637 Bacteria 5345260
775 2644238692 2643221643 Bacteria 5749658
776 2644298659 2643221653 Bacteria 4569637
777 2644374746 2643221668 Bacteria 7306521
778 2644414226 2643221675 Bacteria 7473456
779 2644447754 2643221680 Bacteria 7473610
780 2644483449 2643221686 Bacteria 6310811
781 2644492020 2643221688 Bacteria 5260751
782 2644499660 2643221689 Bacteria 6042950
783 2644521970 2643221693 Bacteria 5513853
784 2644652571 2643221718 Bacteria 5345506
785 2644656888 2643221719 Bacteria 4568197
786 2644676091 2643221723 Bacteria 7095460
787 2644690227 2643221726 Bacteria 7455827
788 2671111442 2667528174 Bacteria 6435400
789 2688598484 2687453392 Bacteria 6880454
790 2692315553 2690316117 Bacteria 6800650
791 2694632947 2693429783 Bacteria 7019804
792 2694636018 2693429784 Bacteria 7241525
793 2719181794 2718217882 Bacteria 6556348
794 2719386397 2718217927 Bacteria 6972593
795 2719666145 2718217997 Bacteria 6740740
796 2719732458 2718218009 Bacteria 6478651
797 2720492565 2718218199 Bacteria 6740745
798 2720614000 2718218232 Bacteria 6720332
799 2720620805 2718218233 Bacteria 6662049
800 2720632130 2718218235 Bacteria 6630699
801 2720775858 2718218269 Bacteria 6906114
802 2721147885 2718218363 Bacteria 6524337
803 2721159336 2718218365 Bacteria 6274507
804 2721164721 2718218366 Bacteria 6425255
805 2721400101 2718218423 Bacteria 6438183
806 2722840891 2721755514 Bacteria 6424414
807 2723027462 2721755556 Bacteria 6745503
808 2723561081 2721755684 Bacteria 6859907
809 2723567677 2721755685 Bacteria 6704835
810 2723575419 2721755686 Bacteria 7343952
811 2724038914 2721755809 Bacteria 6438790
812 2724045214 2721755810 Bacteria 6479005
813 2724090465 2721755819 Bacteria 6906405
814 2724104942 2721755822 Bacteria 6726041
815 2724110801 2721755823 Bacteria 6752556
816 2725952575 2724679232 Bacteria 7646494
817 2730108398 2728369352 Bacteria 6745171
818 2730165029 2728369365 Bacteria 6555560
819 2730298968 2728369397 Bacteria 6274511
820 2738800071 2738541293 Bacteria 7065685
821 2738947345 2738541317 Bacteria 5340176
822 2739032827 2738541333 Bacteria 7106503
823 2739307202 2738543024 Bacteria 5603683
824 2753359755 2751185800 Bacteria 5467370
825 2753462018 2751185821 Bacteria 6189929
826 2756675427 2756170246 Bacteria 7451806
827 2757569722 2757320392 Bacteria 3737298
828 2765464626 2765235802 Bacteria 5618596
829 2766065855 2765235942 Bacteria 7445910
830 2770195432 2767802442 Bacteria 5747986
831 2776270631 2775506902 Bacteria 6208009
832 2776280546 2775506904 Bacteria 5954060
833 2776913912 2775507049 Bacteria 6284736
834 2778175403 2775507266 Bacteria 7392367
835 2792585137 2791355082 Bacteria 5973319
836 2792620781 2791355091 Bacteria 6135441
837 2792626140 2791355092 Bacteria 6248105
838 2792639076 2791355094 Bacteria 7011481
839 2792749280 2791355123 Bacteria 8049106
840 2793294449 2791355256 Bacteria 6798008
841 2793314556 2791355259 Bacteria 7254731
842 2793320383 2791355260 Bacteria 6598818
843 2793334478 2791355262 Bacteria 6774204
844 2793339195 2791355263 Bacteria 6872478
845 2793348868 2791355264 Bacteria 6429314
846 2793351844 2791355265 Bacteria 6539969
847 2793362597 2791355266 Bacteria 7116587
848 2793368887 2791355267 Bacteria 7222458
849 2802720019 2802428858 Bacteria 6636079
850 2802727048 2802428859 Bacteria 6667919
851 2802731949 2802428860 Bacteria 6525526
852 2802739280 2802428861 Bacteria 6534206
853 2802745739 2802428862 Bacteria 6633353
854 2802752341 2802428863 Bacteria 6410669
855 2805928813 2802429605 Bacteria 6875453
856 2805935095 2802429606 Bacteria 6346811
857 2806043807 2802429633 Bacteria 7341974
858 2806050262 2802429634 Bacteria 7083200
859 2806057078 2802429635 Bacteria 7650140
860 2806064460 2802429636 Bacteria 7597525
861 2806071727 2802429637 Bacteria 7067217
862 2808987930 2808606387 Bacteria 5697198
863 2819241415 2818991272 Bacteria 4622173
864 2819559049 2818991439 Bacteria 6907412
865 2819609136 2818991448 Bacteria 6772224
866 2819637636 2818991453 Bacteria 7181617
867 2821127501 2821123053 Bacteria 7836056
868 2837679415 2837678835 Bacteria 5252418
869 2837682893 2837678835 Bacteria 5252418
870 2838017665 2838016132 Bacteria 6577831
871 2838038487 2838035591 Bacteria 7166484
872 2838043956 2838042994 Bacteria 6046894
873 2838054398 2838048938 Bacteria 6044578
874 2838068027 2838061910 Bacteria 6794874
875 2838070155 2838068647 Bacteria 6208656
876 2838076870 2838074704 Bacteria 6785777
877 2838661602 2838661181 Bacteria 7385261
878 2838670348 2838668709 Bacteria 6671819
879 2838675789 2838675328 Bacteria 4909118
880 2838683487 2838680041 Bacteria 6545511
881 2838687069 2838686498 Bacteria 7807632
882 2838697570 2838694306 Bacteria 6853137
883 2838702719 2838701080 Bacteria 6669771
884 2838710686 2838707686 Bacteria 6619912
885 2838714671 2838714209 Bacteria 5525906
886 2838721528 2838719591 Bacteria 5523910
887 2838725431 2838724970 Bacteria 4908691
888 2838729958 2838729681 Bacteria 7400765
889 2838738025 2838736955 Bacteria 5760694
890 2838743027 2838742623 Bacteria 7396178
891 2839997023 2839993093 Bacteria 5512535
892 2841841606 2841840854 Bacteria 5761912
893 2841848480 2841846520 Bacteria 5345850
894 2841852513 2841851746 Bacteria 7532261
895 2841862111 2841859092 Bacteria 5436171
896 2841870769 2841864319 Bacteria 6742987
897 2842078859 2842077413 Bacteria 6508645
898 2842113284 2842110456 Bacteria 7656360
899 2842118631 2842118031 Bacteria 7033875
900 2842125489 2842124991 Bacteria 5346824
901 2842130684 2842130223 Bacteria 4909145
902 2842141384 2842140634 Bacteria 5759631
903 2842148023 2842146304 Bacteria 5957337
904 2842154146 2842152218 Bacteria 4908957
905 2842158027 2842156927 Bacteria 6894975
906 2842168809 2842163707 Bacteria 6916235
907 2842170915 2842170452 Bacteria 5525737
908 2842177766 2842175837 Bacteria 4908771
909 2842181646 2842180545 Bacteria 6888678
910 2842187780 2842187318 Bacteria 5524014
911 2842197345 2842192696 Bacteria 6147454
912 2842205492 2842205361 Bacteria 6340321
913 2842212091 2842211629 Bacteria 5523832
914 2842217921 2842217011 Bacteria 7497767
915 2842226290 2842224351 Bacteria 5524473
916 2842230303 2842229732 Bacteria 7475766
917 2842240543 2842237096 Bacteria 6620661
918 2842244205 2842243621 Bacteria 7421798
919 2842253089 2842250916 Bacteria 6579627
920 2842257709 2842257432 Bacteria 7401195
921 2842266254 2842264693 Bacteria 6472963
922 2842271393 2842271015 Bacteria 7807131
923 2842278949 2842278818 Bacteria 6340002
924 2842285613 2842285085 Bacteria 6011953
925 2842292521 2842291075 Bacteria 7076806
926 2842301357 2842298080 Bacteria 6123127
927 2842305021 2842304105 Bacteria 7023636
928 2842314925 2842311132 Bacteria 6616990
929 2842320697 2842317721 Bacteria 6793725
930 2842346445 2842341865 Bacteria 7003929
931 2842357894 2842357229 Bacteria 6485165
932 2842368976 2842363717 Bacteria 6844742
933 2842374118 2842370503 Bacteria 7038661
934 2842378919 2842377471 Bacteria 7140707
935 2842385142 2842384541 Bacteria 7057858
936 2842399896 2842395702 Bacteria 6780583
937 2842402973 2842402390 Bacteria 6681310
938 2842409655 2842409023 Bacteria 6687331
939 2842416306 2842415677 Bacteria 6596907
940 2842423769 2842422224 Bacteria 6239196
941 2842430717 2842428310 Bacteria 6767288
942 2842437296 2842434925 Bacteria 6502746
943 2842443666 2842441272 Bacteria 6769273
944 2842454039 2842447887 Bacteria 6754142
945 2842464860 2842462802 Bacteria 6588055
946 2842471914 2842469257 Bacteria 6752936
947 2842484573 2842482326 Bacteria 7212537
948 2842491965 2842489311 Bacteria 6620893
949 2842496839 2842495871 Bacteria 6820686
950 2842511142 2842509118 Bacteria 6850950
951 2842518895 2842515876 Bacteria 5436280
952 2842521803 2842521101 Bacteria 6569494
953 2842871945 2842871566 Bacteria 4827117
954 2842924145 2842922631 Bacteria 5824079
955 2844007383 2844002411 Bacteria 7168230
956 2844013746 2844009547 Bacteria 6728125
957 2844164559 2844163670 Bacteria 7266046
958 2844458436 2844454524 Bacteria 7952546
959 2847419387 2847417321 Bacteria 6913799
960 2847675651 2847670302 Bacteria 6165597
961 2847692293 2847686936 Bacteria 6278406
962 2848994414 2848992105 Bacteria 6810864
963 2850081456 2850079185 Bacteria 6848280
964 2852390211 2852387548 Bacteria 8025568
965 2854912407 2854911287 Bacteria 5582813
966 2855826332 2855825444 Bacteria 6785811
967 2855841721 2855839649 Bacteria 7135830
968 2855872531 2855872281 Bacteria 6964271
969 2856319537 2856314179 Bacteria 6477897
970 2856323887 2856320880 Bacteria 7263508
971 2856331137 2856328259 Bacteria 6528202
972 2856347072 2856342000 Bacteria 7176905
973 2857351111 2857349434 Bacteria 7926032
974 2857517448 2857516855 Bacteria 7787325
975 2857536486 2857531043 Bacteria 6754041
976 2858802507 2858800743 Bacteria 6603254
977 2869166913 2869162929 Bacteria 6399702
978 2869172818 2869169390 Bacteria 6659796
979 2869240032 2869234852 Bacteria 6654993
980 2869246347 2869242130 Bacteria 6609239
981 2869255413 2869249662 Bacteria 6868783
982 2869260253 2869256925 Bacteria 6981691
983 2869269364 2869264136 Bacteria 6880765
984 2869271492 2869271264 Bacteria 6908218
985 2869284973 2869278585 Bacteria 7077053
986 2871439529 2871435913 Bacteria 6880295
987 2871453244 2871451962 Bacteria 7336357
988 2871463257 2871459585 Bacteria 6866887
989 2871470589 2871466892 Bacteria 6923287
990 2871501358 2871495908 Bacteria 6935695
991 2874106136 2874102143 Bacteria 6342645
992 2874122268 2874116593 Bacteria 6674494
993 2874130641 2874123672 Bacteria 7238285
994 2874133388 2874131515 Bacteria 6820270
995 2874145915 2874139085 Bacteria 7021506
996 2874167381 2874162495 Bacteria 6174670
997 2874169902 2874168670 Bacteria 8062617
998 2876368431 2876363079 Bacteria 6544991
999 2876381944 2876377896 Bacteria 6565995
1000 2876389930 2876386047 Bacteria 6698674
1001 2876398482 2876392853 Bacteria 6660880
1002 2876406342 2876399893 Bacteria 6927900
1003 2876413092 2876406927 Bacteria 6191900
1004 2876425738 2876420981 Bacteria 6687741
1005 2878040772 2878035449 Bacteria 6555736
1006 2878735678 2878730984 Bacteria 6380721
1007 2878745258 2878738818 Bacteria 7136951
1008 2878765338 2878760144 Bacteria 6823465
1009 2878773045 2878767105 Bacteria 6898628
1010 2878777901 2878774303 Bacteria 6108671
1011 2878788145 2878781027 Bacteria 6834456
1012 2881167573 2881161766 Bacteria 7127907
1013 2881868522 2881861095 Bacteria 7128710
1014 2885309474 2885305155 Bacteria 7348390
1015 2885324694 2885318864 Bacteria 6729568
1016 2885330883 2885326080 Bacteria 7134805
1017 2885339444 2885334103 Bacteria 7216818
1018 2885353787 2885350715 Bacteria 6787678
1019 2888346863 2888343758 Bacteria 6611049
1020 2888355798 2888350351 Bacteria 7372807
1021 2889010739 2889010040 Bacteria 6749192
1022 2889017566 2889016732 Bacteria 6700763
1023 2891050867 2891048133 Bacteria 4447501
1024 2891373335 2891373044 Bacteria 5202277
1025 2894656003 2894652903 Bacteria 4587256
1026 2894820348 2894817345 Bacteria 4892941
1027 2896389036 2896384573 Bacteria 7700774
1028 2899796065 2899792073 Bacteria 4926588
1029 2899807280 2899803654 Bacteria 5577784
1030 2899850643 2899845264 Bacteria 5672268
1031 2903451364 2903448605 Bacteria 7357801
1032 2903504657 2903492973 Bacteria 13473544
1033 2903527430 2903521522 Bacteria 6525694
1034 2903533884 2903528002 Bacteria 6586099
1035 2903546169 2903540706 Bacteria 7062119
1036 2904580629 2904578770 Bacteria 5302906
1037 2904665037 2904659560 Bacteria 6685615
1038 2906327276 2906321335 Bacteria 6579571
1039 2906329969 2906328253 Bacteria 6585166
1040 2906364053 2906363423 Bacteria 6856682
1041 2906373460 2906370794 Bacteria 6881062
1042 2906384137 2906378014 Bacteria 6911440
1043 2906391640 2906386501 Bacteria 5977019
1044 2906395323 2906393657 Bacteria 6790866
1045 2906407625 2906401398 Bacteria 6693206
1046 2906414024 2906408224 Bacteria 6162342
1047 2906420257 2906414383 Bacteria 6580790
1048 2913299321 2913295892 Bacteria 6333755
1049 2913312557 2913308742 Bacteria 5350706
1050 2915653146 2915650412 Bacteria 4288180
1051 2915981431 2915980308 Bacteria 6624279
1052 2915988281 2915986958 Bacteria 6739310
1053 2915998692 2915993759 Bacteria 7016183
1054 2916003495 2916000859 Bacteria 6865702
1055 2916011666 2916007675 Bacteria 6898660
1056 2916020769 2916014648 Bacteria 6946486
1057 2916024966 2916021584 Bacteria 6854472
1058 2916033780 2916028427 Bacteria 6748433
1059 2916037858 2916035215 Bacteria 6755766
1060 2916045343 2916041962 Bacteria 6820487
1061 2916049033 2916048683 Bacteria 6543552
1062 2916055729 2916055098 Bacteria 6758838
1063 2916064912 2916061851 Bacteria 6737736
1064 2916074004 2916068649 Bacteria 6943657
1065 2916082589 2916076590 Bacteria 6596108
1066 2917557282 2917554339 Bacteria 4987857
1067 2919107671 2919100787 Bacteria 7710546
1068 2919114709 2919114240 Bacteria 5700270
1069 2919121654 2919119836 Bacteria 5208557
1070 2919169231 2919166419 Bacteria 4952238
1071 2919174722 2919171160 Bacteria 6499771
1072 2920761532 2920760137 Bacteria 7427611
1073 2920825202 2920822456 Bacteria 6897201
1074 2921203060 2921201388 Bacteria 6926299
1075 2921211120 2921208531 Bacteria 6745326
1076 2921237979 2921237296 Bacteria 6876710
1077 2921246783 2921244191 Bacteria 6568419
1078 2921252078 2921250672 Bacteria 6677771
1079 2921261399 2921257292 Bacteria 6808382
1080 2921266201 2921263974 Bacteria 6864552
1081 2921282778 2921282425 Bacteria 6826397
1082 2921290965 2921289301 Bacteria 7316391
1083 2921298410 2921296804 Bacteria 7176999
1084 2922135715 2922130491 Bacteria 7173936
1085 2922158317 2922151315 Bacteria 6902399
1086 2922161124 2922158528 Bacteria 6573167
1087 2922174246 2922172374 Bacteria 6167644
1088 2924146762 2924144063 Bacteria 6883928
1089 2924158000 2924150972 Bacteria 7169444
1090 2924159266 2924158325 Bacteria 7188855
1091 2924169169 2924165586 Bacteria 7260590
1092 2924174577 2924172951 Bacteria 6749356
1093 2924181172 2924179722 Bacteria 6843264
1094 2924192719 2924186466 Bacteria 6876637
1095 2924195376 2924193448 Bacteria 6955718
1096 2924203333 2924200457 Bacteria 6757188
1097 2924210753 2924207177 Bacteria 6917007
1098 2924220081 2924214083 Bacteria 7080103
1099 2924223302 2924221636 Bacteria 7113495
1100 2924230511 2924228884 Bacteria 6633132
1101 2924717656 2924710171 Bacteria 6752351
1102 2924720120 2924718760 Bacteria 6331356
1103 2924728551 2924726620 Bacteria 6271473
1104 2924736398 2924733363 Bacteria 7574837
1105 2924745031 2924741084 Bacteria 6661321
1106 2924753576 2924748358 Bacteria 6154725
1107 2924757246 2924754689 Bacteria 6774424
1108 2924783395 2924776078 Bacteria 7492003
1109 2924789117 2924784321 Bacteria 7416538
1110 2926755725 2926754445 Bacteria 5964435
1111 2926762840 2926760298 Bacteria 5505990
1112 2928523871 2928521798 Bacteria 4960112
1113 2929140859 2929138655 Bacteria 5810547
1114 2933008791 2933006813 Bacteria 4912075
1115 2933014931 2933011516 Bacteria 5439334
1116 2933019440 2933016740 Bacteria 6355406
1117 2933570829 2933570622 Bacteria 7023390
1118 2933588660 2933586486 Bacteria 7667493
1119 2933596608 2933594066 Bacteria 5594265
1120 2933600961 2933599457 Bacteria 5858799
1121 2935897045 2935894831 Bacteria 6620579
1122 2935901973 2935901341 Bacteria 7341747
1123 2936372059 2936367885 Bacteria 7324495
1124 2936379922 2936375103 Bacteria 6652732
1125 2936382818 2936381700 Bacteria 7006523
1126 2937000696 2936996657 Bacteria 6298727
1127 2937004569 2937002841 Bacteria 6934057
1128 2937011188 2937009748 Bacteria 6746052
1129 2937019834 2937016420 Bacteria 6782579
1130 2937024574 2937023124 Bacteria 6815156
1131 2937030277 2937029754 Bacteria 6424026
1132 2937042658 2937036028 Bacteria 6846469
1133 2937045530 2937042894 Bacteria 6741576
1134 2937055107 2937049772 Bacteria 6757901
1135 2937063580 2937056579 Bacteria 7107896
1136 2937069456 2937063883 Bacteria 7199456
1137 2937074380 2937071275 Bacteria 6984483
1138 2937080285 2937078374 Bacteria 6610289
1139 2937088119 2937084907 Bacteria 6618516
1140 2937092450 2937091812 Bacteria 6979387
1141 2937103046 2937098957 Bacteria 7249374
1142 2937113291 2937106411 Bacteria 6947143
1143 2937116155 2937113482 Bacteria 6505872
1144 2937121975 2937119839 Bacteria 6597547
1145 2937128815 2937126314 Bacteria 6771275
1146 2937815780 2937813078 Bacteria 7783518
1147 2937838180 2937836603 Bacteria 6811263
1148 2937853140 2937848649 Bacteria 6983481
1149 2937865430 2937861824 Bacteria 6660327
1150 2937872599 2937868953 Bacteria 6639878
1151 2937882082 2937877337 Bacteria 7246526
1152 2937894195 2937891427 Bacteria 6357007
1153 2937978543 2937972304 Bacteria 7532020
1154 2938000027 2937994558 Bacteria 7036190
1155 2938017068 2938014810 Bacteria 6700592
1156 2941502149 2941499720 Bacteria 7599444
1157 2954012815 2954011201 Bacteria 4762601
1158 2957376394 2957375807 Bacteria 6425588
1159 2957384288 2957382221 Bacteria 6737050
1160 2957390750 2957388812 Bacteria 6778072
1161 2957395906 2957395598 Bacteria 6822399
1162 2957404512 2957402308 Bacteria 6741770
1163 2957412100 2957408893 Bacteria 6558585
1164 2957421518 2957415311 Bacteria 6991633
1165 2957429677 2957422303 Bacteria 7172205
1166 2957431706 2957430029 Bacteria 7022557
1167 2957442857 2957437181 Bacteria 6568994
1168 2957446919 2957443900 Bacteria 6869977
1169 2957453761 2957450854 Bacteria 6765715
1170 2957461615 2957457609 Bacteria 6967680
1171 2957467054 2957464669 Bacteria 6568877
1172 2957476399 2957471148 Bacteria 6797643
1173 2957479615 2957478035 Bacteria 6756658
1174 2957490472 2957484790 Bacteria 6703082
1175 2957494097 2957491536 Bacteria 6695180
1176 2957503299 2957498199 Bacteria 7126688
1177 2957510604 2957505466 Bacteria 7253085
1178 2958040675 2958034702 Bacteria 6989922
1179 2958045115 2958041894 Bacteria 13082850
1180 2958056757 2958041894 Bacteria 13082850
1181 2958064266 2958064165 Bacteria 7158582
1182 2958089204 2958084443 Bacteria 7312792
1183 2958098150 2958092219 Bacteria 6861151
1184 2958104773 2958100919 Bacteria 6800575
1185 2958114554 2958108152 Bacteria 6681128
1186 2958128539 2958122699 Bacteria 7280457
1187 2958130545 2958130278 Bacteria 6897202
1188 2958143681 2958137437 Bacteria 6050276
1189 2958149752 2958144490 Bacteria 6677056
1190 2958162332 2958158011 Bacteria 6058449
1191 2958170491 2958165035 Bacteria 6906348
1192 2958174893 2958172287 Bacteria 6716688
1193 2958184750 2958179912 Bacteria 6874908
1194 2960585408 2960584000 Bacteria 6864594
1195 2960592076 2960591022 Bacteria 6622873
1196 2960600003 2960597568 Bacteria 6550735
1197 2960610578 2960603979 Bacteria 6898737
1198 2960612327 2960610863 Bacteria 6691244
1199 2960620453 2960617483 Bacteria 6727748
1200 2960624492 2960624210 Bacteria 6875384
1201 2960632037 2960631154 Bacteria 6732508
1202 2960644134 2960637947 Bacteria 7296468
1203 2960648425 2960645483 Bacteria 7211087
1204 2960656536 2960652885 Bacteria 7083688
1205 2960665578 2960660292 Bacteria 7041660
1206 2960669647 2960667422 Bacteria 6763020
1207 2960675170 2960674078 Bacteria 6609048
1208 2960681612 2960680706 Bacteria 6624464
1209 2960691479 2960687367 Bacteria 6535474
1210 2960694812 2960693952 Bacteria 6749742
1211 2961082917 2961077736 Bacteria 7079850
1212 2961120038 2961114664 Bacteria 6680456
1213 2961133054 2961127735 Bacteria 7196641
1214 2961143249 2961136820 Bacteria 6775228
1215 2961168946 2961163497 Bacteria 6901077
1216 2961176008 2961170736 Bacteria 7072258
1217 2961186994 2961183825 Bacteria 6688536
1218 2963647761 2963644680 Bacteria 6530403
1219 2964609774 2964607997 Bacteria 7101408
1220 2964617758 2964615318 Bacteria 6809089
1221 2964623644 2964621998 Bacteria 6834995
1222 2964633845 2964628898 Bacteria 7083044
1223 2964640830 2964636051 Bacteria 7091832
1224 2964645696 2964643177 Bacteria 6820887
1225 2964651545 2964649959 Bacteria 6675118
1226 2964660515 2964656573 Bacteria 7100150
1227 2964666933 2964663802 Bacteria 7019362
1228 2964676712 2964670856 Bacteria 6851364
1229 2964682864 2964678106 Bacteria 6792020
1230 2964685779 2964685014 Bacteria 6839111
1231 2964692468 2964691889 Bacteria 6802758
1232 2964701654 2964698721 Bacteria 6765331
1233 2964711103 2964705432 Bacteria 7114648
1234 2964715170 2964712639 Bacteria 6695970
1235 2964720668 2964719344 Bacteria 7286602
1236 2965024233 2965018300 Bacteria 6883036
1237 2965031514 2965025482 Bacteria 6532201
1238 2965035544 2965032056 Bacteria 6887443
1239 2965044329 2965040258 Bacteria 6855979
1240 2965049982 2965047637 Bacteria 6623551
1241 2965065023 2965062239 Bacteria 7412989
1242 2965089875 2965089291 Bacteria 6866420
1243 2965105838 2965102966 Bacteria 6800987
1244 2965112905 2965110997 Bacteria 6693150
1245 2965122081 2965119406 Bacteria 6956431
1246 2967666391 2967664464 Bacteria 6948836
1247 2967678424 2967671571 Bacteria 7021409
1248 2967684436 2967678726 Bacteria 7264382
1249 2967689726 2967686174 Bacteria 6678622
1250 2967694633 2967693043 Bacteria 6804451
1251 2967706611 2967699805 Bacteria 6854538
1252 2967708611 2967706974 Bacteria 7186053
1253 2967714864 2967714385 Bacteria 7000047
1254 2967726134 2967721400 Bacteria 7073753
1255 2967729005 2967728569 Bacteria 6641507
1256 2967737136 2967735183 Bacteria 6827012
1257 2967748854 2967742019 Bacteria 6794534
1258 2967751614 2967748971 Bacteria 6733771
1259 2967760007 2967755722 Bacteria 6814706
1260 2967767503 2967762386 Bacteria 6923502
1261 2967772131 2967769361 Bacteria 6587838
1262 2967782228 2967775926 Bacteria 6738189
1263 2968001896 2967996073 Bacteria 6787468
1264 2968009080 2968003550 Bacteria 6929263
1265 2968018403 2968016561 Bacteria 7022047
1266 2968090394 2968083720 Bacteria 7351627
1267 2968096402 2968091066 Bacteria 6052692
1268 2968098903 2968097103 Bacteria 6107094
1269 2968116395 2968110612 Bacteria 6814636
1270 2968120670 2968117919 Bacteria 6536078
1271 2968129222 2968128360 Bacteria 6270294
1272 2968177340 2968171901 Bacteria 6894245
1273 2970021072 2970019648 Bacteria 7072033
1274 2970028354 2970026789 Bacteria 6785236
1275 2970040279 2970033650 Bacteria 7118744
1276 2970042629 2970040964 Bacteria 6731123
1277 2970050960 2970047711 Bacteria 7088379
1278 2970056690 2970054988 Bacteria 6611507
1279 2970067132 2970061556 Bacteria 7099761
1280 2970071576 2970068827 Bacteria 7123112
1281 2970078252 2970076120 Bacteria 6697332
1282 2970085234 2970082768 Bacteria 6183754
1283 2970093935 2970088815 Bacteria 6933825
1284 2970102166 2970095765 Bacteria 6936963
1285 2970108009 2970102677 Bacteria 6812532
1286 2970110698 2970109326 Bacteria 6863976
1287 2970117344 2970116247 Bacteria 6501857
1288 2970125833 2970122695 Bacteria 6625855
1289 2970131176 2970129317 Bacteria 6806560
1290 2970136282 2970136068 Bacteria 7207982
1291 2970146739 2970143518 Bacteria 6446480
1292 2970151627 2970149975 Bacteria 6779706
1293 2970159557 2970156795 Bacteria 7168044
1294 2970166988 2970164137 Bacteria 6861252
1295 2970176911 2970170962 Bacteria 6876229
1296 2970180813 2970177841 Bacteria 6768001
1297 2970189159 2970184632 Bacteria 7054431
1298 2970193589 2970191845 Bacteria 7032787
1299 2970471423 2970469710 Bacteria 6969209
1300 2970491075 2970489779 Bacteria 6517260
1301 2970508674 2970503327 Bacteria 7099517
1302 2970511380 2970510686 Bacteria 7006402
1303 2970536438 2970532167 Bacteria 6553173
1304 2970543784 2970540015 Bacteria 6977556
1305 2970552475 2970547951 Bacteria 6931819
1306 2970560186 2970554993 Bacteria 6814252
1307 2970599588 2970593180 Bacteria 7073582
1308 2970626915 2970619444 Bacteria 6986144
1309 2970631956 2970627176 Bacteria 6680862
1310 2977519104 2977516862 Bacteria 6940108
1311 2977526317 2977523885 Bacteria 6960446
1312 2977534067 2977530762 Bacteria 6951399
1313 2977539615 2977537788 Bacteria 6929320
1314 2977546349 2977544691 Bacteria 6875412
1315 2977558421 2977551784 Bacteria 7125765
1316 2977564441 2977558990 Bacteria 6863948
1317 2977567653 2977565890 Bacteria 6901543
1318 2977575757 2977572785 Bacteria 6763888
1319 2977582009 2977579622 Bacteria 6772100
1320 2977827453 2977821940 Bacteria 6906439
1321 2977832732 2977828996 Bacteria 7007971
1322 2977846015 2977843712 Bacteria 6753583
1323 2977856221 2977851361 Bacteria 6694324
1324 2977863733 2977858184 Bacteria 6215359
1325 2977867044 2977864932 Bacteria 7534097
1326 2977876239 2977872689 Bacteria 7270173
1327 2977903658 2977898635 Bacteria 6675551
1328 2977913747 2977907340 Bacteria 6577984
1329 2977919444 2977915119 Bacteria 6829656
1330 2977924268 2977922695 Bacteria 6956781
1331 2977939888 2977935797 Bacteria 6252826
1332 2977942790 2977942078 Bacteria 7570577
1333 2977956258 2977950692 Bacteria 6893264
1334 2977960715 2977957713 Bacteria 6877875
1335 2977977182 2977971508 Bacteria 7472917
1336 2977990594 2977986579 Bacteria 6581278
1337 2978974606 2978969890 Bacteria 5400756
1338 2979094667 2979089926 Bacteria 5670289
1339 2979100768 2979095461 Bacteria 5669583
1340 2979103902 2979100975 Bacteria 5423623
1341 2979711966 2979710463 Bacteria 6785254
1342 2979749334 2979742915 Bacteria 7301278
1343 2979772260 2979764755 Bacteria 6610066
1344 2979779659 2979772303 Bacteria 6618277
1345 2979785516 2979779861 Bacteria 6219781
1346 2979795766 2979793036 Bacteria 6808957
1347 2979811678 2979808191 Bacteria 7179355
1348 2984511531 2984509177 Bacteria 5274802
1349 2984522108 2984518228 Bacteria 5277463
1350 2984541406 2984537506 Bacteria 5277481
1351 2984589928 2984587000 Bacteria 5263363
1352 2984603684 2984601300 Bacteria 5455244
1353 2987638296 2987636660 Bacteria 8088555
1354 2987647376 2987645492 Bacteria 6117018
1355 2987656152 2987652177 Bacteria 6969023
1356 2987664977 2987659509 Bacteria 6966464
1357 2987678317 2987673487 Bacteria 6884027
1358 2989349658 2989349275 Bacteria 6349068
1359 2989774273 2989771324 Bacteria 5605128
1360 2995393043 2995392953 Bacteria 4539380
1361 2996314035 2996310559 Bacteria 6357320
1362 2996339138 2996336353 Bacteria 5511628
1363 2996347290 2996341866 Bacteria 6643098
1364 2996350212 2996348954 Bacteria 7239054
1365 2996388068 2996386984 Bacteria 6978667
1366 2996889051 2996887358 Bacteria 5795980
1367 2996894343 2996893221 Bacteria 5823108
1368 3000140618 3000135777 Bacteria 6891109
1369 3002144746 3002141150 Bacteria 5254435
1370 3003934051 3003930520 Bacteria 5667563
1371 3004168948 3004167301 Bacteria 8330599
1372 3004194034 3004188549 Bacteria 6952365
1373 3004205460 3004203850 Bacteria 7307914
1374 3004216003 3004211236 Bacteria 7417683
1375 3004223753 3004218560 Bacteria 7421728
1376 3004234584 3004232784 Bacteria 6662140
1377 3004244790 3004239961 Bacteria 6892290
1378 3004253438 3004248173 Bacteria 6563236
1379 3004274987 3004268573 Bacteria 7043476
1380 3004276910 3004275668 Bacteria 7114440
1381 3004290399 3004289098 Bacteria 6135450
1382 3004334307 3004334049 Bacteria 8449246
1383 3005414613 3005409236 Bacteria 7188837
1384 3005419483 3005416602 Bacteria 7064308
1385 3005448432 3005445848 Bacteria 6906074
1386 637074556 637000159 Bacteria 7596297
1387 639649174 639633055 Bacteria 7751309
1388 643826303 643692032 Bacteria 6891900
1389 648739201 648276728 Bacteria 6968865
1390 649873010 649633066 Bacteria 6690028
1391 650740546 650716007 Bacteria 5573770
1392 8002062558 8002060224 Bacteria 4026565
1393 8002289003 8002285264 Bacteria 6717907
1394 8003571611 8003570095 Bacteria 5747666
1395 8003994155 8003992118 Bacteria 7266902
1396 8004001787 8003999396 Bacteria 7063185
1397 8004301332 8004300914 Bacteria 6132239
1398 8004313325 8004312739 Bacteria 7444653
1399 8004363547 8004361976 Bacteria 6858373
1400 8004380434 8004374579 Bacteria 6898112
1401 8004393600 8004387939 Bacteria 7049250
1402 8004452035 8004445564 Bacteria 6322258
1403 8004640776 8004640170 Bacteria 6723001
1404 8004699558 8004695233 Bacteria 6731676
1405 8004709399 8004703790 Bacteria 8006957
1406 8004720368 8004714634 Bacteria 6776161
1407 8004730400 8004727605 Bacteria 6643904
1408 8005260292 8005258706 Bacteria 6184835
1409 8005281194 8005275841 Bacteria 6929066
1410 8005283270 8005282627 Bacteria 6675747
1411 8005293624 8005289223 Bacteria 6634003
1412 8005303109 8005301065 Bacteria 6614431
1413 8005312816 8005307578 Bacteria 7395396
1414 8005316774 8005314921 Bacteria 7072929
1415 8005323578 8005321885 Bacteria 5795980
1416 8005380910 8005376324 Bacteria 6590079
1417 8005389138 8005382845 Bacteria 6732062
1418 8005396118 8005395548 Bacteria 6806915
1419 8005435141 8005430974 Bacteria 6689030
1420 8005463663 8005460587 Bacteria 7157962
1421 8005500883 8005497431 Bacteria 6477605
1422 8005545606 8005542996 Bacteria 7077758
1423 8005557033 8005556819 Bacteria 6908598
1424 8005567974 8005563573 Bacteria 7153261
1425 8005573480 8005570704 Bacteria 6957481
1426 8005622256 8005619151 Bacteria 7030230
1427 8005632264 8005626139 Bacteria 6534237
1428 8005648388 8005645114 Bacteria 6950293
1429 8005659041 8005658619 Bacteria 4500593
1430 8005672300 8005668836 Bacteria 6953162
1431 8005682902 8005682033 Bacteria 6726518
1432 8005692123 8005688590 Bacteria 6610080
1433 8005697384 8005695170 Bacteria 6912330
1434 8018134077 8018127388 Bacteria 7351159
1435 8018153215 8018150411 Bacteria 5549903
1436 8018164644 8018163183 Bacteria 7277977
1437 8018181341 8018176218 Bacteria 6896178
1438 8023683186 8023680758 Bacteria 7729763
1439 8024482880 8024479707 Bacteria 6954785
1440 8024488014 8024486573 Bacteria 6540512
1441 8024504407 8024501048 Bacteria 6427847
1442 8045864592 8045864390 Bacteria 5043873
1443 8046771920 8046767195 Bacteria 7547379
1444 8049295311 8049293176 Bacteria 6128433
1445 8054462961 8054460903 Bacteria 4872905
1446 8054562939 8054558443 Bacteria 5204801
1447 8054568617 8054563764 Bacteria 5592885
1448 8055432772 8055431914 Bacteria 4551896
1449 8055620822 8055617313 Bacteria 7548464
1450 8056375917 8056375014 Bacteria 7006639
1451 8056386709 8056382006 Bacteria 6408074
1452 8057575750 8057575449 Bacteria 7367519
1453 8057877692 8057874678 Bacteria 7494653
1454 JGI24740J21852_10000015
1455 JGI24739J22299_10055546
1456 JGI25155J39150_1000001
1457 JGI25156J39149_1000001
1458 JGI25156J39149_1004314
1459 JGI25162J39368_1000366
1460 JGI25162J39368_1000368
1461 JGI25154J39366_1000122
1462 JGI25154J39366_1000150
1463 JGI25157J39369_1000044
1464 JGI25157J39369_1000787
1465 JGI25152J39213_1001384
1466 JGI25152J39213_1006279
1467 JGI25152J39213_1013363
1468 JGI25150J39212_1000107
1469 JGI25150J39212_1001349
1470 JGI25159J45721_1000014
1471 JGI25159J45721_1000154
1472 JGI25159J45721_1002719
1473 JGI25151J46595_10000374
1474 JGI25151J46595_10000839
1475 JGI25151J46595_10016569
1476 JGI25151J46595_10019149
1477 JGI25151J46595_10021827
1478 JGI25406J46586_10020113
1479 JGI25165J46597_1000015
1480 JGI25165J46597_1000516
1481 JGI25165J46597_1001042
1482 JGI25153J46596_10000696
1483 JGI25153J46596_10003704
1484 JGI25153J46596_10016985
1485 rootH1_10079874
1486 rootH2_10088276
1487 rootL2_10014282
1488 rootH1_10021547
1489 rootH1_10070355
1490 JGI25160J50197_1000001
1491 JGI25160J50197_1000020
1492 JGI25160J50197_1000633
1493 JGI25160J50197_1001815
1494 JGI25160J50197_1011442
1495 JGI25161J50226_1000001
1496 JGI25161J50226_1000174
1497 JGI25161J50226_1000917
1498 Ga0006562J51391_1006521
1499 Ga0055542_1002379
1500 Ga0055526_1000597
1501 Ga0055526_1003626
1502 Ga0055526_1005475
1503 Ga0055526_1017907
1504 Ga0055524_1001814
1505 Ga0055524_1002206
1506 Ga0055524_1011881
1507 Ga0055536_1000497
1508 Ga0055536_1015139
1509 Ga0055528_1001645
1510 Ga0055528_1002181
1511 Ga0055528_1006108
1512 Ga0055530_10013931
1513 Ga0055540_1000929
1514 Ga0055540_1014190
1515 Ga0055540_1017573
1516 Ga0055540_1029357
1517 Ga0058692_1006490
1518 Ga0055543_1000003
1519 Ga0055543_1000047
1520 Ga0055543_1000350
1521 Ga0055543_1000500
1522 Ga0065165_1000013
1523 Ga0065165_1000068
1524 Ga0065165_1003143
1525 Ga0065165_1005056
1526 Ga0065165_1013367
1527 Ga0065165_1018479
1528 Ga0070658_10252063
1529 Ga0070670_100019742
1530 Ga0070660_100107609
1531 Ga0070660_100236797
1532 Ga0070661_100360162
1533 Ga0070668_100065942
1534 Ga0070669_100128150
1535 Ga0070667_100198458
1536 Ga0070663_100016027
1537 Ga0070663_100039204
1538 Ga0068867_100224642
1539 Ga0068853_100033685
1540 Ga0070665_100005019
1541 Ga0070665_100026286
1542 Ga0070665_100058445
1543 Ga0070665_100096450
1544 Ga0070665_100386929
1545 Ga0068854_100243268
1546 Ga0068856_100231879
1547 Ga0068852_100064870
1548 Ga0068851_10086460
1549 Ga0068851_10133838
1550 Ga0081455_10121923
1551 Ga0081539_10001091
1552 Ga0075365_10001386
1553 Ga0075365_10032112
1554 Ga0075368_10011243
1555 Ga0075368_10032524
1556 Ga0075363_100007263
1557 Ga0075363_100010076
1558 Ga0075363_100141628
1559 Ga0075364_10004656
1560 Ga0075364_10036635
1561 Ga0075364_10041343
1562 Ga0075364_10064431
1563 Ga0075364_10096237
1564 Ga0075364_10191399
1565 Ga0075362_10001497
1566 Ga0075362_10015468
1567 Ga0075362_10088881
1568 Ga0075367_10005926
1569 Ga0075369_10020288
1570 Ga0075369_10023231
1571 Ga0075369_10062478
1572 Ga0075366_10063536
1573 Ga0075366_10103558
1574 Ga0075370_10020449
1575 Ga0075370_10030359
1576 Ga0075370_10040526
1577 Ga0075370_10072756
1578 Ga0075370_10226606
1579 Ga0079104_1000193
1580 Ga0079104_1005252
1581 Ga0105240_10000076
1582 Ga0105240_10452746
1583 Ga0105243_10252166
1584 Ga0105248_10019832
1585 Ga0105237_10000226
1586 Ga0105237_10109722
1587 Ga0105238_10001971
1588 Ga0105249_10171141
1589 Ga0123342_1008456
1590 Ga0123342_1027287
1591 Ga0105239_10000641
1592 Ga0105239_10088037
1593 Ga0157371_10000017
1594 Ga0157371_10004510
1595 Ga0157370_10000455
1596 Ga0157370_10000461
1597 Ga0157369_10031883
1598 Ga0157369_10125254
1599 Ga0157369_10346555
1600 Ga0171463_1003
1601 Ga0157372_10485652
1602 Ga0182008_10079872
1603 Ga0182007_10001815
1604 Ga0182007_10026809
1605 Ga0183363_1025
1606 Ga0214544_1001800
1607 Ga0214542_1000012
1608 Ga0214542_1023017
1609 Ga0214543_1000024
1610 Ga0214543_1000038
1611 Ga0213874_10009440
1612 Ga0213876_10021274
1613 Ga0213876_10058321
1614 Ga0228711_1000008
1615 Ga0228710_1000009
1616 Ga0209435_100012
1617 Ga0209436_100192
1618 Ga0209436_102637
1619 Ga0209437_100051
1620 Ga0209437_100098
1621 Ga0207425_1000075
1622 Ga0207425_1001337
1623 Ga0207425_1003914
1624 Ga0207425_1007562
1625 Ga0209646_1000026
1626 Ga0209646_1001199
1627 Ga0209646_1005840
1628 Ga0209026_1000014
1629 Ga0209026_1000025
1630 Ga0209677_102022
1631 Ga0209148_1000128
1632 Ga0209759_1000012
1633 Ga0209759_1000121
1634 Ga0209129_1000156
1635 Ga0209129_1000524
1636 Ga0209129_1000903
1637 Ga0209129_1001820
1638 Ga0209129_1003415
1639 Ga0209129_1004539
1640 Ga0209129_1006394
1641 Ga0209233_1000010
1642 Ga0209233_1000095
1643 Ga0209233_1000113
1644 Ga0209233_1000427
1645 Ga0209565_1020818
1646 Ga0209455_1000127
1647 Ga0209455_1005019
1648 Ga0209673_1000010
1649 Ga0209673_1000117
1650 Ga0209673_1000151
1651 Ga0209673_1000863
1652 Ga0209673_1001685
1653 Ga0209673_1001808
1654 Ga0209673_1006523
1655 Ga0209673_1006586
1656 Ga0209673_1015833
1657 Ga0209673_1020454
1658 Ga0209130_1000003
1659 Ga0209130_1000020
1660 Ga0209130_1000034
1661 Ga0209130_1007341
1662 Ga0209130_1008071
1663 Ga0209130_1023618
1664 Ga0209676_1000482
1665 Ga0209676_1006339
1666 Ga0209025_1000070
1667 Ga0209025_1000140
1668 Ga0209025_1000314
1669 Ga0209025_1000506
1670 Ga0209025_1001869
1671 Ga0209025_1003183
1672 Ga0209025_1005091
1673 Ga0209025_1005402
1674 Ga0209025_1012522
1675 Ga0209025_1032235
1676 Ga0209564_1000013
1677 Ga0209564_1000647
1678 Ga0209564_1001780
1679 Ga0209564_1001993
1680 Ga0209564_1006943
1681 Ga0209758_1000413
1682 Ga0209758_1000655
1683 Ga0209758_1000758
1684 Ga0209758_1001882
1685 Ga0209758_1002154
1686 Ga0209758_1003547
1687 Ga0209758_1008206
1688 Ga0209758_1011955
1689 Ga0209758_1012454
1690 Ga0209758_1039819
1691 Ga0209050_1000646
1692 Ga0209050_1005467
1693 Ga0209050_1009095
1694 Ga0209256_1002424
1695 Ga0209256_1003084
1696 Ga0209256_1003214
1697 Ga0209256_1003882
1698 Ga0209256_1004240
1699 Ga0209256_1009377
1700 Ga0209256_1028220
1701 Ga0207426_1000006
1702 Ga0207426_1000008
1703 Ga0207426_1000011
1704 Ga0207426_1000221
1705 Ga0207426_1000958
1706 Ga0209051_1000097
1707 Ga0209051_1000314
1708 Ga0209051_1002962
1709 Ga0209051_1009257
1710 Ga0209051_1009905
1711 Ga0209051_1013215
1712 Ga0209257_1001142
1713 Ga0209257_1002032
1714 Ga0209257_1002070
1715 Ga0207656_10078482
1716 Ga0207647_10004029
1717 Ga0207654_10045317
1718 Ga0207695_10000011
1719 Ga0207695_10191763
1720 Ga0207695_10395515
1721 Ga0207671_10000093
1722 Ga0207671_10079253
1723 Ga0207681_10123911
1724 Ga0207694_10486840
1725 Ga0207711_10216317
1726 Ga0207668_10292067
1727 Ga0207668_10443303
1728 Ga0207640_10049482
1729 Ga0207639_10153167
1730 Ga0207678_10034321
1731 Ga0207678_10035878
1732 Ga0207678_10204455
1733 Ga0207674_10172476
1734 Ga0209281_1000034
1735 Ga0209281_1000106
1736 Ga0209281_1000318
1737 Ga0209371_1000022
1738 Ga0209371_1000993
1739 Ga0209371_1001019
1740 Ga0209282_1000024
1741 Ga0209282_1000531
1742 Ga0209813_10007694
1743 Ga0268266_10008843
1744 Ga0268266_10022262
1745 Ga0268266_10358749
1746 Ga0268266_10518521
1747 Ga0268264_10470411
1748 Ga0307515_10001559
1749 Ga0307515_10001978
1750 Ga0307515_10007368
1751 Ga0307515_10081682
1752 Ga0307515_10267194
1753 Ga0268256_1000019
1754 Ga0268256_1002326
1755 Ga0268256_1003018
1756 Ga0265328_10013731
1757 Ga0265328_10053131
1758 Ga0265331_10000057
1759 Ga0265327_10006578
1760 Ga0307513_10083892
1761 Ga0307408_100012234
1762 Ga0307408_100214803
1763 Ga0307405_10005824
1764 Ga0307406_10018709
1765 Ga0307412_10004908
1766 Ga0315914_1000012
1767 Ga0307414_10146426
1768 Ga0315913_1000006
1769 Ga0315915_1000010
1770 Ga0373927_0000955
1771 Ga0316584_0076972
1772 Ga0373925_0014806
1773 Ga0395900_0000020
1774 Ga0395900_0191807
1775 Ga0395900_0216437
1776 Ga0395898_0000259
1777 Ga0395898_0103703
1778 Ga0395905_0000019
1779 Ga0395905_0000867
1780 Ga0395905_0073574
1781 Ga0395905_0144708
1782 Ga0395901_0000016
1783 Ga0395901_0119019
1784 Ga0395901_0235389
1785 Ga0395901_0289363
1786 Ga0436365_1049263
1787 Ga0436363_0081839
1788 Ga0439465_0004711
1789 Ga0439465_0025296
1790 Ga0439465_0040303
1791 Ga0451789_1234995
1792 Ga0451791_0106417
1793 Ga0451797_0983970
1794 Ga0451798_1147850
1795 Ga0451802_1569334
1796 Ga0451837_0283088
1797 Ga0451853_0516212
1798 Ga0439449_0023481
1799 Ga0439449_0047297
1800 Ga0439462_0015493
1801 Ga0450908_008881
1802 Ga0450918_001951
1803 Ga0466972_0053970
1804 Ga0466965_0064119
1805 Ga0466960_0043787
1806 Ga0495592_0046344
1807 Ga0495629_0114623
1808 Ga0495638_0007419
1809 Ga0495638_0042408
1810 Ga0495605_0005651
1811 Ga0495585_0019624
1812 Ga0495596_0031401
1813 Ga0495583_0022782
1814 Ga0495583_0042806
1815 Ga0495606_0009491
1816 Ga0495606_0022266
1817 Ga0495610_0014176
1818 Ga0495610_0016624
1819 Ga0495610_0050394
1820 Ga0495616_0011762
1821 Ga0495620_0044389
1822 Ga0495631_0016293
1823 Ga0495631_0018448
1824 Ga0495632_0029781
1825 Ga0495643_0002725
1826 Ga0495654_0005762
1827 Ga0495640_0159007
1828 Ga0495609_0014268
1829 Ga0495622_0069496
1830 Ga0495633_0020890
1831 Ga0495633_0039490
1832 Ga0495668_0008493
1833 Ga0495634_0099334
1834 Ga0495611_0014639
1835 Ga0495625_0009309
1836 Ga0495625_0064997
1837 Ga0495635_0033782
1838 Ga0495671_0085212
1839 Ga0495649_0038536
1840 Ga0495600_0096111
1841 Ga0495660_0055134
1842 Ga0495604_0031380
1843 Ga0495672_0069188
1844 Ga0495681_0020691
1845 Ga0495684_0029589
1846 Ga0495686_0002729
1847 Ga0495686_0018186
1848 Ga0496100_0181870
1849 Ga0496102_0014149
1850 Ga0496104_0000102
1851 Ga0496105_0000066
1852 Ga0496105_0437165
1853 Ga0496106_0000982
1854 Ga0496108_0222004
1855 Ga0496109_0449760
1856 Ga0496111_0018337
1857 Ga0496112_0019571
1858 Ga0496112_0054190
1859 Ga0496113_0102058
1860 Ga0496113_0315618
1861 Ga0496116_0000142
1862 Ga0496116_0016593
1863 Ga0496116_0018820
1864 Ga0496116_0038533
1865 Ga0496116_0080222
1866 Ga0496117_0000002
1867 Ga0496117_0001574
1868 Ga0496117_0021729
1869 Ga0496117_0022590
1870 Ga0496117_0061476
1871 Ga0496118_0000087
1872 Ga0496118_0008894
1873 Ga0496118_0016932
1874 Ga0496118_0044870
1875 Ga0496118_0057268
1876 Ga0496119_0009049
1877 Ga0496119_0027308
1878 Ga0496119_0062555
1879 Ga0496119_0091169
1880 Ga0496120_0000180
1881 Ga0496120_0001104
1882 Ga0496120_0013595
1883 Ga0496120_0019812
1884 Ga0496120_0060418
1885 Ga0496121_0000003
1886 Ga0496121_0001116
1887 Ga0496121_0015656
1888 Ga0496121_0032152
1889 Ga0496121_0061938
1890 Ga0496121_0135598
1891 Ga0496121_0144693
1892 Ga0496121_0195615
1893 Ga0496122_0000004
1894 Ga0496122_0000190
1895 Ga0496122_0000215
1896 Ga0496122_0026140
1897 Ga0496122_0037339
1898 Ga0496122_0048183
1899 Ga0496122_0079153
1900 Ga0496122_0079175
1901 Ga0496122_0134204
1902 Ga0496122_0243851
1903 Ga0496123_0000007
1904 Ga0496123_0000306
1905 Ga0496123_0000336
1906 Ga0496123_0018187
1907 Ga0496123_0019973
1908 Ga0496123_0036749
1909 Ga0496123_0052666
1910 Ga0496123_0066775
1911 Ga0496124_0001040
1912 Ga0496124_0009838
1913 Ga0496124_0011540
1914 Ga0496124_0012175
1915 Ga0496124_0019650
1916 Ga0496124_0031448
1917 Ga0496124_0062166
1918 Ga0496124_0097222
1919 Ga0496124_0179023
1920 Ga0496125_0000039
1921 Ga0496125_0000248
1922 Ga0496125_0021378
1923 Ga0496125_0037107
1924 Ga0496125_0050022
1925 Ga0496126_0000866
1926 Ga0496126_0001294
1927 Ga0496126_0033922
1928 Ga0496126_0042795
1929 Ga0495678_056734
1930 Ga0501031_0000036
1931 Ga0501031_0047685
1932 Ga0501031_0149743
1933 Ga0501031_0161025
1934 Ga0501032_0000075
1935 Ga0501032_0000100
1936 Ga0501032_0001737
1937 Ga0501032_0082069
1938 Ga0501032_0143661
1939 Ga0501033_0000088
1940 Ga0501033_0001862
1941 Ga0501033_0002110
1942 Ga0501033_0005265
1943 Ga0501033_0232168
1944 Ga0501034_0000397
1945 Ga0501034_0001558
1946 Ga0501034_0003857
1947 Ga0501034_0048012
1948 Ga0501034_0118490
1949 Ga0501034_0150276
1950 Ga0501034_0191432
1951 Ga0501036_0000056
1952 Ga0501036_0000398
1953 Ga0501036_0080999
1954 Ga0501036_0122861
1955 Ga0501037_0000021
1956 Ga0501037_0000119
1957 Ga0501037_0000181
1958 Ga0501037_0078621
1959 Ga0501038_0000032
1960 Ga0501038_0000098
1961 Ga0501038_0036751
1962 Ga0501038_0070868
1963 Ga0501038_0076793
1964 Ga0501038_0092381
1965 Ga0501038_0175688
1966 Ga0501038_0205028
1967 Ga0501039_0000013
1968 Ga0501039_0000025
1969 Ga0501039_0205470
1970 Ga0501040_0009534
1971 Ga0501041_0187182
1972 Ga0501043_0000008
1973 Ga0501043_0002291
1974 Ga0501043_0004109
1975 Ga0501043_0007295
1976 Ga0501043_0051244
1977 Ga0501043_0083993
1978 Ga0501046_0013314
1979 Ga0501046_0037975
1980 Ga0501046_0202761
1981 Ga0501047_0001349
1982 Ga0501047_0017967
1983 Ga0501047_0039511
1984 Ga0501047_0062535
1985 Ga0501047_0101722
1986 Ga0501047_0102827
1987 Ga0501047_0192369
1988 Ga0501048_0016682
1989 Ga0501067_0141085
1990 Ga0501068_0006998
1991 Ga0501068_0026901
1992 Ga0501069_0000028
1993 Ga0501069_0007284
1994 Ga0501069_0022986
1995 Ga0501069_0228373
1996 Ga0501070_0000264
1997 Ga0501070_0002017
1998 Ga0501070_0015537
1999 Ga0501070_0063027
2000 Ga0501070_0136689
2001 Ga0501071_0003907
2002 Ga0501073_0008365
2003 Ga0501073_0362324
2004 Ga0501073_0386024
2005 Ga0501074_0000016
2006 Ga0501074_0042820
2007 Ga0501238_002902
2008 Ga0501080_0000065
2009 Ga0501080_0000515
2010 Ga0501080_0031280
2011 Ga0501080_0079199
2012 Ga0501080_0295474
2013 Ga0501083_0000482
2014 Ga0501083_0013677
2015 Ga0501083_0064806
2016 Ga0501083_0156097
2017 Ga0501035_0000011
2018 Ga0501035_0000053
2019 Ga0501035_0000085
2020 Ga0501035_0002030
2021 Ga0501035_0032479
2022 Ga0501035_0063203
2023 Ga0501035_0078397
2024 Ga0501035_0124226
2025 Ga0501035_0204797
2026 Ga0501035_0405270
2027 Ga0501044_0000011
2028 Ga0501044_0000214
2029 Ga0501044_0030366
2030 Ga0501044_0040188
2031 Ga0501044_0043769
2032 Ga0501044_0050307
2033 Ga0501044_0053203
2034 Ga0501044_0108582
2035 Ga0501044_0203480
2036 Ga0501045_0005924
2037 Ga0501045_0128842
2038 nmdc:mga03683_118784_c1
2039 nmdc:mga03n38_46787_c1
2040 nmdc:mga00v17_122353_c1
2041 nmdc:mga00v17_12_c1
2042 nmdc:mga00v17_274724_c1
2043 nmdc:mga00v17_639_c1
2044 nmdc:mga00v17_72484_c1
2045 nmdc:mga00v17_88947_c1
2046 nmdc:mga0yw44_131384_c1
2047 nmdc:mga0yw44_281182_c1
2048 nmdc:mga0yw44_5378_c1
2049 nmdc:mga0yw44_76030_c1
2050 nmdc:mga0yw44_7667_c1
2051 nmdc:mga0yw44_78460_c1
2052 nmdc:mga0k408_53778_c1
2053 nmdc:mga0k408_69712_c1
2054 nmdc:mga06z11_26657_c1
2055 nmdc:mga07m45_111570_c1
2056 nmdc:mga07m45_143377_c1
2057 nmdc:mga07m45_221463_c1
2058 nmdc:mga07m45_43873_c1
2059 nmdc:mga0sz30_346_c1
2060 Ga0500578_0023373
2061 Ga0500651_0102592
2062 Ga0500654_052296
2063 Ga0500556_0068597
2064 Ga0500557_014969
2065 Ga0500569_005171
2066 Ga0500607_045902
2067 Ga0500618_000677
2068 Ga0500618_001651
2069 Ga0500618_017165
2070 Ga0500658_0003010
2071 Ga0500658_0014807
2072 Ga0500559_0006770
2073 Ga0500559_0007013
2074 Ga0500568_0000093
2075 Ga0500568_0004654
2076 Ga0500568_0008573
2077 Ga0500573_0010216
2078 Ga0500590_003639
2079 Ga0500604_0026214
2080 Ga0500616_0000277
2081 Ga0500616_0004617
2082 Ga0500616_0102257
2083 Ga0500620_002880
2084 Ga0500622_0000458
2085 Ga0500622_0001719
2086 Ga0500622_0047293
2087 Ga0500624_001212
2088 Ga0500627_0109936
2089 Ga0500633_0002864
2090 Ga0500634_0017227
2091 Ga0500636_0001459
2092 Ga0500636_0170223
2093 Ga0501082_0020558
2094 Ga0501082_0233321
2095 2793280315
2096 2509108407
2097 2509113177
2098 2509143264
2099 2509376460
2100 2509392068
2101 2509445659
2102 2509447040
2103 2510133941
2104 2510306443
2105 2510315459
2106 2510895359
2107 2511135389
2108 2511173655
2109 2511187043
2110 2511199015
2111 2511389844
2112 2511502233
2113 2512533606
2114 2512931452
2115 2512959284
2116 2512970705
2117 2513567986
2118 2513576928
2119 2513584395
2120 2513596463
2121 2513604251
2122 2513612763
2123 2513618793
2124 2513633400
2125 2513708062
2126 2513865586
2127 2513884416
2128 2513904997
2129 2513909014
2130 2513925397
2131 2513986836
2132 2514001514
2133 2514006400
2134 2514020021
2135 2514033668
2136 2514421519
2137 2514589226
2138 2515112984
2139 2515609009
2140 2515637396
2141 2515640949
2142 2515655369
2143 2515739468
2144 2516204135
2145 2516893612
2146 2517036690
2147 2517077049
2148 2517095817
2149 2517407389
2150 2517570324
2151 2520377203
2152 2524448567
2153 2524459576
2154 2530645966
2155 2535485128
2156 2535516854
2157 2537875446
2158 2551674556
2159 2551677937
2160 2551687749
2161 2551691438
2162 2551697662
2163 2551715567
2164 2551715891
2165 2551725523
2166 2551737920
2167 2551741377
2168 2554248220
2169 2558864473
2170 2559295336
2171 2561468382
2172 2585166336
2173 2585200594
2174 2585222818
2175 2585231729
2176 2585255071
2177 2585267437
2178 2585271126
2179 2585277470
2180 2585323346
2181 2585331488
2182 2585386505
2183 2585393243
2184 2585402411
2185 2585527429
2186 2585535097
2187 2585538170
2188 2585545401
2189 2585555947
2190 2585558850
2191 2585822902
2192 2585836119
2193 2585843214
2194 2585898232
2195 2585904180
2196 2585996192
2197 2586000802
2198 2587980703
2199 2588517292
2200 2599331740
2201 2599417313
2202 2599601648
2203 2599721926
2204 2599936711
2205 2600194380
2206 2600374372
2207 2601610092
2208 2601746867
2209 2616293376
2210 2616308945
2211 2616554216
2212 2617384730
2213 2643776083
2214 2643794530
2215 2643803101
2216 2643811543
2217 2643856782
2218 2643920357
2219 2643984441
2220 2644003171
2221 2644050531
2222 2644063463
2223 2644129344
2224 2644153298
2225 2644193495
2226 2644205759
2227 2644209041
2228 2644238692
2229 2644298659
2230 2644374746
2231 2644414226
2232 2644447754
2233 2644483449
2234 2644492020
2235 2644499660
2236 2644521970
2237 2644652571
2238 2644656888
2239 2644676091
2240 2644690227
2241 2671111442
2242 2688598484
2243 2692315553
2244 2694632947
2245 2694636018
2246 2719181794
2247 2719386397
2248 2719666145
2249 2719732458
2250 2720492565
2251 2720614000
2252 2720620805
2253 2720632130
2254 2720775858
2255 2721147885
2256 2721159336
2257 2721164721
2258 2721400101
2259 2722840891
2260 2723027462
2261 2723561081
2262 2723567677
2263 2723575419
2264 2724038914
2265 2724045214
2266 2724090465
2267 2724104942
2268 2724110801
2269 2725952575
2270 2730108398
2271 2730165029
2272 2730298968
2273 2738800071
2274 2738947345
2275 2739032827
2276 2739307202
2277 2753359755
2278 2753462018
2279 2756675427
2280 2757569722
2281 2765464626
2282 2766065855
2283 2770195432
2284 2776270631
2285 2776280546
2286 2776913912
2287 2778175403
2288 2792585137
2289 2792620781
2290 2792626140
2291 2792639076
2292 2792749280
2293 2793294449
2294 2793314556
2295 2793320383
2296 2793334478
2297 2793339195
2298 2793348868
2299 2793351844
2300 2793362597
2301 2793368887
2302 2802720019
2303 2802727048
2304 2802731949
2305 2802739280
2306 2802745739
2307 2802752341
2308 2805928813
2309 2805935095
2310 2806043807
2311 2806050262
2312 2806057078
2313 2806064460
2314 2806071727
2315 2808987930
2316 2819241415
2317 2819559049
2318 2819609136
2319 2819637636
2320 2821127501
2321 2837679415
2322 2837682893
2323 2838017665
2324 2838038487
2325 2838043956
2326 2838054398
2327 2838068027
2328 2838070155
2329 2838076870
2330 2838661602
2331 2838670348
2332 2838675789
2333 2838683487
2334 2838687069
2335 2838697570
2336 2838702719
2337 2838710686
2338 2838714671
2339 2838721528
2340 2838725431
2341 2838729958
2342 2838738025
2343 2838743027
2344 2839997023
2345 2841841606
2346 2841848480
2347 2841852513
2348 2841862111
2349 2841870769
2350 2842078859
2351 2842113284
2352 2842118631
2353 2842125489
2354 2842130684
2355 2842141384
2356 2842148023
2357 2842154146
2358 2842158027
2359 2842168809
2360 2842170915
2361 2842177766
2362 2842181646
2363 2842187780
2364 2842197345
2365 2842205492
2366 2842212091
2367 2842217921
2368 2842226290
2369 2842230303
2370 2842240543
2371 2842244205
2372 2842253089
2373 2842257709
2374 2842266254
2375 2842271393
2376 2842278949
2377 2842285613
2378 2842292521
2379 2842301357
2380 2842305021
2381 2842314925
2382 2842320697
2383 2842346445
2384 2842357894
2385 2842368976
2386 2842374118
2387 2842378919
2388 2842385142
2389 2842399896
2390 2842402973
2391 2842409655
2392 2842416306
2393 2842423769
2394 2842430717
2395 2842437296
2396 2842443666
2397 2842454039
2398 2842464860
2399 2842471914
2400 2842484573
2401 2842491965
2402 2842496839
2403 2842511142
2404 2842518895
2405 2842521803
2406 2842871945
2407 2842924145
2408 2844007383
2409 2844013746
2410 2844164559
2411 2844458436
2412 2847419387
2413 2847675651
2414 2847692293
2415 2848994414
2416 2850081456
2417 2852390211
2418 2854912407
2419 2855826332
2420 2855841721
2421 2855872531
2422 2856319537
2423 2856323887
2424 2856331137
2425 2856347072
2426 2857351111
2427 2857517448
2428 2857536486
2429 2858802507
2430 2869166913
2431 2869172818
2432 2869240032
2433 2869246347
2434 2869255413
2435 2869260253
2436 2869269364
2437 2869271492
2438 2869284973
2439 2871439529
2440 2871453244
2441 2871463257
2442 2871470589
2443 2871501358
2444 2874106136
2445 2874122268
2446 2874130641
2447 2874133388
2448 2874145915
2449 2874167381
2450 2874169902
2451 2876368431
2452 2876381944
2453 2876389930
2454 2876398482
2455 2876406342
2456 2876413092
2457 2876425738
2458 2878040772
2459 2878735678
2460 2878745258
2461 2878765338
2462 2878773045
2463 2878777901
2464 2878788145
2465 2881167573
2466 2881868522
2467 2885309474
2468 2885324694
2469 2885330883
2470 2885339444
2471 2885353787
2472 2888346863
2473 2888355798
2474 2889010739
2475 2889017566
2476 2891050867
2477 2891373335
2478 2894656003
2479 2894820348
2480 2896389036
2481 2899796065
2482 2899807280
2483 2899850643
2484 2903451364
2485 2903504657
2486 2903527430
2487 2903533884
2488 2903546169
2489 2904580629
2490 2904665037
2491 2906327276
2492 2906329969
2493 2906364053
2494 2906373460
2495 2906384137
2496 2906391640
2497 2906395323
2498 2906407625
2499 2906414024
2500 2906420257
2501 2913299321
2502 2913312557
2503 2915653146
2504 2915981431
2505 2915988281
2506 2915998692
2507 2916003495
2508 2916011666
2509 2916020769
2510 2916024966
2511 2916033780
2512 2916037858
2513 2916045343
2514 2916049033
2515 2916055729
2516 2916064912
2517 2916074004
2518 2916082589
2519 2917557282
2520 2919107671
2521 2919114709
2522 2919121654
2523 2919169231
2524 2919174722
2525 2920761532
2526 2920825202
2527 2921203060
2528 2921211120
2529 2921237979
2530 2921246783
2531 2921252078
2532 2921261399
2533 2921266201
2534 2921282778
2535 2921290965
2536 2921298410
2537 2922135715
2538 2922158317
2539 2922161124
2540 2922174246
2541 2924146762
2542 2924158000
2543 2924159266
2544 2924169169
2545 2924174577
2546 2924181172
2547 2924192719
2548 2924195376
2549 2924203333
2550 2924210753
2551 2924220081
2552 2924223302
2553 2924230511
2554 2924717656
2555 2924720120
2556 2924728551
2557 2924736398
2558 2924745031
2559 2924753576
2560 2924757246
2561 2924783395
2562 2924789117
2563 2926755725
2564 2926762840
2565 2928523871
2566 2929140859
2567 2933008791
2568 2933014931
2569 2933019440
2570 2933570829
2571 2933588660
2572 2933596608
2573 2933600961
2574 2935897045
2575 2935901973
2576 2936372059
2577 2936379922
2578 2936382818
2579 2937000696
2580 2937004569
2581 2937011188
2582 2937019834
2583 2937024574
2584 2937030277
2585 2937042658
2586 2937045530
2587 2937055107
2588 2937063580
2589 2937069456
2590 2937074380
2591 2937080285
2592 2937088119
2593 2937092450
2594 2937103046
2595 2937113291
2596 2937116155
2597 2937121975
2598 2937128815
2599 2937815780
2600 2937838180
2601 2937853140
2602 2937865430
2603 2937872599
2604 2937882082
2605 2937894195
2606 2937978543
2607 2938000027
2608 2938017068
2609 2941502149
2610 2954012815
2611 2957376394
2612 2957384288
2613 2957390750
2614 2957395906
2615 2957404512
2616 2957412100
2617 2957421518
2618 2957429677
2619 2957431706
2620 2957442857
2621 2957446919
2622 2957453761
2623 2957461615
2624 2957467054
2625 2957476399
2626 2957479615
2627 2957490472
2628 2957494097
2629 2957503299
2630 2957510604
2631 2958040675
2632 2958045115
2633 2958056757
2634 2958064266
2635 2958089204
2636 2958098150
2637 2958104773
2638 2958114554
2639 2958128539
2640 2958130545
2641 2958143681
2642 2958149752
2643 2958162332
2644 2958170491
2645 2958174893
2646 2958184750
2647 2960585408
2648 2960592076
2649 2960600003
2650 2960610578
2651 2960612327
2652 2960620453
2653 2960624492
2654 2960632037
2655 2960644134
2656 2960648425
2657 2960656536
2658 2960665578
2659 2960669647
2660 2960675170
2661 2960681612
2662 2960691479
2663 2960694812
2664 2961082917
2665 2961120038
2666 2961133054
2667 2961143249
2668 2961168946
2669 2961176008
2670 2961186994
2671 2963647761
2672 2964609774
2673 2964617758
2674 2964623644
2675 2964633845
2676 2964640830
2677 2964645696
2678 2964651545
2679 2964660515
2680 2964666933
2681 2964676712
2682 2964682864
2683 2964685779
2684 2964692468
2685 2964701654
2686 2964711103
2687 2964715170
2688 2964720668
2689 2965024233
2690 2965031514
2691 2965035544
2692 2965044329
2693 2965049982
2694 2965065023
2695 2965089875
2696 2965105838
2697 2965112905
2698 2965122081
2699 2967666391
2700 2967678424
2701 2967684436
2702 2967689726
2703 2967694633
2704 2967706611
2705 2967708611
2706 2967714864
2707 2967726134
2708 2967729005
2709 2967737136
2710 2967748854
2711 2967751614
2712 2967760007
2713 2967767503
2714 2967772131
2715 2967782228
2716 2968001896
2717 2968009080
2718 2968018403
2719 2968090394
2720 2968096402
2721 2968098903
2722 2968116395
2723 2968120670
2724 2968129222
2725 2968177340
2726 2970021072
2727 2970028354
2728 2970040279
2729 2970042629
2730 2970050960
2731 2970056690
2732 2970067132
2733 2970071576
2734 2970078252
2735 2970085234
2736 2970093935
2737 2970102166
2738 2970108009
2739 2970110698
2740 2970117344
2741 2970125833
2742 2970131176
2743 2970136282
2744 2970146739
2745 2970151627
2746 2970159557
2747 2970166988
2748 2970176911
2749 2970180813
2750 2970189159
2751 2970193589
2752 2970471423
2753 2970491075
2754 2970508674
2755 2970511380
2756 2970536438
2757 2970543784
2758 2970552475
2759 2970560186
2760 2970599588
2761 2970626915
2762 2970631956
2763 2977519104
2764 2977526317
2765 2977534067
2766 2977539615
2767 2977546349
2768 2977558421
2769 2977564441
2770 2977567653
2771 2977575757
2772 2977582009
2773 2977827453
2774 2977832732
2775 2977846015
2776 2977856221
2777 2977863733
2778 2977867044
2779 2977876239
2780 2977903658
2781 2977913747
2782 2977919444
2783 2977924268
2784 2977939888
2785 2977942790
2786 2977956258
2787 2977960715
2788 2977977182
2789 2977990594
2790 2978974606
2791 2979094667
2792 2979100768
2793 2979103902
2794 2979711966
2795 2979749334
2796 2979772260
2797 2979779659
2798 2979785516
2799 2979795766
2800 2979811678
2801 2984511531
2802 2984522108
2803 2984541406
2804 2984589928
2805 2984603684
2806 2987638296
2807 2987647376
2808 2987656152
2809 2987664977
2810 2987678317
2811 2989349658
2812 2989774273
2813 2995393043
2814 2996314035
2815 2996339138
2816 2996347290
2817 2996350212
2818 2996388068
2819 2996889051
2820 2996894343
2821 3000140618
2822 3002144746
2823 3003934051
2824 3004168948
2825 3004194034
2826 3004205460
2827 3004216003
2828 3004223753
2829 3004234584
2830 3004244790
2831 3004253438
2832 3004274987
2833 3004276910
2834 3004290399
2835 3004334307
2836 3005414613
2837 3005419483
2838 3005448432
2839 637074556
2840 639649174
2841 643826303
2842 648739201
2843 649873010
2844 650740546
2845 8002062558
2846 8002289003
2847 8003571611
2848 8003994155
2849 8004001787
2850 8004301332
2851 8004313325
2852 8004363547
2853 8004380434
2854 8004393600
2855 8004452035
2856 8004640776
2857 8004699558
2858 8004709399
2859 8004720368
2860 8004730400
2861 8005260292
2862 8005281194
2863 8005283270
2864 8005293624
2865 8005303109
2866 8005312816
2867 8005316774
2868 8005323578
2869 8005380910
2870 8005389138
2871 8005396118
2872 8005435141
2873 8005463663
2874 8005500883
2875 8005545606
2876 8005557033
2877 8005567974
2878 8005573480
2879 8005622256
2880 8005632264
2881 8005648388
2882 8005659041
2883 8005672300
2884 8005682902
2885 8005692123
2886 8005697384
2887 8018134077
2888 8018153215
2889 8018164644
2890 8018181341
2891 8023683186
2892 8024482880
2893 8024488014
2894 8024504407
2895 8045864592
2896 8046771920
2897 8049295311
2898 8054462961
2899 8054562939
2900 8054568617
2901 8055432772
2902 8055620822
2903 8056375917
2904 8056386709
2905 8057575750
2906 8057877692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

43

83

0.91

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

100

302

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zqi-assembly2.cif.gz_C crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8993 3 305
5dmx-assembly1.cif.gz_A crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121 0.8947 5 303
3v4z-assembly1.cif.gz_A d-alanine--d-alanine ligase from yersinia pestis 0.8905 3 302
4zqi-assembly2.cif.gz_C crystal structure of apo d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8882 3 305
5bpf-assembly1.cif.gz_B crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8849 3 305
ID Description Score Start End Superfamily
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9205 87 303 3.30.470.20
3k3pB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9177 179 303 3.30.470.20
5d8dD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9171 87 302 3.30.470.20
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9064 87 303 3.30.470.20
2i8cA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.902 87 302 3.30.470.20
ID Description Score Start End GO Terms
AF-E6YRZ6-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9578 1 308 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-E6YRZ6-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9547 1 308 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A0A3D5ZYJ8-F1-model_v4 deleted 0.951 110 308
AF-A0A6B2JJ06-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) (D-Ala-D-Ala ligase) (D-alanylalanine synthetase) 0.9502 1 308 GO:0005524
GO:0005737
GO:0008360
GO:0008716
GO:0009252
GO:0046872
GO:0071555
AF-A6FQU2-F1-model_v4 deleted 0.9483 10 308

Map