F494076

General Info

Members Datasets Scaffolds Average Seq Length
1454 488 2908 185

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100169478|Ga0070674_1001694782
Length 200
Sequence MPPICVGERTRSVLIEVRPLGLDGVLEIRPRRLRDDRGFFSETWNEREFRDAGIDVSFVQDNHSLSREPGVLRGLHFQAPPFAQDKLIRVSRGSVFDVAVDIRSGSPTFGRWAAAILSAENKRHFWIPEGFAHGFAVLSDYATFSYQCTALYDHSADAAVRWNDGDIAVDWPISAPLLSVKDQRAPFLRDIPHGRLPAFA

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
22 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
26 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
27 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
28 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
95 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
117 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
121 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
122 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
127 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
128 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
129 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
130 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
134 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
141 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
148 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
161 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
242 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
243 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
244 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
245 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
249 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
250 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
265 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
266 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
268 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
277 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
278 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
282 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
283 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
284 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
285 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
286 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
287 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
288 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
289 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
290 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
291 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
292 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
293 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
294 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
295 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
296 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
297 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
298 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
299 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
300 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
301 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
302 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
303 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
304 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
305 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
306 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
307 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
308 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
309 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
310 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
311 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
312 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
313 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
314 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
315 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
316 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
317 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
318 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
319 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
320 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
321 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
322 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
323 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
324 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
325 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
328 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
329 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
330 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
331 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
332 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
333 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
334 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
335 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
336 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
339 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
340 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
341 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
342 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
343 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
344 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
345 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
348 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
351 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
352 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
357 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
358 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
359 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
360 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
361 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
362 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
363 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
364 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
365 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
366 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
367 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
368 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
386 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
387 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
388 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
389 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
390 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
391 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
392 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
393 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
394 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
395 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
396 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
397 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
412 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
413 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
414 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
415 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
416 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
420 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
421 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
422 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
423 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
424 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
425 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
426 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
427 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
428 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
431 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
432 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
433 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
434 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
435 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
436 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
437 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
438 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
439 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
440 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
441 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
442 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
443 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
444 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
445 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
446 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
447 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
448 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
449 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
450 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
451 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
452 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
454 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
455 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
456 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
457 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
458 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
459 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
460 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
461 2643221573 Lysobacter sp. Root604 Isolate Unclassified
462 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
463 2643221607 Rhizobium sp. Root73 Isolate Unclassified
464 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
465 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
466 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
467 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
468 2643221720 Lysobacter sp. Root916 Isolate Unclassified
469 2643221728 Lysobacter sp. Root983 Isolate Unclassified
470 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
471 2738543009 Luteibacter sp. OK325 Isolate Unclassified
472 2739367700 Dyella sp. YR388 Isolate Unclassified
473 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
474 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
475 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
476 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
477 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
478 2884411467 Dyella sp. AD56 Isolate Rhizosphere
479 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
480 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
481 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
482 2919404418 Luteibacter sp. 3190 Isolate Unclassified
483 2928963466 Dyella japonica 1073 Isolate Unclassified
484 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
485 2941471342 Luteibacter sp. 621 Isolate Unclassified
486 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
487 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
488 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0.34
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 0
Rhizoplane 2.82
Rhizosphere 78.06
Stem 0
Stem Tuber 0
Unclassified 0.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100169478 3300005356 Bacteria 1663
2 JGI24740J21852_10000320 3300001979 Bacteria 20427
3 JGI24740J21852_10003591 3300001979 Bacteria 6767
4 JGI24739J22299_10009127 3300001989 Bacteria 3700
5 JGI24739J22299_10045170 3300001989 Bacteria 1447
6 JGI24737J22298_10002818 3300001990 Bacteria 6157
7 JGI24737J22298_10002923 3300001990 Bacteria 6053
8 JGI24735J21928_10000210 3300002067 Bacteria 20437
9 JGI24735J21928_10008070 3300002067 Bacteria 3418
10 JGI24738J21930_10000630 3300002075 Bacteria 10160
11 JGI25162J39368_1000072 3300002737 Bacteria 122550
12 JGI25162J39368_1000403 3300002737 Bacteria 35711
13 JGI25162J39368_1000450 3300002737 Bacteria 32392
14 JGI25154J39366_1005804 3300002738 Bacteria 1905
15 JGI25157J39369_1000143 3300002741 Bacteria 60517
16 JGI25157J39369_1000145 3300002741 Bacteria 60335
17 JGI25157J39369_1000210 3300002741 Bacteria 48631
18 JGI25163J39215_1000608 3300002771 Bacteria 9915
19 JGI25164J39214_1000115 3300002772 Bacteria 77050
20 JGI25164J39214_1000122 3300002772 Bacteria 74977
21 JGI25164J39214_1000276 3300002772 Bacteria 37292
22 JGI25164J39214_1000360 3300002772 Bacteria 27828
23 JGI25164J39214_1000479 3300002772 Bacteria 19723
24 JGI25151J46595_10000165 3300003187 Bacteria 85521
25 JGI25151J46595_10012116 3300003187 Bacteria 3931
26 JGI25165J46597_1000063 3300003214 Bacteria 205051
27 JGI25165J46597_1000241 3300003214 Bacteria 74955
28 JGI25165J46597_1000419 3300003214 Bacteria 43972
29 JGI25165J46597_1001372 3300003214 Bacteria 13423
30 JGI25165J46597_1007774 3300003214 Bacteria 1745
31 JGI25153J46596_10024928 3300003215 Bacteria 2147
32 rootH1_10024742 3300003316 Bacteria 3058
33 rootH1_10071835 3300003316 Bacteria 4198
34 rootH1_10110832 3300003316 Bacteria 3620
35 rootH2_10063162 3300003320 Bacteria 4812
36 rootL2_10006308 3300003322 Bacteria 4060
37 rootL2_10061895 3300003322 Bacteria 1357
38 rootL2_10246862 3300003322 Bacteria 1747
39 rootH1_10327385 3300003323 Bacteria 2908
40 JGI26145J50221_1002765 3300003371 Bacteria 1379
41 Ga0006562J51391_1027422 3300003578 Bacteria 7490
42 Ga0055538_1004437 3300003751 Bacteria 1593
43 Ga0055539_1002939 3300003752 Bacteria 2468
44 Ga0055533_1000338 3300003756 Bacteria 20556
45 Ga0055525_1000135 3300003759 Bacteria 108217
46 Ga0055527_1000043 3300003760 Bacteria 113506
47 Ga0055527_1000079 3300003760 Bacteria 79303
48 Ga0055535_1000068 3300003761 Bacteria 115329
49 Ga0055535_1000071 3300003761 Bacteria 113506
50 Ga0055535_1000166 3300003761 Bacteria 71280
51 Ga0055535_1017601 3300003761 Bacteria 949
52 Ga0055542_1000090 3300003762 Bacteria 122550
53 Ga0055542_1000096 3300003762 Bacteria 118398
54 Ga0055542_1000210 3300003762 Bacteria 71284
55 Ga0055529_1000084 3300003763 Bacteria 143720
56 Ga0055529_1000114 3300003763 Bacteria 118398
57 Ga0055529_1000394 3300003763 Bacteria 46666
58 Ga0055529_1003020 3300003763 Bacteria 2950
59 Ga0055526_1000008 3300003771 Bacteria 300059
60 Ga0055526_1056385 3300003771 Bacteria 861
61 Ga0055524_1002861 3300003775 Bacteria 8653
62 Ga0055524_1002910 3300003775 Bacteria 8556
63 Ga0055536_1002163 3300003781 Bacteria 11201
64 Ga0055536_1003562 3300003781 Bacteria 8325
65 Ga0055528_1044392 3300003790 Bacteria 957
66 Ga0055530_10001268 3300003791 Bacteria 19106
67 Ga0055531_10004683 3300003794 Bacteria 8197
68 Ga0055531_10007280 3300003794 Bacteria 6072
69 Ga0058692_1000040 3300003856 Bacteria 132805
70 Ga0065165_1003771 3300005262 Bacteria 10154
71 Ga0065704_10087117 3300005289 Bacteria 3054
72 Ga0065715_10001173 3300005293 Bacteria 11480
73 Ga0065715_10268777 3300005293 Bacteria 1117
74 Ga0070658_10001469 3300005327 Bacteria 20090
75 Ga0070658_10324163 3300005327 Bacteria 1316
76 Ga0070658_10412723 3300005327 Bacteria 1160
77 Ga0070676_10018581 3300005328 Bacteria 3855
78 Ga0070683_100148589 3300005329 Bacteria 2221
79 Ga0070683_100705389 3300005329 Bacteria 966
80 Ga0070670_100051522 3300005331 Bacteria 3535
81 Ga0070670_100082595 3300005331 Bacteria 2761
82 Ga0070670_100156808 3300005331 Bacteria 1972
83 Ga0070670_100476960 3300005331 Bacteria 1107
84 Ga0070670_100780618 3300005331 Bacteria 862
85 Ga0070670_101066703 3300005331 Bacteria 736
86 Ga0070677_10092159 3300005333 Bacteria 1320
87 Ga0068869_100117424 3300005334 Bacteria 2031
88 Ga0068869_100123858 3300005334 Bacteria 1980
89 Ga0068869_100161403 3300005334 Bacteria 1745
90 Ga0070666_10000010 3300005335 Bacteria 264789
91 Ga0070666_10027007 3300005335 Bacteria 3756
92 Ga0070666_10028601 3300005335 Bacteria 3659
93 Ga0070666_10092942 3300005335 Bacteria 2074
94 Ga0070666_10111766 3300005335 Bacteria 1890
95 Ga0070666_10115168 3300005335 Bacteria 1862
96 Ga0070666_10345067 3300005335 Bacteria 1064
97 Ga0070680_100264546 3300005336 Bacteria 1455
98 Ga0070680_100822370 3300005336 Bacteria 801
99 Ga0070682_100363557 3300005337 Bacteria 1083
100 Ga0070682_100546560 3300005337 Bacteria 906
101 Ga0070682_100791487 3300005337 Bacteria 769
102 Ga0068868_100088396 3300005338 Bacteria 2494
103 Ga0068868_100139242 3300005338 Bacteria 1991
104 Ga0068868_100360665 3300005338 Bacteria 1247
105 Ga0070660_100071494 3300005339 Bacteria 2709
106 Ga0070660_100136540 3300005339 Bacteria 1965
107 Ga0070660_100886085 3300005339 Bacteria 752
108 Ga0070689_100002138 3300005340 Bacteria 12816
109 Ga0070689_100260673 3300005340 Bacteria 1433
110 Ga0070689_100940146 3300005340 Bacteria 766
111 Ga0070661_100008137 3300005344 Bacteria 7233
112 Ga0070661_100139444 3300005344 Bacteria 1826
113 Ga0070661_100233097 3300005344 Bacteria 1415
114 Ga0070692_10003879 3300005345 Bacteria 6161
115 Ga0070668_100049024 3300005347 Bacteria 3249
116 Ga0070668_100649769 3300005347 Bacteria 927
117 Ga0070669_100042491 3300005353 Bacteria 3308
118 Ga0070669_100168407 3300005353 Bacteria 1707
119 Ga0070675_100043062 3300005354 Bacteria 3688
120 Ga0070675_100638317 3300005354 Bacteria 967
121 Ga0070671_100112479 3300005355 Bacteria 2287
122 Ga0070671_100204590 3300005355 Bacteria 1674
123 Ga0070671_100281894 3300005355 Bacteria 1413
124 Ga0070674_100096591 3300005356 Bacteria 2144
125 Ga0070673_100050203 3300005364 Bacteria 3261
126 Ga0070673_100257204 3300005364 Bacteria 1524
127 Ga0070659_100000052 3300005366 Bacteria 96862
128 Ga0070659_100004887 3300005366 Bacteria 9579
129 Ga0070667_100000150 3300005367 Bacteria 86639
130 Ga0070667_100034011 3300005367 Bacteria 4264
131 Ga0070667_100075009 3300005367 Bacteria 2887
132 Ga0070667_100087613 3300005367 Bacteria 2672
133 Ga0070667_100276494 3300005367 Bacteria 1507
134 Ga0070667_100305366 3300005367 Bacteria 1433
135 Ga0070667_100348682 3300005367 Bacteria 1340
136 Ga0070667_100454628 3300005367 Bacteria 1170
137 Ga0070667_100831502 3300005367 Bacteria 858
138 Ga0070667_100973834 3300005367 Bacteria 791
139 Ga0070714_100000393 3300005435 Bacteria 32554
140 Ga0070714_100000605 3300005435 Bacteria 25685
141 Ga0070713_100061037 3300005436 Bacteria 3154
142 Ga0070711_100095752 3300005439 Bacteria 2149
143 Ga0070711_100385734 3300005439 Bacteria 1134
144 Ga0070694_101277709 3300005444 Bacteria 617
145 Ga0070708_100139302 3300005445 Bacteria 2249
146 Ga0070663_100000029 3300005455 Bacteria 82128
147 Ga0070663_100021862 3300005455 Bacteria 4263
148 Ga0070663_100037071 3300005455 Bacteria 3392
149 Ga0070663_100172190 3300005455 Bacteria 1674
150 Ga0070663_100240101 3300005455 Bacteria 1430
151 Ga0070663_100289513 3300005455 Bacteria 1308
152 Ga0070663_100737947 3300005455 Bacteria 840
153 Ga0070663_101065424 3300005455 Bacteria 705
154 Ga0070678_100041709 3300005456 Bacteria 3256
155 Ga0070678_100127460 3300005456 Bacteria 2017
156 Ga0070678_100149741 3300005456 Bacteria 1878
157 Ga0070678_100157470 3300005456 Unclassified 1836
158 Ga0070662_100021500 3300005457 Bacteria 4406
159 Ga0070662_100549394 3300005457 Bacteria 968
160 Ga0070662_100844592 3300005457 Bacteria 780
161 Ga0070681_10028025 3300005458 Bacteria 5661
162 Ga0070681_10046264 3300005458 Bacteria 4351
163 Ga0070681_10074465 3300005458 Bacteria 3356
164 Ga0070681_10352224 3300005458 Bacteria 1383
165 Ga0070681_10537320 3300005458 Bacteria 1083
166 Ga0070681_10959932 3300005458 Bacteria 774
167 Ga0068867_100012849 3300005459 Bacteria 5926
168 Ga0068867_101047542 3300005459 Bacteria 742
169 Ga0070685_10000832 3300005466 Bacteria 16796
170 Ga0070685_10098205 3300005466 Bacteria 1784
171 Ga0070679_100323628 3300005530 Bacteria 1491
172 Ga0070679_100338414 3300005530 Bacteria 1453
173 Ga0070679_100354016 3300005530 Bacteria 1416
174 Ga0070679_100378948 3300005530 Bacteria 1361
175 Ga0070679_100494921 3300005530 Bacteria 1167
176 Ga0070679_100677980 3300005530 Bacteria 973
177 Ga0070684_100194805 3300005535 Bacteria 1845
178 Ga0070684_100555778 3300005535 Bacteria 1065
179 Ga0068853_100002537 3300005539 Bacteria 13707
180 Ga0068853_100002647 3300005539 Bacteria 13496
181 Ga0068853_100027321 3300005539 Bacteria 4794
182 Ga0068853_100035136 3300005539 Bacteria 4256
183 Ga0068853_100035959 3300005539 Bacteria 4209
184 Ga0068853_100054340 3300005539 Bacteria 3451
185 Ga0068853_100120542 3300005539 Bacteria 2339
186 Ga0068853_100139422 3300005539 Bacteria 2176
187 Ga0068853_100406214 3300005539 Bacteria 1275
188 Ga0068853_100436905 3300005539 Bacteria 1229
189 Ga0068853_100442893 3300005539 Bacteria 1221
190 Ga0068853_100599738 3300005539 Bacteria 1046
191 Ga0068853_100600373 3300005539 Bacteria 1045
192 Ga0070672_100013517 3300005543 Bacteria 5770
193 Ga0070672_100167090 3300005543 Bacteria 1828
194 Ga0070672_100480680 3300005543 Bacteria 1073
195 Ga0070672_100597666 3300005543 Bacteria 961
196 Ga0070696_100006208 3300005546 Bacteria 7994
197 Ga0070696_100031859 3300005546 Bacteria 3615
198 Ga0070696_100641700 3300005546 Bacteria 860
199 Ga0070696_100736094 3300005546 Bacteria 807
200 Ga0070693_100005217 3300005547 Bacteria 6217
201 Ga0070693_100088297 3300005547 Bacteria 1864
202 Ga0070693_100164722 3300005547 Bacteria 1415
203 Ga0070693_100331569 3300005547 Bacteria 1036
204 Ga0070693_100446041 3300005547 Bacteria 907
205 Ga0070665_100000026 3300005548 Bacteria 365176
206 Ga0070665_100001464 3300005548 Bacteria 27669
207 Ga0070665_100004807 3300005548 Bacteria 14040
208 Ga0070665_100020504 3300005548 Bacteria 6639
209 Ga0070665_100084135 3300005548 Bacteria 3186
210 Ga0070665_100242107 3300005548 Bacteria 1804
211 Ga0070665_100585482 3300005548 Bacteria 1129
212 Ga0070665_100710045 3300005548 Bacteria 1018
213 Ga0070665_101291684 3300005548 Bacteria 740
214 Ga0068855_100000696 3300005563 Bacteria 41094
215 Ga0068855_100010588 3300005563 Bacteria 11117
216 Ga0068855_100057884 3300005563 Bacteria 4542
217 Ga0068855_100057944 3300005563 Bacteria 4539
218 Ga0068855_100176858 3300005563 Bacteria 2414
219 Ga0068855_100177473 3300005563 Bacteria 2409
220 Ga0068855_100431851 3300005563 Bacteria 1440
221 Ga0068855_100538940 3300005563 Bacteria 1265
222 Ga0068855_100690164 3300005563 Bacteria 1093
223 Ga0068855_100698421 3300005563 Bacteria 1086
224 Ga0068855_100740982 3300005563 Bacteria 1048
225 Ga0068855_100818438 3300005563 Bacteria 989
226 Ga0068855_101124889 3300005563 Bacteria 820
227 Ga0068855_101256879 3300005563 Bacteria 768
228 Ga0070664_100085989 3300005564 Bacteria 2717
229 Ga0070664_100177381 3300005564 Bacteria 1892
230 Ga0070664_100184175 3300005564 Bacteria 1858
231 Ga0070664_100292013 3300005564 Bacteria 1472
232 Ga0068857_100014664 3300005577 Bacteria 6836
233 Ga0068857_100041837 3300005577 Bacteria 4063
234 Ga0068857_100164117 3300005577 Bacteria 2016
235 Ga0068857_100230568 3300005577 Bacteria 1693
236 Ga0068857_100300958 3300005577 Bacteria 1478
237 Ga0068857_100426015 3300005577 Bacteria 1238
238 Ga0068857_100661245 3300005577 Bacteria 991
239 Ga0068857_100700902 3300005577 Bacteria 962
240 Ga0068854_100000282 3300005578 Bacteria 34044
241 Ga0068854_100006540 3300005578 Bacteria 7417
242 Ga0068854_100006900 3300005578 Bacteria 7243
243 Ga0068854_100051750 3300005578 Bacteria 2943
244 Ga0068854_100104414 3300005578 Bacteria 2129
245 Ga0068854_100202049 3300005578 Bacteria 1563
246 Ga0068856_100000022 3300005614 Bacteria 142768
247 Ga0068856_100013211 3300005614 Bacteria 7997
248 Ga0068856_100036502 3300005614 Bacteria 4818
249 Ga0068856_100119510 3300005614 Bacteria 2636
250 Ga0068856_100164207 3300005614 Bacteria 2231
251 Ga0068856_100191212 3300005614 Bacteria 2060
252 Ga0068856_101036380 3300005614 Bacteria 838
253 Ga0068852_100006662 3300005616 Bacteria 8370
254 Ga0068852_100071081 3300005616 Bacteria 3055
255 Ga0068852_100081782 3300005616 Bacteria 2868
256 Ga0068852_100176951 3300005616 Bacteria 2004
257 Ga0068852_100373403 3300005616 Bacteria 1397
258 Ga0068852_100393746 3300005616 Bacteria 1361
259 Ga0068852_100542980 3300005616 Bacteria 1162
260 Ga0068852_100569515 3300005616 Bacteria 1134
261 Ga0068852_100716187 3300005616 Bacteria 1011
262 Ga0068852_101337712 3300005616 Bacteria 738
263 Ga0068859_100001840 3300005617 Bacteria 21596
264 Ga0068859_101588311 3300005617 Bacteria 722
265 Ga0068864_100014730 3300005618 Bacteria 6495
266 Ga0068864_100112829 3300005618 Bacteria 2423
267 Ga0068864_100177450 3300005618 Bacteria 1946
268 Ga0068864_100874382 3300005618 Bacteria 887
269 Ga0068861_100087634 3300005719 Bacteria 2450
270 Ga0068861_100755419 3300005719 Bacteria 909
271 Ga0068861_100939318 3300005719 Bacteria 822
272 Ga0068851_10006767 3300005834 Bacteria 5246
273 Ga0068851_10011459 3300005834 Bacteria 4159
274 Ga0068851_10021594 3300005834 Bacteria 3125
275 Ga0068851_10036620 3300005834 Bacteria 2457
276 Ga0068851_10059334 3300005834 Bacteria 1957
277 Ga0068870_10051228 3300005840 Bacteria 2185
278 Ga0068863_100004653 3300005841 Bacteria 13528
279 Ga0068863_100005490 3300005841 Bacteria 12479
280 Ga0068863_100014974 3300005841 Bacteria 7449
281 Ga0068863_100050734 3300005841 Bacteria 3932
282 Ga0068863_100098184 3300005841 Bacteria 2781
283 Ga0068863_100624224 3300005841 Bacteria 1068
284 Ga0068863_100818070 3300005841 Bacteria 929
285 Ga0068863_101260885 3300005841 Bacteria 745
286 Ga0068858_100001617 3300005842 Bacteria 22975
287 Ga0068858_100151636 3300005842 Bacteria 2180
288 Ga0068858_100260609 3300005842 Bacteria 1648
289 Ga0068858_100304790 3300005842 Bacteria 1520
290 Ga0068858_100509095 3300005842 Bacteria 1163
291 Ga0068858_100567874 3300005842 Bacteria 1099
292 Ga0068858_100622788 3300005842 Bacteria 1048
293 Ga0068860_100025971 3300005843 Bacteria 5650
294 Ga0068860_100031104 3300005843 Bacteria 5132
295 Ga0068860_100108654 3300005843 Bacteria 2651
296 Ga0068860_100708139 3300005843 Bacteria 1017
297 Ga0068860_100926207 3300005843 Bacteria 888
298 Ga0068860_101226300 3300005843 Bacteria 770
299 Ga0068862_100000185 3300005844 Bacteria 68550
300 Ga0068862_100175378 3300005844 Bacteria 1921
301 Ga0081455_10296262 3300005937 Bacteria 1162
302 Ga0075364_10015606 3300006051 Bacteria 4713
303 Ga0070715_10095572 3300006163 Bacteria 1376
304 Ga0070712_100398115 3300006175 Bacteria 1137
305 Ga0075369_10187921 3300006186 Bacteria 951
306 Ga0075366_10016389 3300006195 Bacteria 4258
307 Ga0097621_100019859 3300006237 Bacteria 5168
308 Ga0097621_100021471 3300006237 Bacteria 4995
309 Ga0097621_100038212 3300006237 Bacteria 3852
310 Ga0097621_100133587 3300006237 Bacteria 2114
311 Ga0097621_100167732 3300006237 Bacteria 1891
312 Ga0097621_100483758 3300006237 Bacteria 1119
313 Ga0097621_101517032 3300006237 Bacteria 636
314 Ga0068871_100059368 3300006358 Bacteria 3116
315 Ga0068871_100064765 3300006358 Bacteria 2992
316 Ga0068871_100119581 3300006358 Bacteria 2224
317 Ga0068871_100236037 3300006358 Bacteria 1588
318 Ga0068871_100254438 3300006358 Bacteria 1531
319 Ga0068871_100825699 3300006358 Bacteria 856
320 Ga0075428_100116793 3300006844 Bacteria 2906
321 Ga0075428_100371580 3300006844 Bacteria 1533
322 Ga0075429_100333234 3300006880 Bacteria 1328
323 Ga0068865_100013181 3300006881 Bacteria 5218
324 Ga0068865_100096192 3300006881 Bacteria 2159
325 Ga0068865_100131071 3300006881 Bacteria 1879
326 Ga0068865_100208584 3300006881 Bacteria 1521
327 Ga0097620_100001840 3300006931 Bacteria 21596
328 Ga0097620_101588824 3300006931 Bacteria 722
329 Ga0105250_10226338 3300009092 Bacteria 794
330 Ga0105240_10000359 3300009093 Bacteria 85874
331 Ga0105240_10000633 3300009093 Bacteria 64950
332 Ga0105240_10002007 3300009093 Bacteria 33570
333 Ga0105240_10007977 3300009093 Bacteria 15268
334 Ga0105240_10009334 3300009093 Bacteria 13905
335 Ga0105240_10013427 3300009093 Bacteria 11248
336 Ga0105240_10022190 3300009093 Bacteria 8422
337 Ga0105240_10050541 3300009093 Bacteria 5240
338 Ga0105240_10074426 3300009093 Bacteria 4192
339 Ga0105240_10209967 3300009093 Bacteria 2276
340 Ga0105240_10884759 3300009093 Bacteria 962
341 Ga0105245_10377566 3300009098 Bacteria 1411
342 Ga0105245_10788223 3300009098 Bacteria 988
343 Ga0105245_10947848 3300009098 Bacteria 903
344 Ga0105245_11070398 3300009098 Bacteria 852
345 Ga0114129_10035130 3300009147 Bacteria 7082
346 Ga0105243_10073372 3300009148 Bacteria 2773
347 Ga0105241_10008871 3300009174 Bacteria 7395
348 Ga0105241_10037744 3300009174 Bacteria 3639
349 Ga0105241_10046045 3300009174 Bacteria 3312
350 Ga0105241_10064718 3300009174 Bacteria 2824
351 Ga0105241_10214683 3300009174 Bacteria 1614
352 Ga0105241_10251234 3300009174 Bacteria 1499
353 Ga0105241_10857754 3300009174 Bacteria 840
354 Ga0105241_11254522 3300009174 Bacteria 704
355 Ga0105242_10002842 3300009176 Bacteria 13567
356 Ga0105242_10041120 3300009176 Bacteria 3727
357 Ga0105242_10593268 3300009176 Bacteria 1069
358 Ga0105242_10722576 3300009176 Bacteria 977
359 Ga0105248_10000246 3300009177 Bacteria 62735
360 Ga0105248_10044683 3300009177 Bacteria 4968
361 Ga0105248_10096662 3300009177 Bacteria 3327
362 Ga0105248_10466046 3300009177 Bacteria 1424
363 Ga0105248_10843250 3300009177 Bacteria 1034
364 Ga0105248_10941610 3300009177 Bacteria 975
365 Ga0105248_11019248 3300009177 Bacteria 935
366 Ga0105237_10000148 3300009545 Bacteria 98986
367 Ga0105237_10000231 3300009545 Bacteria 79368
368 Ga0105237_10000383 3300009545 Bacteria 63065
369 Ga0105237_10004315 3300009545 Bacteria 16486
370 Ga0105237_10128389 3300009545 Bacteria 2529
371 Ga0105237_10144331 3300009545 Bacteria 2375
372 Ga0105237_10173267 3300009545 Bacteria 2158
373 Ga0105237_10345613 3300009545 Bacteria 1492
374 Ga0105237_10413818 3300009545 Bacteria 1353
375 Ga0105237_10479787 3300009545 Bacteria 1250
376 Ga0105237_10544780 3300009545 Bacteria 1167
377 Ga0105237_10709464 3300009545 Bacteria 1012
378 Ga0105238_10000044 3300009551 Bacteria 151485
379 Ga0105238_10007919 3300009551 Bacteria 10634
380 Ga0105238_10010855 3300009551 Bacteria 9155
381 Ga0105238_10034862 3300009551 Bacteria 5119
382 Ga0105238_10049939 3300009551 Bacteria 4211
383 Ga0105238_10097896 3300009551 Bacteria 2918
384 Ga0105238_10202715 3300009551 Bacteria 1960
385 Ga0105238_10217876 3300009551 Bacteria 1885
386 Ga0105238_10333048 3300009551 Bacteria 1505
387 Ga0105238_10538112 3300009551 Bacteria 1172
388 Ga0105238_10733790 3300009551 Bacteria 1001
389 Ga0105249_10001225 3300009553 Bacteria 22566
390 Ga0105249_10027305 3300009553 Bacteria 5151
391 Ga0105249_10380955 3300009553 Bacteria 1436
392 Ga0105148_100676 3300009978 Bacteria 2682
393 Ga0105029_100269 3300009984 Bacteria 2698
394 Ga0105239_10000033 3300010375 Bacteria 223933
395 Ga0105239_10003454 3300010375 Bacteria 19337
396 Ga0105239_10009780 3300010375 Bacteria 10778
397 Ga0105239_10014339 3300010375 Bacteria 8793
398 Ga0105239_10021477 3300010375 Bacteria 7117
399 Ga0105239_10026779 3300010375 Bacteria 6346
400 Ga0105239_10121007 3300010375 Bacteria 2907
401 Ga0105239_10152397 3300010375 Bacteria 2580
402 Ga0105239_10157972 3300010375 Bacteria 2533
403 Ga0105239_10256728 3300010375 Bacteria 1964
404 Ga0105239_10286830 3300010375 Bacteria 1854
405 Ga0105239_10660194 3300010375 Bacteria 1195
406 Ga0105239_10699703 3300010375 Bacteria 1159
407 Ga0105239_11489580 3300010375 Bacteria 782
408 Ga0105246_10009566 3300011119 Bacteria 5972
409 Ga0157318_1000739 3300012482 Bacteria 1497
410 Ga0157314_1000098 3300012500 Bacteria 9231
411 Ga0157314_1001103 3300012500 Bacteria 2022
412 Ga0157326_1021775 3300012513 Bacteria 796
413 Ga0157373_10034519 3300013100 Bacteria 3632
414 Ga0157373_10048721 3300013100 Bacteria 3021
415 Ga0157371_10021671 3300013102 Bacteria 4715
416 Ga0157370_10000495 3300013104 Bacteria 48993
417 Ga0157370_10002719 3300013104 Bacteria 21150
418 Ga0157370_10004280 3300013104 Bacteria 16440
419 Ga0157370_10070640 3300013104 Bacteria 3296
420 Ga0157370_10095746 3300013104 Bacteria 2785
421 Ga0157370_10099538 3300013104 Bacteria 2725
422 Ga0157370_10121328 3300013104 Bacteria 2440
423 Ga0157370_10123802 3300013104 Bacteria 2414
424 Ga0157370_10133349 3300013104 Bacteria 2316
425 Ga0157370_10168588 3300013104 Bacteria 2036
426 Ga0157370_10189039 3300013104 Bacteria 1912
427 Ga0157370_10253027 3300013104 Bacteria 1629
428 Ga0157370_10444388 3300013104 Bacteria 1192
429 Ga0157370_10535365 3300013104 Bacteria 1074
430 Ga0157370_11027177 3300013104 Bacteria 746
431 Ga0157370_11101015 3300013104 Bacteria 718
432 Ga0157369_10000464 3300013105 Bacteria 53767
433 Ga0157369_10005929 3300013105 Bacteria 14190
434 Ga0157369_10031464 3300013105 Bacteria 5842
435 Ga0157369_10262059 3300013105 Bacteria 1803
436 Ga0157369_10281052 3300013105 Bacteria 1733
437 Ga0157369_10778324 3300013105 Bacteria 984
438 Ga0157369_10976478 3300013105 Bacteria 868
439 Ga0157374_10066420 3300013296 Bacteria 3389
440 Ga0157374_10130567 3300013296 Bacteria 2431
441 Ga0157374_10474783 3300013296 Bacteria 1253
442 Ga0157378_10001405 3300013297 Bacteria 21654
443 Ga0157378_10691065 3300013297 Bacteria 1039
444 Ga0157378_11048265 3300013297 Bacteria 851
445 Ga0163162_10000021 3300013306 Bacteria 214873
446 Ga0163162_10000193 3300013306 Bacteria 56063
447 Ga0163162_10002029 3300013306 Bacteria 19053
448 Ga0163162_10064563 3300013306 Bacteria 3706
449 Ga0163162_10069740 3300013306 Bacteria 3567
450 Ga0163162_10153910 3300013306 Bacteria 2418
451 Ga0163162_10449684 3300013306 Bacteria 1420
452 Ga0163162_10638951 3300013306 Bacteria 1188
453 Ga0157372_10011884 3300013307 Bacteria 9277
454 Ga0157372_10014982 3300013307 Bacteria 8297
455 Ga0157372_10052222 3300013307 Bacteria 4551
456 Ga0157372_10064309 3300013307 Bacteria 4116
457 Ga0157372_10167991 3300013307 Bacteria 2537
458 Ga0157372_10186027 3300013307 Bacteria 2405
459 Ga0157372_10299531 3300013307 Bacteria 1870
460 Ga0157372_10423863 3300013307 Bacteria 1551
461 Ga0157372_10444901 3300013307 Bacteria 1510
462 Ga0157372_10704796 3300013307 Bacteria 1175
463 Ga0157372_10889204 3300013307 Bacteria 1034
464 Ga0157372_10892887 3300013307 Bacteria 1031
465 Ga0157372_11088308 3300013307 Bacteria 925
466 Ga0157372_11158308 3300013307 Bacteria 894
467 Ga0157372_12292690 3300013307 Bacteria 620
468 Ga0157375_10000950 3300013308 Bacteria 25099
469 Ga0157375_10016908 3300013308 Bacteria 6570
470 Ga0157375_10050059 3300013308 Bacteria 4097
471 Ga0157375_10122204 3300013308 Bacteria 2715
472 Ga0163163_10000403 3300014325 Bacteria 40776
473 Ga0163163_10006152 3300014325 Bacteria 10460
474 Ga0163163_10113006 3300014325 Bacteria 2745
475 Ga0163163_10284699 3300014325 Bacteria 1705
476 Ga0157380_10082842 3300014326 Bacteria 2626
477 Ga0182008_10000209 3300014497 Bacteria 46251
478 Ga0182008_10030065 3300014497 Bacteria 2740
479 Ga0182008_10032240 3300014497 Bacteria 2633
480 Ga0182008_10046665 3300014497 Bacteria 2153
481 Ga0157379_10003888 3300014968 Bacteria 12730
482 Ga0157379_10202302 3300014968 Bacteria 1796
483 Ga0157379_10208706 3300014968 Bacteria 1767
484 Ga0157376_10006685 3300014969 Bacteria 8162
485 Ga0157376_10017225 3300014969 Bacteria 5505
486 Ga0157376_10019219 3300014969 Bacteria 5260
487 Ga0157376_10107390 3300014969 Bacteria 2450
488 Ga0157376_10124715 3300014969 Bacteria 2288
489 Ga0157376_10334337 3300014969 Bacteria 1444
490 Ga0182006_1000034 3300015261 Bacteria 232484
491 Ga0182006_1007770 3300015261 Bacteria 4890
492 Ga0182006_1032677 3300015261 Bacteria 2089
493 Ga0182006_1047053 3300015261 Bacteria 1674
494 Ga0182007_10001346 3300015262 Bacteria 13262
495 Ga0182007_10005029 3300015262 Bacteria 5871
496 Ga0182007_10052110 3300015262 Bacteria 1349
497 Ga0182007_10067388 3300015262 Bacteria 1172
498 Ga0182007_10090807 3300015262 Bacteria 1006
499 Ga0182005_1000064 3300015265 Bacteria 95976
500 Ga0182005_1002932 3300015265 Bacteria 5921
501 Ga0182005_1016840 3300015265 Bacteria 2028
502 Ga0183369_1003 3300015685 Bacteria 726443
503 Ga0183368_1002 3300015687 Bacteria 1865598
504 Ga0163161_10001385 3300017792 Bacteria 17927
505 Ga0163161_10012090 3300017792 Bacteria 5987
506 Ga0163161_10038479 3300017792 Bacteria 3431
507 Ga0206353_10771426 3300020082 Bacteria 2282
508 Ga0154015_1053000 3300020610 Bacteria 2405
509 Ga0213875_10120439 3300021388 Bacteria 1226
510 Ga0224712_10075440 3300022467 Bacteria 1379
511 Ga0209435_108278 3300025206 Bacteria 1146
512 Ga0209760_100294 3300025207 Bacteria 17371
513 Ga0209784_100042 3300025224 Bacteria 218070
514 Ga0209674_100033 3300025226 Bacteria 423450
515 Ga0209674_100441 3300025226 Bacteria 19236
516 Ga0209674_101207 3300025226 Bacteria 7354
517 Ga0209674_103716 3300025226 Bacteria 2714
518 Ga0209672_100004 3300025228 Bacteria 1467504
519 Ga0209672_100008 3300025228 Bacteria 946876
520 Ga0209672_100916 3300025228 Bacteria 13362
521 Ga0209672_102162 3300025228 Bacteria 5180
522 Ga0209563_100036 3300025230 Bacteria 448275
523 Ga0207427_100037 3300025231 Bacteria 303108
524 Ga0207427_100049 3300025231 Bacteria 237504
525 Ga0207427_100078 3300025231 Bacteria 147526
526 Ga0207427_100096 3300025231 Bacteria 123398
527 Ga0207427_105412 3300025231 Bacteria 1806
528 Ga0209437_100074 3300025233 Bacteria 300858
529 Ga0209437_100083 3300025233 Bacteria 256005
530 Ga0209437_100090 3300025233 Bacteria 247138
531 Ga0209437_100157 3300025233 Bacteria 151821
532 Ga0209437_100691 3300025233 Bacteria 17825
533 Ga0209437_100872 3300025233 Bacteria 12437
534 Ga0209437_101965 3300025233 Bacteria 4257
535 Ga0209437_104672 3300025233 Bacteria 2387
536 Ga0209258_100003 3300025242 Bacteria 1467504
537 Ga0209258_100004 3300025242 Bacteria 1376422
538 Ga0209258_100008 3300025242 Bacteria 1009355
539 Ga0209258_100136 3300025242 Bacteria 169078
540 Ga0209258_101400 3300025242 Bacteria 8612
541 Ga0209258_110007 3300025242 Bacteria 1248
542 Ga0209646_1000863 3300025246 Bacteria 10119
543 Ga0209646_1012353 3300025246 Bacteria 1311
544 Ga0209026_1000045 3300025250 Bacteria 263431
545 Ga0209026_1000072 3300025250 Bacteria 205447
546 Ga0209026_1000129 3300025250 Bacteria 121927
547 Ga0209026_1000153 3300025250 Bacteria 109259
548 Ga0209026_1000442 3300025250 Bacteria 33393
549 Ga0209026_1016918 3300025250 Bacteria 1173
550 Ga0209026_1021965 3300025250 Bacteria 981
551 Ga0209677_100348 3300025253 Bacteria 28879
552 Ga0209148_1000025 3300025254 Bacteria 663262
553 Ga0209148_1000036 3300025254 Bacteria 530505
554 Ga0209148_1000053 3300025254 Bacteria 373506
555 Ga0209148_1000791 3300025254 Bacteria 23435
556 Ga0209759_1000140 3300025256 Bacteria 124850
557 Ga0209759_1000831 3300025256 Bacteria 24394
558 Ga0209759_1002615 3300025256 Bacteria 7765
559 Ga0209759_1003821 3300025256 Bacteria 5846
560 Ga0209129_1000604 3300025258 Bacteria 24333
561 Ga0209129_1002103 3300025258 Bacteria 10163
562 Ga0209233_1000040 3300025261 Bacteria 530395
563 Ga0209233_1000075 3300025261 Bacteria 356837
564 Ga0209233_1000077 3300025261 Bacteria 349570
565 Ga0209233_1000096 3300025261 Bacteria 303482
566 Ga0209233_1003582 3300025261 Bacteria 5450
567 Ga0209233_1028224 3300025261 Bacteria 1349
568 Ga0209455_1000004 3300025272 Bacteria 1467504
569 Ga0209455_1000007 3300025272 Bacteria 1157983
570 Ga0209455_1000071 3300025272 Bacteria 300858
571 Ga0209455_1000215 3300025272 Bacteria 81196
572 Ga0209455_1013624 3300025272 Bacteria 1878
573 Ga0209673_1003811 3300025273 Bacteria 8549
574 Ga0209130_1007509 3300025284 Bacteria 3353
575 Ga0209675_1014295 3300025291 Bacteria 2423
576 Ga0209675_1017692 3300025291 Bacteria 2026
577 Ga0209676_1001264 3300025292 Bacteria 26303
578 Ga0209676_1002621 3300025292 Bacteria 12291
579 Ga0209676_1007907 3300025292 Bacteria 4874
580 Ga0209676_1008848 3300025292 Bacteria 4429
581 Ga0209676_1036126 3300025292 Bacteria 1441
582 Ga0209025_1001373 3300025294 Bacteria 32662
583 Ga0209025_1034165 3300025294 Bacteria 2330
584 Ga0209025_1050506 3300025294 Bacteria 1662
585 Ga0209025_1053805 3300025294 Bacteria 1575
586 Ga0209025_1055046 3300025294 Bacteria 1542
587 Ga0209564_1009685 3300025295 Bacteria 4544
588 Ga0209758_1000481 3300025297 Bacteria 65650
589 Ga0209758_1058569 3300025297 Bacteria 1287
590 Ga0209758_1061354 3300025297 Bacteria 1239
591 Ga0209050_1001626 3300025298 Bacteria 23042
592 Ga0209256_1001873 3300025299 Bacteria 19411
593 Ga0209256_1002659 3300025299 Bacteria 14029
594 Ga0209256_1010555 3300025299 Bacteria 3844
595 Ga0209256_1011879 3300025299 Bacteria 3418
596 Ga0209051_1005661 3300025303 Bacteria 7227
597 Ga0209257_1000274 3300025304 Bacteria 117076
598 Ga0209257_1000307 3300025304 Bacteria 105179
599 Ga0209257_1002641 3300025304 Bacteria 17251
600 Ga0209257_1007987 3300025304 Bacteria 6183
601 Ga0207656_10004823 3300025321 Bacteria 4734
602 Ga0207656_10411102 3300025321 Bacteria 681
603 Ga0207692_10191756 3300025898 Bacteria 1196
604 Ga0207710_10028650 3300025900 Bacteria 2418
605 Ga0207680_10000002 3300025903 Bacteria 1018646
606 Ga0207680_10000092 3300025903 Bacteria 41687
607 Ga0207680_10034939 3300025903 Bacteria 2880
608 Ga0207680_10037462 3300025903 Bacteria 2800
609 Ga0207680_10095683 3300025903 Bacteria 1898
610 Ga0207647_10000010 3300025904 Bacteria 174219
611 Ga0207647_10000066 3300025904 Bacteria 81782
612 Ga0207647_10004970 3300025904 Bacteria 9802
613 Ga0207647_10006265 3300025904 Bacteria 8664
614 Ga0207647_10010431 3300025904 Bacteria 6563
615 Ga0207647_10012093 3300025904 Bacteria 6023
616 Ga0207685_10072312 3300025905 Bacteria 1401
617 Ga0207699_10505620 3300025906 Bacteria 873
618 Ga0207645_10043108 3300025907 Bacteria 2887
619 Ga0207645_10096932 3300025907 Bacteria 1900
620 Ga0207643_10008509 3300025908 Bacteria 5503
621 Ga0207705_10001094 3300025909 Bacteria 22061
622 Ga0207705_10035118 3300025909 Bacteria 3586
623 Ga0207705_10039069 3300025909 Bacteria 3401
624 Ga0207705_10238245 3300025909 Bacteria 1385
625 Ga0207705_10303490 3300025909 Bacteria 1225
626 Ga0207654_10001128 3300025911 Bacteria 14430
627 Ga0207654_10181410 3300025911 Bacteria 1374
628 Ga0207654_10229994 3300025911 Bacteria 1234
629 Ga0207654_10733376 3300025911 Bacteria 711
630 Ga0207654_10766565 3300025911 Bacteria 696
631 Ga0207707_10010148 3300025912 Bacteria 8173
632 Ga0207707_10057230 3300025912 Bacteria 3394
633 Ga0207707_10129717 3300025912 Bacteria 2205
634 Ga0207707_10292260 3300025912 Bacteria 1410
635 Ga0207707_10296316 3300025912 Bacteria 1399
636 Ga0207695_10000014 3300025913 Bacteria 812599
637 Ga0207695_10000322 3300025913 Bacteria 114700
638 Ga0207695_10000809 3300025913 Bacteria 58219
639 Ga0207695_10000856 3300025913 Bacteria 55795
640 Ga0207695_10005750 3300025913 Bacteria 16327
641 Ga0207695_10006442 3300025913 Bacteria 15244
642 Ga0207695_10008494 3300025913 Bacteria 12841
643 Ga0207695_10032475 3300025913 Bacteria 5711
644 Ga0207695_10046519 3300025913 Bacteria 4599
645 Ga0207695_10069276 3300025913 Bacteria 3610
646 Ga0207695_10366560 3300025913 Bacteria 1327
647 Ga0207695_11306862 3300025913 Bacteria 606
648 Ga0207671_10000028 3300025914 Bacteria 263092
649 Ga0207671_10000357 3300025914 Bacteria 65092
650 Ga0207671_10001588 3300025914 Bacteria 25826
651 Ga0207671_10004399 3300025914 Bacteria 13503
652 Ga0207671_10318069 3300025914 Bacteria 1231
653 Ga0207671_10458907 3300025914 Bacteria 1015
654 Ga0207663_10264346 3300025916 Bacteria 1272
655 Ga0207663_10308392 3300025916 Bacteria 1185
656 Ga0207660_10097251 3300025917 Bacteria 2193
657 Ga0207660_10263573 3300025917 Bacteria 1363
658 Ga0207660_10390745 3300025917 Bacteria 1119
659 Ga0207657_10009521 3300025919 Bacteria 9756
660 Ga0207657_10011833 3300025919 Bacteria 8637
661 Ga0207657_10042168 3300025919 Bacteria 4028
662 Ga0207657_10335228 3300025919 Bacteria 1194
663 Ga0207657_10861449 3300025919 Bacteria 699
664 Ga0207649_10002084 3300025920 Bacteria 11361
665 Ga0207649_10032583 3300025920 Bacteria 3108
666 Ga0207649_10033209 3300025920 Bacteria 3081
667 Ga0207649_10197571 3300025920 Bacteria 1418
668 Ga0207649_10424825 3300025920 Bacteria 999
669 Ga0207652_10165752 3300025921 Bacteria 1981
670 Ga0207652_10218605 3300025921 Bacteria 1717
671 Ga0207652_10297561 3300025921 Bacteria 1456
672 Ga0207652_10342189 3300025921 Bacteria 1350
673 Ga0207681_10001858 3300025923 Bacteria 13543
674 Ga0207681_10007276 3300025923 Bacteria 6785
675 Ga0207681_10033681 3300025923 Bacteria 3361
676 Ga0207681_10503930 3300025923 Bacteria 991
677 Ga0207694_10000109 3300025924 Bacteria 86216
678 Ga0207694_10000850 3300025924 Bacteria 27165
679 Ga0207694_10001341 3300025924 Bacteria 21199
680 Ga0207694_10097782 3300025924 Bacteria 2323
681 Ga0207694_10140943 3300025924 Bacteria 1938
682 Ga0207694_10185078 3300025924 Bacteria 1690
683 Ga0207694_10269754 3300025924 Bacteria 1396
684 Ga0207650_10021916 3300025925 Bacteria 4521
685 Ga0207650_10229804 3300025925 Bacteria 1496
686 Ga0207659_10373732 3300025926 Bacteria 1187
687 Ga0207687_10344965 3300025927 Bacteria 1212
688 Ga0207687_10554219 3300025927 Bacteria 965
689 Ga0207687_11142225 3300025927 Bacteria 669
690 Ga0207664_10000553 3300025929 Bacteria 26494
691 Ga0207664_10000624 3300025929 Bacteria 24530
692 Ga0207644_10166416 3300025931 Bacteria 1718
693 Ga0207644_10174658 3300025931 Bacteria 1680
694 Ga0207644_10556744 3300025931 Bacteria 949
695 Ga0207690_10000061 3300025932 Bacteria 98910
696 Ga0207690_10000375 3300025932 Bacteria 29631
697 Ga0207690_10006084 3300025932 Bacteria 7149
698 Ga0207690_10030475 3300025932 Bacteria 3441
699 Ga0207690_10145847 3300025932 Bacteria 1750
700 Ga0207706_10042475 3300025933 Bacteria 4029
701 Ga0207706_10049684 3300025933 Bacteria 3706
702 Ga0207686_10003423 3300025934 Bacteria 8519
703 Ga0207709_10005775 3300025935 Bacteria 6992
704 Ga0207670_10001621 3300025936 Bacteria 11738
705 Ga0207670_10446551 3300025936 Bacteria 1042
706 Ga0207670_10758146 3300025936 Bacteria 806
707 Ga0207704_10010792 3300025938 Bacteria 4471
708 Ga0207704_10032219 3300025938 Bacteria 2964
709 Ga0207704_10069820 3300025938 Bacteria 2222
710 Ga0207704_10078000 3300025938 Bacteria 2129
711 Ga0207704_10090427 3300025938 Bacteria 2009
712 Ga0207691_10007374 3300025940 Bacteria 10598
713 Ga0207691_10028648 3300025940 Bacteria 5213
714 Ga0207691_10082771 3300025940 Bacteria 2882
715 Ga0207691_10166529 3300025940 Bacteria 1931
716 Ga0207711_10002283 3300025941 Bacteria 17214
717 Ga0207711_10160406 3300025941 Bacteria 2035
718 Ga0207711_10226669 3300025941 Bacteria 1711
719 Ga0207711_10438985 3300025941 Bacteria 1215
720 Ga0207711_10896166 3300025941 Bacteria 825
721 Ga0207689_10070324 3300025942 Bacteria 2875
722 Ga0207689_10237908 3300025942 Bacteria 1505
723 Ga0207689_10322233 3300025942 Bacteria 1283
724 Ga0207689_10453363 3300025942 Bacteria 1072
725 Ga0207661_10258427 3300025944 Bacteria 1550
726 Ga0207667_10000080 3300025949 Bacteria 163287
727 Ga0207667_10000344 3300025949 Bacteria 63681
728 Ga0207667_10056069 3300025949 Bacteria 4140
729 Ga0207667_10092352 3300025949 Bacteria 3126
730 Ga0207667_10092784 3300025949 Bacteria 3118
731 Ga0207667_10186083 3300025949 Bacteria 2132
732 Ga0207667_10206622 3300025949 Bacteria 2013
733 Ga0207667_10599640 3300025949 Bacteria 1111
734 Ga0207667_11040940 3300025949 Bacteria 804
735 Ga0207667_11463710 3300025949 Bacteria 655
736 Ga0207651_10183658 3300025960 Bacteria 1662
737 Ga0207651_10392254 3300025960 Bacteria 1179
738 Ga0207712_10001195 3300025961 Bacteria 17947
739 Ga0207712_10001216 3300025961 Bacteria 17755
740 Ga0207712_10559312 3300025961 Bacteria 985
741 Ga0207668_10011602 3300025972 Bacteria 5360
742 Ga0207668_10166366 3300025972 Bacteria 1724
743 Ga0207668_10203353 3300025972 Bacteria 1579
744 Ga0207668_10254721 3300025972 Bacteria 1427
745 Ga0207668_10359841 3300025972 Bacteria 1219
746 Ga0207640_10000190 3300025981 Bacteria 43737
747 Ga0207640_10001549 3300025981 Bacteria 12373
748 Ga0207640_10003414 3300025981 Bacteria 8553
749 Ga0207640_10009903 3300025981 Bacteria 5350
750 Ga0207640_10016638 3300025981 Bacteria 4283
751 Ga0207640_10163223 3300025981 Bacteria 1651
752 Ga0207640_10241418 3300025981 Bacteria 1396
753 Ga0207658_10000013 3300025986 Bacteria 220396
754 Ga0207658_10029268 3300025986 Bacteria 3888
755 Ga0207658_10118548 3300025986 Bacteria 2106
756 Ga0207658_10193319 3300025986 Bacteria 1693
757 Ga0207658_10329933 3300025986 Bacteria 1323
758 Ga0207658_10667254 3300025986 Bacteria 938
759 Ga0207658_10891040 3300025986 Bacteria 810
760 Ga0207658_10892344 3300025986 Bacteria 809
761 Ga0207677_10086112 3300026023 Bacteria 2270
762 Ga0207677_10106765 3300026023 Bacteria 2075
763 Ga0207703_10000793 3300026035 Bacteria 31116
764 Ga0207703_10269178 3300026035 Bacteria 1543
765 Ga0207703_10395672 3300026035 Bacteria 1281
766 Ga0207703_10397394 3300026035 Bacteria 1278
767 Ga0207639_10000479 3300026041 Bacteria 27677
768 Ga0207639_10000595 3300026041 Bacteria 24859
769 Ga0207639_10004215 3300026041 Bacteria 9688
770 Ga0207639_10035499 3300026041 Bacteria 3690
771 Ga0207639_10082054 3300026041 Bacteria 2555
772 Ga0207639_10210802 3300026041 Bacteria 1672
773 Ga0207639_10255015 3300026041 Bacteria 1531
774 Ga0207639_10302611 3300026041 Bacteria 1414
775 Ga0207639_10366920 3300026041 Bacteria 1290
776 Ga0207639_10479588 3300026041 Bacteria 1133
777 Ga0207639_10504114 3300026041 Bacteria 1106
778 Ga0207639_10713675 3300026041 Bacteria 931
779 Ga0207639_11203159 3300026041 Bacteria 711
780 Ga0207678_10000035 3300026067 Bacteria 104807
781 Ga0207678_10012465 3300026067 Bacteria 7465
782 Ga0207678_10016540 3300026067 Bacteria 6478
783 Ga0207678_10055104 3300026067 Bacteria 3425
784 Ga0207678_10208614 3300026067 Bacteria 1671
785 Ga0207678_10702636 3300026067 Bacteria 890
786 Ga0207708_10303999 3300026075 Bacteria 1298
787 Ga0207702_10000049 3300026078 Bacteria 140303
788 Ga0207702_10000380 3300026078 Bacteria 50635
789 Ga0207702_10010670 3300026078 Bacteria 7676
790 Ga0207702_10011899 3300026078 Bacteria 7241
791 Ga0207702_10197901 3300026078 Bacteria 1861
792 Ga0207702_10722423 3300026078 Bacteria 982
793 Ga0207702_10821687 3300026078 Bacteria 919
794 Ga0207641_10006513 3300026088 Bacteria 9828
795 Ga0207641_10025673 3300026088 Bacteria 4857
796 Ga0207641_10162028 3300026088 Bacteria 2034
797 Ga0207641_10278074 3300026088 Bacteria 1573
798 Ga0207641_10415131 3300026088 Bacteria 1295
799 Ga0207648_10011901 3300026089 Bacteria 8174
800 Ga0207648_10076457 3300026089 Bacteria 2918
801 Ga0207648_10873773 3300026089 Bacteria 839
802 Ga0207676_10009897 3300026095 Bacteria 6783
803 Ga0207676_10188024 3300026095 Bacteria 1815
804 Ga0207676_10200669 3300026095 Bacteria 1762
805 Ga0207676_10562303 3300026095 Bacteria 1091
806 Ga0207674_10000090 3300026116 Bacteria 99821
807 Ga0207674_10005138 3300026116 Bacteria 15610
808 Ga0207674_10082164 3300026116 Bacteria 3223
809 Ga0207674_10089465 3300026116 Bacteria 3071
810 Ga0207674_10217853 3300026116 Bacteria 1857
811 Ga0207675_100022876 3300026118 Bacteria 5814
812 Ga0207675_100368478 3300026118 Bacteria 1411
813 Ga0207675_100722810 3300026118 Bacteria 1006
814 Ga0207683_10015518 3300026121 Bacteria 6486
815 Ga0207683_10114431 3300026121 Bacteria 2417
816 Ga0207683_10125025 3300026121 Bacteria 2311
817 Ga0207683_10221619 3300026121 Bacteria 1723
818 Ga0207698_10000982 3300026142 Bacteria 16584
819 Ga0207698_10007692 3300026142 Bacteria 6759
820 Ga0207698_10018109 3300026142 Bacteria 4793
821 Ga0207698_10130712 3300026142 Bacteria 2145
822 Ga0207698_10380200 3300026142 Bacteria 1343
823 Ga0207698_10444189 3300026142 Bacteria 1250
824 Ga0207698_10583094 3300026142 Bacteria 1100
825 Ga0207698_10798323 3300026142 Bacteria 946
826 Ga0209973_1003226 3300027252 Bacteria 1589
827 Ga0209371_1000048 3300027312 Bacteria 281705
828 Ga0209984_1001727 3300027424 Bacteria 2391
829 Ga0209999_1000442 3300027543 Bacteria 6380
830 Ga0209982_1001040 3300027552 Bacteria 3693
831 Ga0209970_1008325 3300027614 Bacteria 1702
832 Ga0209971_1001367 3300027682 Bacteria 6057
833 Ga0209974_10001896 3300027876 Bacteria 7638
834 Ga0209974_10006797 3300027876 Bacteria 3971
835 Ga0268266_10000001 3300028379 Bacteria 4040580
836 Ga0268266_10000008 3300028379 Bacteria 1161875
837 Ga0268266_10012196 3300028379 Bacteria 7438
838 Ga0268266_10105549 3300028379 Bacteria 2489
839 Ga0268266_10416320 3300028379 Bacteria 1273
840 Ga0268265_10096396 3300028380 Bacteria 2377
841 Ga0268264_10012879 3300028381 Bacteria 6880
842 Ga0268264_10013020 3300028381 Bacteria 6837
843 Ga0268264_10172359 3300028381 Bacteria 1958
844 Ga0268264_10596859 3300028381 Bacteria 1088
845 Ga0307517_10145217 3300028786 Bacteria 1649
846 Ga0265338_10483232 3300028800 Bacteria 874
847 Ga0268256_1000049 3300030500 Bacteria 307229
848 Ga0316177_1156649 3300030731 Bacteria 6363
849 Ga0316182_1026731 3300030745 Bacteria 5630
850 Ga0307408_100079013 3300031548 Bacteria 2454
851 Ga0307408_100092241 3300031548 Bacteria 2289
852 Ga0307408_100161570 3300031548 Bacteria 1780
853 Ga0307408_100300972 3300031548 Bacteria 1343
854 Ga0307408_100798105 3300031548 Bacteria 856
855 Ga0307508_10030073 3300031616 Bacteria 4908
856 Ga0307508_10203007 3300031616 Bacteria 1583
857 Ga0316575_10076918 3300031665 Bacteria 1344
858 Ga0316576_10265740 3300031727 Bacteria 1287
859 Ga0307516_10216777 3300031730 Bacteria 1625
860 Ga0307405_10204962 3300031731 Bacteria 1435
861 Ga0307413_10005298 3300031824 Bacteria 5737
862 Ga0307413_10036935 3300031824 Bacteria 2817
863 Ga0307413_10124312 3300031824 Bacteria 1753
864 Ga0307413_10301187 3300031824 Bacteria 1216
865 Ga0307413_10776646 3300031824 Bacteria 803
866 Ga0307410_10151037 3300031852 Bacteria 1729
867 Ga0307410_10431738 3300031852 Bacteria 1071
868 Ga0307410_10489988 3300031852 Bacteria 1010
869 Ga0307406_10285424 3300031901 Bacteria 1261
870 Ga0307407_10010967 3300031903 Bacteria 4294
871 Ga0307412_10031558 3300031911 Bacteria 3347
872 Ga0307412_10042740 3300031911 Bacteria 2947
873 Ga0307412_10107047 3300031911 Bacteria 1989
874 Ga0307412_10504300 3300031911 Bacteria 1008
875 Ga0307412_10905455 3300031911 Bacteria 773
876 Ga0307409_101348517 3300031995 Bacteria 739
877 Ga0307416_100243197 3300032002 Bacteria 1745
878 Ga0307416_100337613 3300032002 Bacteria 1518
879 Ga0307416_100600800 3300032002 Bacteria 1180
880 Ga0307414_10040312 3300032004 Bacteria 3153
881 Ga0307414_10067056 3300032004 Bacteria 2568
882 Ga0307414_10113207 3300032004 Bacteria 2070
883 Ga0307414_10138684 3300032004 Bacteria 1900
884 Ga0307414_10179116 3300032004 Bacteria 1703
885 Ga0307414_10292186 3300032004 Bacteria 1374
886 Ga0307414_10406811 3300032004 Bacteria 1183
887 Ga0307414_10457216 3300032004 Bacteria 1121
888 Ga0307414_10522699 3300032004 Bacteria 1053
889 Ga0307411_10013448 3300032005 Bacteria 4516
890 Ga0307411_10084979 3300032005 Bacteria 2190
891 Ga0307411_10333992 3300032005 Bacteria 1229
892 Ga0307411_10460650 3300032005 Bacteria 1066
893 Ga0307411_10476638 3300032005 Bacteria 1050
894 Ga0307411_10834155 3300032005 Bacteria 814
895 Ga0307415_100796717 3300032126 Bacteria 862
896 Ga0307507_10032693 3300033179 Bacteria 5424
897 Ga0307510_10132276 3300033180 Bacteria 2163
898 Ga0373959_0023707 3300034820 Bacteria 1195
899 Ga0373944_0103121 3300035089 Bacteria 966
900 Ga0373936_0155331 3300035113 Bacteria 994
901 Ga0373954_0261813 3300035118 Bacteria 852
902 Ga0373957_0116767 3300035120 Bacteria 1078
903 Ga0373947_0456849 3300035725 Bacteria 865
904 Ga0373937_0422145 3300036401 Bacteria 1266
905 Ga0373937_0855561 3300036401 Bacteria 858
906 Ga0395899_0001125 3300037312 Bacteria 23866
907 Ga0395899_0029586 3300037312 Bacteria 4120
908 Ga0395899_0082043 3300037312 Bacteria 2345
909 Ga0395899_0178593 3300037312 Bacteria 1491
910 Ga0395899_0206202 3300037312 Bacteria 1368
911 Ga0395899_0287868 3300037312 Bacteria 1115
912 Ga0395899_0457805 3300037312 Bacteria 834
913 Ga0395900_0001304 3300037418 Bacteria 30351
914 Ga0395900_0004445 3300037418 Bacteria 14854
915 Ga0395900_0024057 3300037418 Bacteria 6233
916 Ga0395900_0032548 3300037418 Bacteria 5361
917 Ga0395900_0046052 3300037418 Bacteria 4491
918 Ga0395900_0050386 3300037418 Bacteria 4289
919 Ga0395900_0066734 3300037418 Bacteria 3697
920 Ga0395900_0713229 3300037418 Bacteria 936
921 Ga0395900_1152336 3300037418 Bacteria 691
922 Ga0395898_0001583 3300037466 Bacteria 31093
923 Ga0395898_0002066 3300037466 Bacteria 25003
924 Ga0395898_0002627 3300037466 Bacteria 20893
925 Ga0395898_0002725 3300037466 Bacteria 20379
926 Ga0395898_0013479 3300037466 Bacteria 8416
927 Ga0395898_0036705 3300037466 Bacteria 4865
928 Ga0395898_0114789 3300037466 Bacteria 2580
929 Ga0395898_0136496 3300037466 Bacteria 2349
930 Ga0395898_0317809 3300037466 Bacteria 1485
931 Ga0436364_0095944 3300037853 Bacteria 1339
932 Ga0395901_0000259 3300038443 Bacteria 66203
933 Ga0395901_0001429 3300038443 Bacteria 24902
934 Ga0395901_0049227 3300038443 Bacteria 4378
935 Ga0395901_0053602 3300038443 Bacteria 4190
936 Ga0395901_0061507 3300038443 Bacteria 3907
937 Ga0395901_0063473 3300038443 Bacteria 3844
938 Ga0395901_0220090 3300038443 Bacteria 1984
939 Ga0395901_0244857 3300038443 Bacteria 1869
940 Ga0395901_0324327 3300038443 Bacteria 1593
941 Ga0395901_0530985 3300038443 Bacteria 1194
942 Ga0237819_00140 3300038705 Bacteria 27368
943 Ga0400488_38144 3300038741 Unclassified 1235
944 Ga0400486_30133 3300038742 Bacteria 4675
945 Ga0436365_0119571 3300039437 Bacteria 638
946 Ga0436365_0324168 3300039437 Bacteria 3849
947 Ga0436363_0359992 3300039450 Bacteria 2727
948 Ga0436362_0657356 3300039453 Bacteria 1590
949 Ga0439436_0003731 3300041404 Bacteria 4651
950 Ga0439436_0049721 3300041404 Bacteria 1188
951 Ga0439436_0062325 3300041404 Bacteria 1043
952 Ga0439447_001069 3300041407 Bacteria 9935
953 Ga0439465_0000006 3300041413 Bacteria 54247
954 Ga0439465_0004178 3300041413 Bacteria 4697
955 Ga0451789_0416833 3300041443 Bacteria 1156
956 Ga0451793_1086667 3300041452 Bacteria 3180
957 Ga0451797_0190827 3300041453 Bacteria 1333
958 Ga0451795_0046765 3300041456 Bacteria 1080
959 Ga0451800_1451396 3300041459 Bacteria 1082
960 Ga0451802_0727430 3300041460 Bacteria 761
961 Ga0451806_127485 3300041462 Bacteria 616
962 Ga0451807_0483911 3300041486 Bacteria 980
963 Ga0451835_0771462 3300041492 Bacteria 597
964 Ga0451837_1048697 3300041494 Bacteria 892
965 Ga0451837_1628237 3300041494 Bacteria 2570
966 Ga0451839_0794977 3300041496 Bacteria 966
967 Ga0451849_0604301 3300041505 Bacteria 689
968 Ga0451843_1708573 3300041509 Bacteria 733
969 Ga0451853_1416507 3300041512 Bacteria 660
970 Ga0451853_1645120 3300041512 Bacteria 1005
971 Ga0451853_3750318 3300041512 Bacteria 783
972 Ga0439431_0002900 3300041997 Bacteria 3774
973 Ga0439433_0037525 3300041999 Bacteria 1122
974 Ga0439445_0000142 3300042004 Bacteria 12656
975 Ga0439448_0102780 3300042005 Bacteria 972
976 Ga0439432_065208 3300042006 Bacteria 1117
977 Ga0439432_108552 3300042006 Bacteria 827
978 Ga0439449_0020297 3300042007 Bacteria 2490
979 Ga0439449_0127096 3300042007 Bacteria 947
980 Ga0439452_004747 3300042010 Bacteria 4496
981 Ga0439459_0002300 3300042438 Bacteria 2931
982 Ga0439459_0002709 3300042438 Bacteria 2755
983 Ga0451577_0000425 3300042876 Bacteria 75871
984 Ga0451577_0008483 3300042876 Bacteria 10003
985 Ga0466969_0015351 3300044656 Bacteria 4014
986 Ga0466969_0030228 3300044656 Bacteria 2761
987 Ga0466972_0000647 3300044658 Bacteria 16793
988 Ga0466972_0001847 3300044658 Bacteria 10373
989 Ga0466972_0002963 3300044658 Bacteria 8405
990 Ga0466982_0000007 3300044672 Bacteria 250854
991 Ga0466982_0000029 3300044672 Bacteria 60348
992 Ga0466965_0000764 3300044683 Bacteria 12107
993 Ga0466965_0002141 3300044683 Bacteria 8293
994 Ga0466965_0007999 3300044683 Bacteria 4878
995 Ga0466965_0032814 3300044683 Bacteria 2536
996 Ga0466965_0104626 3300044683 Bacteria 1450
997 Ga0466966_0000343 3300044684 Bacteria 30095
998 Ga0466966_0001588 3300044684 Bacteria 14607
999 Ga0466961_0000199 3300044693 Bacteria 40467
1000 Ga0466961_0002917 3300044693 Bacteria 10619
1001 Ga0466961_0096135 3300044693 Bacteria 1868
1002 Ga0466961_0282415 3300044693 Bacteria 1016
1003 Ga0466961_0586090 3300044693 Bacteria 671
1004 Ga0466964_0000680 3300044706 Bacteria 10952
1005 Ga0453684_0025105 3300044712 Bacteria 8669
1006 Ga0466971_0004638 3300044719 Bacteria 5938
1007 Ga0466968_0019341 3300044735 Bacteria 2742
1008 Ga0466970_0000132 3300044765 Bacteria 34193
1009 Ga0466970_0000260 3300044765 Bacteria 25913
1010 Ga0466970_0058767 3300044765 Bacteria 2058
1011 Ga0466970_0076519 3300044765 Bacteria 1803
1012 Ga0466957_0001273 3300044842 Bacteria 13130
1013 Ga0466957_0030641 3300044842 Bacteria 3212
1014 Ga0466960_0106077 3300044901 Bacteria 1453
1015 Ga0466959_0000293 3300045049 Bacteria 29880
1016 Ga0466959_0058398 3300045049 Bacteria 2810
1017 Ga0466959_0227903 3300045049 Bacteria 1290
1018 Ga0466958_0003516 3300045836 Bacteria 8143
1019 Ga0466967_0409936 3300045976 Bacteria 1320
1020 Ga0495617_000122 3300046452 Bacteria 51915
1021 Ga0495617_000504 3300046452 Bacteria 20437
1022 Ga0495590_0181138 3300046457 Bacteria 770
1023 Ga0495629_0240917 3300046459 Bacteria 1245
1024 Ga0495638_0000106 3300046460 Bacteria 133921
1025 Ga0495638_0000237 3300046460 Bacteria 75347
1026 Ga0495638_0000479 3300046460 Bacteria 47958
1027 Ga0495641_0134174 3300046461 Bacteria 1105
1028 Ga0495650_0000074 3300046471 Bacteria 251346
1029 Ga0495650_0000134 3300046471 Bacteria 173331
1030 Ga0495580_0237075 3300046472 Bacteria 1251
1031 Ga0495582_0033576 3300046473 Bacteria 2821
1032 Ga0495639_0064198 3300046475 Bacteria 1687
1033 Ga0495584_0001870 3300046491 Bacteria 12175
1034 Ga0495594_0189023 3300046499 Bacteria 1173
1035 Ga0495607_0000042 3300046501 Bacteria 130434
1036 Ga0495607_0004080 3300046501 Bacteria 10918
1037 Ga0495583_0000833 3300046506 Bacteria 37749
1038 Ga0495583_0003138 3300046506 Bacteria 13041
1039 Ga0495583_0008323 3300046506 Bacteria 6359
1040 Ga0495606_0000562 3300046507 Bacteria 59044
1041 Ga0495606_0001636 3300046507 Bacteria 29195
1042 Ga0495606_0008349 3300046507 Bacteria 9018
1043 Ga0495606_0015682 3300046507 Bacteria 5822
1044 Ga0495610_0000711 3300046512 Bacteria 31740
1045 Ga0495616_0000617 3300046513 Bacteria 26769
1046 Ga0495616_0003053 3300046513 Bacteria 10846
1047 Ga0495620_0000182 3300046515 Bacteria 48877
1048 Ga0495620_0000216 3300046515 Bacteria 43506
1049 Ga0495620_0027243 3300046515 Bacteria 2677
1050 Ga0495630_0161208 3300046517 Bacteria 1708
1051 Ga0495632_0000241 3300046519 Bacteria 54558
1052 Ga0495637_0014597 3300046520 Bacteria 3703
1053 Ga0495648_0001366 3300046524 Bacteria 24119
1054 Ga0495663_0051406 3300046525 Bacteria 1277
1055 Ga0495663_0122884 3300046525 Bacteria 870
1056 Ga0495587_0708173 3300046536 Bacteria 552
1057 Ga0495609_0030336 3300046538 Bacteria 2461
1058 Ga0495622_0106668 3300046557 Bacteria 1283
1059 Ga0495656_0000847 3300046615 Bacteria 9876
1060 Ga0495656_0121006 3300046615 Bacteria 1235
1061 Ga0495668_0000411 3300046616 Bacteria 55902
1062 Ga0495611_0000004 3300046648 Bacteria 308149
1063 Ga0495611_0000023 3300046648 Bacteria 120553
1064 Ga0495611_0002701 3300046648 Bacteria 7998
1065 Ga0495625_0000024 3300046660 Bacteria 271126
1066 Ga0495625_0001652 3300046660 Bacteria 26150
1067 Ga0495625_0018885 3300046660 Bacteria 5368
1068 Ga0495625_0047054 3300046660 Bacteria 3111
1069 Ga0495625_0057783 3300046660 Bacteria 2757
1070 Ga0495625_0160641 3300046660 Bacteria 1505
1071 Ga0495625_0382372 3300046660 Bacteria 883
1072 Ga0495588_0071922 3300046674 Bacteria 1799
1073 Ga0495588_0153472 3300046674 Bacteria 1217
1074 Ga0495657_0095923 3300046675 Bacteria 1895
1075 Ga0495599_0389719 3300046678 Bacteria 831
1076 Ga0495647_0032678 3300046681 Bacteria 1941
1077 Ga0495613_0656007 3300046689 Bacteria 694
1078 Ga0495670_0009105 3300046691 Bacteria 4882
1079 Ga0495670_0129075 3300046691 Bacteria 1317
1080 Ga0495671_0000390 3300046692 Bacteria 36237
1081 Ga0495649_0000687 3300046694 Bacteria 27564
1082 Ga0495589_0000038 3300046794 Bacteria 149381
1083 Ga0495589_0000547 3300046794 Bacteria 26112
1084 Ga0495600_0117039 3300046809 Bacteria 1735
1085 Ga0495660_0000321 3300046810 Bacteria 42518
1086 Ga0495636_0003246 3300047318 Bacteria 6308
1087 Ga0495636_0006414 3300047318 Bacteria 4622
1088 Ga0495636_0086670 3300047318 Bacteria 1354
1089 Ga0495672_0000544 3300047320 Bacteria 42844
1090 Ga0495679_000011 3300047446 Bacteria 324498
1091 Ga0495673_0000616 3300047469 Bacteria 35177
1092 Ga0495681_0015144 3300047470 Bacteria 4375
1093 Ga0495684_0168776 3300047471 Bacteria 1629
1094 Ga0495686_0000608 3300047472 Bacteria 49564
1095 Ga0495686_0010132 3300047472 Bacteria 6726
1096 Ga0495686_0010763 3300047472 Bacteria 6488
1097 Ga0495686_0061393 3300047472 Bacteria 2334
1098 Ga0495686_0071603 3300047472 Bacteria 2133
1099 Ga0495686_0127698 3300047472 Bacteria 1510
1100 Ga0495686_0250464 3300047472 Bacteria 995
1101 Ga0495602_0158386 3300048088 Bacteria 1771
1102 Ga0496100_0001740 3300048903 Bacteria 10855
1103 Ga0496100_0584488 3300048903 Bacteria 866
1104 Ga0496101_0012388 3300048904 Bacteria 5690
1105 Ga0496101_0073503 3300048904 Bacteria 2512
1106 Ga0496101_0132636 3300048904 Bacteria 1893
1107 Ga0496102_0082098 3300048905 Bacteria 2973
1108 Ga0496102_0583618 3300048905 Bacteria 1040
1109 Ga0496104_0000012 3300048907 Bacteria 438011
1110 Ga0496104_0338658 3300048907 Bacteria 1417
1111 Ga0496105_0000011 3300048908 Bacteria 302186
1112 Ga0496106_0175573 3300048909 Bacteria 1699
1113 Ga0496107_0035157 3300048910 Bacteria 3592
1114 Ga0496107_0094425 3300048910 Bacteria 2188
1115 Ga0496107_0378835 3300048910 Bacteria 1052
1116 Ga0496108_0724804 3300048911 Bacteria 861
1117 Ga0496108_1175036 3300048911 Bacteria 650
1118 Ga0496110_0298806 3300048913 Bacteria 1466
1119 Ga0496112_0540649 3300048915 Bacteria 1099
1120 Ga0496113_0024417 3300048916 Bacteria 4297
1121 Ga0496113_0203915 3300048916 Bacteria 1572
1122 Ga0496113_1191232 3300048916 Bacteria 595
1123 Ga0496114_0001533 3300048917 Bacteria 17508
1124 Ga0496114_0006408 3300048917 Bacteria 9269
1125 Ga0496114_0172916 3300048917 Bacteria 1883
1126 Ga0496114_0208232 3300048917 Bacteria 1715
1127 Ga0496115_0000092 3300048918 Bacteria 83381
1128 Ga0496115_0000193 3300048918 Bacteria 56720
1129 Ga0496115_0000617 3300048918 Bacteria 27037
1130 Ga0496115_0004525 3300048918 Bacteria 10055
1131 Ga0496115_0031269 3300048918 Bacteria 4193
1132 Ga0496115_0145340 3300048918 Bacteria 1957
1133 Ga0496115_0221537 3300048918 Bacteria 1561
1134 Ga0496117_0004278 3300048920 Bacteria 15910
1135 Ga0496117_0005719 3300048920 Bacteria 12931
1136 Ga0496117_0009436 3300048920 Bacteria 9080
1137 Ga0496118_0000885 3300048921 Bacteria 47246
1138 Ga0496118_0001282 3300048921 Bacteria 38428
1139 Ga0496118_0001962 3300048921 Bacteria 29176
1140 Ga0496118_0002465 3300048921 Bacteria 24852
1141 Ga0496118_0004440 3300048921 Bacteria 16648
1142 Ga0496118_0012974 3300048921 Bacteria 7933
1143 Ga0496118_0241615 3300048921 Bacteria 1033
1144 Ga0496119_0041672 3300048922 Bacteria 2921
1145 Ga0496120_0107468 3300048923 Bacteria 1463
1146 Ga0496120_0117853 3300048923 Bacteria 1377
1147 Ga0496121_0000071 3300048924 Bacteria 247039
1148 Ga0496121_0000942 3300048924 Bacteria 52638
1149 Ga0496121_0001620 3300048924 Bacteria 37310
1150 Ga0496121_0001863 3300048924 Bacteria 33851
1151 Ga0496121_0001864 3300048924 Bacteria 33829
1152 Ga0496121_0001888 3300048924 Bacteria 33577
1153 Ga0496121_0002280 3300048924 Bacteria 29844
1154 Ga0496121_0006661 3300048924 Bacteria 14212
1155 Ga0496121_0016652 3300048924 Bacteria 7570
1156 Ga0496121_0037969 3300048924 Bacteria 4272
1157 Ga0496121_0142210 3300048924 Bacteria 1778
1158 Ga0496122_0000062 3300048925 Bacteria 241387
1159 Ga0496122_0016999 3300048925 Bacteria 6833
1160 Ga0496122_0018310 3300048925 Bacteria 6482
1161 Ga0496122_0048979 3300048925 Bacteria 3243
1162 Ga0496122_0066017 3300048925 Bacteria 2618
1163 Ga0496123_0004387 3300048926 Bacteria 14875
1164 Ga0496123_0009110 3300048926 Bacteria 8985
1165 Ga0496123_0012934 3300048926 Bacteria 7057
1166 Ga0496123_0013031 3300048926 Bacteria 7018
1167 Ga0496123_0075915 3300048926 Bacteria 2071
1168 Ga0496124_0000313 3300048927 Bacteria 89891
1169 Ga0496124_0000314 3300048927 Bacteria 89797
1170 Ga0496124_0007021 3300048927 Bacteria 12067
1171 Ga0496125_0000291 3300048928 Bacteria 98752
1172 Ga0496125_0024124 3300048928 Bacteria 5600
1173 Ga0496125_0060859 3300048928 Bacteria 3032
1174 Ga0496125_0349895 3300048928 Bacteria 883
1175 Ga0496126_0000160 3300048929 Bacteria 155144
1176 Ga0496126_0003733 3300048929 Bacteria 18974
1177 Ga0496126_0004079 3300048929 Bacteria 17716
1178 Ga0496126_0004964 3300048929 Bacteria 15517
1179 Ga0496126_0009232 3300048929 Bacteria 10514
1180 Ga0496126_0011982 3300048929 Bacteria 8913
1181 Ga0496126_0017284 3300048929 Bacteria 7188
1182 Ga0496126_0018434 3300048929 Bacteria 6914
1183 Ga0496126_0050363 3300048929 Bacteria 3796
1184 Ga0496126_0060206 3300048929 Bacteria 3416
1185 Ga0496126_0080523 3300048929 Bacteria 2882
1186 Ga0496126_0086649 3300048929 Bacteria 2760
1187 Ga0496126_1012005 3300048929 Bacteria 623
1188 Ga0495678_000062 3300049459 Bacteria 140706
1189 Ga0495678_025362 3300049459 Bacteria 2547
1190 Ga0495682_0000283 3300049460 Bacteria 39664
1191 Ga0495682_0000341 3300049460 Bacteria 34546
1192 Ga0495682_0000372 3300049460 Bacteria 32548
1193 Ga0495682_0013547 3300049460 Bacteria 3102
1194 Ga0501031_0002957 3300049568 Bacteria 10872
1195 Ga0501031_0016767 3300049568 Bacteria 4758
1196 Ga0501031_0047333 3300049568 Bacteria 2804
1197 Ga0501031_0076103 3300049568 Bacteria 2185
1198 Ga0501031_0117963 3300049568 Bacteria 1734
1199 Ga0501031_0207521 3300049568 Bacteria 1277
1200 Ga0501031_0357314 3300049568 Bacteria 945
1201 Ga0501032_0000485 3300049569 Bacteria 32254
1202 Ga0501032_0004538 3300049569 Bacteria 10445
1203 Ga0501032_0007187 3300049569 Bacteria 8145
1204 Ga0501032_0042745 3300049569 Bacteria 3073
1205 Ga0501032_0100806 3300049569 Bacteria 1913
1206 Ga0501032_0174762 3300049569 Bacteria 1407
1207 Ga0501032_0225935 3300049569 Bacteria 1217
1208 Ga0501032_0589179 3300049569 Bacteria 708
1209 Ga0501033_0002332 3300049570 Bacteria 16174
1210 Ga0501033_0002853 3300049570 Bacteria 14482
1211 Ga0501033_0004295 3300049570 Bacteria 11444
1212 Ga0501033_0005340 3300049570 Bacteria 10182
1213 Ga0501033_0036768 3300049570 Bacteria 3667
1214 Ga0501033_0265859 3300049570 Bacteria 1213
1215 Ga0501034_0000544 3300049571 Bacteria 59969
1216 Ga0501034_0001449 3300049571 Bacteria 31438
1217 Ga0501034_0004230 3300049571 Bacteria 16025
1218 Ga0501034_0006520 3300049571 Bacteria 12549
1219 Ga0501034_0006867 3300049571 Bacteria 12170
1220 Ga0501034_0010307 3300049571 Bacteria 9744
1221 Ga0501034_0012391 3300049571 Bacteria 8807
1222 Ga0501034_0042361 3300049571 Bacteria 4609
1223 Ga0501034_0056437 3300049571 Bacteria 3952
1224 Ga0501034_0073006 3300049571 Bacteria 3439
1225 Ga0501034_0125919 3300049571 Bacteria 2547
1226 Ga0501034_0141390 3300049571 Bacteria 2386
1227 Ga0501034_0294235 3300049571 Bacteria 1561
1228 Ga0501034_0356522 3300049571 Bacteria 1390
1229 Ga0501034_0778465 3300049571 Bacteria 851
1230 Ga0501036_0008476 3300049572 Bacteria 8426
1231 Ga0501036_0047433 3300049572 Bacteria 3638
1232 Ga0501036_0108054 3300049572 Bacteria 2352
1233 Ga0501036_0375127 3300049572 Bacteria 1187
1234 Ga0501036_0579029 3300049572 Bacteria 932
1235 Ga0501036_0739410 3300049572 Bacteria 812
1236 Ga0501036_0794192 3300049572 Bacteria 780
1237 Ga0501037_0004806 3300049573 Bacteria 9821
1238 Ga0501037_0028275 3300049573 Bacteria 4141
1239 Ga0501037_0091448 3300049573 Bacteria 2200
1240 Ga0501037_0096898 3300049573 Bacteria 2131
1241 Ga0501037_0104567 3300049573 Bacteria 2041
1242 Ga0501037_0206295 3300049573 Bacteria 1387
1243 Ga0501037_0360052 3300049573 Bacteria 1002
1244 Ga0501037_0388123 3300049573 Bacteria 959
1245 Ga0501037_0413500 3300049573 Bacteria 924
1246 Ga0501038_0000251 3300049574 Bacteria 45437
1247 Ga0501038_0006634 3300049574 Bacteria 10706
1248 Ga0501038_0011631 3300049574 Bacteria 8028
1249 Ga0501038_0023411 3300049574 Bacteria 5521
1250 Ga0501038_0220810 3300049574 Bacteria 1512
1251 Ga0501038_0222956 3300049574 Bacteria 1503
1252 Ga0501038_0489651 3300049574 Bacteria 941
1253 Ga0501039_0007491 3300049575 Bacteria 8335
1254 Ga0501039_0055978 3300049575 Bacteria 3055
1255 Ga0501039_0073969 3300049575 Bacteria 2647
1256 Ga0501039_0144966 3300049575 Bacteria 1866
1257 Ga0501039_0195532 3300049575 Bacteria 1590
1258 Ga0501039_0223697 3300049575 Bacteria 1479
1259 Ga0501040_0118373 3300049576 Bacteria 1857
1260 Ga0501042_0398761 3300049578 Bacteria 996
1261 Ga0501043_0003128 3300049579 Bacteria 13725
1262 Ga0501043_0003723 3300049579 Bacteria 12532
1263 Ga0501043_0009046 3300049579 Bacteria 7837
1264 Ga0501043_0014418 3300049579 Bacteria 6184
1265 Ga0501043_0017421 3300049579 Bacteria 5631
1266 Ga0501043_0019309 3300049579 Bacteria 5350
1267 Ga0501043_0063840 3300049579 Bacteria 2892
1268 Ga0501043_0129292 3300049579 Bacteria 1979
1269 Ga0501043_0208162 3300049579 Bacteria 1516
1270 Ga0501043_0252463 3300049579 Bacteria 1358
1271 Ga0501046_0009056 3300049580 Bacteria 8630
1272 Ga0501046_0013125 3300049580 Bacteria 7032
1273 Ga0501046_0015580 3300049580 Bacteria 6385
1274 Ga0501046_0024091 3300049580 Bacteria 4997
1275 Ga0501046_0093130 3300049580 Bacteria 2316
1276 Ga0501046_0124060 3300049580 Bacteria 1963
1277 Ga0501046_0156218 3300049580 Bacteria 1718
1278 Ga0501047_0000250 3300049581 Bacteria 63699
1279 Ga0501047_0002064 3300049581 Bacteria 19202
1280 Ga0501047_0004581 3300049581 Bacteria 13005
1281 Ga0501047_0008714 3300049581 Bacteria 9572
1282 Ga0501047_0050558 3300049581 Bacteria 4014
1283 Ga0501047_0143168 3300049581 Bacteria 2268
1284 Ga0501047_0167971 3300049581 Bacteria 2064
1285 Ga0501047_0219175 3300049581 Bacteria 1759
1286 Ga0501047_0220542 3300049581 Bacteria 1753
1287 Ga0501047_0299928 3300049581 Bacteria 1449
1288 Ga0501047_0311134 3300049581 Bacteria 1416
1289 Ga0501047_0412210 3300049581 Bacteria 1183
1290 Ga0501048_0017672 3300049582 Bacteria 5250
1291 Ga0501048_0039385 3300049582 Bacteria 3390
1292 Ga0501048_0112774 3300049582 Bacteria 1920
1293 Ga0501067_0000560 3300049583 Bacteria 20112
1294 Ga0501067_0008269 3300049583 Bacteria 5779
1295 Ga0501068_0016281 3300049584 Bacteria 4285
1296 Ga0501068_0031539 3300049584 Bacteria 3148
1297 Ga0501068_0094355 3300049584 Bacteria 1849
1298 Ga0501068_0094652 3300049584 Bacteria 1846
1299 Ga0501068_0399129 3300049584 Bacteria 886
1300 Ga0501069_0016989 3300049585 Bacteria 3910
1301 Ga0501069_0018450 3300049585 Bacteria 3764
1302 Ga0501069_0024864 3300049585 Bacteria 3270
1303 Ga0501069_0045605 3300049585 Bacteria 2429
1304 Ga0501070_0003399 3300049586 Bacteria 13818
1305 Ga0501070_0022970 3300049586 Bacteria 5221
1306 Ga0501070_0026818 3300049586 Bacteria 4832
1307 Ga0501070_0080766 3300049586 Bacteria 2690
1308 Ga0501070_0149339 3300049586 Bacteria 1928
1309 Ga0501070_0157905 3300049586 Bacteria 1870
1310 Ga0501070_0240087 3300049586 Bacteria 1483
1311 Ga0501070_0263973 3300049586 Bacteria 1407
1312 Ga0501070_0727883 3300049586 Bacteria 783
1313 Ga0501071_0040096 3300049587 Bacteria 3351
1314 Ga0501071_0205648 3300049587 Bacteria 1479
1315 Ga0501072_0003501 3300049588 Bacteria 11825
1316 Ga0501072_0016955 3300049588 Bacteria 5597
1317 Ga0501073_0001096 3300049589 Bacteria 19612
1318 Ga0501073_0003002 3300049589 Bacteria 12643
1319 Ga0501073_0004205 3300049589 Bacteria 10794
1320 Ga0501073_0110334 3300049589 Bacteria 1908
1321 Ga0501073_0230488 3300049589 Bacteria 1279
1322 Ga0501073_0351642 3300049589 Bacteria 1017
1323 Ga0501073_0360338 3300049589 Bacteria 1004
1324 Ga0501073_0658082 3300049589 Unclassified 723
1325 Ga0501074_0019562 3300049590 Bacteria 4914
1326 Ga0501074_0034353 3300049590 Bacteria 3676
1327 Ga0501074_0035175 3300049590 Bacteria 3629
1328 Ga0501074_0049890 3300049590 Bacteria 3021
1329 Ga0501074_0058058 3300049590 Bacteria 2787
1330 Ga0501074_0067221 3300049590 Bacteria 2578
1331 Ga0501074_0110530 3300049590 Bacteria 1967
1332 Ga0501076_0571329 3300049592 Bacteria 932
1333 Ga0501077_0360496 3300049593 Bacteria 928
1334 Ga0501077_0393926 3300049593 Bacteria 885
1335 Ga0501202_016651 3300049652 Bacteria 1429
1336 Ga0501079_0112934 3300049741 Bacteria 2112
1337 Ga0501079_0120832 3300049741 Bacteria 2037
1338 Ga0501079_0183846 3300049741 Bacteria 1631
1339 Ga0501079_0270545 3300049741 Bacteria 1328
1340 Ga0501079_0385713 3300049741 Bacteria 1098
1341 Ga0501080_0000306 3300049742 Bacteria 37439
1342 Ga0501080_0000320 3300049742 Bacteria 36678
1343 Ga0501080_0001885 3300049742 Bacteria 18044
1344 Ga0501080_0038508 3300049742 Bacteria 4463
1345 Ga0501080_0051615 3300049742 Bacteria 3827
1346 Ga0501080_0060509 3300049742 Bacteria 3526
1347 Ga0501080_0095289 3300049742 Bacteria 2764
1348 Ga0501080_0126272 3300049742 Bacteria 2369
1349 Ga0501080_0197515 3300049742 Bacteria 1847
1350 Ga0501080_0775118 3300049742 Bacteria 842
1351 Ga0501081_0086682 3300049743 Bacteria 2198
1352 Ga0501083_0007488 3300049744 Bacteria 7734
1353 Ga0501083_0068982 3300049744 Bacteria 2353
1354 Ga0501266_011828 3300049763 Bacteria 1122
1355 Ga0501269_035278 3300049766 Bacteria 653
1356 Ga0501035_0009752 3300049822 Bacteria 8926
1357 Ga0501035_0016886 3300049822 Bacteria 6730
1358 Ga0501035_0017379 3300049822 Bacteria 6632
1359 Ga0501035_0025209 3300049822 Bacteria 5451
1360 Ga0501035_0026599 3300049822 Bacteria 5292
1361 Ga0501035_0034014 3300049822 Bacteria 4632
1362 Ga0501035_0050395 3300049822 Bacteria 3731
1363 Ga0501035_0055280 3300049822 Bacteria 3544
1364 Ga0501035_0111994 3300049822 Bacteria 2391
1365 Ga0501035_0385476 3300049822 Bacteria 1168
1366 Ga0501035_0723091 3300049822 Bacteria 801
1367 Ga0501035_0780814 3300049822 Bacteria 764
1368 Ga0501044_0003969 3300049823 Bacteria 16569
1369 Ga0501044_0005486 3300049823 Bacteria 14091
1370 Ga0501044_0017657 3300049823 Bacteria 7652
1371 Ga0501044_0028186 3300049823 Bacteria 5928
1372 Ga0501044_0075598 3300049823 Bacteria 3420
1373 Ga0501044_0107242 3300049823 Bacteria 2805
1374 Ga0501044_0108743 3300049823 Bacteria 2782
1375 Ga0501044_0140742 3300049823 Bacteria 2401
1376 Ga0501044_0143207 3300049823 Bacteria 2378
1377 Ga0501044_0174273 3300049823 Bacteria 2121
1378 Ga0501044_0225483 3300049823 Bacteria 1823
1379 Ga0501044_0295543 3300049823 Bacteria 1550
1380 Ga0501044_0304012 3300049823 Bacteria 1523
1381 Ga0501044_0323959 3300049823 Bacteria 1465
1382 Ga0501044_0400469 3300049823 Bacteria 1285
1383 Ga0501044_0462230 3300049823 Bacteria 1174
1384 Ga0501044_0926429 3300049823 Bacteria 745
1385 Ga0501044_1144822 3300049823 Bacteria 646
1386 Ga0501045_0144308 3300049824 Bacteria 1770
1387 Ga0501045_0591876 3300049824 Bacteria 822
1388 nmdc:mga05p37_32385_c1 3300050507 Bacteria 4070
1389 nmdc:mga09592_180455_c1 3300050508 Bacteria 1826
1390 nmdc:mga0sz30_16282_c1 3300050516 Bacteria 2554
1391 Ga0500610_0003017 3300053079 Bacteria 6354
1392 Ga0495619_0081142 3300053085 Bacteria 2184
1393 Ga0500643_001605 3300053087 Bacteria 12714
1394 Ga0500643_008552 3300053087 Bacteria 4016
1395 Ga0500643_008927 3300053087 Bacteria 3881
1396 Ga0500651_0002320 3300053093 Bacteria 10000
1397 Ga0500651_0015083 3300053093 Bacteria 4738
1398 Ga0500566_0191366 3300053094 Bacteria 1041
1399 Ga0500641_0017442 3300053096 Bacteria 2685
1400 Ga0500555_000235 3300053103 Bacteria 24708
1401 Ga0500562_042424 3300053108 Bacteria 1210
1402 Ga0500597_000019 3300053120 Bacteria 34589
1403 Ga0500628_146496 3300053129 Bacteria 658
1404 Ga0500658_0005949 3300053134 Bacteria 4536
1405 Ga0500559_0281522 3300053136 Bacteria 782
1406 Ga0500568_0001313 3300053139 Bacteria 16297
1407 Ga0500577_0003758 3300053142 Bacteria 3959
1408 Ga0500616_0044457 3300053153 Bacteria 2370
1409 Ga0500636_0389787 3300053177 Bacteria 650
1410 Ga0500645_000167 3300053730 Bacteria 51590
1411 Ga0501084_0015131 3300054114 Bacteria 6398
1412 Ga0501084_0414703 3300054114 Bacteria 1138
1413 Ga0501084_0645659 3300054114 Bacteria 893
1414 Ga0587073_0046370 3300059492 Bacteria 968
1415 Ga0501082_0000394 3300060353 Bacteria 38764
1416 Ga0501082_0093743 3300060353 Bacteria 2594
1417 Ga0501082_0124847 3300060353 Bacteria 2232
1418 Ga0501082_0326672 3300060353 Bacteria 1337
1419 Ga0466962_0001724 3300061719 Bacteria 10272
1420 Ga0466962_0005053 3300061719 Bacteria 6345
1421 2538833768 2537561836 Bacteria 3910579
1422 2572255430 2571042365 Bacteria 3289345
1423 2595447285 2593339238 Bacteria 4182970
1424 2595450067 2593339239 Bacteria 4124669
1425 2600225624 2599185359 Bacteria 4772316
1426 2643831102 2643221562 Bacteria 4048635
1427 2643881487 2643221573 Bacteria 4784121
1428 2643896863 2643221577 Bacteria 3710843
1429 2644049895 2643221607 Bacteria 6314006
1430 2644203319 2643221636 Bacteria 6583769
1431 2644479067 2643221685 Bacteria 3673288
1432 2644497671 2643221689 Bacteria 6042950
1433 2644507094 2643221691 Bacteria 5093099
1434 2644662624 2643221720 Bacteria 4694283
1435 2644698422 2643221728 Bacteria 4797149
1436 2687581894 2687453130 Bacteria 4227172
1437 2739227158 2738543009 Bacteria 4944499
1438 2739729813 2739367700 Bacteria 4747630
1439 2819565670 2818991440 Bacteria 4774720
1440 2819613378 2818991448 Bacteria 6772224
1441 2837680697 2837678835 Bacteria 5252418
1442 2842918322 2842914999 Bacteria 4419378
1443 2884339425 2884338543 Bacteria 4610696
1444 2884416050 2884411467 Bacteria 5246714
1445 2894819112 2894817345 Bacteria 4892941
1446 2895396287 2895395659 Bacteria 3983269
1447 2904465954 2904463128 Bacteria 4775606
1448 2919406608 2919404418 Bacteria 4232372
1449 2928966003 2928963466 Bacteria 5165703
1450 2939614796 2939611941 Bacteria 3892017
1451 2941473178 2941471342 Bacteria 5018624
1452 2953995650 2953994433 Bacteria 4303959
1453 2989774652 2989771324 Bacteria 5605128
1454 8002869637 8002869464 Bacteria 3588529
1455 Ga0070674_100169478
1456 JGI24740J21852_10000320
1457 JGI24740J21852_10003591
1458 JGI24739J22299_10009127
1459 JGI24739J22299_10045170
1460 JGI24737J22298_10002818
1461 JGI24737J22298_10002923
1462 JGI24735J21928_10000210
1463 JGI24735J21928_10008070
1464 JGI24738J21930_10000630
1465 JGI25162J39368_1000072
1466 JGI25162J39368_1000403
1467 JGI25162J39368_1000450
1468 JGI25154J39366_1005804
1469 JGI25157J39369_1000143
1470 JGI25157J39369_1000145
1471 JGI25157J39369_1000210
1472 JGI25163J39215_1000608
1473 JGI25164J39214_1000115
1474 JGI25164J39214_1000122
1475 JGI25164J39214_1000276
1476 JGI25164J39214_1000360
1477 JGI25164J39214_1000479
1478 JGI25151J46595_10000165
1479 JGI25151J46595_10012116
1480 JGI25165J46597_1000063
1481 JGI25165J46597_1000241
1482 JGI25165J46597_1000419
1483 JGI25165J46597_1001372
1484 JGI25165J46597_1007774
1485 JGI25153J46596_10024928
1486 rootH1_10024742
1487 rootH1_10071835
1488 rootH1_10110832
1489 rootH2_10063162
1490 rootL2_10006308
1491 rootL2_10061895
1492 rootL2_10246862
1493 rootH1_10327385
1494 JGI26145J50221_1002765
1495 Ga0006562J51391_1027422
1496 Ga0055538_1004437
1497 Ga0055539_1002939
1498 Ga0055533_1000338
1499 Ga0055525_1000135
1500 Ga0055527_1000043
1501 Ga0055527_1000079
1502 Ga0055535_1000068
1503 Ga0055535_1000071
1504 Ga0055535_1000166
1505 Ga0055535_1017601
1506 Ga0055542_1000090
1507 Ga0055542_1000096
1508 Ga0055542_1000210
1509 Ga0055529_1000084
1510 Ga0055529_1000114
1511 Ga0055529_1000394
1512 Ga0055529_1003020
1513 Ga0055526_1000008
1514 Ga0055526_1056385
1515 Ga0055524_1002861
1516 Ga0055524_1002910
1517 Ga0055536_1002163
1518 Ga0055536_1003562
1519 Ga0055528_1044392
1520 Ga0055530_10001268
1521 Ga0055531_10004683
1522 Ga0055531_10007280
1523 Ga0058692_1000040
1524 Ga0065165_1003771
1525 Ga0065704_10087117
1526 Ga0065715_10001173
1527 Ga0065715_10268777
1528 Ga0070658_10001469
1529 Ga0070658_10324163
1530 Ga0070658_10412723
1531 Ga0070676_10018581
1532 Ga0070683_100148589
1533 Ga0070683_100705389
1534 Ga0070670_100051522
1535 Ga0070670_100082595
1536 Ga0070670_100156808
1537 Ga0070670_100476960
1538 Ga0070670_100780618
1539 Ga0070670_101066703
1540 Ga0070677_10092159
1541 Ga0068869_100117424
1542 Ga0068869_100123858
1543 Ga0068869_100161403
1544 Ga0070666_10000010
1545 Ga0070666_10027007
1546 Ga0070666_10028601
1547 Ga0070666_10092942
1548 Ga0070666_10111766
1549 Ga0070666_10115168
1550 Ga0070666_10345067
1551 Ga0070680_100264546
1552 Ga0070680_100822370
1553 Ga0070682_100363557
1554 Ga0070682_100546560
1555 Ga0070682_100791487
1556 Ga0068868_100088396
1557 Ga0068868_100139242
1558 Ga0068868_100360665
1559 Ga0070660_100071494
1560 Ga0070660_100136540
1561 Ga0070660_100886085
1562 Ga0070689_100002138
1563 Ga0070689_100260673
1564 Ga0070689_100940146
1565 Ga0070661_100008137
1566 Ga0070661_100139444
1567 Ga0070661_100233097
1568 Ga0070692_10003879
1569 Ga0070668_100049024
1570 Ga0070668_100649769
1571 Ga0070669_100042491
1572 Ga0070669_100168407
1573 Ga0070675_100043062
1574 Ga0070675_100638317
1575 Ga0070671_100112479
1576 Ga0070671_100204590
1577 Ga0070671_100281894
1578 Ga0070674_100096591
1579 Ga0070673_100050203
1580 Ga0070673_100257204
1581 Ga0070659_100000052
1582 Ga0070659_100004887
1583 Ga0070667_100000150
1584 Ga0070667_100034011
1585 Ga0070667_100075009
1586 Ga0070667_100087613
1587 Ga0070667_100276494
1588 Ga0070667_100305366
1589 Ga0070667_100348682
1590 Ga0070667_100454628
1591 Ga0070667_100831502
1592 Ga0070667_100973834
1593 Ga0070714_100000393
1594 Ga0070714_100000605
1595 Ga0070713_100061037
1596 Ga0070711_100095752
1597 Ga0070711_100385734
1598 Ga0070694_101277709
1599 Ga0070708_100139302
1600 Ga0070663_100000029
1601 Ga0070663_100021862
1602 Ga0070663_100037071
1603 Ga0070663_100172190
1604 Ga0070663_100240101
1605 Ga0070663_100289513
1606 Ga0070663_100737947
1607 Ga0070663_101065424
1608 Ga0070678_100041709
1609 Ga0070678_100127460
1610 Ga0070678_100149741
1611 Ga0070678_100157470
1612 Ga0070662_100021500
1613 Ga0070662_100549394
1614 Ga0070662_100844592
1615 Ga0070681_10028025
1616 Ga0070681_10046264
1617 Ga0070681_10074465
1618 Ga0070681_10352224
1619 Ga0070681_10537320
1620 Ga0070681_10959932
1621 Ga0068867_100012849
1622 Ga0068867_101047542
1623 Ga0070685_10000832
1624 Ga0070685_10098205
1625 Ga0070679_100323628
1626 Ga0070679_100338414
1627 Ga0070679_100354016
1628 Ga0070679_100378948
1629 Ga0070679_100494921
1630 Ga0070679_100677980
1631 Ga0070684_100194805
1632 Ga0070684_100555778
1633 Ga0068853_100002537
1634 Ga0068853_100002647
1635 Ga0068853_100027321
1636 Ga0068853_100035136
1637 Ga0068853_100035959
1638 Ga0068853_100054340
1639 Ga0068853_100120542
1640 Ga0068853_100139422
1641 Ga0068853_100406214
1642 Ga0068853_100436905
1643 Ga0068853_100442893
1644 Ga0068853_100599738
1645 Ga0068853_100600373
1646 Ga0070672_100013517
1647 Ga0070672_100167090
1648 Ga0070672_100480680
1649 Ga0070672_100597666
1650 Ga0070696_100006208
1651 Ga0070696_100031859
1652 Ga0070696_100641700
1653 Ga0070696_100736094
1654 Ga0070693_100005217
1655 Ga0070693_100088297
1656 Ga0070693_100164722
1657 Ga0070693_100331569
1658 Ga0070693_100446041
1659 Ga0070665_100000026
1660 Ga0070665_100001464
1661 Ga0070665_100004807
1662 Ga0070665_100020504
1663 Ga0070665_100084135
1664 Ga0070665_100242107
1665 Ga0070665_100585482
1666 Ga0070665_100710045
1667 Ga0070665_101291684
1668 Ga0068855_100000696
1669 Ga0068855_100010588
1670 Ga0068855_100057884
1671 Ga0068855_100057944
1672 Ga0068855_100176858
1673 Ga0068855_100177473
1674 Ga0068855_100431851
1675 Ga0068855_100538940
1676 Ga0068855_100690164
1677 Ga0068855_100698421
1678 Ga0068855_100740982
1679 Ga0068855_100818438
1680 Ga0068855_101124889
1681 Ga0068855_101256879
1682 Ga0070664_100085989
1683 Ga0070664_100177381
1684 Ga0070664_100184175
1685 Ga0070664_100292013
1686 Ga0068857_100014664
1687 Ga0068857_100041837
1688 Ga0068857_100164117
1689 Ga0068857_100230568
1690 Ga0068857_100300958
1691 Ga0068857_100426015
1692 Ga0068857_100661245
1693 Ga0068857_100700902
1694 Ga0068854_100000282
1695 Ga0068854_100006540
1696 Ga0068854_100006900
1697 Ga0068854_100051750
1698 Ga0068854_100104414
1699 Ga0068854_100202049
1700 Ga0068856_100000022
1701 Ga0068856_100013211
1702 Ga0068856_100036502
1703 Ga0068856_100119510
1704 Ga0068856_100164207
1705 Ga0068856_100191212
1706 Ga0068856_101036380
1707 Ga0068852_100006662
1708 Ga0068852_100071081
1709 Ga0068852_100081782
1710 Ga0068852_100176951
1711 Ga0068852_100373403
1712 Ga0068852_100393746
1713 Ga0068852_100542980
1714 Ga0068852_100569515
1715 Ga0068852_100716187
1716 Ga0068852_101337712
1717 Ga0068859_100001840
1718 Ga0068859_101588311
1719 Ga0068864_100014730
1720 Ga0068864_100112829
1721 Ga0068864_100177450
1722 Ga0068864_100874382
1723 Ga0068861_100087634
1724 Ga0068861_100755419
1725 Ga0068861_100939318
1726 Ga0068851_10006767
1727 Ga0068851_10011459
1728 Ga0068851_10021594
1729 Ga0068851_10036620
1730 Ga0068851_10059334
1731 Ga0068870_10051228
1732 Ga0068863_100004653
1733 Ga0068863_100005490
1734 Ga0068863_100014974
1735 Ga0068863_100050734
1736 Ga0068863_100098184
1737 Ga0068863_100624224
1738 Ga0068863_100818070
1739 Ga0068863_101260885
1740 Ga0068858_100001617
1741 Ga0068858_100151636
1742 Ga0068858_100260609
1743 Ga0068858_100304790
1744 Ga0068858_100509095
1745 Ga0068858_100567874
1746 Ga0068858_100622788
1747 Ga0068860_100025971
1748 Ga0068860_100031104
1749 Ga0068860_100108654
1750 Ga0068860_100708139
1751 Ga0068860_100926207
1752 Ga0068860_101226300
1753 Ga0068862_100000185
1754 Ga0068862_100175378
1755 Ga0081455_10296262
1756 Ga0075364_10015606
1757 Ga0070715_10095572
1758 Ga0070712_100398115
1759 Ga0075369_10187921
1760 Ga0075366_10016389
1761 Ga0097621_100019859
1762 Ga0097621_100021471
1763 Ga0097621_100038212
1764 Ga0097621_100133587
1765 Ga0097621_100167732
1766 Ga0097621_100483758
1767 Ga0097621_101517032
1768 Ga0068871_100059368
1769 Ga0068871_100064765
1770 Ga0068871_100119581
1771 Ga0068871_100236037
1772 Ga0068871_100254438
1773 Ga0068871_100825699
1774 Ga0075428_100116793
1775 Ga0075428_100371580
1776 Ga0075429_100333234
1777 Ga0068865_100013181
1778 Ga0068865_100096192
1779 Ga0068865_100131071
1780 Ga0068865_100208584
1781 Ga0097620_100001840
1782 Ga0097620_101588824
1783 Ga0105250_10226338
1784 Ga0105240_10000359
1785 Ga0105240_10000633
1786 Ga0105240_10002007
1787 Ga0105240_10007977
1788 Ga0105240_10009334
1789 Ga0105240_10013427
1790 Ga0105240_10022190
1791 Ga0105240_10050541
1792 Ga0105240_10074426
1793 Ga0105240_10209967
1794 Ga0105240_10884759
1795 Ga0105245_10377566
1796 Ga0105245_10788223
1797 Ga0105245_10947848
1798 Ga0105245_11070398
1799 Ga0114129_10035130
1800 Ga0105243_10073372
1801 Ga0105241_10008871
1802 Ga0105241_10037744
1803 Ga0105241_10046045
1804 Ga0105241_10064718
1805 Ga0105241_10214683
1806 Ga0105241_10251234
1807 Ga0105241_10857754
1808 Ga0105241_11254522
1809 Ga0105242_10002842
1810 Ga0105242_10041120
1811 Ga0105242_10593268
1812 Ga0105242_10722576
1813 Ga0105248_10000246
1814 Ga0105248_10044683
1815 Ga0105248_10096662
1816 Ga0105248_10466046
1817 Ga0105248_10843250
1818 Ga0105248_10941610
1819 Ga0105248_11019248
1820 Ga0105237_10000148
1821 Ga0105237_10000231
1822 Ga0105237_10000383
1823 Ga0105237_10004315
1824 Ga0105237_10128389
1825 Ga0105237_10144331
1826 Ga0105237_10173267
1827 Ga0105237_10345613
1828 Ga0105237_10413818
1829 Ga0105237_10479787
1830 Ga0105237_10544780
1831 Ga0105237_10709464
1832 Ga0105238_10000044
1833 Ga0105238_10007919
1834 Ga0105238_10010855
1835 Ga0105238_10034862
1836 Ga0105238_10049939
1837 Ga0105238_10097896
1838 Ga0105238_10202715
1839 Ga0105238_10217876
1840 Ga0105238_10333048
1841 Ga0105238_10538112
1842 Ga0105238_10733790
1843 Ga0105249_10001225
1844 Ga0105249_10027305
1845 Ga0105249_10380955
1846 Ga0105148_100676
1847 Ga0105029_100269
1848 Ga0105239_10000033
1849 Ga0105239_10003454
1850 Ga0105239_10009780
1851 Ga0105239_10014339
1852 Ga0105239_10021477
1853 Ga0105239_10026779
1854 Ga0105239_10121007
1855 Ga0105239_10152397
1856 Ga0105239_10157972
1857 Ga0105239_10256728
1858 Ga0105239_10286830
1859 Ga0105239_10660194
1860 Ga0105239_10699703
1861 Ga0105239_11489580
1862 Ga0105246_10009566
1863 Ga0157318_1000739
1864 Ga0157314_1000098
1865 Ga0157314_1001103
1866 Ga0157326_1021775
1867 Ga0157373_10034519
1868 Ga0157373_10048721
1869 Ga0157371_10021671
1870 Ga0157370_10000495
1871 Ga0157370_10002719
1872 Ga0157370_10004280
1873 Ga0157370_10070640
1874 Ga0157370_10095746
1875 Ga0157370_10099538
1876 Ga0157370_10121328
1877 Ga0157370_10123802
1878 Ga0157370_10133349
1879 Ga0157370_10168588
1880 Ga0157370_10189039
1881 Ga0157370_10253027
1882 Ga0157370_10444388
1883 Ga0157370_10535365
1884 Ga0157370_11027177
1885 Ga0157370_11101015
1886 Ga0157369_10000464
1887 Ga0157369_10005929
1888 Ga0157369_10031464
1889 Ga0157369_10262059
1890 Ga0157369_10281052
1891 Ga0157369_10778324
1892 Ga0157369_10976478
1893 Ga0157374_10066420
1894 Ga0157374_10130567
1895 Ga0157374_10474783
1896 Ga0157378_10001405
1897 Ga0157378_10691065
1898 Ga0157378_11048265
1899 Ga0163162_10000021
1900 Ga0163162_10000193
1901 Ga0163162_10002029
1902 Ga0163162_10064563
1903 Ga0163162_10069740
1904 Ga0163162_10153910
1905 Ga0163162_10449684
1906 Ga0163162_10638951
1907 Ga0157372_10011884
1908 Ga0157372_10014982
1909 Ga0157372_10052222
1910 Ga0157372_10064309
1911 Ga0157372_10167991
1912 Ga0157372_10186027
1913 Ga0157372_10299531
1914 Ga0157372_10423863
1915 Ga0157372_10444901
1916 Ga0157372_10704796
1917 Ga0157372_10889204
1918 Ga0157372_10892887
1919 Ga0157372_11088308
1920 Ga0157372_11158308
1921 Ga0157372_12292690
1922 Ga0157375_10000950
1923 Ga0157375_10016908
1924 Ga0157375_10050059
1925 Ga0157375_10122204
1926 Ga0163163_10000403
1927 Ga0163163_10006152
1928 Ga0163163_10113006
1929 Ga0163163_10284699
1930 Ga0157380_10082842
1931 Ga0182008_10000209
1932 Ga0182008_10030065
1933 Ga0182008_10032240
1934 Ga0182008_10046665
1935 Ga0157379_10003888
1936 Ga0157379_10202302
1937 Ga0157379_10208706
1938 Ga0157376_10006685
1939 Ga0157376_10017225
1940 Ga0157376_10019219
1941 Ga0157376_10107390
1942 Ga0157376_10124715
1943 Ga0157376_10334337
1944 Ga0182006_1000034
1945 Ga0182006_1007770
1946 Ga0182006_1032677
1947 Ga0182006_1047053
1948 Ga0182007_10001346
1949 Ga0182007_10005029
1950 Ga0182007_10052110
1951 Ga0182007_10067388
1952 Ga0182007_10090807
1953 Ga0182005_1000064
1954 Ga0182005_1002932
1955 Ga0182005_1016840
1956 Ga0183369_1003
1957 Ga0183368_1002
1958 Ga0163161_10001385
1959 Ga0163161_10012090
1960 Ga0163161_10038479
1961 Ga0206353_10771426
1962 Ga0154015_1053000
1963 Ga0213875_10120439
1964 Ga0224712_10075440
1965 Ga0209435_108278
1966 Ga0209760_100294
1967 Ga0209784_100042
1968 Ga0209674_100033
1969 Ga0209674_100441
1970 Ga0209674_101207
1971 Ga0209674_103716
1972 Ga0209672_100004
1973 Ga0209672_100008
1974 Ga0209672_100916
1975 Ga0209672_102162
1976 Ga0209563_100036
1977 Ga0207427_100037
1978 Ga0207427_100049
1979 Ga0207427_100078
1980 Ga0207427_100096
1981 Ga0207427_105412
1982 Ga0209437_100074
1983 Ga0209437_100083
1984 Ga0209437_100090
1985 Ga0209437_100157
1986 Ga0209437_100691
1987 Ga0209437_100872
1988 Ga0209437_101965
1989 Ga0209437_104672
1990 Ga0209258_100003
1991 Ga0209258_100004
1992 Ga0209258_100008
1993 Ga0209258_100136
1994 Ga0209258_101400
1995 Ga0209258_110007
1996 Ga0209646_1000863
1997 Ga0209646_1012353
1998 Ga0209026_1000045
1999 Ga0209026_1000072
2000 Ga0209026_1000129
2001 Ga0209026_1000153
2002 Ga0209026_1000442
2003 Ga0209026_1016918
2004 Ga0209026_1021965
2005 Ga0209677_100348
2006 Ga0209148_1000025
2007 Ga0209148_1000036
2008 Ga0209148_1000053
2009 Ga0209148_1000791
2010 Ga0209759_1000140
2011 Ga0209759_1000831
2012 Ga0209759_1002615
2013 Ga0209759_1003821
2014 Ga0209129_1000604
2015 Ga0209129_1002103
2016 Ga0209233_1000040
2017 Ga0209233_1000075
2018 Ga0209233_1000077
2019 Ga0209233_1000096
2020 Ga0209233_1003582
2021 Ga0209233_1028224
2022 Ga0209455_1000004
2023 Ga0209455_1000007
2024 Ga0209455_1000071
2025 Ga0209455_1000215
2026 Ga0209455_1013624
2027 Ga0209673_1003811
2028 Ga0209130_1007509
2029 Ga0209675_1014295
2030 Ga0209675_1017692
2031 Ga0209676_1001264
2032 Ga0209676_1002621
2033 Ga0209676_1007907
2034 Ga0209676_1008848
2035 Ga0209676_1036126
2036 Ga0209025_1001373
2037 Ga0209025_1034165
2038 Ga0209025_1050506
2039 Ga0209025_1053805
2040 Ga0209025_1055046
2041 Ga0209564_1009685
2042 Ga0209758_1000481
2043 Ga0209758_1058569
2044 Ga0209758_1061354
2045 Ga0209050_1001626
2046 Ga0209256_1001873
2047 Ga0209256_1002659
2048 Ga0209256_1010555
2049 Ga0209256_1011879
2050 Ga0209051_1005661
2051 Ga0209257_1000274
2052 Ga0209257_1000307
2053 Ga0209257_1002641
2054 Ga0209257_1007987
2055 Ga0207656_10004823
2056 Ga0207656_10411102
2057 Ga0207692_10191756
2058 Ga0207710_10028650
2059 Ga0207680_10000002
2060 Ga0207680_10000092
2061 Ga0207680_10034939
2062 Ga0207680_10037462
2063 Ga0207680_10095683
2064 Ga0207647_10000010
2065 Ga0207647_10000066
2066 Ga0207647_10004970
2067 Ga0207647_10006265
2068 Ga0207647_10010431
2069 Ga0207647_10012093
2070 Ga0207685_10072312
2071 Ga0207699_10505620
2072 Ga0207645_10043108
2073 Ga0207645_10096932
2074 Ga0207643_10008509
2075 Ga0207705_10001094
2076 Ga0207705_10035118
2077 Ga0207705_10039069
2078 Ga0207705_10238245
2079 Ga0207705_10303490
2080 Ga0207654_10001128
2081 Ga0207654_10181410
2082 Ga0207654_10229994
2083 Ga0207654_10733376
2084 Ga0207654_10766565
2085 Ga0207707_10010148
2086 Ga0207707_10057230
2087 Ga0207707_10129717
2088 Ga0207707_10292260
2089 Ga0207707_10296316
2090 Ga0207695_10000014
2091 Ga0207695_10000322
2092 Ga0207695_10000809
2093 Ga0207695_10000856
2094 Ga0207695_10005750
2095 Ga0207695_10006442
2096 Ga0207695_10008494
2097 Ga0207695_10032475
2098 Ga0207695_10046519
2099 Ga0207695_10069276
2100 Ga0207695_10366560
2101 Ga0207695_11306862
2102 Ga0207671_10000028
2103 Ga0207671_10000357
2104 Ga0207671_10001588
2105 Ga0207671_10004399
2106 Ga0207671_10318069
2107 Ga0207671_10458907
2108 Ga0207663_10264346
2109 Ga0207663_10308392
2110 Ga0207660_10097251
2111 Ga0207660_10263573
2112 Ga0207660_10390745
2113 Ga0207657_10009521
2114 Ga0207657_10011833
2115 Ga0207657_10042168
2116 Ga0207657_10335228
2117 Ga0207657_10861449
2118 Ga0207649_10002084
2119 Ga0207649_10032583
2120 Ga0207649_10033209
2121 Ga0207649_10197571
2122 Ga0207649_10424825
2123 Ga0207652_10165752
2124 Ga0207652_10218605
2125 Ga0207652_10297561
2126 Ga0207652_10342189
2127 Ga0207681_10001858
2128 Ga0207681_10007276
2129 Ga0207681_10033681
2130 Ga0207681_10503930
2131 Ga0207694_10000109
2132 Ga0207694_10000850
2133 Ga0207694_10001341
2134 Ga0207694_10097782
2135 Ga0207694_10140943
2136 Ga0207694_10185078
2137 Ga0207694_10269754
2138 Ga0207650_10021916
2139 Ga0207650_10229804
2140 Ga0207659_10373732
2141 Ga0207687_10344965
2142 Ga0207687_10554219
2143 Ga0207687_11142225
2144 Ga0207664_10000553
2145 Ga0207664_10000624
2146 Ga0207644_10166416
2147 Ga0207644_10174658
2148 Ga0207644_10556744
2149 Ga0207690_10000061
2150 Ga0207690_10000375
2151 Ga0207690_10006084
2152 Ga0207690_10030475
2153 Ga0207690_10145847
2154 Ga0207706_10042475
2155 Ga0207706_10049684
2156 Ga0207686_10003423
2157 Ga0207709_10005775
2158 Ga0207670_10001621
2159 Ga0207670_10446551
2160 Ga0207670_10758146
2161 Ga0207704_10010792
2162 Ga0207704_10032219
2163 Ga0207704_10069820
2164 Ga0207704_10078000
2165 Ga0207704_10090427
2166 Ga0207691_10007374
2167 Ga0207691_10028648
2168 Ga0207691_10082771
2169 Ga0207691_10166529
2170 Ga0207711_10002283
2171 Ga0207711_10160406
2172 Ga0207711_10226669
2173 Ga0207711_10438985
2174 Ga0207711_10896166
2175 Ga0207689_10070324
2176 Ga0207689_10237908
2177 Ga0207689_10322233
2178 Ga0207689_10453363
2179 Ga0207661_10258427
2180 Ga0207667_10000080
2181 Ga0207667_10000344
2182 Ga0207667_10056069
2183 Ga0207667_10092352
2184 Ga0207667_10092784
2185 Ga0207667_10186083
2186 Ga0207667_10206622
2187 Ga0207667_10599640
2188 Ga0207667_11040940
2189 Ga0207667_11463710
2190 Ga0207651_10183658
2191 Ga0207651_10392254
2192 Ga0207712_10001195
2193 Ga0207712_10001216
2194 Ga0207712_10559312
2195 Ga0207668_10011602
2196 Ga0207668_10166366
2197 Ga0207668_10203353
2198 Ga0207668_10254721
2199 Ga0207668_10359841
2200 Ga0207640_10000190
2201 Ga0207640_10001549
2202 Ga0207640_10003414
2203 Ga0207640_10009903
2204 Ga0207640_10016638
2205 Ga0207640_10163223
2206 Ga0207640_10241418
2207 Ga0207658_10000013
2208 Ga0207658_10029268
2209 Ga0207658_10118548
2210 Ga0207658_10193319
2211 Ga0207658_10329933
2212 Ga0207658_10667254
2213 Ga0207658_10891040
2214 Ga0207658_10892344
2215 Ga0207677_10086112
2216 Ga0207677_10106765
2217 Ga0207703_10000793
2218 Ga0207703_10269178
2219 Ga0207703_10395672
2220 Ga0207703_10397394
2221 Ga0207639_10000479
2222 Ga0207639_10000595
2223 Ga0207639_10004215
2224 Ga0207639_10035499
2225 Ga0207639_10082054
2226 Ga0207639_10210802
2227 Ga0207639_10255015
2228 Ga0207639_10302611
2229 Ga0207639_10366920
2230 Ga0207639_10479588
2231 Ga0207639_10504114
2232 Ga0207639_10713675
2233 Ga0207639_11203159
2234 Ga0207678_10000035
2235 Ga0207678_10012465
2236 Ga0207678_10016540
2237 Ga0207678_10055104
2238 Ga0207678_10208614
2239 Ga0207678_10702636
2240 Ga0207708_10303999
2241 Ga0207702_10000049
2242 Ga0207702_10000380
2243 Ga0207702_10010670
2244 Ga0207702_10011899
2245 Ga0207702_10197901
2246 Ga0207702_10722423
2247 Ga0207702_10821687
2248 Ga0207641_10006513
2249 Ga0207641_10025673
2250 Ga0207641_10162028
2251 Ga0207641_10278074
2252 Ga0207641_10415131
2253 Ga0207648_10011901
2254 Ga0207648_10076457
2255 Ga0207648_10873773
2256 Ga0207676_10009897
2257 Ga0207676_10188024
2258 Ga0207676_10200669
2259 Ga0207676_10562303
2260 Ga0207674_10000090
2261 Ga0207674_10005138
2262 Ga0207674_10082164
2263 Ga0207674_10089465
2264 Ga0207674_10217853
2265 Ga0207675_100022876
2266 Ga0207675_100368478
2267 Ga0207675_100722810
2268 Ga0207683_10015518
2269 Ga0207683_10114431
2270 Ga0207683_10125025
2271 Ga0207683_10221619
2272 Ga0207698_10000982
2273 Ga0207698_10007692
2274 Ga0207698_10018109
2275 Ga0207698_10130712
2276 Ga0207698_10380200
2277 Ga0207698_10444189
2278 Ga0207698_10583094
2279 Ga0207698_10798323
2280 Ga0209973_1003226
2281 Ga0209371_1000048
2282 Ga0209984_1001727
2283 Ga0209999_1000442
2284 Ga0209982_1001040
2285 Ga0209970_1008325
2286 Ga0209971_1001367
2287 Ga0209974_10001896
2288 Ga0209974_10006797
2289 Ga0268266_10000001
2290 Ga0268266_10000008
2291 Ga0268266_10012196
2292 Ga0268266_10105549
2293 Ga0268266_10416320
2294 Ga0268265_10096396
2295 Ga0268264_10012879
2296 Ga0268264_10013020
2297 Ga0268264_10172359
2298 Ga0268264_10596859
2299 Ga0307517_10145217
2300 Ga0265338_10483232
2301 Ga0268256_1000049
2302 Ga0316177_1156649
2303 Ga0316182_1026731
2304 Ga0307408_100079013
2305 Ga0307408_100092241
2306 Ga0307408_100161570
2307 Ga0307408_100300972
2308 Ga0307408_100798105
2309 Ga0307508_10030073
2310 Ga0307508_10203007
2311 Ga0316575_10076918
2312 Ga0316576_10265740
2313 Ga0307516_10216777
2314 Ga0307405_10204962
2315 Ga0307413_10005298
2316 Ga0307413_10036935
2317 Ga0307413_10124312
2318 Ga0307413_10301187
2319 Ga0307413_10776646
2320 Ga0307410_10151037
2321 Ga0307410_10431738
2322 Ga0307410_10489988
2323 Ga0307406_10285424
2324 Ga0307407_10010967
2325 Ga0307412_10031558
2326 Ga0307412_10042740
2327 Ga0307412_10107047
2328 Ga0307412_10504300
2329 Ga0307412_10905455
2330 Ga0307409_101348517
2331 Ga0307416_100243197
2332 Ga0307416_100337613
2333 Ga0307416_100600800
2334 Ga0307414_10040312
2335 Ga0307414_10067056
2336 Ga0307414_10113207
2337 Ga0307414_10138684
2338 Ga0307414_10179116
2339 Ga0307414_10292186
2340 Ga0307414_10406811
2341 Ga0307414_10457216
2342 Ga0307414_10522699
2343 Ga0307411_10013448
2344 Ga0307411_10084979
2345 Ga0307411_10333992
2346 Ga0307411_10460650
2347 Ga0307411_10476638
2348 Ga0307411_10834155
2349 Ga0307415_100796717
2350 Ga0307507_10032693
2351 Ga0307510_10132276
2352 Ga0373959_0023707
2353 Ga0373944_0103121
2354 Ga0373936_0155331
2355 Ga0373954_0261813
2356 Ga0373957_0116767
2357 Ga0373947_0456849
2358 Ga0373937_0422145
2359 Ga0373937_0855561
2360 Ga0395899_0001125
2361 Ga0395899_0029586
2362 Ga0395899_0082043
2363 Ga0395899_0178593
2364 Ga0395899_0206202
2365 Ga0395899_0287868
2366 Ga0395899_0457805
2367 Ga0395900_0001304
2368 Ga0395900_0004445
2369 Ga0395900_0024057
2370 Ga0395900_0032548
2371 Ga0395900_0046052
2372 Ga0395900_0050386
2373 Ga0395900_0066734
2374 Ga0395900_0713229
2375 Ga0395900_1152336
2376 Ga0395898_0001583
2377 Ga0395898_0002066
2378 Ga0395898_0002627
2379 Ga0395898_0002725
2380 Ga0395898_0013479
2381 Ga0395898_0036705
2382 Ga0395898_0114789
2383 Ga0395898_0136496
2384 Ga0395898_0317809
2385 Ga0436364_0095944
2386 Ga0395901_0000259
2387 Ga0395901_0001429
2388 Ga0395901_0049227
2389 Ga0395901_0053602
2390 Ga0395901_0061507
2391 Ga0395901_0063473
2392 Ga0395901_0220090
2393 Ga0395901_0244857
2394 Ga0395901_0324327
2395 Ga0395901_0530985
2396 Ga0237819_00140
2397 Ga0400488_38144
2398 Ga0400486_30133
2399 Ga0436365_0119571
2400 Ga0436365_0324168
2401 Ga0436363_0359992
2402 Ga0436362_0657356
2403 Ga0439436_0003731
2404 Ga0439436_0049721
2405 Ga0439436_0062325
2406 Ga0439447_001069
2407 Ga0439465_0000006
2408 Ga0439465_0004178
2409 Ga0451789_0416833
2410 Ga0451793_1086667
2411 Ga0451797_0190827
2412 Ga0451795_0046765
2413 Ga0451800_1451396
2414 Ga0451802_0727430
2415 Ga0451806_127485
2416 Ga0451807_0483911
2417 Ga0451835_0771462
2418 Ga0451837_1048697
2419 Ga0451837_1628237
2420 Ga0451839_0794977
2421 Ga0451849_0604301
2422 Ga0451843_1708573
2423 Ga0451853_1416507
2424 Ga0451853_1645120
2425 Ga0451853_3750318
2426 Ga0439431_0002900
2427 Ga0439433_0037525
2428 Ga0439445_0000142
2429 Ga0439448_0102780
2430 Ga0439432_065208
2431 Ga0439432_108552
2432 Ga0439449_0020297
2433 Ga0439449_0127096
2434 Ga0439452_004747
2435 Ga0439459_0002300
2436 Ga0439459_0002709
2437 Ga0451577_0000425
2438 Ga0451577_0008483
2439 Ga0466969_0015351
2440 Ga0466969_0030228
2441 Ga0466972_0000647
2442 Ga0466972_0001847
2443 Ga0466972_0002963
2444 Ga0466982_0000007
2445 Ga0466982_0000029
2446 Ga0466965_0000764
2447 Ga0466965_0002141
2448 Ga0466965_0007999
2449 Ga0466965_0032814
2450 Ga0466965_0104626
2451 Ga0466966_0000343
2452 Ga0466966_0001588
2453 Ga0466961_0000199
2454 Ga0466961_0002917
2455 Ga0466961_0096135
2456 Ga0466961_0282415
2457 Ga0466961_0586090
2458 Ga0466964_0000680
2459 Ga0453684_0025105
2460 Ga0466971_0004638
2461 Ga0466968_0019341
2462 Ga0466970_0000132
2463 Ga0466970_0000260
2464 Ga0466970_0058767
2465 Ga0466970_0076519
2466 Ga0466957_0001273
2467 Ga0466957_0030641
2468 Ga0466960_0106077
2469 Ga0466959_0000293
2470 Ga0466959_0058398
2471 Ga0466959_0227903
2472 Ga0466958_0003516
2473 Ga0466967_0409936
2474 Ga0495617_000122
2475 Ga0495617_000504
2476 Ga0495590_0181138
2477 Ga0495629_0240917
2478 Ga0495638_0000106
2479 Ga0495638_0000237
2480 Ga0495638_0000479
2481 Ga0495641_0134174
2482 Ga0495650_0000074
2483 Ga0495650_0000134
2484 Ga0495580_0237075
2485 Ga0495582_0033576
2486 Ga0495639_0064198
2487 Ga0495584_0001870
2488 Ga0495594_0189023
2489 Ga0495607_0000042
2490 Ga0495607_0004080
2491 Ga0495583_0000833
2492 Ga0495583_0003138
2493 Ga0495583_0008323
2494 Ga0495606_0000562
2495 Ga0495606_0001636
2496 Ga0495606_0008349
2497 Ga0495606_0015682
2498 Ga0495610_0000711
2499 Ga0495616_0000617
2500 Ga0495616_0003053
2501 Ga0495620_0000182
2502 Ga0495620_0000216
2503 Ga0495620_0027243
2504 Ga0495630_0161208
2505 Ga0495632_0000241
2506 Ga0495637_0014597
2507 Ga0495648_0001366
2508 Ga0495663_0051406
2509 Ga0495663_0122884
2510 Ga0495587_0708173
2511 Ga0495609_0030336
2512 Ga0495622_0106668
2513 Ga0495656_0000847
2514 Ga0495656_0121006
2515 Ga0495668_0000411
2516 Ga0495611_0000004
2517 Ga0495611_0000023
2518 Ga0495611_0002701
2519 Ga0495625_0000024
2520 Ga0495625_0001652
2521 Ga0495625_0018885
2522 Ga0495625_0047054
2523 Ga0495625_0057783
2524 Ga0495625_0160641
2525 Ga0495625_0382372
2526 Ga0495588_0071922
2527 Ga0495588_0153472
2528 Ga0495657_0095923
2529 Ga0495599_0389719
2530 Ga0495647_0032678
2531 Ga0495613_0656007
2532 Ga0495670_0009105
2533 Ga0495670_0129075
2534 Ga0495671_0000390
2535 Ga0495649_0000687
2536 Ga0495589_0000038
2537 Ga0495589_0000547
2538 Ga0495600_0117039
2539 Ga0495660_0000321
2540 Ga0495636_0003246
2541 Ga0495636_0006414
2542 Ga0495636_0086670
2543 Ga0495672_0000544
2544 Ga0495679_000011
2545 Ga0495673_0000616
2546 Ga0495681_0015144
2547 Ga0495684_0168776
2548 Ga0495686_0000608
2549 Ga0495686_0010132
2550 Ga0495686_0010763
2551 Ga0495686_0061393
2552 Ga0495686_0071603
2553 Ga0495686_0127698
2554 Ga0495686_0250464
2555 Ga0495602_0158386
2556 Ga0496100_0001740
2557 Ga0496100_0584488
2558 Ga0496101_0012388
2559 Ga0496101_0073503
2560 Ga0496101_0132636
2561 Ga0496102_0082098
2562 Ga0496102_0583618
2563 Ga0496104_0000012
2564 Ga0496104_0338658
2565 Ga0496105_0000011
2566 Ga0496106_0175573
2567 Ga0496107_0035157
2568 Ga0496107_0094425
2569 Ga0496107_0378835
2570 Ga0496108_0724804
2571 Ga0496108_1175036
2572 Ga0496110_0298806
2573 Ga0496112_0540649
2574 Ga0496113_0024417
2575 Ga0496113_0203915
2576 Ga0496113_1191232
2577 Ga0496114_0001533
2578 Ga0496114_0006408
2579 Ga0496114_0172916
2580 Ga0496114_0208232
2581 Ga0496115_0000092
2582 Ga0496115_0000193
2583 Ga0496115_0000617
2584 Ga0496115_0004525
2585 Ga0496115_0031269
2586 Ga0496115_0145340
2587 Ga0496115_0221537
2588 Ga0496117_0004278
2589 Ga0496117_0005719
2590 Ga0496117_0009436
2591 Ga0496118_0000885
2592 Ga0496118_0001282
2593 Ga0496118_0001962
2594 Ga0496118_0002465
2595 Ga0496118_0004440
2596 Ga0496118_0012974
2597 Ga0496118_0241615
2598 Ga0496119_0041672
2599 Ga0496120_0107468
2600 Ga0496120_0117853
2601 Ga0496121_0000071
2602 Ga0496121_0000942
2603 Ga0496121_0001620
2604 Ga0496121_0001863
2605 Ga0496121_0001864
2606 Ga0496121_0001888
2607 Ga0496121_0002280
2608 Ga0496121_0006661
2609 Ga0496121_0016652
2610 Ga0496121_0037969
2611 Ga0496121_0142210
2612 Ga0496122_0000062
2613 Ga0496122_0016999
2614 Ga0496122_0018310
2615 Ga0496122_0048979
2616 Ga0496122_0066017
2617 Ga0496123_0004387
2618 Ga0496123_0009110
2619 Ga0496123_0012934
2620 Ga0496123_0013031
2621 Ga0496123_0075915
2622 Ga0496124_0000313
2623 Ga0496124_0000314
2624 Ga0496124_0007021
2625 Ga0496125_0000291
2626 Ga0496125_0024124
2627 Ga0496125_0060859
2628 Ga0496125_0349895
2629 Ga0496126_0000160
2630 Ga0496126_0003733
2631 Ga0496126_0004079
2632 Ga0496126_0004964
2633 Ga0496126_0009232
2634 Ga0496126_0011982
2635 Ga0496126_0017284
2636 Ga0496126_0018434
2637 Ga0496126_0050363
2638 Ga0496126_0060206
2639 Ga0496126_0080523
2640 Ga0496126_0086649
2641 Ga0496126_1012005
2642 Ga0495678_000062
2643 Ga0495678_025362
2644 Ga0495682_0000283
2645 Ga0495682_0000341
2646 Ga0495682_0000372
2647 Ga0495682_0013547
2648 Ga0501031_0002957
2649 Ga0501031_0016767
2650 Ga0501031_0047333
2651 Ga0501031_0076103
2652 Ga0501031_0117963
2653 Ga0501031_0207521
2654 Ga0501031_0357314
2655 Ga0501032_0000485
2656 Ga0501032_0004538
2657 Ga0501032_0007187
2658 Ga0501032_0042745
2659 Ga0501032_0100806
2660 Ga0501032_0174762
2661 Ga0501032_0225935
2662 Ga0501032_0589179
2663 Ga0501033_0002332
2664 Ga0501033_0002853
2665 Ga0501033_0004295
2666 Ga0501033_0005340
2667 Ga0501033_0036768
2668 Ga0501033_0265859
2669 Ga0501034_0000544
2670 Ga0501034_0001449
2671 Ga0501034_0004230
2672 Ga0501034_0006520
2673 Ga0501034_0006867
2674 Ga0501034_0010307
2675 Ga0501034_0012391
2676 Ga0501034_0042361
2677 Ga0501034_0056437
2678 Ga0501034_0073006
2679 Ga0501034_0125919
2680 Ga0501034_0141390
2681 Ga0501034_0294235
2682 Ga0501034_0356522
2683 Ga0501034_0778465
2684 Ga0501036_0008476
2685 Ga0501036_0047433
2686 Ga0501036_0108054
2687 Ga0501036_0375127
2688 Ga0501036_0579029
2689 Ga0501036_0739410
2690 Ga0501036_0794192
2691 Ga0501037_0004806
2692 Ga0501037_0028275
2693 Ga0501037_0091448
2694 Ga0501037_0096898
2695 Ga0501037_0104567
2696 Ga0501037_0206295
2697 Ga0501037_0360052
2698 Ga0501037_0388123
2699 Ga0501037_0413500
2700 Ga0501038_0000251
2701 Ga0501038_0006634
2702 Ga0501038_0011631
2703 Ga0501038_0023411
2704 Ga0501038_0220810
2705 Ga0501038_0222956
2706 Ga0501038_0489651
2707 Ga0501039_0007491
2708 Ga0501039_0055978
2709 Ga0501039_0073969
2710 Ga0501039_0144966
2711 Ga0501039_0195532
2712 Ga0501039_0223697
2713 Ga0501040_0118373
2714 Ga0501042_0398761
2715 Ga0501043_0003128
2716 Ga0501043_0003723
2717 Ga0501043_0009046
2718 Ga0501043_0014418
2719 Ga0501043_0017421
2720 Ga0501043_0019309
2721 Ga0501043_0063840
2722 Ga0501043_0129292
2723 Ga0501043_0208162
2724 Ga0501043_0252463
2725 Ga0501046_0009056
2726 Ga0501046_0013125
2727 Ga0501046_0015580
2728 Ga0501046_0024091
2729 Ga0501046_0093130
2730 Ga0501046_0124060
2731 Ga0501046_0156218
2732 Ga0501047_0000250
2733 Ga0501047_0002064
2734 Ga0501047_0004581
2735 Ga0501047_0008714
2736 Ga0501047_0050558
2737 Ga0501047_0143168
2738 Ga0501047_0167971
2739 Ga0501047_0219175
2740 Ga0501047_0220542
2741 Ga0501047_0299928
2742 Ga0501047_0311134
2743 Ga0501047_0412210
2744 Ga0501048_0017672
2745 Ga0501048_0039385
2746 Ga0501048_0112774
2747 Ga0501067_0000560
2748 Ga0501067_0008269
2749 Ga0501068_0016281
2750 Ga0501068_0031539
2751 Ga0501068_0094355
2752 Ga0501068_0094652
2753 Ga0501068_0399129
2754 Ga0501069_0016989
2755 Ga0501069_0018450
2756 Ga0501069_0024864
2757 Ga0501069_0045605
2758 Ga0501070_0003399
2759 Ga0501070_0022970
2760 Ga0501070_0026818
2761 Ga0501070_0080766
2762 Ga0501070_0149339
2763 Ga0501070_0157905
2764 Ga0501070_0240087
2765 Ga0501070_0263973
2766 Ga0501070_0727883
2767 Ga0501071_0040096
2768 Ga0501071_0205648
2769 Ga0501072_0003501
2770 Ga0501072_0016955
2771 Ga0501073_0001096
2772 Ga0501073_0003002
2773 Ga0501073_0004205
2774 Ga0501073_0110334
2775 Ga0501073_0230488
2776 Ga0501073_0351642
2777 Ga0501073_0360338
2778 Ga0501073_0658082
2779 Ga0501074_0019562
2780 Ga0501074_0034353
2781 Ga0501074_0035175
2782 Ga0501074_0049890
2783 Ga0501074_0058058
2784 Ga0501074_0067221
2785 Ga0501074_0110530
2786 Ga0501076_0571329
2787 Ga0501077_0360496
2788 Ga0501077_0393926
2789 Ga0501202_016651
2790 Ga0501079_0112934
2791 Ga0501079_0120832
2792 Ga0501079_0183846
2793 Ga0501079_0270545
2794 Ga0501079_0385713
2795 Ga0501080_0000306
2796 Ga0501080_0000320
2797 Ga0501080_0001885
2798 Ga0501080_0038508
2799 Ga0501080_0051615
2800 Ga0501080_0060509
2801 Ga0501080_0095289
2802 Ga0501080_0126272
2803 Ga0501080_0197515
2804 Ga0501080_0775118
2805 Ga0501081_0086682
2806 Ga0501083_0007488
2807 Ga0501083_0068982
2808 Ga0501266_011828
2809 Ga0501269_035278
2810 Ga0501035_0009752
2811 Ga0501035_0016886
2812 Ga0501035_0017379
2813 Ga0501035_0025209
2814 Ga0501035_0026599
2815 Ga0501035_0034014
2816 Ga0501035_0050395
2817 Ga0501035_0055280
2818 Ga0501035_0111994
2819 Ga0501035_0385476
2820 Ga0501035_0723091
2821 Ga0501035_0780814
2822 Ga0501044_0003969
2823 Ga0501044_0005486
2824 Ga0501044_0017657
2825 Ga0501044_0028186
2826 Ga0501044_0075598
2827 Ga0501044_0107242
2828 Ga0501044_0108743
2829 Ga0501044_0140742
2830 Ga0501044_0143207
2831 Ga0501044_0174273
2832 Ga0501044_0225483
2833 Ga0501044_0295543
2834 Ga0501044_0304012
2835 Ga0501044_0323959
2836 Ga0501044_0400469
2837 Ga0501044_0462230
2838 Ga0501044_0926429
2839 Ga0501044_1144822
2840 Ga0501045_0144308
2841 Ga0501045_0591876
2842 nmdc:mga05p37_32385_c1
2843 nmdc:mga09592_180455_c1
2844 nmdc:mga0sz30_16282_c1
2845 Ga0500610_0003017
2846 Ga0495619_0081142
2847 Ga0500643_001605
2848 Ga0500643_008552
2849 Ga0500643_008927
2850 Ga0500651_0002320
2851 Ga0500651_0015083
2852 Ga0500566_0191366
2853 Ga0500641_0017442
2854 Ga0500555_000235
2855 Ga0500562_042424
2856 Ga0500597_000019
2857 Ga0500628_146496
2858 Ga0500658_0005949
2859 Ga0500559_0281522
2860 Ga0500568_0001313
2861 Ga0500577_0003758
2862 Ga0500616_0044457
2863 Ga0500636_0389787
2864 Ga0500645_000167
2865 Ga0501084_0015131
2866 Ga0501084_0414703
2867 Ga0501084_0645659
2868 Ga0587073_0046370
2869 Ga0501082_0000394
2870 Ga0501082_0093743
2871 Ga0501082_0124847
2872 Ga0501082_0326672
2873 Ga0466962_0001724
2874 Ga0466962_0005053
2875 2538833768
2876 2572255430
2877 2595447285
2878 2595450067
2879 2600225624
2880 2643831102
2881 2643881487
2882 2643896863
2883 2644049895
2884 2644203319
2885 2644479067
2886 2644497671
2887 2644507094
2888 2644662624
2889 2644698422
2890 2687581894
2891 2739227158
2892 2739729813
2893 2819565670
2894 2819613378
2895 2837680697
2896 2842918322
2897 2884339425
2898 2884416050
2899 2894819112
2900 2895396287
2901 2904465954
2902 2919406608
2903 2928966003
2904 2939614796
2905 2941473178
2906 2953995650
2907 2989774652
2908 8002869637

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

19

190

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9803 1 176
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9798 2 179
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9735 2 179
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9693 1 176
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9681 2 180
ID Description Score Start End Superfamily
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9596 2 179 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9595 3 179 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9591 1 177 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9523 3 180 2.60.120.10
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9492 12 180 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2P5LJ26-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9958 2 143 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A435TQB2-F1-model_v4 deleted 0.9953 1 159
AF-A0A2T0RTK2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9931 2 186 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A069E616-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.993 1 186 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7W6WAL4-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9926 3 186 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Map