F494076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1454 | 488 | 2908 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100169478|Ga0070674_1001694782 |
| Length | 200 |
| Sequence | MPPICVGERTRSVLIEVRPLGLDGVLEIRPRRLRDDRGFFSETWNEREFRDAGIDVSFVQDNHSLSREPGVLRGLHFQAPPFAQDKLIRVSRGSVFDVAVDIRSGSPTFGRWAAAILSAENKRHFWIPEGFAHGFAVLSDYATFSYQCTALYDHSADAAVRWNDGDIAVDWPISAPLLSVKDQRAPFLRDIPHGRLPAFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 20 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 21 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 95 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 117 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 121 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 122 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 141 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 146 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 242 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 244 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 245 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 249 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 250 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 251 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 262 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 263 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 264 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 277 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 278 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 282 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 283 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 284 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 285 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 290 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 291 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 292 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 293 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 294 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 295 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 296 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 297 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 298 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 299 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 300 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 301 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 302 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 303 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 304 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 305 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 306 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 307 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 308 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 309 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 310 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 311 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 312 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 313 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 314 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 315 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 316 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 317 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 318 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 319 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 320 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 321 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 322 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 323 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 324 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 376 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 377 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 378 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 379 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 381 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 382 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 383 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 384 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 385 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 386 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 387 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 388 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 389 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 390 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 391 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 392 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 393 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 394 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 395 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 422 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 427 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 428 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 435 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 437 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 438 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 439 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 441 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 442 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 443 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 444 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 446 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 447 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 448 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 449 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 450 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 451 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 455 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 456 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 457 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 458 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 459 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 460 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 461 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 462 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 463 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 464 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 465 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 466 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 467 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 468 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 469 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 470 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 471 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 472 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 473 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 474 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 475 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 476 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 477 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 478 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 479 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 480 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 481 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 482 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 483 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 484 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 485 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 486 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 487 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 488 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.32 |
| Metatranscriptomes | 0.34 |
| Isolates | 2.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.9 |
| Nodule | 0 |
| Rhizoplane | 2.82 |
| Rhizosphere | 78.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070674_100169478 | 3300005356 | Bacteria | 1663 |
| 2 | JGI24740J21852_10000320 | 3300001979 | Bacteria | 20427 |
| 3 | JGI24740J21852_10003591 | 3300001979 | Bacteria | 6767 |
| 4 | JGI24739J22299_10009127 | 3300001989 | Bacteria | 3700 |
| 5 | JGI24739J22299_10045170 | 3300001989 | Bacteria | 1447 |
| 6 | JGI24737J22298_10002818 | 3300001990 | Bacteria | 6157 |
| 7 | JGI24737J22298_10002923 | 3300001990 | Bacteria | 6053 |
| 8 | JGI24735J21928_10000210 | 3300002067 | Bacteria | 20437 |
| 9 | JGI24735J21928_10008070 | 3300002067 | Bacteria | 3418 |
| 10 | JGI24738J21930_10000630 | 3300002075 | Bacteria | 10160 |
| 11 | JGI25162J39368_1000072 | 3300002737 | Bacteria | 122550 |
| 12 | JGI25162J39368_1000403 | 3300002737 | Bacteria | 35711 |
| 13 | JGI25162J39368_1000450 | 3300002737 | Bacteria | 32392 |
| 14 | JGI25154J39366_1005804 | 3300002738 | Bacteria | 1905 |
| 15 | JGI25157J39369_1000143 | 3300002741 | Bacteria | 60517 |
| 16 | JGI25157J39369_1000145 | 3300002741 | Bacteria | 60335 |
| 17 | JGI25157J39369_1000210 | 3300002741 | Bacteria | 48631 |
| 18 | JGI25163J39215_1000608 | 3300002771 | Bacteria | 9915 |
| 19 | JGI25164J39214_1000115 | 3300002772 | Bacteria | 77050 |
| 20 | JGI25164J39214_1000122 | 3300002772 | Bacteria | 74977 |
| 21 | JGI25164J39214_1000276 | 3300002772 | Bacteria | 37292 |
| 22 | JGI25164J39214_1000360 | 3300002772 | Bacteria | 27828 |
| 23 | JGI25164J39214_1000479 | 3300002772 | Bacteria | 19723 |
| 24 | JGI25151J46595_10000165 | 3300003187 | Bacteria | 85521 |
| 25 | JGI25151J46595_10012116 | 3300003187 | Bacteria | 3931 |
| 26 | JGI25165J46597_1000063 | 3300003214 | Bacteria | 205051 |
| 27 | JGI25165J46597_1000241 | 3300003214 | Bacteria | 74955 |
| 28 | JGI25165J46597_1000419 | 3300003214 | Bacteria | 43972 |
| 29 | JGI25165J46597_1001372 | 3300003214 | Bacteria | 13423 |
| 30 | JGI25165J46597_1007774 | 3300003214 | Bacteria | 1745 |
| 31 | JGI25153J46596_10024928 | 3300003215 | Bacteria | 2147 |
| 32 | rootH1_10024742 | 3300003316 | Bacteria | 3058 |
| 33 | rootH1_10071835 | 3300003316 | Bacteria | 4198 |
| 34 | rootH1_10110832 | 3300003316 | Bacteria | 3620 |
| 35 | rootH2_10063162 | 3300003320 | Bacteria | 4812 |
| 36 | rootL2_10006308 | 3300003322 | Bacteria | 4060 |
| 37 | rootL2_10061895 | 3300003322 | Bacteria | 1357 |
| 38 | rootL2_10246862 | 3300003322 | Bacteria | 1747 |
| 39 | rootH1_10327385 | 3300003323 | Bacteria | 2908 |
| 40 | JGI26145J50221_1002765 | 3300003371 | Bacteria | 1379 |
| 41 | Ga0006562J51391_1027422 | 3300003578 | Bacteria | 7490 |
| 42 | Ga0055538_1004437 | 3300003751 | Bacteria | 1593 |
| 43 | Ga0055539_1002939 | 3300003752 | Bacteria | 2468 |
| 44 | Ga0055533_1000338 | 3300003756 | Bacteria | 20556 |
| 45 | Ga0055525_1000135 | 3300003759 | Bacteria | 108217 |
| 46 | Ga0055527_1000043 | 3300003760 | Bacteria | 113506 |
| 47 | Ga0055527_1000079 | 3300003760 | Bacteria | 79303 |
| 48 | Ga0055535_1000068 | 3300003761 | Bacteria | 115329 |
| 49 | Ga0055535_1000071 | 3300003761 | Bacteria | 113506 |
| 50 | Ga0055535_1000166 | 3300003761 | Bacteria | 71280 |
| 51 | Ga0055535_1017601 | 3300003761 | Bacteria | 949 |
| 52 | Ga0055542_1000090 | 3300003762 | Bacteria | 122550 |
| 53 | Ga0055542_1000096 | 3300003762 | Bacteria | 118398 |
| 54 | Ga0055542_1000210 | 3300003762 | Bacteria | 71284 |
| 55 | Ga0055529_1000084 | 3300003763 | Bacteria | 143720 |
| 56 | Ga0055529_1000114 | 3300003763 | Bacteria | 118398 |
| 57 | Ga0055529_1000394 | 3300003763 | Bacteria | 46666 |
| 58 | Ga0055529_1003020 | 3300003763 | Bacteria | 2950 |
| 59 | Ga0055526_1000008 | 3300003771 | Bacteria | 300059 |
| 60 | Ga0055526_1056385 | 3300003771 | Bacteria | 861 |
| 61 | Ga0055524_1002861 | 3300003775 | Bacteria | 8653 |
| 62 | Ga0055524_1002910 | 3300003775 | Bacteria | 8556 |
| 63 | Ga0055536_1002163 | 3300003781 | Bacteria | 11201 |
| 64 | Ga0055536_1003562 | 3300003781 | Bacteria | 8325 |
| 65 | Ga0055528_1044392 | 3300003790 | Bacteria | 957 |
| 66 | Ga0055530_10001268 | 3300003791 | Bacteria | 19106 |
| 67 | Ga0055531_10004683 | 3300003794 | Bacteria | 8197 |
| 68 | Ga0055531_10007280 | 3300003794 | Bacteria | 6072 |
| 69 | Ga0058692_1000040 | 3300003856 | Bacteria | 132805 |
| 70 | Ga0065165_1003771 | 3300005262 | Bacteria | 10154 |
| 71 | Ga0065704_10087117 | 3300005289 | Bacteria | 3054 |
| 72 | Ga0065715_10001173 | 3300005293 | Bacteria | 11480 |
| 73 | Ga0065715_10268777 | 3300005293 | Bacteria | 1117 |
| 74 | Ga0070658_10001469 | 3300005327 | Bacteria | 20090 |
| 75 | Ga0070658_10324163 | 3300005327 | Bacteria | 1316 |
| 76 | Ga0070658_10412723 | 3300005327 | Bacteria | 1160 |
| 77 | Ga0070676_10018581 | 3300005328 | Bacteria | 3855 |
| 78 | Ga0070683_100148589 | 3300005329 | Bacteria | 2221 |
| 79 | Ga0070683_100705389 | 3300005329 | Bacteria | 966 |
| 80 | Ga0070670_100051522 | 3300005331 | Bacteria | 3535 |
| 81 | Ga0070670_100082595 | 3300005331 | Bacteria | 2761 |
| 82 | Ga0070670_100156808 | 3300005331 | Bacteria | 1972 |
| 83 | Ga0070670_100476960 | 3300005331 | Bacteria | 1107 |
| 84 | Ga0070670_100780618 | 3300005331 | Bacteria | 862 |
| 85 | Ga0070670_101066703 | 3300005331 | Bacteria | 736 |
| 86 | Ga0070677_10092159 | 3300005333 | Bacteria | 1320 |
| 87 | Ga0068869_100117424 | 3300005334 | Bacteria | 2031 |
| 88 | Ga0068869_100123858 | 3300005334 | Bacteria | 1980 |
| 89 | Ga0068869_100161403 | 3300005334 | Bacteria | 1745 |
| 90 | Ga0070666_10000010 | 3300005335 | Bacteria | 264789 |
| 91 | Ga0070666_10027007 | 3300005335 | Bacteria | 3756 |
| 92 | Ga0070666_10028601 | 3300005335 | Bacteria | 3659 |
| 93 | Ga0070666_10092942 | 3300005335 | Bacteria | 2074 |
| 94 | Ga0070666_10111766 | 3300005335 | Bacteria | 1890 |
| 95 | Ga0070666_10115168 | 3300005335 | Bacteria | 1862 |
| 96 | Ga0070666_10345067 | 3300005335 | Bacteria | 1064 |
| 97 | Ga0070680_100264546 | 3300005336 | Bacteria | 1455 |
| 98 | Ga0070680_100822370 | 3300005336 | Bacteria | 801 |
| 99 | Ga0070682_100363557 | 3300005337 | Bacteria | 1083 |
| 100 | Ga0070682_100546560 | 3300005337 | Bacteria | 906 |
| 101 | Ga0070682_100791487 | 3300005337 | Bacteria | 769 |
| 102 | Ga0068868_100088396 | 3300005338 | Bacteria | 2494 |
| 103 | Ga0068868_100139242 | 3300005338 | Bacteria | 1991 |
| 104 | Ga0068868_100360665 | 3300005338 | Bacteria | 1247 |
| 105 | Ga0070660_100071494 | 3300005339 | Bacteria | 2709 |
| 106 | Ga0070660_100136540 | 3300005339 | Bacteria | 1965 |
| 107 | Ga0070660_100886085 | 3300005339 | Bacteria | 752 |
| 108 | Ga0070689_100002138 | 3300005340 | Bacteria | 12816 |
| 109 | Ga0070689_100260673 | 3300005340 | Bacteria | 1433 |
| 110 | Ga0070689_100940146 | 3300005340 | Bacteria | 766 |
| 111 | Ga0070661_100008137 | 3300005344 | Bacteria | 7233 |
| 112 | Ga0070661_100139444 | 3300005344 | Bacteria | 1826 |
| 113 | Ga0070661_100233097 | 3300005344 | Bacteria | 1415 |
| 114 | Ga0070692_10003879 | 3300005345 | Bacteria | 6161 |
| 115 | Ga0070668_100049024 | 3300005347 | Bacteria | 3249 |
| 116 | Ga0070668_100649769 | 3300005347 | Bacteria | 927 |
| 117 | Ga0070669_100042491 | 3300005353 | Bacteria | 3308 |
| 118 | Ga0070669_100168407 | 3300005353 | Bacteria | 1707 |
| 119 | Ga0070675_100043062 | 3300005354 | Bacteria | 3688 |
| 120 | Ga0070675_100638317 | 3300005354 | Bacteria | 967 |
| 121 | Ga0070671_100112479 | 3300005355 | Bacteria | 2287 |
| 122 | Ga0070671_100204590 | 3300005355 | Bacteria | 1674 |
| 123 | Ga0070671_100281894 | 3300005355 | Bacteria | 1413 |
| 124 | Ga0070674_100096591 | 3300005356 | Bacteria | 2144 |
| 125 | Ga0070673_100050203 | 3300005364 | Bacteria | 3261 |
| 126 | Ga0070673_100257204 | 3300005364 | Bacteria | 1524 |
| 127 | Ga0070659_100000052 | 3300005366 | Bacteria | 96862 |
| 128 | Ga0070659_100004887 | 3300005366 | Bacteria | 9579 |
| 129 | Ga0070667_100000150 | 3300005367 | Bacteria | 86639 |
| 130 | Ga0070667_100034011 | 3300005367 | Bacteria | 4264 |
| 131 | Ga0070667_100075009 | 3300005367 | Bacteria | 2887 |
| 132 | Ga0070667_100087613 | 3300005367 | Bacteria | 2672 |
| 133 | Ga0070667_100276494 | 3300005367 | Bacteria | 1507 |
| 134 | Ga0070667_100305366 | 3300005367 | Bacteria | 1433 |
| 135 | Ga0070667_100348682 | 3300005367 | Bacteria | 1340 |
| 136 | Ga0070667_100454628 | 3300005367 | Bacteria | 1170 |
| 137 | Ga0070667_100831502 | 3300005367 | Bacteria | 858 |
| 138 | Ga0070667_100973834 | 3300005367 | Bacteria | 791 |
| 139 | Ga0070714_100000393 | 3300005435 | Bacteria | 32554 |
| 140 | Ga0070714_100000605 | 3300005435 | Bacteria | 25685 |
| 141 | Ga0070713_100061037 | 3300005436 | Bacteria | 3154 |
| 142 | Ga0070711_100095752 | 3300005439 | Bacteria | 2149 |
| 143 | Ga0070711_100385734 | 3300005439 | Bacteria | 1134 |
| 144 | Ga0070694_101277709 | 3300005444 | Bacteria | 617 |
| 145 | Ga0070708_100139302 | 3300005445 | Bacteria | 2249 |
| 146 | Ga0070663_100000029 | 3300005455 | Bacteria | 82128 |
| 147 | Ga0070663_100021862 | 3300005455 | Bacteria | 4263 |
| 148 | Ga0070663_100037071 | 3300005455 | Bacteria | 3392 |
| 149 | Ga0070663_100172190 | 3300005455 | Bacteria | 1674 |
| 150 | Ga0070663_100240101 | 3300005455 | Bacteria | 1430 |
| 151 | Ga0070663_100289513 | 3300005455 | Bacteria | 1308 |
| 152 | Ga0070663_100737947 | 3300005455 | Bacteria | 840 |
| 153 | Ga0070663_101065424 | 3300005455 | Bacteria | 705 |
| 154 | Ga0070678_100041709 | 3300005456 | Bacteria | 3256 |
| 155 | Ga0070678_100127460 | 3300005456 | Bacteria | 2017 |
| 156 | Ga0070678_100149741 | 3300005456 | Bacteria | 1878 |
| 157 | Ga0070678_100157470 | 3300005456 | Unclassified | 1836 |
| 158 | Ga0070662_100021500 | 3300005457 | Bacteria | 4406 |
| 159 | Ga0070662_100549394 | 3300005457 | Bacteria | 968 |
| 160 | Ga0070662_100844592 | 3300005457 | Bacteria | 780 |
| 161 | Ga0070681_10028025 | 3300005458 | Bacteria | 5661 |
| 162 | Ga0070681_10046264 | 3300005458 | Bacteria | 4351 |
| 163 | Ga0070681_10074465 | 3300005458 | Bacteria | 3356 |
| 164 | Ga0070681_10352224 | 3300005458 | Bacteria | 1383 |
| 165 | Ga0070681_10537320 | 3300005458 | Bacteria | 1083 |
| 166 | Ga0070681_10959932 | 3300005458 | Bacteria | 774 |
| 167 | Ga0068867_100012849 | 3300005459 | Bacteria | 5926 |
| 168 | Ga0068867_101047542 | 3300005459 | Bacteria | 742 |
| 169 | Ga0070685_10000832 | 3300005466 | Bacteria | 16796 |
| 170 | Ga0070685_10098205 | 3300005466 | Bacteria | 1784 |
| 171 | Ga0070679_100323628 | 3300005530 | Bacteria | 1491 |
| 172 | Ga0070679_100338414 | 3300005530 | Bacteria | 1453 |
| 173 | Ga0070679_100354016 | 3300005530 | Bacteria | 1416 |
| 174 | Ga0070679_100378948 | 3300005530 | Bacteria | 1361 |
| 175 | Ga0070679_100494921 | 3300005530 | Bacteria | 1167 |
| 176 | Ga0070679_100677980 | 3300005530 | Bacteria | 973 |
| 177 | Ga0070684_100194805 | 3300005535 | Bacteria | 1845 |
| 178 | Ga0070684_100555778 | 3300005535 | Bacteria | 1065 |
| 179 | Ga0068853_100002537 | 3300005539 | Bacteria | 13707 |
| 180 | Ga0068853_100002647 | 3300005539 | Bacteria | 13496 |
| 181 | Ga0068853_100027321 | 3300005539 | Bacteria | 4794 |
| 182 | Ga0068853_100035136 | 3300005539 | Bacteria | 4256 |
| 183 | Ga0068853_100035959 | 3300005539 | Bacteria | 4209 |
| 184 | Ga0068853_100054340 | 3300005539 | Bacteria | 3451 |
| 185 | Ga0068853_100120542 | 3300005539 | Bacteria | 2339 |
| 186 | Ga0068853_100139422 | 3300005539 | Bacteria | 2176 |
| 187 | Ga0068853_100406214 | 3300005539 | Bacteria | 1275 |
| 188 | Ga0068853_100436905 | 3300005539 | Bacteria | 1229 |
| 189 | Ga0068853_100442893 | 3300005539 | Bacteria | 1221 |
| 190 | Ga0068853_100599738 | 3300005539 | Bacteria | 1046 |
| 191 | Ga0068853_100600373 | 3300005539 | Bacteria | 1045 |
| 192 | Ga0070672_100013517 | 3300005543 | Bacteria | 5770 |
| 193 | Ga0070672_100167090 | 3300005543 | Bacteria | 1828 |
| 194 | Ga0070672_100480680 | 3300005543 | Bacteria | 1073 |
| 195 | Ga0070672_100597666 | 3300005543 | Bacteria | 961 |
| 196 | Ga0070696_100006208 | 3300005546 | Bacteria | 7994 |
| 197 | Ga0070696_100031859 | 3300005546 | Bacteria | 3615 |
| 198 | Ga0070696_100641700 | 3300005546 | Bacteria | 860 |
| 199 | Ga0070696_100736094 | 3300005546 | Bacteria | 807 |
| 200 | Ga0070693_100005217 | 3300005547 | Bacteria | 6217 |
| 201 | Ga0070693_100088297 | 3300005547 | Bacteria | 1864 |
| 202 | Ga0070693_100164722 | 3300005547 | Bacteria | 1415 |
| 203 | Ga0070693_100331569 | 3300005547 | Bacteria | 1036 |
| 204 | Ga0070693_100446041 | 3300005547 | Bacteria | 907 |
| 205 | Ga0070665_100000026 | 3300005548 | Bacteria | 365176 |
| 206 | Ga0070665_100001464 | 3300005548 | Bacteria | 27669 |
| 207 | Ga0070665_100004807 | 3300005548 | Bacteria | 14040 |
| 208 | Ga0070665_100020504 | 3300005548 | Bacteria | 6639 |
| 209 | Ga0070665_100084135 | 3300005548 | Bacteria | 3186 |
| 210 | Ga0070665_100242107 | 3300005548 | Bacteria | 1804 |
| 211 | Ga0070665_100585482 | 3300005548 | Bacteria | 1129 |
| 212 | Ga0070665_100710045 | 3300005548 | Bacteria | 1018 |
| 213 | Ga0070665_101291684 | 3300005548 | Bacteria | 740 |
| 214 | Ga0068855_100000696 | 3300005563 | Bacteria | 41094 |
| 215 | Ga0068855_100010588 | 3300005563 | Bacteria | 11117 |
| 216 | Ga0068855_100057884 | 3300005563 | Bacteria | 4542 |
| 217 | Ga0068855_100057944 | 3300005563 | Bacteria | 4539 |
| 218 | Ga0068855_100176858 | 3300005563 | Bacteria | 2414 |
| 219 | Ga0068855_100177473 | 3300005563 | Bacteria | 2409 |
| 220 | Ga0068855_100431851 | 3300005563 | Bacteria | 1440 |
| 221 | Ga0068855_100538940 | 3300005563 | Bacteria | 1265 |
| 222 | Ga0068855_100690164 | 3300005563 | Bacteria | 1093 |
| 223 | Ga0068855_100698421 | 3300005563 | Bacteria | 1086 |
| 224 | Ga0068855_100740982 | 3300005563 | Bacteria | 1048 |
| 225 | Ga0068855_100818438 | 3300005563 | Bacteria | 989 |
| 226 | Ga0068855_101124889 | 3300005563 | Bacteria | 820 |
| 227 | Ga0068855_101256879 | 3300005563 | Bacteria | 768 |
| 228 | Ga0070664_100085989 | 3300005564 | Bacteria | 2717 |
| 229 | Ga0070664_100177381 | 3300005564 | Bacteria | 1892 |
| 230 | Ga0070664_100184175 | 3300005564 | Bacteria | 1858 |
| 231 | Ga0070664_100292013 | 3300005564 | Bacteria | 1472 |
| 232 | Ga0068857_100014664 | 3300005577 | Bacteria | 6836 |
| 233 | Ga0068857_100041837 | 3300005577 | Bacteria | 4063 |
| 234 | Ga0068857_100164117 | 3300005577 | Bacteria | 2016 |
| 235 | Ga0068857_100230568 | 3300005577 | Bacteria | 1693 |
| 236 | Ga0068857_100300958 | 3300005577 | Bacteria | 1478 |
| 237 | Ga0068857_100426015 | 3300005577 | Bacteria | 1238 |
| 238 | Ga0068857_100661245 | 3300005577 | Bacteria | 991 |
| 239 | Ga0068857_100700902 | 3300005577 | Bacteria | 962 |
| 240 | Ga0068854_100000282 | 3300005578 | Bacteria | 34044 |
| 241 | Ga0068854_100006540 | 3300005578 | Bacteria | 7417 |
| 242 | Ga0068854_100006900 | 3300005578 | Bacteria | 7243 |
| 243 | Ga0068854_100051750 | 3300005578 | Bacteria | 2943 |
| 244 | Ga0068854_100104414 | 3300005578 | Bacteria | 2129 |
| 245 | Ga0068854_100202049 | 3300005578 | Bacteria | 1563 |
| 246 | Ga0068856_100000022 | 3300005614 | Bacteria | 142768 |
| 247 | Ga0068856_100013211 | 3300005614 | Bacteria | 7997 |
| 248 | Ga0068856_100036502 | 3300005614 | Bacteria | 4818 |
| 249 | Ga0068856_100119510 | 3300005614 | Bacteria | 2636 |
| 250 | Ga0068856_100164207 | 3300005614 | Bacteria | 2231 |
| 251 | Ga0068856_100191212 | 3300005614 | Bacteria | 2060 |
| 252 | Ga0068856_101036380 | 3300005614 | Bacteria | 838 |
| 253 | Ga0068852_100006662 | 3300005616 | Bacteria | 8370 |
| 254 | Ga0068852_100071081 | 3300005616 | Bacteria | 3055 |
| 255 | Ga0068852_100081782 | 3300005616 | Bacteria | 2868 |
| 256 | Ga0068852_100176951 | 3300005616 | Bacteria | 2004 |
| 257 | Ga0068852_100373403 | 3300005616 | Bacteria | 1397 |
| 258 | Ga0068852_100393746 | 3300005616 | Bacteria | 1361 |
| 259 | Ga0068852_100542980 | 3300005616 | Bacteria | 1162 |
| 260 | Ga0068852_100569515 | 3300005616 | Bacteria | 1134 |
| 261 | Ga0068852_100716187 | 3300005616 | Bacteria | 1011 |
| 262 | Ga0068852_101337712 | 3300005616 | Bacteria | 738 |
| 263 | Ga0068859_100001840 | 3300005617 | Bacteria | 21596 |
| 264 | Ga0068859_101588311 | 3300005617 | Bacteria | 722 |
| 265 | Ga0068864_100014730 | 3300005618 | Bacteria | 6495 |
| 266 | Ga0068864_100112829 | 3300005618 | Bacteria | 2423 |
| 267 | Ga0068864_100177450 | 3300005618 | Bacteria | 1946 |
| 268 | Ga0068864_100874382 | 3300005618 | Bacteria | 887 |
| 269 | Ga0068861_100087634 | 3300005719 | Bacteria | 2450 |
| 270 | Ga0068861_100755419 | 3300005719 | Bacteria | 909 |
| 271 | Ga0068861_100939318 | 3300005719 | Bacteria | 822 |
| 272 | Ga0068851_10006767 | 3300005834 | Bacteria | 5246 |
| 273 | Ga0068851_10011459 | 3300005834 | Bacteria | 4159 |
| 274 | Ga0068851_10021594 | 3300005834 | Bacteria | 3125 |
| 275 | Ga0068851_10036620 | 3300005834 | Bacteria | 2457 |
| 276 | Ga0068851_10059334 | 3300005834 | Bacteria | 1957 |
| 277 | Ga0068870_10051228 | 3300005840 | Bacteria | 2185 |
| 278 | Ga0068863_100004653 | 3300005841 | Bacteria | 13528 |
| 279 | Ga0068863_100005490 | 3300005841 | Bacteria | 12479 |
| 280 | Ga0068863_100014974 | 3300005841 | Bacteria | 7449 |
| 281 | Ga0068863_100050734 | 3300005841 | Bacteria | 3932 |
| 282 | Ga0068863_100098184 | 3300005841 | Bacteria | 2781 |
| 283 | Ga0068863_100624224 | 3300005841 | Bacteria | 1068 |
| 284 | Ga0068863_100818070 | 3300005841 | Bacteria | 929 |
| 285 | Ga0068863_101260885 | 3300005841 | Bacteria | 745 |
| 286 | Ga0068858_100001617 | 3300005842 | Bacteria | 22975 |
| 287 | Ga0068858_100151636 | 3300005842 | Bacteria | 2180 |
| 288 | Ga0068858_100260609 | 3300005842 | Bacteria | 1648 |
| 289 | Ga0068858_100304790 | 3300005842 | Bacteria | 1520 |
| 290 | Ga0068858_100509095 | 3300005842 | Bacteria | 1163 |
| 291 | Ga0068858_100567874 | 3300005842 | Bacteria | 1099 |
| 292 | Ga0068858_100622788 | 3300005842 | Bacteria | 1048 |
| 293 | Ga0068860_100025971 | 3300005843 | Bacteria | 5650 |
| 294 | Ga0068860_100031104 | 3300005843 | Bacteria | 5132 |
| 295 | Ga0068860_100108654 | 3300005843 | Bacteria | 2651 |
| 296 | Ga0068860_100708139 | 3300005843 | Bacteria | 1017 |
| 297 | Ga0068860_100926207 | 3300005843 | Bacteria | 888 |
| 298 | Ga0068860_101226300 | 3300005843 | Bacteria | 770 |
| 299 | Ga0068862_100000185 | 3300005844 | Bacteria | 68550 |
| 300 | Ga0068862_100175378 | 3300005844 | Bacteria | 1921 |
| 301 | Ga0081455_10296262 | 3300005937 | Bacteria | 1162 |
| 302 | Ga0075364_10015606 | 3300006051 | Bacteria | 4713 |
| 303 | Ga0070715_10095572 | 3300006163 | Bacteria | 1376 |
| 304 | Ga0070712_100398115 | 3300006175 | Bacteria | 1137 |
| 305 | Ga0075369_10187921 | 3300006186 | Bacteria | 951 |
| 306 | Ga0075366_10016389 | 3300006195 | Bacteria | 4258 |
| 307 | Ga0097621_100019859 | 3300006237 | Bacteria | 5168 |
| 308 | Ga0097621_100021471 | 3300006237 | Bacteria | 4995 |
| 309 | Ga0097621_100038212 | 3300006237 | Bacteria | 3852 |
| 310 | Ga0097621_100133587 | 3300006237 | Bacteria | 2114 |
| 311 | Ga0097621_100167732 | 3300006237 | Bacteria | 1891 |
| 312 | Ga0097621_100483758 | 3300006237 | Bacteria | 1119 |
| 313 | Ga0097621_101517032 | 3300006237 | Bacteria | 636 |
| 314 | Ga0068871_100059368 | 3300006358 | Bacteria | 3116 |
| 315 | Ga0068871_100064765 | 3300006358 | Bacteria | 2992 |
| 316 | Ga0068871_100119581 | 3300006358 | Bacteria | 2224 |
| 317 | Ga0068871_100236037 | 3300006358 | Bacteria | 1588 |
| 318 | Ga0068871_100254438 | 3300006358 | Bacteria | 1531 |
| 319 | Ga0068871_100825699 | 3300006358 | Bacteria | 856 |
| 320 | Ga0075428_100116793 | 3300006844 | Bacteria | 2906 |
| 321 | Ga0075428_100371580 | 3300006844 | Bacteria | 1533 |
| 322 | Ga0075429_100333234 | 3300006880 | Bacteria | 1328 |
| 323 | Ga0068865_100013181 | 3300006881 | Bacteria | 5218 |
| 324 | Ga0068865_100096192 | 3300006881 | Bacteria | 2159 |
| 325 | Ga0068865_100131071 | 3300006881 | Bacteria | 1879 |
| 326 | Ga0068865_100208584 | 3300006881 | Bacteria | 1521 |
| 327 | Ga0097620_100001840 | 3300006931 | Bacteria | 21596 |
| 328 | Ga0097620_101588824 | 3300006931 | Bacteria | 722 |
| 329 | Ga0105250_10226338 | 3300009092 | Bacteria | 794 |
| 330 | Ga0105240_10000359 | 3300009093 | Bacteria | 85874 |
| 331 | Ga0105240_10000633 | 3300009093 | Bacteria | 64950 |
| 332 | Ga0105240_10002007 | 3300009093 | Bacteria | 33570 |
| 333 | Ga0105240_10007977 | 3300009093 | Bacteria | 15268 |
| 334 | Ga0105240_10009334 | 3300009093 | Bacteria | 13905 |
| 335 | Ga0105240_10013427 | 3300009093 | Bacteria | 11248 |
| 336 | Ga0105240_10022190 | 3300009093 | Bacteria | 8422 |
| 337 | Ga0105240_10050541 | 3300009093 | Bacteria | 5240 |
| 338 | Ga0105240_10074426 | 3300009093 | Bacteria | 4192 |
| 339 | Ga0105240_10209967 | 3300009093 | Bacteria | 2276 |
| 340 | Ga0105240_10884759 | 3300009093 | Bacteria | 962 |
| 341 | Ga0105245_10377566 | 3300009098 | Bacteria | 1411 |
| 342 | Ga0105245_10788223 | 3300009098 | Bacteria | 988 |
| 343 | Ga0105245_10947848 | 3300009098 | Bacteria | 903 |
| 344 | Ga0105245_11070398 | 3300009098 | Bacteria | 852 |
| 345 | Ga0114129_10035130 | 3300009147 | Bacteria | 7082 |
| 346 | Ga0105243_10073372 | 3300009148 | Bacteria | 2773 |
| 347 | Ga0105241_10008871 | 3300009174 | Bacteria | 7395 |
| 348 | Ga0105241_10037744 | 3300009174 | Bacteria | 3639 |
| 349 | Ga0105241_10046045 | 3300009174 | Bacteria | 3312 |
| 350 | Ga0105241_10064718 | 3300009174 | Bacteria | 2824 |
| 351 | Ga0105241_10214683 | 3300009174 | Bacteria | 1614 |
| 352 | Ga0105241_10251234 | 3300009174 | Bacteria | 1499 |
| 353 | Ga0105241_10857754 | 3300009174 | Bacteria | 840 |
| 354 | Ga0105241_11254522 | 3300009174 | Bacteria | 704 |
| 355 | Ga0105242_10002842 | 3300009176 | Bacteria | 13567 |
| 356 | Ga0105242_10041120 | 3300009176 | Bacteria | 3727 |
| 357 | Ga0105242_10593268 | 3300009176 | Bacteria | 1069 |
| 358 | Ga0105242_10722576 | 3300009176 | Bacteria | 977 |
| 359 | Ga0105248_10000246 | 3300009177 | Bacteria | 62735 |
| 360 | Ga0105248_10044683 | 3300009177 | Bacteria | 4968 |
| 361 | Ga0105248_10096662 | 3300009177 | Bacteria | 3327 |
| 362 | Ga0105248_10466046 | 3300009177 | Bacteria | 1424 |
| 363 | Ga0105248_10843250 | 3300009177 | Bacteria | 1034 |
| 364 | Ga0105248_10941610 | 3300009177 | Bacteria | 975 |
| 365 | Ga0105248_11019248 | 3300009177 | Bacteria | 935 |
| 366 | Ga0105237_10000148 | 3300009545 | Bacteria | 98986 |
| 367 | Ga0105237_10000231 | 3300009545 | Bacteria | 79368 |
| 368 | Ga0105237_10000383 | 3300009545 | Bacteria | 63065 |
| 369 | Ga0105237_10004315 | 3300009545 | Bacteria | 16486 |
| 370 | Ga0105237_10128389 | 3300009545 | Bacteria | 2529 |
| 371 | Ga0105237_10144331 | 3300009545 | Bacteria | 2375 |
| 372 | Ga0105237_10173267 | 3300009545 | Bacteria | 2158 |
| 373 | Ga0105237_10345613 | 3300009545 | Bacteria | 1492 |
| 374 | Ga0105237_10413818 | 3300009545 | Bacteria | 1353 |
| 375 | Ga0105237_10479787 | 3300009545 | Bacteria | 1250 |
| 376 | Ga0105237_10544780 | 3300009545 | Bacteria | 1167 |
| 377 | Ga0105237_10709464 | 3300009545 | Bacteria | 1012 |
| 378 | Ga0105238_10000044 | 3300009551 | Bacteria | 151485 |
| 379 | Ga0105238_10007919 | 3300009551 | Bacteria | 10634 |
| 380 | Ga0105238_10010855 | 3300009551 | Bacteria | 9155 |
| 381 | Ga0105238_10034862 | 3300009551 | Bacteria | 5119 |
| 382 | Ga0105238_10049939 | 3300009551 | Bacteria | 4211 |
| 383 | Ga0105238_10097896 | 3300009551 | Bacteria | 2918 |
| 384 | Ga0105238_10202715 | 3300009551 | Bacteria | 1960 |
| 385 | Ga0105238_10217876 | 3300009551 | Bacteria | 1885 |
| 386 | Ga0105238_10333048 | 3300009551 | Bacteria | 1505 |
| 387 | Ga0105238_10538112 | 3300009551 | Bacteria | 1172 |
| 388 | Ga0105238_10733790 | 3300009551 | Bacteria | 1001 |
| 389 | Ga0105249_10001225 | 3300009553 | Bacteria | 22566 |
| 390 | Ga0105249_10027305 | 3300009553 | Bacteria | 5151 |
| 391 | Ga0105249_10380955 | 3300009553 | Bacteria | 1436 |
| 392 | Ga0105148_100676 | 3300009978 | Bacteria | 2682 |
| 393 | Ga0105029_100269 | 3300009984 | Bacteria | 2698 |
| 394 | Ga0105239_10000033 | 3300010375 | Bacteria | 223933 |
| 395 | Ga0105239_10003454 | 3300010375 | Bacteria | 19337 |
| 396 | Ga0105239_10009780 | 3300010375 | Bacteria | 10778 |
| 397 | Ga0105239_10014339 | 3300010375 | Bacteria | 8793 |
| 398 | Ga0105239_10021477 | 3300010375 | Bacteria | 7117 |
| 399 | Ga0105239_10026779 | 3300010375 | Bacteria | 6346 |
| 400 | Ga0105239_10121007 | 3300010375 | Bacteria | 2907 |
| 401 | Ga0105239_10152397 | 3300010375 | Bacteria | 2580 |
| 402 | Ga0105239_10157972 | 3300010375 | Bacteria | 2533 |
| 403 | Ga0105239_10256728 | 3300010375 | Bacteria | 1964 |
| 404 | Ga0105239_10286830 | 3300010375 | Bacteria | 1854 |
| 405 | Ga0105239_10660194 | 3300010375 | Bacteria | 1195 |
| 406 | Ga0105239_10699703 | 3300010375 | Bacteria | 1159 |
| 407 | Ga0105239_11489580 | 3300010375 | Bacteria | 782 |
| 408 | Ga0105246_10009566 | 3300011119 | Bacteria | 5972 |
| 409 | Ga0157318_1000739 | 3300012482 | Bacteria | 1497 |
| 410 | Ga0157314_1000098 | 3300012500 | Bacteria | 9231 |
| 411 | Ga0157314_1001103 | 3300012500 | Bacteria | 2022 |
| 412 | Ga0157326_1021775 | 3300012513 | Bacteria | 796 |
| 413 | Ga0157373_10034519 | 3300013100 | Bacteria | 3632 |
| 414 | Ga0157373_10048721 | 3300013100 | Bacteria | 3021 |
| 415 | Ga0157371_10021671 | 3300013102 | Bacteria | 4715 |
| 416 | Ga0157370_10000495 | 3300013104 | Bacteria | 48993 |
| 417 | Ga0157370_10002719 | 3300013104 | Bacteria | 21150 |
| 418 | Ga0157370_10004280 | 3300013104 | Bacteria | 16440 |
| 419 | Ga0157370_10070640 | 3300013104 | Bacteria | 3296 |
| 420 | Ga0157370_10095746 | 3300013104 | Bacteria | 2785 |
| 421 | Ga0157370_10099538 | 3300013104 | Bacteria | 2725 |
| 422 | Ga0157370_10121328 | 3300013104 | Bacteria | 2440 |
| 423 | Ga0157370_10123802 | 3300013104 | Bacteria | 2414 |
| 424 | Ga0157370_10133349 | 3300013104 | Bacteria | 2316 |
| 425 | Ga0157370_10168588 | 3300013104 | Bacteria | 2036 |
| 426 | Ga0157370_10189039 | 3300013104 | Bacteria | 1912 |
| 427 | Ga0157370_10253027 | 3300013104 | Bacteria | 1629 |
| 428 | Ga0157370_10444388 | 3300013104 | Bacteria | 1192 |
| 429 | Ga0157370_10535365 | 3300013104 | Bacteria | 1074 |
| 430 | Ga0157370_11027177 | 3300013104 | Bacteria | 746 |
| 431 | Ga0157370_11101015 | 3300013104 | Bacteria | 718 |
| 432 | Ga0157369_10000464 | 3300013105 | Bacteria | 53767 |
| 433 | Ga0157369_10005929 | 3300013105 | Bacteria | 14190 |
| 434 | Ga0157369_10031464 | 3300013105 | Bacteria | 5842 |
| 435 | Ga0157369_10262059 | 3300013105 | Bacteria | 1803 |
| 436 | Ga0157369_10281052 | 3300013105 | Bacteria | 1733 |
| 437 | Ga0157369_10778324 | 3300013105 | Bacteria | 984 |
| 438 | Ga0157369_10976478 | 3300013105 | Bacteria | 868 |
| 439 | Ga0157374_10066420 | 3300013296 | Bacteria | 3389 |
| 440 | Ga0157374_10130567 | 3300013296 | Bacteria | 2431 |
| 441 | Ga0157374_10474783 | 3300013296 | Bacteria | 1253 |
| 442 | Ga0157378_10001405 | 3300013297 | Bacteria | 21654 |
| 443 | Ga0157378_10691065 | 3300013297 | Bacteria | 1039 |
| 444 | Ga0157378_11048265 | 3300013297 | Bacteria | 851 |
| 445 | Ga0163162_10000021 | 3300013306 | Bacteria | 214873 |
| 446 | Ga0163162_10000193 | 3300013306 | Bacteria | 56063 |
| 447 | Ga0163162_10002029 | 3300013306 | Bacteria | 19053 |
| 448 | Ga0163162_10064563 | 3300013306 | Bacteria | 3706 |
| 449 | Ga0163162_10069740 | 3300013306 | Bacteria | 3567 |
| 450 | Ga0163162_10153910 | 3300013306 | Bacteria | 2418 |
| 451 | Ga0163162_10449684 | 3300013306 | Bacteria | 1420 |
| 452 | Ga0163162_10638951 | 3300013306 | Bacteria | 1188 |
| 453 | Ga0157372_10011884 | 3300013307 | Bacteria | 9277 |
| 454 | Ga0157372_10014982 | 3300013307 | Bacteria | 8297 |
| 455 | Ga0157372_10052222 | 3300013307 | Bacteria | 4551 |
| 456 | Ga0157372_10064309 | 3300013307 | Bacteria | 4116 |
| 457 | Ga0157372_10167991 | 3300013307 | Bacteria | 2537 |
| 458 | Ga0157372_10186027 | 3300013307 | Bacteria | 2405 |
| 459 | Ga0157372_10299531 | 3300013307 | Bacteria | 1870 |
| 460 | Ga0157372_10423863 | 3300013307 | Bacteria | 1551 |
| 461 | Ga0157372_10444901 | 3300013307 | Bacteria | 1510 |
| 462 | Ga0157372_10704796 | 3300013307 | Bacteria | 1175 |
| 463 | Ga0157372_10889204 | 3300013307 | Bacteria | 1034 |
| 464 | Ga0157372_10892887 | 3300013307 | Bacteria | 1031 |
| 465 | Ga0157372_11088308 | 3300013307 | Bacteria | 925 |
| 466 | Ga0157372_11158308 | 3300013307 | Bacteria | 894 |
| 467 | Ga0157372_12292690 | 3300013307 | Bacteria | 620 |
| 468 | Ga0157375_10000950 | 3300013308 | Bacteria | 25099 |
| 469 | Ga0157375_10016908 | 3300013308 | Bacteria | 6570 |
| 470 | Ga0157375_10050059 | 3300013308 | Bacteria | 4097 |
| 471 | Ga0157375_10122204 | 3300013308 | Bacteria | 2715 |
| 472 | Ga0163163_10000403 | 3300014325 | Bacteria | 40776 |
| 473 | Ga0163163_10006152 | 3300014325 | Bacteria | 10460 |
| 474 | Ga0163163_10113006 | 3300014325 | Bacteria | 2745 |
| 475 | Ga0163163_10284699 | 3300014325 | Bacteria | 1705 |
| 476 | Ga0157380_10082842 | 3300014326 | Bacteria | 2626 |
| 477 | Ga0182008_10000209 | 3300014497 | Bacteria | 46251 |
| 478 | Ga0182008_10030065 | 3300014497 | Bacteria | 2740 |
| 479 | Ga0182008_10032240 | 3300014497 | Bacteria | 2633 |
| 480 | Ga0182008_10046665 | 3300014497 | Bacteria | 2153 |
| 481 | Ga0157379_10003888 | 3300014968 | Bacteria | 12730 |
| 482 | Ga0157379_10202302 | 3300014968 | Bacteria | 1796 |
| 483 | Ga0157379_10208706 | 3300014968 | Bacteria | 1767 |
| 484 | Ga0157376_10006685 | 3300014969 | Bacteria | 8162 |
| 485 | Ga0157376_10017225 | 3300014969 | Bacteria | 5505 |
| 486 | Ga0157376_10019219 | 3300014969 | Bacteria | 5260 |
| 487 | Ga0157376_10107390 | 3300014969 | Bacteria | 2450 |
| 488 | Ga0157376_10124715 | 3300014969 | Bacteria | 2288 |
| 489 | Ga0157376_10334337 | 3300014969 | Bacteria | 1444 |
| 490 | Ga0182006_1000034 | 3300015261 | Bacteria | 232484 |
| 491 | Ga0182006_1007770 | 3300015261 | Bacteria | 4890 |
| 492 | Ga0182006_1032677 | 3300015261 | Bacteria | 2089 |
| 493 | Ga0182006_1047053 | 3300015261 | Bacteria | 1674 |
| 494 | Ga0182007_10001346 | 3300015262 | Bacteria | 13262 |
| 495 | Ga0182007_10005029 | 3300015262 | Bacteria | 5871 |
| 496 | Ga0182007_10052110 | 3300015262 | Bacteria | 1349 |
| 497 | Ga0182007_10067388 | 3300015262 | Bacteria | 1172 |
| 498 | Ga0182007_10090807 | 3300015262 | Bacteria | 1006 |
| 499 | Ga0182005_1000064 | 3300015265 | Bacteria | 95976 |
| 500 | Ga0182005_1002932 | 3300015265 | Bacteria | 5921 |
| 501 | Ga0182005_1016840 | 3300015265 | Bacteria | 2028 |
| 502 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 503 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 504 | Ga0163161_10001385 | 3300017792 | Bacteria | 17927 |
| 505 | Ga0163161_10012090 | 3300017792 | Bacteria | 5987 |
| 506 | Ga0163161_10038479 | 3300017792 | Bacteria | 3431 |
| 507 | Ga0206353_10771426 | 3300020082 | Bacteria | 2282 |
| 508 | Ga0154015_1053000 | 3300020610 | Bacteria | 2405 |
| 509 | Ga0213875_10120439 | 3300021388 | Bacteria | 1226 |
| 510 | Ga0224712_10075440 | 3300022467 | Bacteria | 1379 |
| 511 | Ga0209435_108278 | 3300025206 | Bacteria | 1146 |
| 512 | Ga0209760_100294 | 3300025207 | Bacteria | 17371 |
| 513 | Ga0209784_100042 | 3300025224 | Bacteria | 218070 |
| 514 | Ga0209674_100033 | 3300025226 | Bacteria | 423450 |
| 515 | Ga0209674_100441 | 3300025226 | Bacteria | 19236 |
| 516 | Ga0209674_101207 | 3300025226 | Bacteria | 7354 |
| 517 | Ga0209674_103716 | 3300025226 | Bacteria | 2714 |
| 518 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 519 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 520 | Ga0209672_100916 | 3300025228 | Bacteria | 13362 |
| 521 | Ga0209672_102162 | 3300025228 | Bacteria | 5180 |
| 522 | Ga0209563_100036 | 3300025230 | Bacteria | 448275 |
| 523 | Ga0207427_100037 | 3300025231 | Bacteria | 303108 |
| 524 | Ga0207427_100049 | 3300025231 | Bacteria | 237504 |
| 525 | Ga0207427_100078 | 3300025231 | Bacteria | 147526 |
| 526 | Ga0207427_100096 | 3300025231 | Bacteria | 123398 |
| 527 | Ga0207427_105412 | 3300025231 | Bacteria | 1806 |
| 528 | Ga0209437_100074 | 3300025233 | Bacteria | 300858 |
| 529 | Ga0209437_100083 | 3300025233 | Bacteria | 256005 |
| 530 | Ga0209437_100090 | 3300025233 | Bacteria | 247138 |
| 531 | Ga0209437_100157 | 3300025233 | Bacteria | 151821 |
| 532 | Ga0209437_100691 | 3300025233 | Bacteria | 17825 |
| 533 | Ga0209437_100872 | 3300025233 | Bacteria | 12437 |
| 534 | Ga0209437_101965 | 3300025233 | Bacteria | 4257 |
| 535 | Ga0209437_104672 | 3300025233 | Bacteria | 2387 |
| 536 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 537 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 538 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 539 | Ga0209258_100136 | 3300025242 | Bacteria | 169078 |
| 540 | Ga0209258_101400 | 3300025242 | Bacteria | 8612 |
| 541 | Ga0209258_110007 | 3300025242 | Bacteria | 1248 |
| 542 | Ga0209646_1000863 | 3300025246 | Bacteria | 10119 |
| 543 | Ga0209646_1012353 | 3300025246 | Bacteria | 1311 |
| 544 | Ga0209026_1000045 | 3300025250 | Bacteria | 263431 |
| 545 | Ga0209026_1000072 | 3300025250 | Bacteria | 205447 |
| 546 | Ga0209026_1000129 | 3300025250 | Bacteria | 121927 |
| 547 | Ga0209026_1000153 | 3300025250 | Bacteria | 109259 |
| 548 | Ga0209026_1000442 | 3300025250 | Bacteria | 33393 |
| 549 | Ga0209026_1016918 | 3300025250 | Bacteria | 1173 |
| 550 | Ga0209026_1021965 | 3300025250 | Bacteria | 981 |
| 551 | Ga0209677_100348 | 3300025253 | Bacteria | 28879 |
| 552 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 553 | Ga0209148_1000036 | 3300025254 | Bacteria | 530505 |
| 554 | Ga0209148_1000053 | 3300025254 | Bacteria | 373506 |
| 555 | Ga0209148_1000791 | 3300025254 | Bacteria | 23435 |
| 556 | Ga0209759_1000140 | 3300025256 | Bacteria | 124850 |
| 557 | Ga0209759_1000831 | 3300025256 | Bacteria | 24394 |
| 558 | Ga0209759_1002615 | 3300025256 | Bacteria | 7765 |
| 559 | Ga0209759_1003821 | 3300025256 | Bacteria | 5846 |
| 560 | Ga0209129_1000604 | 3300025258 | Bacteria | 24333 |
| 561 | Ga0209129_1002103 | 3300025258 | Bacteria | 10163 |
| 562 | Ga0209233_1000040 | 3300025261 | Bacteria | 530395 |
| 563 | Ga0209233_1000075 | 3300025261 | Bacteria | 356837 |
| 564 | Ga0209233_1000077 | 3300025261 | Bacteria | 349570 |
| 565 | Ga0209233_1000096 | 3300025261 | Bacteria | 303482 |
| 566 | Ga0209233_1003582 | 3300025261 | Bacteria | 5450 |
| 567 | Ga0209233_1028224 | 3300025261 | Bacteria | 1349 |
| 568 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 569 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 570 | Ga0209455_1000071 | 3300025272 | Bacteria | 300858 |
| 571 | Ga0209455_1000215 | 3300025272 | Bacteria | 81196 |
| 572 | Ga0209455_1013624 | 3300025272 | Bacteria | 1878 |
| 573 | Ga0209673_1003811 | 3300025273 | Bacteria | 8549 |
| 574 | Ga0209130_1007509 | 3300025284 | Bacteria | 3353 |
| 575 | Ga0209675_1014295 | 3300025291 | Bacteria | 2423 |
| 576 | Ga0209675_1017692 | 3300025291 | Bacteria | 2026 |
| 577 | Ga0209676_1001264 | 3300025292 | Bacteria | 26303 |
| 578 | Ga0209676_1002621 | 3300025292 | Bacteria | 12291 |
| 579 | Ga0209676_1007907 | 3300025292 | Bacteria | 4874 |
| 580 | Ga0209676_1008848 | 3300025292 | Bacteria | 4429 |
| 581 | Ga0209676_1036126 | 3300025292 | Bacteria | 1441 |
| 582 | Ga0209025_1001373 | 3300025294 | Bacteria | 32662 |
| 583 | Ga0209025_1034165 | 3300025294 | Bacteria | 2330 |
| 584 | Ga0209025_1050506 | 3300025294 | Bacteria | 1662 |
| 585 | Ga0209025_1053805 | 3300025294 | Bacteria | 1575 |
| 586 | Ga0209025_1055046 | 3300025294 | Bacteria | 1542 |
| 587 | Ga0209564_1009685 | 3300025295 | Bacteria | 4544 |
| 588 | Ga0209758_1000481 | 3300025297 | Bacteria | 65650 |
| 589 | Ga0209758_1058569 | 3300025297 | Bacteria | 1287 |
| 590 | Ga0209758_1061354 | 3300025297 | Bacteria | 1239 |
| 591 | Ga0209050_1001626 | 3300025298 | Bacteria | 23042 |
| 592 | Ga0209256_1001873 | 3300025299 | Bacteria | 19411 |
| 593 | Ga0209256_1002659 | 3300025299 | Bacteria | 14029 |
| 594 | Ga0209256_1010555 | 3300025299 | Bacteria | 3844 |
| 595 | Ga0209256_1011879 | 3300025299 | Bacteria | 3418 |
| 596 | Ga0209051_1005661 | 3300025303 | Bacteria | 7227 |
| 597 | Ga0209257_1000274 | 3300025304 | Bacteria | 117076 |
| 598 | Ga0209257_1000307 | 3300025304 | Bacteria | 105179 |
| 599 | Ga0209257_1002641 | 3300025304 | Bacteria | 17251 |
| 600 | Ga0209257_1007987 | 3300025304 | Bacteria | 6183 |
| 601 | Ga0207656_10004823 | 3300025321 | Bacteria | 4734 |
| 602 | Ga0207656_10411102 | 3300025321 | Bacteria | 681 |
| 603 | Ga0207692_10191756 | 3300025898 | Bacteria | 1196 |
| 604 | Ga0207710_10028650 | 3300025900 | Bacteria | 2418 |
| 605 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 606 | Ga0207680_10000092 | 3300025903 | Bacteria | 41687 |
| 607 | Ga0207680_10034939 | 3300025903 | Bacteria | 2880 |
| 608 | Ga0207680_10037462 | 3300025903 | Bacteria | 2800 |
| 609 | Ga0207680_10095683 | 3300025903 | Bacteria | 1898 |
| 610 | Ga0207647_10000010 | 3300025904 | Bacteria | 174219 |
| 611 | Ga0207647_10000066 | 3300025904 | Bacteria | 81782 |
| 612 | Ga0207647_10004970 | 3300025904 | Bacteria | 9802 |
| 613 | Ga0207647_10006265 | 3300025904 | Bacteria | 8664 |
| 614 | Ga0207647_10010431 | 3300025904 | Bacteria | 6563 |
| 615 | Ga0207647_10012093 | 3300025904 | Bacteria | 6023 |
| 616 | Ga0207685_10072312 | 3300025905 | Bacteria | 1401 |
| 617 | Ga0207699_10505620 | 3300025906 | Bacteria | 873 |
| 618 | Ga0207645_10043108 | 3300025907 | Bacteria | 2887 |
| 619 | Ga0207645_10096932 | 3300025907 | Bacteria | 1900 |
| 620 | Ga0207643_10008509 | 3300025908 | Bacteria | 5503 |
| 621 | Ga0207705_10001094 | 3300025909 | Bacteria | 22061 |
| 622 | Ga0207705_10035118 | 3300025909 | Bacteria | 3586 |
| 623 | Ga0207705_10039069 | 3300025909 | Bacteria | 3401 |
| 624 | Ga0207705_10238245 | 3300025909 | Bacteria | 1385 |
| 625 | Ga0207705_10303490 | 3300025909 | Bacteria | 1225 |
| 626 | Ga0207654_10001128 | 3300025911 | Bacteria | 14430 |
| 627 | Ga0207654_10181410 | 3300025911 | Bacteria | 1374 |
| 628 | Ga0207654_10229994 | 3300025911 | Bacteria | 1234 |
| 629 | Ga0207654_10733376 | 3300025911 | Bacteria | 711 |
| 630 | Ga0207654_10766565 | 3300025911 | Bacteria | 696 |
| 631 | Ga0207707_10010148 | 3300025912 | Bacteria | 8173 |
| 632 | Ga0207707_10057230 | 3300025912 | Bacteria | 3394 |
| 633 | Ga0207707_10129717 | 3300025912 | Bacteria | 2205 |
| 634 | Ga0207707_10292260 | 3300025912 | Bacteria | 1410 |
| 635 | Ga0207707_10296316 | 3300025912 | Bacteria | 1399 |
| 636 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 637 | Ga0207695_10000322 | 3300025913 | Bacteria | 114700 |
| 638 | Ga0207695_10000809 | 3300025913 | Bacteria | 58219 |
| 639 | Ga0207695_10000856 | 3300025913 | Bacteria | 55795 |
| 640 | Ga0207695_10005750 | 3300025913 | Bacteria | 16327 |
| 641 | Ga0207695_10006442 | 3300025913 | Bacteria | 15244 |
| 642 | Ga0207695_10008494 | 3300025913 | Bacteria | 12841 |
| 643 | Ga0207695_10032475 | 3300025913 | Bacteria | 5711 |
| 644 | Ga0207695_10046519 | 3300025913 | Bacteria | 4599 |
| 645 | Ga0207695_10069276 | 3300025913 | Bacteria | 3610 |
| 646 | Ga0207695_10366560 | 3300025913 | Bacteria | 1327 |
| 647 | Ga0207695_11306862 | 3300025913 | Bacteria | 606 |
| 648 | Ga0207671_10000028 | 3300025914 | Bacteria | 263092 |
| 649 | Ga0207671_10000357 | 3300025914 | Bacteria | 65092 |
| 650 | Ga0207671_10001588 | 3300025914 | Bacteria | 25826 |
| 651 | Ga0207671_10004399 | 3300025914 | Bacteria | 13503 |
| 652 | Ga0207671_10318069 | 3300025914 | Bacteria | 1231 |
| 653 | Ga0207671_10458907 | 3300025914 | Bacteria | 1015 |
| 654 | Ga0207663_10264346 | 3300025916 | Bacteria | 1272 |
| 655 | Ga0207663_10308392 | 3300025916 | Bacteria | 1185 |
| 656 | Ga0207660_10097251 | 3300025917 | Bacteria | 2193 |
| 657 | Ga0207660_10263573 | 3300025917 | Bacteria | 1363 |
| 658 | Ga0207660_10390745 | 3300025917 | Bacteria | 1119 |
| 659 | Ga0207657_10009521 | 3300025919 | Bacteria | 9756 |
| 660 | Ga0207657_10011833 | 3300025919 | Bacteria | 8637 |
| 661 | Ga0207657_10042168 | 3300025919 | Bacteria | 4028 |
| 662 | Ga0207657_10335228 | 3300025919 | Bacteria | 1194 |
| 663 | Ga0207657_10861449 | 3300025919 | Bacteria | 699 |
| 664 | Ga0207649_10002084 | 3300025920 | Bacteria | 11361 |
| 665 | Ga0207649_10032583 | 3300025920 | Bacteria | 3108 |
| 666 | Ga0207649_10033209 | 3300025920 | Bacteria | 3081 |
| 667 | Ga0207649_10197571 | 3300025920 | Bacteria | 1418 |
| 668 | Ga0207649_10424825 | 3300025920 | Bacteria | 999 |
| 669 | Ga0207652_10165752 | 3300025921 | Bacteria | 1981 |
| 670 | Ga0207652_10218605 | 3300025921 | Bacteria | 1717 |
| 671 | Ga0207652_10297561 | 3300025921 | Bacteria | 1456 |
| 672 | Ga0207652_10342189 | 3300025921 | Bacteria | 1350 |
| 673 | Ga0207681_10001858 | 3300025923 | Bacteria | 13543 |
| 674 | Ga0207681_10007276 | 3300025923 | Bacteria | 6785 |
| 675 | Ga0207681_10033681 | 3300025923 | Bacteria | 3361 |
| 676 | Ga0207681_10503930 | 3300025923 | Bacteria | 991 |
| 677 | Ga0207694_10000109 | 3300025924 | Bacteria | 86216 |
| 678 | Ga0207694_10000850 | 3300025924 | Bacteria | 27165 |
| 679 | Ga0207694_10001341 | 3300025924 | Bacteria | 21199 |
| 680 | Ga0207694_10097782 | 3300025924 | Bacteria | 2323 |
| 681 | Ga0207694_10140943 | 3300025924 | Bacteria | 1938 |
| 682 | Ga0207694_10185078 | 3300025924 | Bacteria | 1690 |
| 683 | Ga0207694_10269754 | 3300025924 | Bacteria | 1396 |
| 684 | Ga0207650_10021916 | 3300025925 | Bacteria | 4521 |
| 685 | Ga0207650_10229804 | 3300025925 | Bacteria | 1496 |
| 686 | Ga0207659_10373732 | 3300025926 | Bacteria | 1187 |
| 687 | Ga0207687_10344965 | 3300025927 | Bacteria | 1212 |
| 688 | Ga0207687_10554219 | 3300025927 | Bacteria | 965 |
| 689 | Ga0207687_11142225 | 3300025927 | Bacteria | 669 |
| 690 | Ga0207664_10000553 | 3300025929 | Bacteria | 26494 |
| 691 | Ga0207664_10000624 | 3300025929 | Bacteria | 24530 |
| 692 | Ga0207644_10166416 | 3300025931 | Bacteria | 1718 |
| 693 | Ga0207644_10174658 | 3300025931 | Bacteria | 1680 |
| 694 | Ga0207644_10556744 | 3300025931 | Bacteria | 949 |
| 695 | Ga0207690_10000061 | 3300025932 | Bacteria | 98910 |
| 696 | Ga0207690_10000375 | 3300025932 | Bacteria | 29631 |
| 697 | Ga0207690_10006084 | 3300025932 | Bacteria | 7149 |
| 698 | Ga0207690_10030475 | 3300025932 | Bacteria | 3441 |
| 699 | Ga0207690_10145847 | 3300025932 | Bacteria | 1750 |
| 700 | Ga0207706_10042475 | 3300025933 | Bacteria | 4029 |
| 701 | Ga0207706_10049684 | 3300025933 | Bacteria | 3706 |
| 702 | Ga0207686_10003423 | 3300025934 | Bacteria | 8519 |
| 703 | Ga0207709_10005775 | 3300025935 | Bacteria | 6992 |
| 704 | Ga0207670_10001621 | 3300025936 | Bacteria | 11738 |
| 705 | Ga0207670_10446551 | 3300025936 | Bacteria | 1042 |
| 706 | Ga0207670_10758146 | 3300025936 | Bacteria | 806 |
| 707 | Ga0207704_10010792 | 3300025938 | Bacteria | 4471 |
| 708 | Ga0207704_10032219 | 3300025938 | Bacteria | 2964 |
| 709 | Ga0207704_10069820 | 3300025938 | Bacteria | 2222 |
| 710 | Ga0207704_10078000 | 3300025938 | Bacteria | 2129 |
| 711 | Ga0207704_10090427 | 3300025938 | Bacteria | 2009 |
| 712 | Ga0207691_10007374 | 3300025940 | Bacteria | 10598 |
| 713 | Ga0207691_10028648 | 3300025940 | Bacteria | 5213 |
| 714 | Ga0207691_10082771 | 3300025940 | Bacteria | 2882 |
| 715 | Ga0207691_10166529 | 3300025940 | Bacteria | 1931 |
| 716 | Ga0207711_10002283 | 3300025941 | Bacteria | 17214 |
| 717 | Ga0207711_10160406 | 3300025941 | Bacteria | 2035 |
| 718 | Ga0207711_10226669 | 3300025941 | Bacteria | 1711 |
| 719 | Ga0207711_10438985 | 3300025941 | Bacteria | 1215 |
| 720 | Ga0207711_10896166 | 3300025941 | Bacteria | 825 |
| 721 | Ga0207689_10070324 | 3300025942 | Bacteria | 2875 |
| 722 | Ga0207689_10237908 | 3300025942 | Bacteria | 1505 |
| 723 | Ga0207689_10322233 | 3300025942 | Bacteria | 1283 |
| 724 | Ga0207689_10453363 | 3300025942 | Bacteria | 1072 |
| 725 | Ga0207661_10258427 | 3300025944 | Bacteria | 1550 |
| 726 | Ga0207667_10000080 | 3300025949 | Bacteria | 163287 |
| 727 | Ga0207667_10000344 | 3300025949 | Bacteria | 63681 |
| 728 | Ga0207667_10056069 | 3300025949 | Bacteria | 4140 |
| 729 | Ga0207667_10092352 | 3300025949 | Bacteria | 3126 |
| 730 | Ga0207667_10092784 | 3300025949 | Bacteria | 3118 |
| 731 | Ga0207667_10186083 | 3300025949 | Bacteria | 2132 |
| 732 | Ga0207667_10206622 | 3300025949 | Bacteria | 2013 |
| 733 | Ga0207667_10599640 | 3300025949 | Bacteria | 1111 |
| 734 | Ga0207667_11040940 | 3300025949 | Bacteria | 804 |
| 735 | Ga0207667_11463710 | 3300025949 | Bacteria | 655 |
| 736 | Ga0207651_10183658 | 3300025960 | Bacteria | 1662 |
| 737 | Ga0207651_10392254 | 3300025960 | Bacteria | 1179 |
| 738 | Ga0207712_10001195 | 3300025961 | Bacteria | 17947 |
| 739 | Ga0207712_10001216 | 3300025961 | Bacteria | 17755 |
| 740 | Ga0207712_10559312 | 3300025961 | Bacteria | 985 |
| 741 | Ga0207668_10011602 | 3300025972 | Bacteria | 5360 |
| 742 | Ga0207668_10166366 | 3300025972 | Bacteria | 1724 |
| 743 | Ga0207668_10203353 | 3300025972 | Bacteria | 1579 |
| 744 | Ga0207668_10254721 | 3300025972 | Bacteria | 1427 |
| 745 | Ga0207668_10359841 | 3300025972 | Bacteria | 1219 |
| 746 | Ga0207640_10000190 | 3300025981 | Bacteria | 43737 |
| 747 | Ga0207640_10001549 | 3300025981 | Bacteria | 12373 |
| 748 | Ga0207640_10003414 | 3300025981 | Bacteria | 8553 |
| 749 | Ga0207640_10009903 | 3300025981 | Bacteria | 5350 |
| 750 | Ga0207640_10016638 | 3300025981 | Bacteria | 4283 |
| 751 | Ga0207640_10163223 | 3300025981 | Bacteria | 1651 |
| 752 | Ga0207640_10241418 | 3300025981 | Bacteria | 1396 |
| 753 | Ga0207658_10000013 | 3300025986 | Bacteria | 220396 |
| 754 | Ga0207658_10029268 | 3300025986 | Bacteria | 3888 |
| 755 | Ga0207658_10118548 | 3300025986 | Bacteria | 2106 |
| 756 | Ga0207658_10193319 | 3300025986 | Bacteria | 1693 |
| 757 | Ga0207658_10329933 | 3300025986 | Bacteria | 1323 |
| 758 | Ga0207658_10667254 | 3300025986 | Bacteria | 938 |
| 759 | Ga0207658_10891040 | 3300025986 | Bacteria | 810 |
| 760 | Ga0207658_10892344 | 3300025986 | Bacteria | 809 |
| 761 | Ga0207677_10086112 | 3300026023 | Bacteria | 2270 |
| 762 | Ga0207677_10106765 | 3300026023 | Bacteria | 2075 |
| 763 | Ga0207703_10000793 | 3300026035 | Bacteria | 31116 |
| 764 | Ga0207703_10269178 | 3300026035 | Bacteria | 1543 |
| 765 | Ga0207703_10395672 | 3300026035 | Bacteria | 1281 |
| 766 | Ga0207703_10397394 | 3300026035 | Bacteria | 1278 |
| 767 | Ga0207639_10000479 | 3300026041 | Bacteria | 27677 |
| 768 | Ga0207639_10000595 | 3300026041 | Bacteria | 24859 |
| 769 | Ga0207639_10004215 | 3300026041 | Bacteria | 9688 |
| 770 | Ga0207639_10035499 | 3300026041 | Bacteria | 3690 |
| 771 | Ga0207639_10082054 | 3300026041 | Bacteria | 2555 |
| 772 | Ga0207639_10210802 | 3300026041 | Bacteria | 1672 |
| 773 | Ga0207639_10255015 | 3300026041 | Bacteria | 1531 |
| 774 | Ga0207639_10302611 | 3300026041 | Bacteria | 1414 |
| 775 | Ga0207639_10366920 | 3300026041 | Bacteria | 1290 |
| 776 | Ga0207639_10479588 | 3300026041 | Bacteria | 1133 |
| 777 | Ga0207639_10504114 | 3300026041 | Bacteria | 1106 |
| 778 | Ga0207639_10713675 | 3300026041 | Bacteria | 931 |
| 779 | Ga0207639_11203159 | 3300026041 | Bacteria | 711 |
| 780 | Ga0207678_10000035 | 3300026067 | Bacteria | 104807 |
| 781 | Ga0207678_10012465 | 3300026067 | Bacteria | 7465 |
| 782 | Ga0207678_10016540 | 3300026067 | Bacteria | 6478 |
| 783 | Ga0207678_10055104 | 3300026067 | Bacteria | 3425 |
| 784 | Ga0207678_10208614 | 3300026067 | Bacteria | 1671 |
| 785 | Ga0207678_10702636 | 3300026067 | Bacteria | 890 |
| 786 | Ga0207708_10303999 | 3300026075 | Bacteria | 1298 |
| 787 | Ga0207702_10000049 | 3300026078 | Bacteria | 140303 |
| 788 | Ga0207702_10000380 | 3300026078 | Bacteria | 50635 |
| 789 | Ga0207702_10010670 | 3300026078 | Bacteria | 7676 |
| 790 | Ga0207702_10011899 | 3300026078 | Bacteria | 7241 |
| 791 | Ga0207702_10197901 | 3300026078 | Bacteria | 1861 |
| 792 | Ga0207702_10722423 | 3300026078 | Bacteria | 982 |
| 793 | Ga0207702_10821687 | 3300026078 | Bacteria | 919 |
| 794 | Ga0207641_10006513 | 3300026088 | Bacteria | 9828 |
| 795 | Ga0207641_10025673 | 3300026088 | Bacteria | 4857 |
| 796 | Ga0207641_10162028 | 3300026088 | Bacteria | 2034 |
| 797 | Ga0207641_10278074 | 3300026088 | Bacteria | 1573 |
| 798 | Ga0207641_10415131 | 3300026088 | Bacteria | 1295 |
| 799 | Ga0207648_10011901 | 3300026089 | Bacteria | 8174 |
| 800 | Ga0207648_10076457 | 3300026089 | Bacteria | 2918 |
| 801 | Ga0207648_10873773 | 3300026089 | Bacteria | 839 |
| 802 | Ga0207676_10009897 | 3300026095 | Bacteria | 6783 |
| 803 | Ga0207676_10188024 | 3300026095 | Bacteria | 1815 |
| 804 | Ga0207676_10200669 | 3300026095 | Bacteria | 1762 |
| 805 | Ga0207676_10562303 | 3300026095 | Bacteria | 1091 |
| 806 | Ga0207674_10000090 | 3300026116 | Bacteria | 99821 |
| 807 | Ga0207674_10005138 | 3300026116 | Bacteria | 15610 |
| 808 | Ga0207674_10082164 | 3300026116 | Bacteria | 3223 |
| 809 | Ga0207674_10089465 | 3300026116 | Bacteria | 3071 |
| 810 | Ga0207674_10217853 | 3300026116 | Bacteria | 1857 |
| 811 | Ga0207675_100022876 | 3300026118 | Bacteria | 5814 |
| 812 | Ga0207675_100368478 | 3300026118 | Bacteria | 1411 |
| 813 | Ga0207675_100722810 | 3300026118 | Bacteria | 1006 |
| 814 | Ga0207683_10015518 | 3300026121 | Bacteria | 6486 |
| 815 | Ga0207683_10114431 | 3300026121 | Bacteria | 2417 |
| 816 | Ga0207683_10125025 | 3300026121 | Bacteria | 2311 |
| 817 | Ga0207683_10221619 | 3300026121 | Bacteria | 1723 |
| 818 | Ga0207698_10000982 | 3300026142 | Bacteria | 16584 |
| 819 | Ga0207698_10007692 | 3300026142 | Bacteria | 6759 |
| 820 | Ga0207698_10018109 | 3300026142 | Bacteria | 4793 |
| 821 | Ga0207698_10130712 | 3300026142 | Bacteria | 2145 |
| 822 | Ga0207698_10380200 | 3300026142 | Bacteria | 1343 |
| 823 | Ga0207698_10444189 | 3300026142 | Bacteria | 1250 |
| 824 | Ga0207698_10583094 | 3300026142 | Bacteria | 1100 |
| 825 | Ga0207698_10798323 | 3300026142 | Bacteria | 946 |
| 826 | Ga0209973_1003226 | 3300027252 | Bacteria | 1589 |
| 827 | Ga0209371_1000048 | 3300027312 | Bacteria | 281705 |
| 828 | Ga0209984_1001727 | 3300027424 | Bacteria | 2391 |
| 829 | Ga0209999_1000442 | 3300027543 | Bacteria | 6380 |
| 830 | Ga0209982_1001040 | 3300027552 | Bacteria | 3693 |
| 831 | Ga0209970_1008325 | 3300027614 | Bacteria | 1702 |
| 832 | Ga0209971_1001367 | 3300027682 | Bacteria | 6057 |
| 833 | Ga0209974_10001896 | 3300027876 | Bacteria | 7638 |
| 834 | Ga0209974_10006797 | 3300027876 | Bacteria | 3971 |
| 835 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 836 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 837 | Ga0268266_10012196 | 3300028379 | Bacteria | 7438 |
| 838 | Ga0268266_10105549 | 3300028379 | Bacteria | 2489 |
| 839 | Ga0268266_10416320 | 3300028379 | Bacteria | 1273 |
| 840 | Ga0268265_10096396 | 3300028380 | Bacteria | 2377 |
| 841 | Ga0268264_10012879 | 3300028381 | Bacteria | 6880 |
| 842 | Ga0268264_10013020 | 3300028381 | Bacteria | 6837 |
| 843 | Ga0268264_10172359 | 3300028381 | Bacteria | 1958 |
| 844 | Ga0268264_10596859 | 3300028381 | Bacteria | 1088 |
| 845 | Ga0307517_10145217 | 3300028786 | Bacteria | 1649 |
| 846 | Ga0265338_10483232 | 3300028800 | Bacteria | 874 |
| 847 | Ga0268256_1000049 | 3300030500 | Bacteria | 307229 |
| 848 | Ga0316177_1156649 | 3300030731 | Bacteria | 6363 |
| 849 | Ga0316182_1026731 | 3300030745 | Bacteria | 5630 |
| 850 | Ga0307408_100079013 | 3300031548 | Bacteria | 2454 |
| 851 | Ga0307408_100092241 | 3300031548 | Bacteria | 2289 |
| 852 | Ga0307408_100161570 | 3300031548 | Bacteria | 1780 |
| 853 | Ga0307408_100300972 | 3300031548 | Bacteria | 1343 |
| 854 | Ga0307408_100798105 | 3300031548 | Bacteria | 856 |
| 855 | Ga0307508_10030073 | 3300031616 | Bacteria | 4908 |
| 856 | Ga0307508_10203007 | 3300031616 | Bacteria | 1583 |
| 857 | Ga0316575_10076918 | 3300031665 | Bacteria | 1344 |
| 858 | Ga0316576_10265740 | 3300031727 | Bacteria | 1287 |
| 859 | Ga0307516_10216777 | 3300031730 | Bacteria | 1625 |
| 860 | Ga0307405_10204962 | 3300031731 | Bacteria | 1435 |
| 861 | Ga0307413_10005298 | 3300031824 | Bacteria | 5737 |
| 862 | Ga0307413_10036935 | 3300031824 | Bacteria | 2817 |
| 863 | Ga0307413_10124312 | 3300031824 | Bacteria | 1753 |
| 864 | Ga0307413_10301187 | 3300031824 | Bacteria | 1216 |
| 865 | Ga0307413_10776646 | 3300031824 | Bacteria | 803 |
| 866 | Ga0307410_10151037 | 3300031852 | Bacteria | 1729 |
| 867 | Ga0307410_10431738 | 3300031852 | Bacteria | 1071 |
| 868 | Ga0307410_10489988 | 3300031852 | Bacteria | 1010 |
| 869 | Ga0307406_10285424 | 3300031901 | Bacteria | 1261 |
| 870 | Ga0307407_10010967 | 3300031903 | Bacteria | 4294 |
| 871 | Ga0307412_10031558 | 3300031911 | Bacteria | 3347 |
| 872 | Ga0307412_10042740 | 3300031911 | Bacteria | 2947 |
| 873 | Ga0307412_10107047 | 3300031911 | Bacteria | 1989 |
| 874 | Ga0307412_10504300 | 3300031911 | Bacteria | 1008 |
| 875 | Ga0307412_10905455 | 3300031911 | Bacteria | 773 |
| 876 | Ga0307409_101348517 | 3300031995 | Bacteria | 739 |
| 877 | Ga0307416_100243197 | 3300032002 | Bacteria | 1745 |
| 878 | Ga0307416_100337613 | 3300032002 | Bacteria | 1518 |
| 879 | Ga0307416_100600800 | 3300032002 | Bacteria | 1180 |
| 880 | Ga0307414_10040312 | 3300032004 | Bacteria | 3153 |
| 881 | Ga0307414_10067056 | 3300032004 | Bacteria | 2568 |
| 882 | Ga0307414_10113207 | 3300032004 | Bacteria | 2070 |
| 883 | Ga0307414_10138684 | 3300032004 | Bacteria | 1900 |
| 884 | Ga0307414_10179116 | 3300032004 | Bacteria | 1703 |
| 885 | Ga0307414_10292186 | 3300032004 | Bacteria | 1374 |
| 886 | Ga0307414_10406811 | 3300032004 | Bacteria | 1183 |
| 887 | Ga0307414_10457216 | 3300032004 | Bacteria | 1121 |
| 888 | Ga0307414_10522699 | 3300032004 | Bacteria | 1053 |
| 889 | Ga0307411_10013448 | 3300032005 | Bacteria | 4516 |
| 890 | Ga0307411_10084979 | 3300032005 | Bacteria | 2190 |
| 891 | Ga0307411_10333992 | 3300032005 | Bacteria | 1229 |
| 892 | Ga0307411_10460650 | 3300032005 | Bacteria | 1066 |
| 893 | Ga0307411_10476638 | 3300032005 | Bacteria | 1050 |
| 894 | Ga0307411_10834155 | 3300032005 | Bacteria | 814 |
| 895 | Ga0307415_100796717 | 3300032126 | Bacteria | 862 |
| 896 | Ga0307507_10032693 | 3300033179 | Bacteria | 5424 |
| 897 | Ga0307510_10132276 | 3300033180 | Bacteria | 2163 |
| 898 | Ga0373959_0023707 | 3300034820 | Bacteria | 1195 |
| 899 | Ga0373944_0103121 | 3300035089 | Bacteria | 966 |
| 900 | Ga0373936_0155331 | 3300035113 | Bacteria | 994 |
| 901 | Ga0373954_0261813 | 3300035118 | Bacteria | 852 |
| 902 | Ga0373957_0116767 | 3300035120 | Bacteria | 1078 |
| 903 | Ga0373947_0456849 | 3300035725 | Bacteria | 865 |
| 904 | Ga0373937_0422145 | 3300036401 | Bacteria | 1266 |
| 905 | Ga0373937_0855561 | 3300036401 | Bacteria | 858 |
| 906 | Ga0395899_0001125 | 3300037312 | Bacteria | 23866 |
| 907 | Ga0395899_0029586 | 3300037312 | Bacteria | 4120 |
| 908 | Ga0395899_0082043 | 3300037312 | Bacteria | 2345 |
| 909 | Ga0395899_0178593 | 3300037312 | Bacteria | 1491 |
| 910 | Ga0395899_0206202 | 3300037312 | Bacteria | 1368 |
| 911 | Ga0395899_0287868 | 3300037312 | Bacteria | 1115 |
| 912 | Ga0395899_0457805 | 3300037312 | Bacteria | 834 |
| 913 | Ga0395900_0001304 | 3300037418 | Bacteria | 30351 |
| 914 | Ga0395900_0004445 | 3300037418 | Bacteria | 14854 |
| 915 | Ga0395900_0024057 | 3300037418 | Bacteria | 6233 |
| 916 | Ga0395900_0032548 | 3300037418 | Bacteria | 5361 |
| 917 | Ga0395900_0046052 | 3300037418 | Bacteria | 4491 |
| 918 | Ga0395900_0050386 | 3300037418 | Bacteria | 4289 |
| 919 | Ga0395900_0066734 | 3300037418 | Bacteria | 3697 |
| 920 | Ga0395900_0713229 | 3300037418 | Bacteria | 936 |
| 921 | Ga0395900_1152336 | 3300037418 | Bacteria | 691 |
| 922 | Ga0395898_0001583 | 3300037466 | Bacteria | 31093 |
| 923 | Ga0395898_0002066 | 3300037466 | Bacteria | 25003 |
| 924 | Ga0395898_0002627 | 3300037466 | Bacteria | 20893 |
| 925 | Ga0395898_0002725 | 3300037466 | Bacteria | 20379 |
| 926 | Ga0395898_0013479 | 3300037466 | Bacteria | 8416 |
| 927 | Ga0395898_0036705 | 3300037466 | Bacteria | 4865 |
| 928 | Ga0395898_0114789 | 3300037466 | Bacteria | 2580 |
| 929 | Ga0395898_0136496 | 3300037466 | Bacteria | 2349 |
| 930 | Ga0395898_0317809 | 3300037466 | Bacteria | 1485 |
| 931 | Ga0436364_0095944 | 3300037853 | Bacteria | 1339 |
| 932 | Ga0395901_0000259 | 3300038443 | Bacteria | 66203 |
| 933 | Ga0395901_0001429 | 3300038443 | Bacteria | 24902 |
| 934 | Ga0395901_0049227 | 3300038443 | Bacteria | 4378 |
| 935 | Ga0395901_0053602 | 3300038443 | Bacteria | 4190 |
| 936 | Ga0395901_0061507 | 3300038443 | Bacteria | 3907 |
| 937 | Ga0395901_0063473 | 3300038443 | Bacteria | 3844 |
| 938 | Ga0395901_0220090 | 3300038443 | Bacteria | 1984 |
| 939 | Ga0395901_0244857 | 3300038443 | Bacteria | 1869 |
| 940 | Ga0395901_0324327 | 3300038443 | Bacteria | 1593 |
| 941 | Ga0395901_0530985 | 3300038443 | Bacteria | 1194 |
| 942 | Ga0237819_00140 | 3300038705 | Bacteria | 27368 |
| 943 | Ga0400488_38144 | 3300038741 | Unclassified | 1235 |
| 944 | Ga0400486_30133 | 3300038742 | Bacteria | 4675 |
| 945 | Ga0436365_0119571 | 3300039437 | Bacteria | 638 |
| 946 | Ga0436365_0324168 | 3300039437 | Bacteria | 3849 |
| 947 | Ga0436363_0359992 | 3300039450 | Bacteria | 2727 |
| 948 | Ga0436362_0657356 | 3300039453 | Bacteria | 1590 |
| 949 | Ga0439436_0003731 | 3300041404 | Bacteria | 4651 |
| 950 | Ga0439436_0049721 | 3300041404 | Bacteria | 1188 |
| 951 | Ga0439436_0062325 | 3300041404 | Bacteria | 1043 |
| 952 | Ga0439447_001069 | 3300041407 | Bacteria | 9935 |
| 953 | Ga0439465_0000006 | 3300041413 | Bacteria | 54247 |
| 954 | Ga0439465_0004178 | 3300041413 | Bacteria | 4697 |
| 955 | Ga0451789_0416833 | 3300041443 | Bacteria | 1156 |
| 956 | Ga0451793_1086667 | 3300041452 | Bacteria | 3180 |
| 957 | Ga0451797_0190827 | 3300041453 | Bacteria | 1333 |
| 958 | Ga0451795_0046765 | 3300041456 | Bacteria | 1080 |
| 959 | Ga0451800_1451396 | 3300041459 | Bacteria | 1082 |
| 960 | Ga0451802_0727430 | 3300041460 | Bacteria | 761 |
| 961 | Ga0451806_127485 | 3300041462 | Bacteria | 616 |
| 962 | Ga0451807_0483911 | 3300041486 | Bacteria | 980 |
| 963 | Ga0451835_0771462 | 3300041492 | Bacteria | 597 |
| 964 | Ga0451837_1048697 | 3300041494 | Bacteria | 892 |
| 965 | Ga0451837_1628237 | 3300041494 | Bacteria | 2570 |
| 966 | Ga0451839_0794977 | 3300041496 | Bacteria | 966 |
| 967 | Ga0451849_0604301 | 3300041505 | Bacteria | 689 |
| 968 | Ga0451843_1708573 | 3300041509 | Bacteria | 733 |
| 969 | Ga0451853_1416507 | 3300041512 | Bacteria | 660 |
| 970 | Ga0451853_1645120 | 3300041512 | Bacteria | 1005 |
| 971 | Ga0451853_3750318 | 3300041512 | Bacteria | 783 |
| 972 | Ga0439431_0002900 | 3300041997 | Bacteria | 3774 |
| 973 | Ga0439433_0037525 | 3300041999 | Bacteria | 1122 |
| 974 | Ga0439445_0000142 | 3300042004 | Bacteria | 12656 |
| 975 | Ga0439448_0102780 | 3300042005 | Bacteria | 972 |
| 976 | Ga0439432_065208 | 3300042006 | Bacteria | 1117 |
| 977 | Ga0439432_108552 | 3300042006 | Bacteria | 827 |
| 978 | Ga0439449_0020297 | 3300042007 | Bacteria | 2490 |
| 979 | Ga0439449_0127096 | 3300042007 | Bacteria | 947 |
| 980 | Ga0439452_004747 | 3300042010 | Bacteria | 4496 |
| 981 | Ga0439459_0002300 | 3300042438 | Bacteria | 2931 |
| 982 | Ga0439459_0002709 | 3300042438 | Bacteria | 2755 |
| 983 | Ga0451577_0000425 | 3300042876 | Bacteria | 75871 |
| 984 | Ga0451577_0008483 | 3300042876 | Bacteria | 10003 |
| 985 | Ga0466969_0015351 | 3300044656 | Bacteria | 4014 |
| 986 | Ga0466969_0030228 | 3300044656 | Bacteria | 2761 |
| 987 | Ga0466972_0000647 | 3300044658 | Bacteria | 16793 |
| 988 | Ga0466972_0001847 | 3300044658 | Bacteria | 10373 |
| 989 | Ga0466972_0002963 | 3300044658 | Bacteria | 8405 |
| 990 | Ga0466982_0000007 | 3300044672 | Bacteria | 250854 |
| 991 | Ga0466982_0000029 | 3300044672 | Bacteria | 60348 |
| 992 | Ga0466965_0000764 | 3300044683 | Bacteria | 12107 |
| 993 | Ga0466965_0002141 | 3300044683 | Bacteria | 8293 |
| 994 | Ga0466965_0007999 | 3300044683 | Bacteria | 4878 |
| 995 | Ga0466965_0032814 | 3300044683 | Bacteria | 2536 |
| 996 | Ga0466965_0104626 | 3300044683 | Bacteria | 1450 |
| 997 | Ga0466966_0000343 | 3300044684 | Bacteria | 30095 |
| 998 | Ga0466966_0001588 | 3300044684 | Bacteria | 14607 |
| 999 | Ga0466961_0000199 | 3300044693 | Bacteria | 40467 |
| 1000 | Ga0466961_0002917 | 3300044693 | Bacteria | 10619 |
| 1001 | Ga0466961_0096135 | 3300044693 | Bacteria | 1868 |
| 1002 | Ga0466961_0282415 | 3300044693 | Bacteria | 1016 |
| 1003 | Ga0466961_0586090 | 3300044693 | Bacteria | 671 |
| 1004 | Ga0466964_0000680 | 3300044706 | Bacteria | 10952 |
| 1005 | Ga0453684_0025105 | 3300044712 | Bacteria | 8669 |
| 1006 | Ga0466971_0004638 | 3300044719 | Bacteria | 5938 |
| 1007 | Ga0466968_0019341 | 3300044735 | Bacteria | 2742 |
| 1008 | Ga0466970_0000132 | 3300044765 | Bacteria | 34193 |
| 1009 | Ga0466970_0000260 | 3300044765 | Bacteria | 25913 |
| 1010 | Ga0466970_0058767 | 3300044765 | Bacteria | 2058 |
| 1011 | Ga0466970_0076519 | 3300044765 | Bacteria | 1803 |
| 1012 | Ga0466957_0001273 | 3300044842 | Bacteria | 13130 |
| 1013 | Ga0466957_0030641 | 3300044842 | Bacteria | 3212 |
| 1014 | Ga0466960_0106077 | 3300044901 | Bacteria | 1453 |
| 1015 | Ga0466959_0000293 | 3300045049 | Bacteria | 29880 |
| 1016 | Ga0466959_0058398 | 3300045049 | Bacteria | 2810 |
| 1017 | Ga0466959_0227903 | 3300045049 | Bacteria | 1290 |
| 1018 | Ga0466958_0003516 | 3300045836 | Bacteria | 8143 |
| 1019 | Ga0466967_0409936 | 3300045976 | Bacteria | 1320 |
| 1020 | Ga0495617_000122 | 3300046452 | Bacteria | 51915 |
| 1021 | Ga0495617_000504 | 3300046452 | Bacteria | 20437 |
| 1022 | Ga0495590_0181138 | 3300046457 | Bacteria | 770 |
| 1023 | Ga0495629_0240917 | 3300046459 | Bacteria | 1245 |
| 1024 | Ga0495638_0000106 | 3300046460 | Bacteria | 133921 |
| 1025 | Ga0495638_0000237 | 3300046460 | Bacteria | 75347 |
| 1026 | Ga0495638_0000479 | 3300046460 | Bacteria | 47958 |
| 1027 | Ga0495641_0134174 | 3300046461 | Bacteria | 1105 |
| 1028 | Ga0495650_0000074 | 3300046471 | Bacteria | 251346 |
| 1029 | Ga0495650_0000134 | 3300046471 | Bacteria | 173331 |
| 1030 | Ga0495580_0237075 | 3300046472 | Bacteria | 1251 |
| 1031 | Ga0495582_0033576 | 3300046473 | Bacteria | 2821 |
| 1032 | Ga0495639_0064198 | 3300046475 | Bacteria | 1687 |
| 1033 | Ga0495584_0001870 | 3300046491 | Bacteria | 12175 |
| 1034 | Ga0495594_0189023 | 3300046499 | Bacteria | 1173 |
| 1035 | Ga0495607_0000042 | 3300046501 | Bacteria | 130434 |
| 1036 | Ga0495607_0004080 | 3300046501 | Bacteria | 10918 |
| 1037 | Ga0495583_0000833 | 3300046506 | Bacteria | 37749 |
| 1038 | Ga0495583_0003138 | 3300046506 | Bacteria | 13041 |
| 1039 | Ga0495583_0008323 | 3300046506 | Bacteria | 6359 |
| 1040 | Ga0495606_0000562 | 3300046507 | Bacteria | 59044 |
| 1041 | Ga0495606_0001636 | 3300046507 | Bacteria | 29195 |
| 1042 | Ga0495606_0008349 | 3300046507 | Bacteria | 9018 |
| 1043 | Ga0495606_0015682 | 3300046507 | Bacteria | 5822 |
| 1044 | Ga0495610_0000711 | 3300046512 | Bacteria | 31740 |
| 1045 | Ga0495616_0000617 | 3300046513 | Bacteria | 26769 |
| 1046 | Ga0495616_0003053 | 3300046513 | Bacteria | 10846 |
| 1047 | Ga0495620_0000182 | 3300046515 | Bacteria | 48877 |
| 1048 | Ga0495620_0000216 | 3300046515 | Bacteria | 43506 |
| 1049 | Ga0495620_0027243 | 3300046515 | Bacteria | 2677 |
| 1050 | Ga0495630_0161208 | 3300046517 | Bacteria | 1708 |
| 1051 | Ga0495632_0000241 | 3300046519 | Bacteria | 54558 |
| 1052 | Ga0495637_0014597 | 3300046520 | Bacteria | 3703 |
| 1053 | Ga0495648_0001366 | 3300046524 | Bacteria | 24119 |
| 1054 | Ga0495663_0051406 | 3300046525 | Bacteria | 1277 |
| 1055 | Ga0495663_0122884 | 3300046525 | Bacteria | 870 |
| 1056 | Ga0495587_0708173 | 3300046536 | Bacteria | 552 |
| 1057 | Ga0495609_0030336 | 3300046538 | Bacteria | 2461 |
| 1058 | Ga0495622_0106668 | 3300046557 | Bacteria | 1283 |
| 1059 | Ga0495656_0000847 | 3300046615 | Bacteria | 9876 |
| 1060 | Ga0495656_0121006 | 3300046615 | Bacteria | 1235 |
| 1061 | Ga0495668_0000411 | 3300046616 | Bacteria | 55902 |
| 1062 | Ga0495611_0000004 | 3300046648 | Bacteria | 308149 |
| 1063 | Ga0495611_0000023 | 3300046648 | Bacteria | 120553 |
| 1064 | Ga0495611_0002701 | 3300046648 | Bacteria | 7998 |
| 1065 | Ga0495625_0000024 | 3300046660 | Bacteria | 271126 |
| 1066 | Ga0495625_0001652 | 3300046660 | Bacteria | 26150 |
| 1067 | Ga0495625_0018885 | 3300046660 | Bacteria | 5368 |
| 1068 | Ga0495625_0047054 | 3300046660 | Bacteria | 3111 |
| 1069 | Ga0495625_0057783 | 3300046660 | Bacteria | 2757 |
| 1070 | Ga0495625_0160641 | 3300046660 | Bacteria | 1505 |
| 1071 | Ga0495625_0382372 | 3300046660 | Bacteria | 883 |
| 1072 | Ga0495588_0071922 | 3300046674 | Bacteria | 1799 |
| 1073 | Ga0495588_0153472 | 3300046674 | Bacteria | 1217 |
| 1074 | Ga0495657_0095923 | 3300046675 | Bacteria | 1895 |
| 1075 | Ga0495599_0389719 | 3300046678 | Bacteria | 831 |
| 1076 | Ga0495647_0032678 | 3300046681 | Bacteria | 1941 |
| 1077 | Ga0495613_0656007 | 3300046689 | Bacteria | 694 |
| 1078 | Ga0495670_0009105 | 3300046691 | Bacteria | 4882 |
| 1079 | Ga0495670_0129075 | 3300046691 | Bacteria | 1317 |
| 1080 | Ga0495671_0000390 | 3300046692 | Bacteria | 36237 |
| 1081 | Ga0495649_0000687 | 3300046694 | Bacteria | 27564 |
| 1082 | Ga0495589_0000038 | 3300046794 | Bacteria | 149381 |
| 1083 | Ga0495589_0000547 | 3300046794 | Bacteria | 26112 |
| 1084 | Ga0495600_0117039 | 3300046809 | Bacteria | 1735 |
| 1085 | Ga0495660_0000321 | 3300046810 | Bacteria | 42518 |
| 1086 | Ga0495636_0003246 | 3300047318 | Bacteria | 6308 |
| 1087 | Ga0495636_0006414 | 3300047318 | Bacteria | 4622 |
| 1088 | Ga0495636_0086670 | 3300047318 | Bacteria | 1354 |
| 1089 | Ga0495672_0000544 | 3300047320 | Bacteria | 42844 |
| 1090 | Ga0495679_000011 | 3300047446 | Bacteria | 324498 |
| 1091 | Ga0495673_0000616 | 3300047469 | Bacteria | 35177 |
| 1092 | Ga0495681_0015144 | 3300047470 | Bacteria | 4375 |
| 1093 | Ga0495684_0168776 | 3300047471 | Bacteria | 1629 |
| 1094 | Ga0495686_0000608 | 3300047472 | Bacteria | 49564 |
| 1095 | Ga0495686_0010132 | 3300047472 | Bacteria | 6726 |
| 1096 | Ga0495686_0010763 | 3300047472 | Bacteria | 6488 |
| 1097 | Ga0495686_0061393 | 3300047472 | Bacteria | 2334 |
| 1098 | Ga0495686_0071603 | 3300047472 | Bacteria | 2133 |
| 1099 | Ga0495686_0127698 | 3300047472 | Bacteria | 1510 |
| 1100 | Ga0495686_0250464 | 3300047472 | Bacteria | 995 |
| 1101 | Ga0495602_0158386 | 3300048088 | Bacteria | 1771 |
| 1102 | Ga0496100_0001740 | 3300048903 | Bacteria | 10855 |
| 1103 | Ga0496100_0584488 | 3300048903 | Bacteria | 866 |
| 1104 | Ga0496101_0012388 | 3300048904 | Bacteria | 5690 |
| 1105 | Ga0496101_0073503 | 3300048904 | Bacteria | 2512 |
| 1106 | Ga0496101_0132636 | 3300048904 | Bacteria | 1893 |
| 1107 | Ga0496102_0082098 | 3300048905 | Bacteria | 2973 |
| 1108 | Ga0496102_0583618 | 3300048905 | Bacteria | 1040 |
| 1109 | Ga0496104_0000012 | 3300048907 | Bacteria | 438011 |
| 1110 | Ga0496104_0338658 | 3300048907 | Bacteria | 1417 |
| 1111 | Ga0496105_0000011 | 3300048908 | Bacteria | 302186 |
| 1112 | Ga0496106_0175573 | 3300048909 | Bacteria | 1699 |
| 1113 | Ga0496107_0035157 | 3300048910 | Bacteria | 3592 |
| 1114 | Ga0496107_0094425 | 3300048910 | Bacteria | 2188 |
| 1115 | Ga0496107_0378835 | 3300048910 | Bacteria | 1052 |
| 1116 | Ga0496108_0724804 | 3300048911 | Bacteria | 861 |
| 1117 | Ga0496108_1175036 | 3300048911 | Bacteria | 650 |
| 1118 | Ga0496110_0298806 | 3300048913 | Bacteria | 1466 |
| 1119 | Ga0496112_0540649 | 3300048915 | Bacteria | 1099 |
| 1120 | Ga0496113_0024417 | 3300048916 | Bacteria | 4297 |
| 1121 | Ga0496113_0203915 | 3300048916 | Bacteria | 1572 |
| 1122 | Ga0496113_1191232 | 3300048916 | Bacteria | 595 |
| 1123 | Ga0496114_0001533 | 3300048917 | Bacteria | 17508 |
| 1124 | Ga0496114_0006408 | 3300048917 | Bacteria | 9269 |
| 1125 | Ga0496114_0172916 | 3300048917 | Bacteria | 1883 |
| 1126 | Ga0496114_0208232 | 3300048917 | Bacteria | 1715 |
| 1127 | Ga0496115_0000092 | 3300048918 | Bacteria | 83381 |
| 1128 | Ga0496115_0000193 | 3300048918 | Bacteria | 56720 |
| 1129 | Ga0496115_0000617 | 3300048918 | Bacteria | 27037 |
| 1130 | Ga0496115_0004525 | 3300048918 | Bacteria | 10055 |
| 1131 | Ga0496115_0031269 | 3300048918 | Bacteria | 4193 |
| 1132 | Ga0496115_0145340 | 3300048918 | Bacteria | 1957 |
| 1133 | Ga0496115_0221537 | 3300048918 | Bacteria | 1561 |
| 1134 | Ga0496117_0004278 | 3300048920 | Bacteria | 15910 |
| 1135 | Ga0496117_0005719 | 3300048920 | Bacteria | 12931 |
| 1136 | Ga0496117_0009436 | 3300048920 | Bacteria | 9080 |
| 1137 | Ga0496118_0000885 | 3300048921 | Bacteria | 47246 |
| 1138 | Ga0496118_0001282 | 3300048921 | Bacteria | 38428 |
| 1139 | Ga0496118_0001962 | 3300048921 | Bacteria | 29176 |
| 1140 | Ga0496118_0002465 | 3300048921 | Bacteria | 24852 |
| 1141 | Ga0496118_0004440 | 3300048921 | Bacteria | 16648 |
| 1142 | Ga0496118_0012974 | 3300048921 | Bacteria | 7933 |
| 1143 | Ga0496118_0241615 | 3300048921 | Bacteria | 1033 |
| 1144 | Ga0496119_0041672 | 3300048922 | Bacteria | 2921 |
| 1145 | Ga0496120_0107468 | 3300048923 | Bacteria | 1463 |
| 1146 | Ga0496120_0117853 | 3300048923 | Bacteria | 1377 |
| 1147 | Ga0496121_0000071 | 3300048924 | Bacteria | 247039 |
| 1148 | Ga0496121_0000942 | 3300048924 | Bacteria | 52638 |
| 1149 | Ga0496121_0001620 | 3300048924 | Bacteria | 37310 |
| 1150 | Ga0496121_0001863 | 3300048924 | Bacteria | 33851 |
| 1151 | Ga0496121_0001864 | 3300048924 | Bacteria | 33829 |
| 1152 | Ga0496121_0001888 | 3300048924 | Bacteria | 33577 |
| 1153 | Ga0496121_0002280 | 3300048924 | Bacteria | 29844 |
| 1154 | Ga0496121_0006661 | 3300048924 | Bacteria | 14212 |
| 1155 | Ga0496121_0016652 | 3300048924 | Bacteria | 7570 |
| 1156 | Ga0496121_0037969 | 3300048924 | Bacteria | 4272 |
| 1157 | Ga0496121_0142210 | 3300048924 | Bacteria | 1778 |
| 1158 | Ga0496122_0000062 | 3300048925 | Bacteria | 241387 |
| 1159 | Ga0496122_0016999 | 3300048925 | Bacteria | 6833 |
| 1160 | Ga0496122_0018310 | 3300048925 | Bacteria | 6482 |
| 1161 | Ga0496122_0048979 | 3300048925 | Bacteria | 3243 |
| 1162 | Ga0496122_0066017 | 3300048925 | Bacteria | 2618 |
| 1163 | Ga0496123_0004387 | 3300048926 | Bacteria | 14875 |
| 1164 | Ga0496123_0009110 | 3300048926 | Bacteria | 8985 |
| 1165 | Ga0496123_0012934 | 3300048926 | Bacteria | 7057 |
| 1166 | Ga0496123_0013031 | 3300048926 | Bacteria | 7018 |
| 1167 | Ga0496123_0075915 | 3300048926 | Bacteria | 2071 |
| 1168 | Ga0496124_0000313 | 3300048927 | Bacteria | 89891 |
| 1169 | Ga0496124_0000314 | 3300048927 | Bacteria | 89797 |
| 1170 | Ga0496124_0007021 | 3300048927 | Bacteria | 12067 |
| 1171 | Ga0496125_0000291 | 3300048928 | Bacteria | 98752 |
| 1172 | Ga0496125_0024124 | 3300048928 | Bacteria | 5600 |
| 1173 | Ga0496125_0060859 | 3300048928 | Bacteria | 3032 |
| 1174 | Ga0496125_0349895 | 3300048928 | Bacteria | 883 |
| 1175 | Ga0496126_0000160 | 3300048929 | Bacteria | 155144 |
| 1176 | Ga0496126_0003733 | 3300048929 | Bacteria | 18974 |
| 1177 | Ga0496126_0004079 | 3300048929 | Bacteria | 17716 |
| 1178 | Ga0496126_0004964 | 3300048929 | Bacteria | 15517 |
| 1179 | Ga0496126_0009232 | 3300048929 | Bacteria | 10514 |
| 1180 | Ga0496126_0011982 | 3300048929 | Bacteria | 8913 |
| 1181 | Ga0496126_0017284 | 3300048929 | Bacteria | 7188 |
| 1182 | Ga0496126_0018434 | 3300048929 | Bacteria | 6914 |
| 1183 | Ga0496126_0050363 | 3300048929 | Bacteria | 3796 |
| 1184 | Ga0496126_0060206 | 3300048929 | Bacteria | 3416 |
| 1185 | Ga0496126_0080523 | 3300048929 | Bacteria | 2882 |
| 1186 | Ga0496126_0086649 | 3300048929 | Bacteria | 2760 |
| 1187 | Ga0496126_1012005 | 3300048929 | Bacteria | 623 |
| 1188 | Ga0495678_000062 | 3300049459 | Bacteria | 140706 |
| 1189 | Ga0495678_025362 | 3300049459 | Bacteria | 2547 |
| 1190 | Ga0495682_0000283 | 3300049460 | Bacteria | 39664 |
| 1191 | Ga0495682_0000341 | 3300049460 | Bacteria | 34546 |
| 1192 | Ga0495682_0000372 | 3300049460 | Bacteria | 32548 |
| 1193 | Ga0495682_0013547 | 3300049460 | Bacteria | 3102 |
| 1194 | Ga0501031_0002957 | 3300049568 | Bacteria | 10872 |
| 1195 | Ga0501031_0016767 | 3300049568 | Bacteria | 4758 |
| 1196 | Ga0501031_0047333 | 3300049568 | Bacteria | 2804 |
| 1197 | Ga0501031_0076103 | 3300049568 | Bacteria | 2185 |
| 1198 | Ga0501031_0117963 | 3300049568 | Bacteria | 1734 |
| 1199 | Ga0501031_0207521 | 3300049568 | Bacteria | 1277 |
| 1200 | Ga0501031_0357314 | 3300049568 | Bacteria | 945 |
| 1201 | Ga0501032_0000485 | 3300049569 | Bacteria | 32254 |
| 1202 | Ga0501032_0004538 | 3300049569 | Bacteria | 10445 |
| 1203 | Ga0501032_0007187 | 3300049569 | Bacteria | 8145 |
| 1204 | Ga0501032_0042745 | 3300049569 | Bacteria | 3073 |
| 1205 | Ga0501032_0100806 | 3300049569 | Bacteria | 1913 |
| 1206 | Ga0501032_0174762 | 3300049569 | Bacteria | 1407 |
| 1207 | Ga0501032_0225935 | 3300049569 | Bacteria | 1217 |
| 1208 | Ga0501032_0589179 | 3300049569 | Bacteria | 708 |
| 1209 | Ga0501033_0002332 | 3300049570 | Bacteria | 16174 |
| 1210 | Ga0501033_0002853 | 3300049570 | Bacteria | 14482 |
| 1211 | Ga0501033_0004295 | 3300049570 | Bacteria | 11444 |
| 1212 | Ga0501033_0005340 | 3300049570 | Bacteria | 10182 |
| 1213 | Ga0501033_0036768 | 3300049570 | Bacteria | 3667 |
| 1214 | Ga0501033_0265859 | 3300049570 | Bacteria | 1213 |
| 1215 | Ga0501034_0000544 | 3300049571 | Bacteria | 59969 |
| 1216 | Ga0501034_0001449 | 3300049571 | Bacteria | 31438 |
| 1217 | Ga0501034_0004230 | 3300049571 | Bacteria | 16025 |
| 1218 | Ga0501034_0006520 | 3300049571 | Bacteria | 12549 |
| 1219 | Ga0501034_0006867 | 3300049571 | Bacteria | 12170 |
| 1220 | Ga0501034_0010307 | 3300049571 | Bacteria | 9744 |
| 1221 | Ga0501034_0012391 | 3300049571 | Bacteria | 8807 |
| 1222 | Ga0501034_0042361 | 3300049571 | Bacteria | 4609 |
| 1223 | Ga0501034_0056437 | 3300049571 | Bacteria | 3952 |
| 1224 | Ga0501034_0073006 | 3300049571 | Bacteria | 3439 |
| 1225 | Ga0501034_0125919 | 3300049571 | Bacteria | 2547 |
| 1226 | Ga0501034_0141390 | 3300049571 | Bacteria | 2386 |
| 1227 | Ga0501034_0294235 | 3300049571 | Bacteria | 1561 |
| 1228 | Ga0501034_0356522 | 3300049571 | Bacteria | 1390 |
| 1229 | Ga0501034_0778465 | 3300049571 | Bacteria | 851 |
| 1230 | Ga0501036_0008476 | 3300049572 | Bacteria | 8426 |
| 1231 | Ga0501036_0047433 | 3300049572 | Bacteria | 3638 |
| 1232 | Ga0501036_0108054 | 3300049572 | Bacteria | 2352 |
| 1233 | Ga0501036_0375127 | 3300049572 | Bacteria | 1187 |
| 1234 | Ga0501036_0579029 | 3300049572 | Bacteria | 932 |
| 1235 | Ga0501036_0739410 | 3300049572 | Bacteria | 812 |
| 1236 | Ga0501036_0794192 | 3300049572 | Bacteria | 780 |
| 1237 | Ga0501037_0004806 | 3300049573 | Bacteria | 9821 |
| 1238 | Ga0501037_0028275 | 3300049573 | Bacteria | 4141 |
| 1239 | Ga0501037_0091448 | 3300049573 | Bacteria | 2200 |
| 1240 | Ga0501037_0096898 | 3300049573 | Bacteria | 2131 |
| 1241 | Ga0501037_0104567 | 3300049573 | Bacteria | 2041 |
| 1242 | Ga0501037_0206295 | 3300049573 | Bacteria | 1387 |
| 1243 | Ga0501037_0360052 | 3300049573 | Bacteria | 1002 |
| 1244 | Ga0501037_0388123 | 3300049573 | Bacteria | 959 |
| 1245 | Ga0501037_0413500 | 3300049573 | Bacteria | 924 |
| 1246 | Ga0501038_0000251 | 3300049574 | Bacteria | 45437 |
| 1247 | Ga0501038_0006634 | 3300049574 | Bacteria | 10706 |
| 1248 | Ga0501038_0011631 | 3300049574 | Bacteria | 8028 |
| 1249 | Ga0501038_0023411 | 3300049574 | Bacteria | 5521 |
| 1250 | Ga0501038_0220810 | 3300049574 | Bacteria | 1512 |
| 1251 | Ga0501038_0222956 | 3300049574 | Bacteria | 1503 |
| 1252 | Ga0501038_0489651 | 3300049574 | Bacteria | 941 |
| 1253 | Ga0501039_0007491 | 3300049575 | Bacteria | 8335 |
| 1254 | Ga0501039_0055978 | 3300049575 | Bacteria | 3055 |
| 1255 | Ga0501039_0073969 | 3300049575 | Bacteria | 2647 |
| 1256 | Ga0501039_0144966 | 3300049575 | Bacteria | 1866 |
| 1257 | Ga0501039_0195532 | 3300049575 | Bacteria | 1590 |
| 1258 | Ga0501039_0223697 | 3300049575 | Bacteria | 1479 |
| 1259 | Ga0501040_0118373 | 3300049576 | Bacteria | 1857 |
| 1260 | Ga0501042_0398761 | 3300049578 | Bacteria | 996 |
| 1261 | Ga0501043_0003128 | 3300049579 | Bacteria | 13725 |
| 1262 | Ga0501043_0003723 | 3300049579 | Bacteria | 12532 |
| 1263 | Ga0501043_0009046 | 3300049579 | Bacteria | 7837 |
| 1264 | Ga0501043_0014418 | 3300049579 | Bacteria | 6184 |
| 1265 | Ga0501043_0017421 | 3300049579 | Bacteria | 5631 |
| 1266 | Ga0501043_0019309 | 3300049579 | Bacteria | 5350 |
| 1267 | Ga0501043_0063840 | 3300049579 | Bacteria | 2892 |
| 1268 | Ga0501043_0129292 | 3300049579 | Bacteria | 1979 |
| 1269 | Ga0501043_0208162 | 3300049579 | Bacteria | 1516 |
| 1270 | Ga0501043_0252463 | 3300049579 | Bacteria | 1358 |
| 1271 | Ga0501046_0009056 | 3300049580 | Bacteria | 8630 |
| 1272 | Ga0501046_0013125 | 3300049580 | Bacteria | 7032 |
| 1273 | Ga0501046_0015580 | 3300049580 | Bacteria | 6385 |
| 1274 | Ga0501046_0024091 | 3300049580 | Bacteria | 4997 |
| 1275 | Ga0501046_0093130 | 3300049580 | Bacteria | 2316 |
| 1276 | Ga0501046_0124060 | 3300049580 | Bacteria | 1963 |
| 1277 | Ga0501046_0156218 | 3300049580 | Bacteria | 1718 |
| 1278 | Ga0501047_0000250 | 3300049581 | Bacteria | 63699 |
| 1279 | Ga0501047_0002064 | 3300049581 | Bacteria | 19202 |
| 1280 | Ga0501047_0004581 | 3300049581 | Bacteria | 13005 |
| 1281 | Ga0501047_0008714 | 3300049581 | Bacteria | 9572 |
| 1282 | Ga0501047_0050558 | 3300049581 | Bacteria | 4014 |
| 1283 | Ga0501047_0143168 | 3300049581 | Bacteria | 2268 |
| 1284 | Ga0501047_0167971 | 3300049581 | Bacteria | 2064 |
| 1285 | Ga0501047_0219175 | 3300049581 | Bacteria | 1759 |
| 1286 | Ga0501047_0220542 | 3300049581 | Bacteria | 1753 |
| 1287 | Ga0501047_0299928 | 3300049581 | Bacteria | 1449 |
| 1288 | Ga0501047_0311134 | 3300049581 | Bacteria | 1416 |
| 1289 | Ga0501047_0412210 | 3300049581 | Bacteria | 1183 |
| 1290 | Ga0501048_0017672 | 3300049582 | Bacteria | 5250 |
| 1291 | Ga0501048_0039385 | 3300049582 | Bacteria | 3390 |
| 1292 | Ga0501048_0112774 | 3300049582 | Bacteria | 1920 |
| 1293 | Ga0501067_0000560 | 3300049583 | Bacteria | 20112 |
| 1294 | Ga0501067_0008269 | 3300049583 | Bacteria | 5779 |
| 1295 | Ga0501068_0016281 | 3300049584 | Bacteria | 4285 |
| 1296 | Ga0501068_0031539 | 3300049584 | Bacteria | 3148 |
| 1297 | Ga0501068_0094355 | 3300049584 | Bacteria | 1849 |
| 1298 | Ga0501068_0094652 | 3300049584 | Bacteria | 1846 |
| 1299 | Ga0501068_0399129 | 3300049584 | Bacteria | 886 |
| 1300 | Ga0501069_0016989 | 3300049585 | Bacteria | 3910 |
| 1301 | Ga0501069_0018450 | 3300049585 | Bacteria | 3764 |
| 1302 | Ga0501069_0024864 | 3300049585 | Bacteria | 3270 |
| 1303 | Ga0501069_0045605 | 3300049585 | Bacteria | 2429 |
| 1304 | Ga0501070_0003399 | 3300049586 | Bacteria | 13818 |
| 1305 | Ga0501070_0022970 | 3300049586 | Bacteria | 5221 |
| 1306 | Ga0501070_0026818 | 3300049586 | Bacteria | 4832 |
| 1307 | Ga0501070_0080766 | 3300049586 | Bacteria | 2690 |
| 1308 | Ga0501070_0149339 | 3300049586 | Bacteria | 1928 |
| 1309 | Ga0501070_0157905 | 3300049586 | Bacteria | 1870 |
| 1310 | Ga0501070_0240087 | 3300049586 | Bacteria | 1483 |
| 1311 | Ga0501070_0263973 | 3300049586 | Bacteria | 1407 |
| 1312 | Ga0501070_0727883 | 3300049586 | Bacteria | 783 |
| 1313 | Ga0501071_0040096 | 3300049587 | Bacteria | 3351 |
| 1314 | Ga0501071_0205648 | 3300049587 | Bacteria | 1479 |
| 1315 | Ga0501072_0003501 | 3300049588 | Bacteria | 11825 |
| 1316 | Ga0501072_0016955 | 3300049588 | Bacteria | 5597 |
| 1317 | Ga0501073_0001096 | 3300049589 | Bacteria | 19612 |
| 1318 | Ga0501073_0003002 | 3300049589 | Bacteria | 12643 |
| 1319 | Ga0501073_0004205 | 3300049589 | Bacteria | 10794 |
| 1320 | Ga0501073_0110334 | 3300049589 | Bacteria | 1908 |
| 1321 | Ga0501073_0230488 | 3300049589 | Bacteria | 1279 |
| 1322 | Ga0501073_0351642 | 3300049589 | Bacteria | 1017 |
| 1323 | Ga0501073_0360338 | 3300049589 | Bacteria | 1004 |
| 1324 | Ga0501073_0658082 | 3300049589 | Unclassified | 723 |
| 1325 | Ga0501074_0019562 | 3300049590 | Bacteria | 4914 |
| 1326 | Ga0501074_0034353 | 3300049590 | Bacteria | 3676 |
| 1327 | Ga0501074_0035175 | 3300049590 | Bacteria | 3629 |
| 1328 | Ga0501074_0049890 | 3300049590 | Bacteria | 3021 |
| 1329 | Ga0501074_0058058 | 3300049590 | Bacteria | 2787 |
| 1330 | Ga0501074_0067221 | 3300049590 | Bacteria | 2578 |
| 1331 | Ga0501074_0110530 | 3300049590 | Bacteria | 1967 |
| 1332 | Ga0501076_0571329 | 3300049592 | Bacteria | 932 |
| 1333 | Ga0501077_0360496 | 3300049593 | Bacteria | 928 |
| 1334 | Ga0501077_0393926 | 3300049593 | Bacteria | 885 |
| 1335 | Ga0501202_016651 | 3300049652 | Bacteria | 1429 |
| 1336 | Ga0501079_0112934 | 3300049741 | Bacteria | 2112 |
| 1337 | Ga0501079_0120832 | 3300049741 | Bacteria | 2037 |
| 1338 | Ga0501079_0183846 | 3300049741 | Bacteria | 1631 |
| 1339 | Ga0501079_0270545 | 3300049741 | Bacteria | 1328 |
| 1340 | Ga0501079_0385713 | 3300049741 | Bacteria | 1098 |
| 1341 | Ga0501080_0000306 | 3300049742 | Bacteria | 37439 |
| 1342 | Ga0501080_0000320 | 3300049742 | Bacteria | 36678 |
| 1343 | Ga0501080_0001885 | 3300049742 | Bacteria | 18044 |
| 1344 | Ga0501080_0038508 | 3300049742 | Bacteria | 4463 |
| 1345 | Ga0501080_0051615 | 3300049742 | Bacteria | 3827 |
| 1346 | Ga0501080_0060509 | 3300049742 | Bacteria | 3526 |
| 1347 | Ga0501080_0095289 | 3300049742 | Bacteria | 2764 |
| 1348 | Ga0501080_0126272 | 3300049742 | Bacteria | 2369 |
| 1349 | Ga0501080_0197515 | 3300049742 | Bacteria | 1847 |
| 1350 | Ga0501080_0775118 | 3300049742 | Bacteria | 842 |
| 1351 | Ga0501081_0086682 | 3300049743 | Bacteria | 2198 |
| 1352 | Ga0501083_0007488 | 3300049744 | Bacteria | 7734 |
| 1353 | Ga0501083_0068982 | 3300049744 | Bacteria | 2353 |
| 1354 | Ga0501266_011828 | 3300049763 | Bacteria | 1122 |
| 1355 | Ga0501269_035278 | 3300049766 | Bacteria | 653 |
| 1356 | Ga0501035_0009752 | 3300049822 | Bacteria | 8926 |
| 1357 | Ga0501035_0016886 | 3300049822 | Bacteria | 6730 |
| 1358 | Ga0501035_0017379 | 3300049822 | Bacteria | 6632 |
| 1359 | Ga0501035_0025209 | 3300049822 | Bacteria | 5451 |
| 1360 | Ga0501035_0026599 | 3300049822 | Bacteria | 5292 |
| 1361 | Ga0501035_0034014 | 3300049822 | Bacteria | 4632 |
| 1362 | Ga0501035_0050395 | 3300049822 | Bacteria | 3731 |
| 1363 | Ga0501035_0055280 | 3300049822 | Bacteria | 3544 |
| 1364 | Ga0501035_0111994 | 3300049822 | Bacteria | 2391 |
| 1365 | Ga0501035_0385476 | 3300049822 | Bacteria | 1168 |
| 1366 | Ga0501035_0723091 | 3300049822 | Bacteria | 801 |
| 1367 | Ga0501035_0780814 | 3300049822 | Bacteria | 764 |
| 1368 | Ga0501044_0003969 | 3300049823 | Bacteria | 16569 |
| 1369 | Ga0501044_0005486 | 3300049823 | Bacteria | 14091 |
| 1370 | Ga0501044_0017657 | 3300049823 | Bacteria | 7652 |
| 1371 | Ga0501044_0028186 | 3300049823 | Bacteria | 5928 |
| 1372 | Ga0501044_0075598 | 3300049823 | Bacteria | 3420 |
| 1373 | Ga0501044_0107242 | 3300049823 | Bacteria | 2805 |
| 1374 | Ga0501044_0108743 | 3300049823 | Bacteria | 2782 |
| 1375 | Ga0501044_0140742 | 3300049823 | Bacteria | 2401 |
| 1376 | Ga0501044_0143207 | 3300049823 | Bacteria | 2378 |
| 1377 | Ga0501044_0174273 | 3300049823 | Bacteria | 2121 |
| 1378 | Ga0501044_0225483 | 3300049823 | Bacteria | 1823 |
| 1379 | Ga0501044_0295543 | 3300049823 | Bacteria | 1550 |
| 1380 | Ga0501044_0304012 | 3300049823 | Bacteria | 1523 |
| 1381 | Ga0501044_0323959 | 3300049823 | Bacteria | 1465 |
| 1382 | Ga0501044_0400469 | 3300049823 | Bacteria | 1285 |
| 1383 | Ga0501044_0462230 | 3300049823 | Bacteria | 1174 |
| 1384 | Ga0501044_0926429 | 3300049823 | Bacteria | 745 |
| 1385 | Ga0501044_1144822 | 3300049823 | Bacteria | 646 |
| 1386 | Ga0501045_0144308 | 3300049824 | Bacteria | 1770 |
| 1387 | Ga0501045_0591876 | 3300049824 | Bacteria | 822 |
| 1388 | nmdc:mga05p37_32385_c1 | 3300050507 | Bacteria | 4070 |
| 1389 | nmdc:mga09592_180455_c1 | 3300050508 | Bacteria | 1826 |
| 1390 | nmdc:mga0sz30_16282_c1 | 3300050516 | Bacteria | 2554 |
| 1391 | Ga0500610_0003017 | 3300053079 | Bacteria | 6354 |
| 1392 | Ga0495619_0081142 | 3300053085 | Bacteria | 2184 |
| 1393 | Ga0500643_001605 | 3300053087 | Bacteria | 12714 |
| 1394 | Ga0500643_008552 | 3300053087 | Bacteria | 4016 |
| 1395 | Ga0500643_008927 | 3300053087 | Bacteria | 3881 |
| 1396 | Ga0500651_0002320 | 3300053093 | Bacteria | 10000 |
| 1397 | Ga0500651_0015083 | 3300053093 | Bacteria | 4738 |
| 1398 | Ga0500566_0191366 | 3300053094 | Bacteria | 1041 |
| 1399 | Ga0500641_0017442 | 3300053096 | Bacteria | 2685 |
| 1400 | Ga0500555_000235 | 3300053103 | Bacteria | 24708 |
| 1401 | Ga0500562_042424 | 3300053108 | Bacteria | 1210 |
| 1402 | Ga0500597_000019 | 3300053120 | Bacteria | 34589 |
| 1403 | Ga0500628_146496 | 3300053129 | Bacteria | 658 |
| 1404 | Ga0500658_0005949 | 3300053134 | Bacteria | 4536 |
| 1405 | Ga0500559_0281522 | 3300053136 | Bacteria | 782 |
| 1406 | Ga0500568_0001313 | 3300053139 | Bacteria | 16297 |
| 1407 | Ga0500577_0003758 | 3300053142 | Bacteria | 3959 |
| 1408 | Ga0500616_0044457 | 3300053153 | Bacteria | 2370 |
| 1409 | Ga0500636_0389787 | 3300053177 | Bacteria | 650 |
| 1410 | Ga0500645_000167 | 3300053730 | Bacteria | 51590 |
| 1411 | Ga0501084_0015131 | 3300054114 | Bacteria | 6398 |
| 1412 | Ga0501084_0414703 | 3300054114 | Bacteria | 1138 |
| 1413 | Ga0501084_0645659 | 3300054114 | Bacteria | 893 |
| 1414 | Ga0587073_0046370 | 3300059492 | Bacteria | 968 |
| 1415 | Ga0501082_0000394 | 3300060353 | Bacteria | 38764 |
| 1416 | Ga0501082_0093743 | 3300060353 | Bacteria | 2594 |
| 1417 | Ga0501082_0124847 | 3300060353 | Bacteria | 2232 |
| 1418 | Ga0501082_0326672 | 3300060353 | Bacteria | 1337 |
| 1419 | Ga0466962_0001724 | 3300061719 | Bacteria | 10272 |
| 1420 | Ga0466962_0005053 | 3300061719 | Bacteria | 6345 |
| 1421 | 2538833768 | 2537561836 | Bacteria | 3910579 |
| 1422 | 2572255430 | 2571042365 | Bacteria | 3289345 |
| 1423 | 2595447285 | 2593339238 | Bacteria | 4182970 |
| 1424 | 2595450067 | 2593339239 | Bacteria | 4124669 |
| 1425 | 2600225624 | 2599185359 | Bacteria | 4772316 |
| 1426 | 2643831102 | 2643221562 | Bacteria | 4048635 |
| 1427 | 2643881487 | 2643221573 | Bacteria | 4784121 |
| 1428 | 2643896863 | 2643221577 | Bacteria | 3710843 |
| 1429 | 2644049895 | 2643221607 | Bacteria | 6314006 |
| 1430 | 2644203319 | 2643221636 | Bacteria | 6583769 |
| 1431 | 2644479067 | 2643221685 | Bacteria | 3673288 |
| 1432 | 2644497671 | 2643221689 | Bacteria | 6042950 |
| 1433 | 2644507094 | 2643221691 | Bacteria | 5093099 |
| 1434 | 2644662624 | 2643221720 | Bacteria | 4694283 |
| 1435 | 2644698422 | 2643221728 | Bacteria | 4797149 |
| 1436 | 2687581894 | 2687453130 | Bacteria | 4227172 |
| 1437 | 2739227158 | 2738543009 | Bacteria | 4944499 |
| 1438 | 2739729813 | 2739367700 | Bacteria | 4747630 |
| 1439 | 2819565670 | 2818991440 | Bacteria | 4774720 |
| 1440 | 2819613378 | 2818991448 | Bacteria | 6772224 |
| 1441 | 2837680697 | 2837678835 | Bacteria | 5252418 |
| 1442 | 2842918322 | 2842914999 | Bacteria | 4419378 |
| 1443 | 2884339425 | 2884338543 | Bacteria | 4610696 |
| 1444 | 2884416050 | 2884411467 | Bacteria | 5246714 |
| 1445 | 2894819112 | 2894817345 | Bacteria | 4892941 |
| 1446 | 2895396287 | 2895395659 | Bacteria | 3983269 |
| 1447 | 2904465954 | 2904463128 | Bacteria | 4775606 |
| 1448 | 2919406608 | 2919404418 | Bacteria | 4232372 |
| 1449 | 2928966003 | 2928963466 | Bacteria | 5165703 |
| 1450 | 2939614796 | 2939611941 | Bacteria | 3892017 |
| 1451 | 2941473178 | 2941471342 | Bacteria | 5018624 |
| 1452 | 2953995650 | 2953994433 | Bacteria | 4303959 |
| 1453 | 2989774652 | 2989771324 | Bacteria | 5605128 |
| 1454 | 8002869637 | 8002869464 | Bacteria | 3588529 |
| 1455 | Ga0070674_100169478 | |||
| 1456 | JGI24740J21852_10000320 | |||
| 1457 | JGI24740J21852_10003591 | |||
| 1458 | JGI24739J22299_10009127 | |||
| 1459 | JGI24739J22299_10045170 | |||
| 1460 | JGI24737J22298_10002818 | |||
| 1461 | JGI24737J22298_10002923 | |||
| 1462 | JGI24735J21928_10000210 | |||
| 1463 | JGI24735J21928_10008070 | |||
| 1464 | JGI24738J21930_10000630 | |||
| 1465 | JGI25162J39368_1000072 | |||
| 1466 | JGI25162J39368_1000403 | |||
| 1467 | JGI25162J39368_1000450 | |||
| 1468 | JGI25154J39366_1005804 | |||
| 1469 | JGI25157J39369_1000143 | |||
| 1470 | JGI25157J39369_1000145 | |||
| 1471 | JGI25157J39369_1000210 | |||
| 1472 | JGI25163J39215_1000608 | |||
| 1473 | JGI25164J39214_1000115 | |||
| 1474 | JGI25164J39214_1000122 | |||
| 1475 | JGI25164J39214_1000276 | |||
| 1476 | JGI25164J39214_1000360 | |||
| 1477 | JGI25164J39214_1000479 | |||
| 1478 | JGI25151J46595_10000165 | |||
| 1479 | JGI25151J46595_10012116 | |||
| 1480 | JGI25165J46597_1000063 | |||
| 1481 | JGI25165J46597_1000241 | |||
| 1482 | JGI25165J46597_1000419 | |||
| 1483 | JGI25165J46597_1001372 | |||
| 1484 | JGI25165J46597_1007774 | |||
| 1485 | JGI25153J46596_10024928 | |||
| 1486 | rootH1_10024742 | |||
| 1487 | rootH1_10071835 | |||
| 1488 | rootH1_10110832 | |||
| 1489 | rootH2_10063162 | |||
| 1490 | rootL2_10006308 | |||
| 1491 | rootL2_10061895 | |||
| 1492 | rootL2_10246862 | |||
| 1493 | rootH1_10327385 | |||
| 1494 | JGI26145J50221_1002765 | |||
| 1495 | Ga0006562J51391_1027422 | |||
| 1496 | Ga0055538_1004437 | |||
| 1497 | Ga0055539_1002939 | |||
| 1498 | Ga0055533_1000338 | |||
| 1499 | Ga0055525_1000135 | |||
| 1500 | Ga0055527_1000043 | |||
| 1501 | Ga0055527_1000079 | |||
| 1502 | Ga0055535_1000068 | |||
| 1503 | Ga0055535_1000071 | |||
| 1504 | Ga0055535_1000166 | |||
| 1505 | Ga0055535_1017601 | |||
| 1506 | Ga0055542_1000090 | |||
| 1507 | Ga0055542_1000096 | |||
| 1508 | Ga0055542_1000210 | |||
| 1509 | Ga0055529_1000084 | |||
| 1510 | Ga0055529_1000114 | |||
| 1511 | Ga0055529_1000394 | |||
| 1512 | Ga0055529_1003020 | |||
| 1513 | Ga0055526_1000008 | |||
| 1514 | Ga0055526_1056385 | |||
| 1515 | Ga0055524_1002861 | |||
| 1516 | Ga0055524_1002910 | |||
| 1517 | Ga0055536_1002163 | |||
| 1518 | Ga0055536_1003562 | |||
| 1519 | Ga0055528_1044392 | |||
| 1520 | Ga0055530_10001268 | |||
| 1521 | Ga0055531_10004683 | |||
| 1522 | Ga0055531_10007280 | |||
| 1523 | Ga0058692_1000040 | |||
| 1524 | Ga0065165_1003771 | |||
| 1525 | Ga0065704_10087117 | |||
| 1526 | Ga0065715_10001173 | |||
| 1527 | Ga0065715_10268777 | |||
| 1528 | Ga0070658_10001469 | |||
| 1529 | Ga0070658_10324163 | |||
| 1530 | Ga0070658_10412723 | |||
| 1531 | Ga0070676_10018581 | |||
| 1532 | Ga0070683_100148589 | |||
| 1533 | Ga0070683_100705389 | |||
| 1534 | Ga0070670_100051522 | |||
| 1535 | Ga0070670_100082595 | |||
| 1536 | Ga0070670_100156808 | |||
| 1537 | Ga0070670_100476960 | |||
| 1538 | Ga0070670_100780618 | |||
| 1539 | Ga0070670_101066703 | |||
| 1540 | Ga0070677_10092159 | |||
| 1541 | Ga0068869_100117424 | |||
| 1542 | Ga0068869_100123858 | |||
| 1543 | Ga0068869_100161403 | |||
| 1544 | Ga0070666_10000010 | |||
| 1545 | Ga0070666_10027007 | |||
| 1546 | Ga0070666_10028601 | |||
| 1547 | Ga0070666_10092942 | |||
| 1548 | Ga0070666_10111766 | |||
| 1549 | Ga0070666_10115168 | |||
| 1550 | Ga0070666_10345067 | |||
| 1551 | Ga0070680_100264546 | |||
| 1552 | Ga0070680_100822370 | |||
| 1553 | Ga0070682_100363557 | |||
| 1554 | Ga0070682_100546560 | |||
| 1555 | Ga0070682_100791487 | |||
| 1556 | Ga0068868_100088396 | |||
| 1557 | Ga0068868_100139242 | |||
| 1558 | Ga0068868_100360665 | |||
| 1559 | Ga0070660_100071494 | |||
| 1560 | Ga0070660_100136540 | |||
| 1561 | Ga0070660_100886085 | |||
| 1562 | Ga0070689_100002138 | |||
| 1563 | Ga0070689_100260673 | |||
| 1564 | Ga0070689_100940146 | |||
| 1565 | Ga0070661_100008137 | |||
| 1566 | Ga0070661_100139444 | |||
| 1567 | Ga0070661_100233097 | |||
| 1568 | Ga0070692_10003879 | |||
| 1569 | Ga0070668_100049024 | |||
| 1570 | Ga0070668_100649769 | |||
| 1571 | Ga0070669_100042491 | |||
| 1572 | Ga0070669_100168407 | |||
| 1573 | Ga0070675_100043062 | |||
| 1574 | Ga0070675_100638317 | |||
| 1575 | Ga0070671_100112479 | |||
| 1576 | Ga0070671_100204590 | |||
| 1577 | Ga0070671_100281894 | |||
| 1578 | Ga0070674_100096591 | |||
| 1579 | Ga0070673_100050203 | |||
| 1580 | Ga0070673_100257204 | |||
| 1581 | Ga0070659_100000052 | |||
| 1582 | Ga0070659_100004887 | |||
| 1583 | Ga0070667_100000150 | |||
| 1584 | Ga0070667_100034011 | |||
| 1585 | Ga0070667_100075009 | |||
| 1586 | Ga0070667_100087613 | |||
| 1587 | Ga0070667_100276494 | |||
| 1588 | Ga0070667_100305366 | |||
| 1589 | Ga0070667_100348682 | |||
| 1590 | Ga0070667_100454628 | |||
| 1591 | Ga0070667_100831502 | |||
| 1592 | Ga0070667_100973834 | |||
| 1593 | Ga0070714_100000393 | |||
| 1594 | Ga0070714_100000605 | |||
| 1595 | Ga0070713_100061037 | |||
| 1596 | Ga0070711_100095752 | |||
| 1597 | Ga0070711_100385734 | |||
| 1598 | Ga0070694_101277709 | |||
| 1599 | Ga0070708_100139302 | |||
| 1600 | Ga0070663_100000029 | |||
| 1601 | Ga0070663_100021862 | |||
| 1602 | Ga0070663_100037071 | |||
| 1603 | Ga0070663_100172190 | |||
| 1604 | Ga0070663_100240101 | |||
| 1605 | Ga0070663_100289513 | |||
| 1606 | Ga0070663_100737947 | |||
| 1607 | Ga0070663_101065424 | |||
| 1608 | Ga0070678_100041709 | |||
| 1609 | Ga0070678_100127460 | |||
| 1610 | Ga0070678_100149741 | |||
| 1611 | Ga0070678_100157470 | |||
| 1612 | Ga0070662_100021500 | |||
| 1613 | Ga0070662_100549394 | |||
| 1614 | Ga0070662_100844592 | |||
| 1615 | Ga0070681_10028025 | |||
| 1616 | Ga0070681_10046264 | |||
| 1617 | Ga0070681_10074465 | |||
| 1618 | Ga0070681_10352224 | |||
| 1619 | Ga0070681_10537320 | |||
| 1620 | Ga0070681_10959932 | |||
| 1621 | Ga0068867_100012849 | |||
| 1622 | Ga0068867_101047542 | |||
| 1623 | Ga0070685_10000832 | |||
| 1624 | Ga0070685_10098205 | |||
| 1625 | Ga0070679_100323628 | |||
| 1626 | Ga0070679_100338414 | |||
| 1627 | Ga0070679_100354016 | |||
| 1628 | Ga0070679_100378948 | |||
| 1629 | Ga0070679_100494921 | |||
| 1630 | Ga0070679_100677980 | |||
| 1631 | Ga0070684_100194805 | |||
| 1632 | Ga0070684_100555778 | |||
| 1633 | Ga0068853_100002537 | |||
| 1634 | Ga0068853_100002647 | |||
| 1635 | Ga0068853_100027321 | |||
| 1636 | Ga0068853_100035136 | |||
| 1637 | Ga0068853_100035959 | |||
| 1638 | Ga0068853_100054340 | |||
| 1639 | Ga0068853_100120542 | |||
| 1640 | Ga0068853_100139422 | |||
| 1641 | Ga0068853_100406214 | |||
| 1642 | Ga0068853_100436905 | |||
| 1643 | Ga0068853_100442893 | |||
| 1644 | Ga0068853_100599738 | |||
| 1645 | Ga0068853_100600373 | |||
| 1646 | Ga0070672_100013517 | |||
| 1647 | Ga0070672_100167090 | |||
| 1648 | Ga0070672_100480680 | |||
| 1649 | Ga0070672_100597666 | |||
| 1650 | Ga0070696_100006208 | |||
| 1651 | Ga0070696_100031859 | |||
| 1652 | Ga0070696_100641700 | |||
| 1653 | Ga0070696_100736094 | |||
| 1654 | Ga0070693_100005217 | |||
| 1655 | Ga0070693_100088297 | |||
| 1656 | Ga0070693_100164722 | |||
| 1657 | Ga0070693_100331569 | |||
| 1658 | Ga0070693_100446041 | |||
| 1659 | Ga0070665_100000026 | |||
| 1660 | Ga0070665_100001464 | |||
| 1661 | Ga0070665_100004807 | |||
| 1662 | Ga0070665_100020504 | |||
| 1663 | Ga0070665_100084135 | |||
| 1664 | Ga0070665_100242107 | |||
| 1665 | Ga0070665_100585482 | |||
| 1666 | Ga0070665_100710045 | |||
| 1667 | Ga0070665_101291684 | |||
| 1668 | Ga0068855_100000696 | |||
| 1669 | Ga0068855_100010588 | |||
| 1670 | Ga0068855_100057884 | |||
| 1671 | Ga0068855_100057944 | |||
| 1672 | Ga0068855_100176858 | |||
| 1673 | Ga0068855_100177473 | |||
| 1674 | Ga0068855_100431851 | |||
| 1675 | Ga0068855_100538940 | |||
| 1676 | Ga0068855_100690164 | |||
| 1677 | Ga0068855_100698421 | |||
| 1678 | Ga0068855_100740982 | |||
| 1679 | Ga0068855_100818438 | |||
| 1680 | Ga0068855_101124889 | |||
| 1681 | Ga0068855_101256879 | |||
| 1682 | Ga0070664_100085989 | |||
| 1683 | Ga0070664_100177381 | |||
| 1684 | Ga0070664_100184175 | |||
| 1685 | Ga0070664_100292013 | |||
| 1686 | Ga0068857_100014664 | |||
| 1687 | Ga0068857_100041837 | |||
| 1688 | Ga0068857_100164117 | |||
| 1689 | Ga0068857_100230568 | |||
| 1690 | Ga0068857_100300958 | |||
| 1691 | Ga0068857_100426015 | |||
| 1692 | Ga0068857_100661245 | |||
| 1693 | Ga0068857_100700902 | |||
| 1694 | Ga0068854_100000282 | |||
| 1695 | Ga0068854_100006540 | |||
| 1696 | Ga0068854_100006900 | |||
| 1697 | Ga0068854_100051750 | |||
| 1698 | Ga0068854_100104414 | |||
| 1699 | Ga0068854_100202049 | |||
| 1700 | Ga0068856_100000022 | |||
| 1701 | Ga0068856_100013211 | |||
| 1702 | Ga0068856_100036502 | |||
| 1703 | Ga0068856_100119510 | |||
| 1704 | Ga0068856_100164207 | |||
| 1705 | Ga0068856_100191212 | |||
| 1706 | Ga0068856_101036380 | |||
| 1707 | Ga0068852_100006662 | |||
| 1708 | Ga0068852_100071081 | |||
| 1709 | Ga0068852_100081782 | |||
| 1710 | Ga0068852_100176951 | |||
| 1711 | Ga0068852_100373403 | |||
| 1712 | Ga0068852_100393746 | |||
| 1713 | Ga0068852_100542980 | |||
| 1714 | Ga0068852_100569515 | |||
| 1715 | Ga0068852_100716187 | |||
| 1716 | Ga0068852_101337712 | |||
| 1717 | Ga0068859_100001840 | |||
| 1718 | Ga0068859_101588311 | |||
| 1719 | Ga0068864_100014730 | |||
| 1720 | Ga0068864_100112829 | |||
| 1721 | Ga0068864_100177450 | |||
| 1722 | Ga0068864_100874382 | |||
| 1723 | Ga0068861_100087634 | |||
| 1724 | Ga0068861_100755419 | |||
| 1725 | Ga0068861_100939318 | |||
| 1726 | Ga0068851_10006767 | |||
| 1727 | Ga0068851_10011459 | |||
| 1728 | Ga0068851_10021594 | |||
| 1729 | Ga0068851_10036620 | |||
| 1730 | Ga0068851_10059334 | |||
| 1731 | Ga0068870_10051228 | |||
| 1732 | Ga0068863_100004653 | |||
| 1733 | Ga0068863_100005490 | |||
| 1734 | Ga0068863_100014974 | |||
| 1735 | Ga0068863_100050734 | |||
| 1736 | Ga0068863_100098184 | |||
| 1737 | Ga0068863_100624224 | |||
| 1738 | Ga0068863_100818070 | |||
| 1739 | Ga0068863_101260885 | |||
| 1740 | Ga0068858_100001617 | |||
| 1741 | Ga0068858_100151636 | |||
| 1742 | Ga0068858_100260609 | |||
| 1743 | Ga0068858_100304790 | |||
| 1744 | Ga0068858_100509095 | |||
| 1745 | Ga0068858_100567874 | |||
| 1746 | Ga0068858_100622788 | |||
| 1747 | Ga0068860_100025971 | |||
| 1748 | Ga0068860_100031104 | |||
| 1749 | Ga0068860_100108654 | |||
| 1750 | Ga0068860_100708139 | |||
| 1751 | Ga0068860_100926207 | |||
| 1752 | Ga0068860_101226300 | |||
| 1753 | Ga0068862_100000185 | |||
| 1754 | Ga0068862_100175378 | |||
| 1755 | Ga0081455_10296262 | |||
| 1756 | Ga0075364_10015606 | |||
| 1757 | Ga0070715_10095572 | |||
| 1758 | Ga0070712_100398115 | |||
| 1759 | Ga0075369_10187921 | |||
| 1760 | Ga0075366_10016389 | |||
| 1761 | Ga0097621_100019859 | |||
| 1762 | Ga0097621_100021471 | |||
| 1763 | Ga0097621_100038212 | |||
| 1764 | Ga0097621_100133587 | |||
| 1765 | Ga0097621_100167732 | |||
| 1766 | Ga0097621_100483758 | |||
| 1767 | Ga0097621_101517032 | |||
| 1768 | Ga0068871_100059368 | |||
| 1769 | Ga0068871_100064765 | |||
| 1770 | Ga0068871_100119581 | |||
| 1771 | Ga0068871_100236037 | |||
| 1772 | Ga0068871_100254438 | |||
| 1773 | Ga0068871_100825699 | |||
| 1774 | Ga0075428_100116793 | |||
| 1775 | Ga0075428_100371580 | |||
| 1776 | Ga0075429_100333234 | |||
| 1777 | Ga0068865_100013181 | |||
| 1778 | Ga0068865_100096192 | |||
| 1779 | Ga0068865_100131071 | |||
| 1780 | Ga0068865_100208584 | |||
| 1781 | Ga0097620_100001840 | |||
| 1782 | Ga0097620_101588824 | |||
| 1783 | Ga0105250_10226338 | |||
| 1784 | Ga0105240_10000359 | |||
| 1785 | Ga0105240_10000633 | |||
| 1786 | Ga0105240_10002007 | |||
| 1787 | Ga0105240_10007977 | |||
| 1788 | Ga0105240_10009334 | |||
| 1789 | Ga0105240_10013427 | |||
| 1790 | Ga0105240_10022190 | |||
| 1791 | Ga0105240_10050541 | |||
| 1792 | Ga0105240_10074426 | |||
| 1793 | Ga0105240_10209967 | |||
| 1794 | Ga0105240_10884759 | |||
| 1795 | Ga0105245_10377566 | |||
| 1796 | Ga0105245_10788223 | |||
| 1797 | Ga0105245_10947848 | |||
| 1798 | Ga0105245_11070398 | |||
| 1799 | Ga0114129_10035130 | |||
| 1800 | Ga0105243_10073372 | |||
| 1801 | Ga0105241_10008871 | |||
| 1802 | Ga0105241_10037744 | |||
| 1803 | Ga0105241_10046045 | |||
| 1804 | Ga0105241_10064718 | |||
| 1805 | Ga0105241_10214683 | |||
| 1806 | Ga0105241_10251234 | |||
| 1807 | Ga0105241_10857754 | |||
| 1808 | Ga0105241_11254522 | |||
| 1809 | Ga0105242_10002842 | |||
| 1810 | Ga0105242_10041120 | |||
| 1811 | Ga0105242_10593268 | |||
| 1812 | Ga0105242_10722576 | |||
| 1813 | Ga0105248_10000246 | |||
| 1814 | Ga0105248_10044683 | |||
| 1815 | Ga0105248_10096662 | |||
| 1816 | Ga0105248_10466046 | |||
| 1817 | Ga0105248_10843250 | |||
| 1818 | Ga0105248_10941610 | |||
| 1819 | Ga0105248_11019248 | |||
| 1820 | Ga0105237_10000148 | |||
| 1821 | Ga0105237_10000231 | |||
| 1822 | Ga0105237_10000383 | |||
| 1823 | Ga0105237_10004315 | |||
| 1824 | Ga0105237_10128389 | |||
| 1825 | Ga0105237_10144331 | |||
| 1826 | Ga0105237_10173267 | |||
| 1827 | Ga0105237_10345613 | |||
| 1828 | Ga0105237_10413818 | |||
| 1829 | Ga0105237_10479787 | |||
| 1830 | Ga0105237_10544780 | |||
| 1831 | Ga0105237_10709464 | |||
| 1832 | Ga0105238_10000044 | |||
| 1833 | Ga0105238_10007919 | |||
| 1834 | Ga0105238_10010855 | |||
| 1835 | Ga0105238_10034862 | |||
| 1836 | Ga0105238_10049939 | |||
| 1837 | Ga0105238_10097896 | |||
| 1838 | Ga0105238_10202715 | |||
| 1839 | Ga0105238_10217876 | |||
| 1840 | Ga0105238_10333048 | |||
| 1841 | Ga0105238_10538112 | |||
| 1842 | Ga0105238_10733790 | |||
| 1843 | Ga0105249_10001225 | |||
| 1844 | Ga0105249_10027305 | |||
| 1845 | Ga0105249_10380955 | |||
| 1846 | Ga0105148_100676 | |||
| 1847 | Ga0105029_100269 | |||
| 1848 | Ga0105239_10000033 | |||
| 1849 | Ga0105239_10003454 | |||
| 1850 | Ga0105239_10009780 | |||
| 1851 | Ga0105239_10014339 | |||
| 1852 | Ga0105239_10021477 | |||
| 1853 | Ga0105239_10026779 | |||
| 1854 | Ga0105239_10121007 | |||
| 1855 | Ga0105239_10152397 | |||
| 1856 | Ga0105239_10157972 | |||
| 1857 | Ga0105239_10256728 | |||
| 1858 | Ga0105239_10286830 | |||
| 1859 | Ga0105239_10660194 | |||
| 1860 | Ga0105239_10699703 | |||
| 1861 | Ga0105239_11489580 | |||
| 1862 | Ga0105246_10009566 | |||
| 1863 | Ga0157318_1000739 | |||
| 1864 | Ga0157314_1000098 | |||
| 1865 | Ga0157314_1001103 | |||
| 1866 | Ga0157326_1021775 | |||
| 1867 | Ga0157373_10034519 | |||
| 1868 | Ga0157373_10048721 | |||
| 1869 | Ga0157371_10021671 | |||
| 1870 | Ga0157370_10000495 | |||
| 1871 | Ga0157370_10002719 | |||
| 1872 | Ga0157370_10004280 | |||
| 1873 | Ga0157370_10070640 | |||
| 1874 | Ga0157370_10095746 | |||
| 1875 | Ga0157370_10099538 | |||
| 1876 | Ga0157370_10121328 | |||
| 1877 | Ga0157370_10123802 | |||
| 1878 | Ga0157370_10133349 | |||
| 1879 | Ga0157370_10168588 | |||
| 1880 | Ga0157370_10189039 | |||
| 1881 | Ga0157370_10253027 | |||
| 1882 | Ga0157370_10444388 | |||
| 1883 | Ga0157370_10535365 | |||
| 1884 | Ga0157370_11027177 | |||
| 1885 | Ga0157370_11101015 | |||
| 1886 | Ga0157369_10000464 | |||
| 1887 | Ga0157369_10005929 | |||
| 1888 | Ga0157369_10031464 | |||
| 1889 | Ga0157369_10262059 | |||
| 1890 | Ga0157369_10281052 | |||
| 1891 | Ga0157369_10778324 | |||
| 1892 | Ga0157369_10976478 | |||
| 1893 | Ga0157374_10066420 | |||
| 1894 | Ga0157374_10130567 | |||
| 1895 | Ga0157374_10474783 | |||
| 1896 | Ga0157378_10001405 | |||
| 1897 | Ga0157378_10691065 | |||
| 1898 | Ga0157378_11048265 | |||
| 1899 | Ga0163162_10000021 | |||
| 1900 | Ga0163162_10000193 | |||
| 1901 | Ga0163162_10002029 | |||
| 1902 | Ga0163162_10064563 | |||
| 1903 | Ga0163162_10069740 | |||
| 1904 | Ga0163162_10153910 | |||
| 1905 | Ga0163162_10449684 | |||
| 1906 | Ga0163162_10638951 | |||
| 1907 | Ga0157372_10011884 | |||
| 1908 | Ga0157372_10014982 | |||
| 1909 | Ga0157372_10052222 | |||
| 1910 | Ga0157372_10064309 | |||
| 1911 | Ga0157372_10167991 | |||
| 1912 | Ga0157372_10186027 | |||
| 1913 | Ga0157372_10299531 | |||
| 1914 | Ga0157372_10423863 | |||
| 1915 | Ga0157372_10444901 | |||
| 1916 | Ga0157372_10704796 | |||
| 1917 | Ga0157372_10889204 | |||
| 1918 | Ga0157372_10892887 | |||
| 1919 | Ga0157372_11088308 | |||
| 1920 | Ga0157372_11158308 | |||
| 1921 | Ga0157372_12292690 | |||
| 1922 | Ga0157375_10000950 | |||
| 1923 | Ga0157375_10016908 | |||
| 1924 | Ga0157375_10050059 | |||
| 1925 | Ga0157375_10122204 | |||
| 1926 | Ga0163163_10000403 | |||
| 1927 | Ga0163163_10006152 | |||
| 1928 | Ga0163163_10113006 | |||
| 1929 | Ga0163163_10284699 | |||
| 1930 | Ga0157380_10082842 | |||
| 1931 | Ga0182008_10000209 | |||
| 1932 | Ga0182008_10030065 | |||
| 1933 | Ga0182008_10032240 | |||
| 1934 | Ga0182008_10046665 | |||
| 1935 | Ga0157379_10003888 | |||
| 1936 | Ga0157379_10202302 | |||
| 1937 | Ga0157379_10208706 | |||
| 1938 | Ga0157376_10006685 | |||
| 1939 | Ga0157376_10017225 | |||
| 1940 | Ga0157376_10019219 | |||
| 1941 | Ga0157376_10107390 | |||
| 1942 | Ga0157376_10124715 | |||
| 1943 | Ga0157376_10334337 | |||
| 1944 | Ga0182006_1000034 | |||
| 1945 | Ga0182006_1007770 | |||
| 1946 | Ga0182006_1032677 | |||
| 1947 | Ga0182006_1047053 | |||
| 1948 | Ga0182007_10001346 | |||
| 1949 | Ga0182007_10005029 | |||
| 1950 | Ga0182007_10052110 | |||
| 1951 | Ga0182007_10067388 | |||
| 1952 | Ga0182007_10090807 | |||
| 1953 | Ga0182005_1000064 | |||
| 1954 | Ga0182005_1002932 | |||
| 1955 | Ga0182005_1016840 | |||
| 1956 | Ga0183369_1003 | |||
| 1957 | Ga0183368_1002 | |||
| 1958 | Ga0163161_10001385 | |||
| 1959 | Ga0163161_10012090 | |||
| 1960 | Ga0163161_10038479 | |||
| 1961 | Ga0206353_10771426 | |||
| 1962 | Ga0154015_1053000 | |||
| 1963 | Ga0213875_10120439 | |||
| 1964 | Ga0224712_10075440 | |||
| 1965 | Ga0209435_108278 | |||
| 1966 | Ga0209760_100294 | |||
| 1967 | Ga0209784_100042 | |||
| 1968 | Ga0209674_100033 | |||
| 1969 | Ga0209674_100441 | |||
| 1970 | Ga0209674_101207 | |||
| 1971 | Ga0209674_103716 | |||
| 1972 | Ga0209672_100004 | |||
| 1973 | Ga0209672_100008 | |||
| 1974 | Ga0209672_100916 | |||
| 1975 | Ga0209672_102162 | |||
| 1976 | Ga0209563_100036 | |||
| 1977 | Ga0207427_100037 | |||
| 1978 | Ga0207427_100049 | |||
| 1979 | Ga0207427_100078 | |||
| 1980 | Ga0207427_100096 | |||
| 1981 | Ga0207427_105412 | |||
| 1982 | Ga0209437_100074 | |||
| 1983 | Ga0209437_100083 | |||
| 1984 | Ga0209437_100090 | |||
| 1985 | Ga0209437_100157 | |||
| 1986 | Ga0209437_100691 | |||
| 1987 | Ga0209437_100872 | |||
| 1988 | Ga0209437_101965 | |||
| 1989 | Ga0209437_104672 | |||
| 1990 | Ga0209258_100003 | |||
| 1991 | Ga0209258_100004 | |||
| 1992 | Ga0209258_100008 | |||
| 1993 | Ga0209258_100136 | |||
| 1994 | Ga0209258_101400 | |||
| 1995 | Ga0209258_110007 | |||
| 1996 | Ga0209646_1000863 | |||
| 1997 | Ga0209646_1012353 | |||
| 1998 | Ga0209026_1000045 | |||
| 1999 | Ga0209026_1000072 | |||
| 2000 | Ga0209026_1000129 | |||
| 2001 | Ga0209026_1000153 | |||
| 2002 | Ga0209026_1000442 | |||
| 2003 | Ga0209026_1016918 | |||
| 2004 | Ga0209026_1021965 | |||
| 2005 | Ga0209677_100348 | |||
| 2006 | Ga0209148_1000025 | |||
| 2007 | Ga0209148_1000036 | |||
| 2008 | Ga0209148_1000053 | |||
| 2009 | Ga0209148_1000791 | |||
| 2010 | Ga0209759_1000140 | |||
| 2011 | Ga0209759_1000831 | |||
| 2012 | Ga0209759_1002615 | |||
| 2013 | Ga0209759_1003821 | |||
| 2014 | Ga0209129_1000604 | |||
| 2015 | Ga0209129_1002103 | |||
| 2016 | Ga0209233_1000040 | |||
| 2017 | Ga0209233_1000075 | |||
| 2018 | Ga0209233_1000077 | |||
| 2019 | Ga0209233_1000096 | |||
| 2020 | Ga0209233_1003582 | |||
| 2021 | Ga0209233_1028224 | |||
| 2022 | Ga0209455_1000004 | |||
| 2023 | Ga0209455_1000007 | |||
| 2024 | Ga0209455_1000071 | |||
| 2025 | Ga0209455_1000215 | |||
| 2026 | Ga0209455_1013624 | |||
| 2027 | Ga0209673_1003811 | |||
| 2028 | Ga0209130_1007509 | |||
| 2029 | Ga0209675_1014295 | |||
| 2030 | Ga0209675_1017692 | |||
| 2031 | Ga0209676_1001264 | |||
| 2032 | Ga0209676_1002621 | |||
| 2033 | Ga0209676_1007907 | |||
| 2034 | Ga0209676_1008848 | |||
| 2035 | Ga0209676_1036126 | |||
| 2036 | Ga0209025_1001373 | |||
| 2037 | Ga0209025_1034165 | |||
| 2038 | Ga0209025_1050506 | |||
| 2039 | Ga0209025_1053805 | |||
| 2040 | Ga0209025_1055046 | |||
| 2041 | Ga0209564_1009685 | |||
| 2042 | Ga0209758_1000481 | |||
| 2043 | Ga0209758_1058569 | |||
| 2044 | Ga0209758_1061354 | |||
| 2045 | Ga0209050_1001626 | |||
| 2046 | Ga0209256_1001873 | |||
| 2047 | Ga0209256_1002659 | |||
| 2048 | Ga0209256_1010555 | |||
| 2049 | Ga0209256_1011879 | |||
| 2050 | Ga0209051_1005661 | |||
| 2051 | Ga0209257_1000274 | |||
| 2052 | Ga0209257_1000307 | |||
| 2053 | Ga0209257_1002641 | |||
| 2054 | Ga0209257_1007987 | |||
| 2055 | Ga0207656_10004823 | |||
| 2056 | Ga0207656_10411102 | |||
| 2057 | Ga0207692_10191756 | |||
| 2058 | Ga0207710_10028650 | |||
| 2059 | Ga0207680_10000002 | |||
| 2060 | Ga0207680_10000092 | |||
| 2061 | Ga0207680_10034939 | |||
| 2062 | Ga0207680_10037462 | |||
| 2063 | Ga0207680_10095683 | |||
| 2064 | Ga0207647_10000010 | |||
| 2065 | Ga0207647_10000066 | |||
| 2066 | Ga0207647_10004970 | |||
| 2067 | Ga0207647_10006265 | |||
| 2068 | Ga0207647_10010431 | |||
| 2069 | Ga0207647_10012093 | |||
| 2070 | Ga0207685_10072312 | |||
| 2071 | Ga0207699_10505620 | |||
| 2072 | Ga0207645_10043108 | |||
| 2073 | Ga0207645_10096932 | |||
| 2074 | Ga0207643_10008509 | |||
| 2075 | Ga0207705_10001094 | |||
| 2076 | Ga0207705_10035118 | |||
| 2077 | Ga0207705_10039069 | |||
| 2078 | Ga0207705_10238245 | |||
| 2079 | Ga0207705_10303490 | |||
| 2080 | Ga0207654_10001128 | |||
| 2081 | Ga0207654_10181410 | |||
| 2082 | Ga0207654_10229994 | |||
| 2083 | Ga0207654_10733376 | |||
| 2084 | Ga0207654_10766565 | |||
| 2085 | Ga0207707_10010148 | |||
| 2086 | Ga0207707_10057230 | |||
| 2087 | Ga0207707_10129717 | |||
| 2088 | Ga0207707_10292260 | |||
| 2089 | Ga0207707_10296316 | |||
| 2090 | Ga0207695_10000014 | |||
| 2091 | Ga0207695_10000322 | |||
| 2092 | Ga0207695_10000809 | |||
| 2093 | Ga0207695_10000856 | |||
| 2094 | Ga0207695_10005750 | |||
| 2095 | Ga0207695_10006442 | |||
| 2096 | Ga0207695_10008494 | |||
| 2097 | Ga0207695_10032475 | |||
| 2098 | Ga0207695_10046519 | |||
| 2099 | Ga0207695_10069276 | |||
| 2100 | Ga0207695_10366560 | |||
| 2101 | Ga0207695_11306862 | |||
| 2102 | Ga0207671_10000028 | |||
| 2103 | Ga0207671_10000357 | |||
| 2104 | Ga0207671_10001588 | |||
| 2105 | Ga0207671_10004399 | |||
| 2106 | Ga0207671_10318069 | |||
| 2107 | Ga0207671_10458907 | |||
| 2108 | Ga0207663_10264346 | |||
| 2109 | Ga0207663_10308392 | |||
| 2110 | Ga0207660_10097251 | |||
| 2111 | Ga0207660_10263573 | |||
| 2112 | Ga0207660_10390745 | |||
| 2113 | Ga0207657_10009521 | |||
| 2114 | Ga0207657_10011833 | |||
| 2115 | Ga0207657_10042168 | |||
| 2116 | Ga0207657_10335228 | |||
| 2117 | Ga0207657_10861449 | |||
| 2118 | Ga0207649_10002084 | |||
| 2119 | Ga0207649_10032583 | |||
| 2120 | Ga0207649_10033209 | |||
| 2121 | Ga0207649_10197571 | |||
| 2122 | Ga0207649_10424825 | |||
| 2123 | Ga0207652_10165752 | |||
| 2124 | Ga0207652_10218605 | |||
| 2125 | Ga0207652_10297561 | |||
| 2126 | Ga0207652_10342189 | |||
| 2127 | Ga0207681_10001858 | |||
| 2128 | Ga0207681_10007276 | |||
| 2129 | Ga0207681_10033681 | |||
| 2130 | Ga0207681_10503930 | |||
| 2131 | Ga0207694_10000109 | |||
| 2132 | Ga0207694_10000850 | |||
| 2133 | Ga0207694_10001341 | |||
| 2134 | Ga0207694_10097782 | |||
| 2135 | Ga0207694_10140943 | |||
| 2136 | Ga0207694_10185078 | |||
| 2137 | Ga0207694_10269754 | |||
| 2138 | Ga0207650_10021916 | |||
| 2139 | Ga0207650_10229804 | |||
| 2140 | Ga0207659_10373732 | |||
| 2141 | Ga0207687_10344965 | |||
| 2142 | Ga0207687_10554219 | |||
| 2143 | Ga0207687_11142225 | |||
| 2144 | Ga0207664_10000553 | |||
| 2145 | Ga0207664_10000624 | |||
| 2146 | Ga0207644_10166416 | |||
| 2147 | Ga0207644_10174658 | |||
| 2148 | Ga0207644_10556744 | |||
| 2149 | Ga0207690_10000061 | |||
| 2150 | Ga0207690_10000375 | |||
| 2151 | Ga0207690_10006084 | |||
| 2152 | Ga0207690_10030475 | |||
| 2153 | Ga0207690_10145847 | |||
| 2154 | Ga0207706_10042475 | |||
| 2155 | Ga0207706_10049684 | |||
| 2156 | Ga0207686_10003423 | |||
| 2157 | Ga0207709_10005775 | |||
| 2158 | Ga0207670_10001621 | |||
| 2159 | Ga0207670_10446551 | |||
| 2160 | Ga0207670_10758146 | |||
| 2161 | Ga0207704_10010792 | |||
| 2162 | Ga0207704_10032219 | |||
| 2163 | Ga0207704_10069820 | |||
| 2164 | Ga0207704_10078000 | |||
| 2165 | Ga0207704_10090427 | |||
| 2166 | Ga0207691_10007374 | |||
| 2167 | Ga0207691_10028648 | |||
| 2168 | Ga0207691_10082771 | |||
| 2169 | Ga0207691_10166529 | |||
| 2170 | Ga0207711_10002283 | |||
| 2171 | Ga0207711_10160406 | |||
| 2172 | Ga0207711_10226669 | |||
| 2173 | Ga0207711_10438985 | |||
| 2174 | Ga0207711_10896166 | |||
| 2175 | Ga0207689_10070324 | |||
| 2176 | Ga0207689_10237908 | |||
| 2177 | Ga0207689_10322233 | |||
| 2178 | Ga0207689_10453363 | |||
| 2179 | Ga0207661_10258427 | |||
| 2180 | Ga0207667_10000080 | |||
| 2181 | Ga0207667_10000344 | |||
| 2182 | Ga0207667_10056069 | |||
| 2183 | Ga0207667_10092352 | |||
| 2184 | Ga0207667_10092784 | |||
| 2185 | Ga0207667_10186083 | |||
| 2186 | Ga0207667_10206622 | |||
| 2187 | Ga0207667_10599640 | |||
| 2188 | Ga0207667_11040940 | |||
| 2189 | Ga0207667_11463710 | |||
| 2190 | Ga0207651_10183658 | |||
| 2191 | Ga0207651_10392254 | |||
| 2192 | Ga0207712_10001195 | |||
| 2193 | Ga0207712_10001216 | |||
| 2194 | Ga0207712_10559312 | |||
| 2195 | Ga0207668_10011602 | |||
| 2196 | Ga0207668_10166366 | |||
| 2197 | Ga0207668_10203353 | |||
| 2198 | Ga0207668_10254721 | |||
| 2199 | Ga0207668_10359841 | |||
| 2200 | Ga0207640_10000190 | |||
| 2201 | Ga0207640_10001549 | |||
| 2202 | Ga0207640_10003414 | |||
| 2203 | Ga0207640_10009903 | |||
| 2204 | Ga0207640_10016638 | |||
| 2205 | Ga0207640_10163223 | |||
| 2206 | Ga0207640_10241418 | |||
| 2207 | Ga0207658_10000013 | |||
| 2208 | Ga0207658_10029268 | |||
| 2209 | Ga0207658_10118548 | |||
| 2210 | Ga0207658_10193319 | |||
| 2211 | Ga0207658_10329933 | |||
| 2212 | Ga0207658_10667254 | |||
| 2213 | Ga0207658_10891040 | |||
| 2214 | Ga0207658_10892344 | |||
| 2215 | Ga0207677_10086112 | |||
| 2216 | Ga0207677_10106765 | |||
| 2217 | Ga0207703_10000793 | |||
| 2218 | Ga0207703_10269178 | |||
| 2219 | Ga0207703_10395672 | |||
| 2220 | Ga0207703_10397394 | |||
| 2221 | Ga0207639_10000479 | |||
| 2222 | Ga0207639_10000595 | |||
| 2223 | Ga0207639_10004215 | |||
| 2224 | Ga0207639_10035499 | |||
| 2225 | Ga0207639_10082054 | |||
| 2226 | Ga0207639_10210802 | |||
| 2227 | Ga0207639_10255015 | |||
| 2228 | Ga0207639_10302611 | |||
| 2229 | Ga0207639_10366920 | |||
| 2230 | Ga0207639_10479588 | |||
| 2231 | Ga0207639_10504114 | |||
| 2232 | Ga0207639_10713675 | |||
| 2233 | Ga0207639_11203159 | |||
| 2234 | Ga0207678_10000035 | |||
| 2235 | Ga0207678_10012465 | |||
| 2236 | Ga0207678_10016540 | |||
| 2237 | Ga0207678_10055104 | |||
| 2238 | Ga0207678_10208614 | |||
| 2239 | Ga0207678_10702636 | |||
| 2240 | Ga0207708_10303999 | |||
| 2241 | Ga0207702_10000049 | |||
| 2242 | Ga0207702_10000380 | |||
| 2243 | Ga0207702_10010670 | |||
| 2244 | Ga0207702_10011899 | |||
| 2245 | Ga0207702_10197901 | |||
| 2246 | Ga0207702_10722423 | |||
| 2247 | Ga0207702_10821687 | |||
| 2248 | Ga0207641_10006513 | |||
| 2249 | Ga0207641_10025673 | |||
| 2250 | Ga0207641_10162028 | |||
| 2251 | Ga0207641_10278074 | |||
| 2252 | Ga0207641_10415131 | |||
| 2253 | Ga0207648_10011901 | |||
| 2254 | Ga0207648_10076457 | |||
| 2255 | Ga0207648_10873773 | |||
| 2256 | Ga0207676_10009897 | |||
| 2257 | Ga0207676_10188024 | |||
| 2258 | Ga0207676_10200669 | |||
| 2259 | Ga0207676_10562303 | |||
| 2260 | Ga0207674_10000090 | |||
| 2261 | Ga0207674_10005138 | |||
| 2262 | Ga0207674_10082164 | |||
| 2263 | Ga0207674_10089465 | |||
| 2264 | Ga0207674_10217853 | |||
| 2265 | Ga0207675_100022876 | |||
| 2266 | Ga0207675_100368478 | |||
| 2267 | Ga0207675_100722810 | |||
| 2268 | Ga0207683_10015518 | |||
| 2269 | Ga0207683_10114431 | |||
| 2270 | Ga0207683_10125025 | |||
| 2271 | Ga0207683_10221619 | |||
| 2272 | Ga0207698_10000982 | |||
| 2273 | Ga0207698_10007692 | |||
| 2274 | Ga0207698_10018109 | |||
| 2275 | Ga0207698_10130712 | |||
| 2276 | Ga0207698_10380200 | |||
| 2277 | Ga0207698_10444189 | |||
| 2278 | Ga0207698_10583094 | |||
| 2279 | Ga0207698_10798323 | |||
| 2280 | Ga0209973_1003226 | |||
| 2281 | Ga0209371_1000048 | |||
| 2282 | Ga0209984_1001727 | |||
| 2283 | Ga0209999_1000442 | |||
| 2284 | Ga0209982_1001040 | |||
| 2285 | Ga0209970_1008325 | |||
| 2286 | Ga0209971_1001367 | |||
| 2287 | Ga0209974_10001896 | |||
| 2288 | Ga0209974_10006797 | |||
| 2289 | Ga0268266_10000001 | |||
| 2290 | Ga0268266_10000008 | |||
| 2291 | Ga0268266_10012196 | |||
| 2292 | Ga0268266_10105549 | |||
| 2293 | Ga0268266_10416320 | |||
| 2294 | Ga0268265_10096396 | |||
| 2295 | Ga0268264_10012879 | |||
| 2296 | Ga0268264_10013020 | |||
| 2297 | Ga0268264_10172359 | |||
| 2298 | Ga0268264_10596859 | |||
| 2299 | Ga0307517_10145217 | |||
| 2300 | Ga0265338_10483232 | |||
| 2301 | Ga0268256_1000049 | |||
| 2302 | Ga0316177_1156649 | |||
| 2303 | Ga0316182_1026731 | |||
| 2304 | Ga0307408_100079013 | |||
| 2305 | Ga0307408_100092241 | |||
| 2306 | Ga0307408_100161570 | |||
| 2307 | Ga0307408_100300972 | |||
| 2308 | Ga0307408_100798105 | |||
| 2309 | Ga0307508_10030073 | |||
| 2310 | Ga0307508_10203007 | |||
| 2311 | Ga0316575_10076918 | |||
| 2312 | Ga0316576_10265740 | |||
| 2313 | Ga0307516_10216777 | |||
| 2314 | Ga0307405_10204962 | |||
| 2315 | Ga0307413_10005298 | |||
| 2316 | Ga0307413_10036935 | |||
| 2317 | Ga0307413_10124312 | |||
| 2318 | Ga0307413_10301187 | |||
| 2319 | Ga0307413_10776646 | |||
| 2320 | Ga0307410_10151037 | |||
| 2321 | Ga0307410_10431738 | |||
| 2322 | Ga0307410_10489988 | |||
| 2323 | Ga0307406_10285424 | |||
| 2324 | Ga0307407_10010967 | |||
| 2325 | Ga0307412_10031558 | |||
| 2326 | Ga0307412_10042740 | |||
| 2327 | Ga0307412_10107047 | |||
| 2328 | Ga0307412_10504300 | |||
| 2329 | Ga0307412_10905455 | |||
| 2330 | Ga0307409_101348517 | |||
| 2331 | Ga0307416_100243197 | |||
| 2332 | Ga0307416_100337613 | |||
| 2333 | Ga0307416_100600800 | |||
| 2334 | Ga0307414_10040312 | |||
| 2335 | Ga0307414_10067056 | |||
| 2336 | Ga0307414_10113207 | |||
| 2337 | Ga0307414_10138684 | |||
| 2338 | Ga0307414_10179116 | |||
| 2339 | Ga0307414_10292186 | |||
| 2340 | Ga0307414_10406811 | |||
| 2341 | Ga0307414_10457216 | |||
| 2342 | Ga0307414_10522699 | |||
| 2343 | Ga0307411_10013448 | |||
| 2344 | Ga0307411_10084979 | |||
| 2345 | Ga0307411_10333992 | |||
| 2346 | Ga0307411_10460650 | |||
| 2347 | Ga0307411_10476638 | |||
| 2348 | Ga0307411_10834155 | |||
| 2349 | Ga0307415_100796717 | |||
| 2350 | Ga0307507_10032693 | |||
| 2351 | Ga0307510_10132276 | |||
| 2352 | Ga0373959_0023707 | |||
| 2353 | Ga0373944_0103121 | |||
| 2354 | Ga0373936_0155331 | |||
| 2355 | Ga0373954_0261813 | |||
| 2356 | Ga0373957_0116767 | |||
| 2357 | Ga0373947_0456849 | |||
| 2358 | Ga0373937_0422145 | |||
| 2359 | Ga0373937_0855561 | |||
| 2360 | Ga0395899_0001125 | |||
| 2361 | Ga0395899_0029586 | |||
| 2362 | Ga0395899_0082043 | |||
| 2363 | Ga0395899_0178593 | |||
| 2364 | Ga0395899_0206202 | |||
| 2365 | Ga0395899_0287868 | |||
| 2366 | Ga0395899_0457805 | |||
| 2367 | Ga0395900_0001304 | |||
| 2368 | Ga0395900_0004445 | |||
| 2369 | Ga0395900_0024057 | |||
| 2370 | Ga0395900_0032548 | |||
| 2371 | Ga0395900_0046052 | |||
| 2372 | Ga0395900_0050386 | |||
| 2373 | Ga0395900_0066734 | |||
| 2374 | Ga0395900_0713229 | |||
| 2375 | Ga0395900_1152336 | |||
| 2376 | Ga0395898_0001583 | |||
| 2377 | Ga0395898_0002066 | |||
| 2378 | Ga0395898_0002627 | |||
| 2379 | Ga0395898_0002725 | |||
| 2380 | Ga0395898_0013479 | |||
| 2381 | Ga0395898_0036705 | |||
| 2382 | Ga0395898_0114789 | |||
| 2383 | Ga0395898_0136496 | |||
| 2384 | Ga0395898_0317809 | |||
| 2385 | Ga0436364_0095944 | |||
| 2386 | Ga0395901_0000259 | |||
| 2387 | Ga0395901_0001429 | |||
| 2388 | Ga0395901_0049227 | |||
| 2389 | Ga0395901_0053602 | |||
| 2390 | Ga0395901_0061507 | |||
| 2391 | Ga0395901_0063473 | |||
| 2392 | Ga0395901_0220090 | |||
| 2393 | Ga0395901_0244857 | |||
| 2394 | Ga0395901_0324327 | |||
| 2395 | Ga0395901_0530985 | |||
| 2396 | Ga0237819_00140 | |||
| 2397 | Ga0400488_38144 | |||
| 2398 | Ga0400486_30133 | |||
| 2399 | Ga0436365_0119571 | |||
| 2400 | Ga0436365_0324168 | |||
| 2401 | Ga0436363_0359992 | |||
| 2402 | Ga0436362_0657356 | |||
| 2403 | Ga0439436_0003731 | |||
| 2404 | Ga0439436_0049721 | |||
| 2405 | Ga0439436_0062325 | |||
| 2406 | Ga0439447_001069 | |||
| 2407 | Ga0439465_0000006 | |||
| 2408 | Ga0439465_0004178 | |||
| 2409 | Ga0451789_0416833 | |||
| 2410 | Ga0451793_1086667 | |||
| 2411 | Ga0451797_0190827 | |||
| 2412 | Ga0451795_0046765 | |||
| 2413 | Ga0451800_1451396 | |||
| 2414 | Ga0451802_0727430 | |||
| 2415 | Ga0451806_127485 | |||
| 2416 | Ga0451807_0483911 | |||
| 2417 | Ga0451835_0771462 | |||
| 2418 | Ga0451837_1048697 | |||
| 2419 | Ga0451837_1628237 | |||
| 2420 | Ga0451839_0794977 | |||
| 2421 | Ga0451849_0604301 | |||
| 2422 | Ga0451843_1708573 | |||
| 2423 | Ga0451853_1416507 | |||
| 2424 | Ga0451853_1645120 | |||
| 2425 | Ga0451853_3750318 | |||
| 2426 | Ga0439431_0002900 | |||
| 2427 | Ga0439433_0037525 | |||
| 2428 | Ga0439445_0000142 | |||
| 2429 | Ga0439448_0102780 | |||
| 2430 | Ga0439432_065208 | |||
| 2431 | Ga0439432_108552 | |||
| 2432 | Ga0439449_0020297 | |||
| 2433 | Ga0439449_0127096 | |||
| 2434 | Ga0439452_004747 | |||
| 2435 | Ga0439459_0002300 | |||
| 2436 | Ga0439459_0002709 | |||
| 2437 | Ga0451577_0000425 | |||
| 2438 | Ga0451577_0008483 | |||
| 2439 | Ga0466969_0015351 | |||
| 2440 | Ga0466969_0030228 | |||
| 2441 | Ga0466972_0000647 | |||
| 2442 | Ga0466972_0001847 | |||
| 2443 | Ga0466972_0002963 | |||
| 2444 | Ga0466982_0000007 | |||
| 2445 | Ga0466982_0000029 | |||
| 2446 | Ga0466965_0000764 | |||
| 2447 | Ga0466965_0002141 | |||
| 2448 | Ga0466965_0007999 | |||
| 2449 | Ga0466965_0032814 | |||
| 2450 | Ga0466965_0104626 | |||
| 2451 | Ga0466966_0000343 | |||
| 2452 | Ga0466966_0001588 | |||
| 2453 | Ga0466961_0000199 | |||
| 2454 | Ga0466961_0002917 | |||
| 2455 | Ga0466961_0096135 | |||
| 2456 | Ga0466961_0282415 | |||
| 2457 | Ga0466961_0586090 | |||
| 2458 | Ga0466964_0000680 | |||
| 2459 | Ga0453684_0025105 | |||
| 2460 | Ga0466971_0004638 | |||
| 2461 | Ga0466968_0019341 | |||
| 2462 | Ga0466970_0000132 | |||
| 2463 | Ga0466970_0000260 | |||
| 2464 | Ga0466970_0058767 | |||
| 2465 | Ga0466970_0076519 | |||
| 2466 | Ga0466957_0001273 | |||
| 2467 | Ga0466957_0030641 | |||
| 2468 | Ga0466960_0106077 | |||
| 2469 | Ga0466959_0000293 | |||
| 2470 | Ga0466959_0058398 | |||
| 2471 | Ga0466959_0227903 | |||
| 2472 | Ga0466958_0003516 | |||
| 2473 | Ga0466967_0409936 | |||
| 2474 | Ga0495617_000122 | |||
| 2475 | Ga0495617_000504 | |||
| 2476 | Ga0495590_0181138 | |||
| 2477 | Ga0495629_0240917 | |||
| 2478 | Ga0495638_0000106 | |||
| 2479 | Ga0495638_0000237 | |||
| 2480 | Ga0495638_0000479 | |||
| 2481 | Ga0495641_0134174 | |||
| 2482 | Ga0495650_0000074 | |||
| 2483 | Ga0495650_0000134 | |||
| 2484 | Ga0495580_0237075 | |||
| 2485 | Ga0495582_0033576 | |||
| 2486 | Ga0495639_0064198 | |||
| 2487 | Ga0495584_0001870 | |||
| 2488 | Ga0495594_0189023 | |||
| 2489 | Ga0495607_0000042 | |||
| 2490 | Ga0495607_0004080 | |||
| 2491 | Ga0495583_0000833 | |||
| 2492 | Ga0495583_0003138 | |||
| 2493 | Ga0495583_0008323 | |||
| 2494 | Ga0495606_0000562 | |||
| 2495 | Ga0495606_0001636 | |||
| 2496 | Ga0495606_0008349 | |||
| 2497 | Ga0495606_0015682 | |||
| 2498 | Ga0495610_0000711 | |||
| 2499 | Ga0495616_0000617 | |||
| 2500 | Ga0495616_0003053 | |||
| 2501 | Ga0495620_0000182 | |||
| 2502 | Ga0495620_0000216 | |||
| 2503 | Ga0495620_0027243 | |||
| 2504 | Ga0495630_0161208 | |||
| 2505 | Ga0495632_0000241 | |||
| 2506 | Ga0495637_0014597 | |||
| 2507 | Ga0495648_0001366 | |||
| 2508 | Ga0495663_0051406 | |||
| 2509 | Ga0495663_0122884 | |||
| 2510 | Ga0495587_0708173 | |||
| 2511 | Ga0495609_0030336 | |||
| 2512 | Ga0495622_0106668 | |||
| 2513 | Ga0495656_0000847 | |||
| 2514 | Ga0495656_0121006 | |||
| 2515 | Ga0495668_0000411 | |||
| 2516 | Ga0495611_0000004 | |||
| 2517 | Ga0495611_0000023 | |||
| 2518 | Ga0495611_0002701 | |||
| 2519 | Ga0495625_0000024 | |||
| 2520 | Ga0495625_0001652 | |||
| 2521 | Ga0495625_0018885 | |||
| 2522 | Ga0495625_0047054 | |||
| 2523 | Ga0495625_0057783 | |||
| 2524 | Ga0495625_0160641 | |||
| 2525 | Ga0495625_0382372 | |||
| 2526 | Ga0495588_0071922 | |||
| 2527 | Ga0495588_0153472 | |||
| 2528 | Ga0495657_0095923 | |||
| 2529 | Ga0495599_0389719 | |||
| 2530 | Ga0495647_0032678 | |||
| 2531 | Ga0495613_0656007 | |||
| 2532 | Ga0495670_0009105 | |||
| 2533 | Ga0495670_0129075 | |||
| 2534 | Ga0495671_0000390 | |||
| 2535 | Ga0495649_0000687 | |||
| 2536 | Ga0495589_0000038 | |||
| 2537 | Ga0495589_0000547 | |||
| 2538 | Ga0495600_0117039 | |||
| 2539 | Ga0495660_0000321 | |||
| 2540 | Ga0495636_0003246 | |||
| 2541 | Ga0495636_0006414 | |||
| 2542 | Ga0495636_0086670 | |||
| 2543 | Ga0495672_0000544 | |||
| 2544 | Ga0495679_000011 | |||
| 2545 | Ga0495673_0000616 | |||
| 2546 | Ga0495681_0015144 | |||
| 2547 | Ga0495684_0168776 | |||
| 2548 | Ga0495686_0000608 | |||
| 2549 | Ga0495686_0010132 | |||
| 2550 | Ga0495686_0010763 | |||
| 2551 | Ga0495686_0061393 | |||
| 2552 | Ga0495686_0071603 | |||
| 2553 | Ga0495686_0127698 | |||
| 2554 | Ga0495686_0250464 | |||
| 2555 | Ga0495602_0158386 | |||
| 2556 | Ga0496100_0001740 | |||
| 2557 | Ga0496100_0584488 | |||
| 2558 | Ga0496101_0012388 | |||
| 2559 | Ga0496101_0073503 | |||
| 2560 | Ga0496101_0132636 | |||
| 2561 | Ga0496102_0082098 | |||
| 2562 | Ga0496102_0583618 | |||
| 2563 | Ga0496104_0000012 | |||
| 2564 | Ga0496104_0338658 | |||
| 2565 | Ga0496105_0000011 | |||
| 2566 | Ga0496106_0175573 | |||
| 2567 | Ga0496107_0035157 | |||
| 2568 | Ga0496107_0094425 | |||
| 2569 | Ga0496107_0378835 | |||
| 2570 | Ga0496108_0724804 | |||
| 2571 | Ga0496108_1175036 | |||
| 2572 | Ga0496110_0298806 | |||
| 2573 | Ga0496112_0540649 | |||
| 2574 | Ga0496113_0024417 | |||
| 2575 | Ga0496113_0203915 | |||
| 2576 | Ga0496113_1191232 | |||
| 2577 | Ga0496114_0001533 | |||
| 2578 | Ga0496114_0006408 | |||
| 2579 | Ga0496114_0172916 | |||
| 2580 | Ga0496114_0208232 | |||
| 2581 | Ga0496115_0000092 | |||
| 2582 | Ga0496115_0000193 | |||
| 2583 | Ga0496115_0000617 | |||
| 2584 | Ga0496115_0004525 | |||
| 2585 | Ga0496115_0031269 | |||
| 2586 | Ga0496115_0145340 | |||
| 2587 | Ga0496115_0221537 | |||
| 2588 | Ga0496117_0004278 | |||
| 2589 | Ga0496117_0005719 | |||
| 2590 | Ga0496117_0009436 | |||
| 2591 | Ga0496118_0000885 | |||
| 2592 | Ga0496118_0001282 | |||
| 2593 | Ga0496118_0001962 | |||
| 2594 | Ga0496118_0002465 | |||
| 2595 | Ga0496118_0004440 | |||
| 2596 | Ga0496118_0012974 | |||
| 2597 | Ga0496118_0241615 | |||
| 2598 | Ga0496119_0041672 | |||
| 2599 | Ga0496120_0107468 | |||
| 2600 | Ga0496120_0117853 | |||
| 2601 | Ga0496121_0000071 | |||
| 2602 | Ga0496121_0000942 | |||
| 2603 | Ga0496121_0001620 | |||
| 2604 | Ga0496121_0001863 | |||
| 2605 | Ga0496121_0001864 | |||
| 2606 | Ga0496121_0001888 | |||
| 2607 | Ga0496121_0002280 | |||
| 2608 | Ga0496121_0006661 | |||
| 2609 | Ga0496121_0016652 | |||
| 2610 | Ga0496121_0037969 | |||
| 2611 | Ga0496121_0142210 | |||
| 2612 | Ga0496122_0000062 | |||
| 2613 | Ga0496122_0016999 | |||
| 2614 | Ga0496122_0018310 | |||
| 2615 | Ga0496122_0048979 | |||
| 2616 | Ga0496122_0066017 | |||
| 2617 | Ga0496123_0004387 | |||
| 2618 | Ga0496123_0009110 | |||
| 2619 | Ga0496123_0012934 | |||
| 2620 | Ga0496123_0013031 | |||
| 2621 | Ga0496123_0075915 | |||
| 2622 | Ga0496124_0000313 | |||
| 2623 | Ga0496124_0000314 | |||
| 2624 | Ga0496124_0007021 | |||
| 2625 | Ga0496125_0000291 | |||
| 2626 | Ga0496125_0024124 | |||
| 2627 | Ga0496125_0060859 | |||
| 2628 | Ga0496125_0349895 | |||
| 2629 | Ga0496126_0000160 | |||
| 2630 | Ga0496126_0003733 | |||
| 2631 | Ga0496126_0004079 | |||
| 2632 | Ga0496126_0004964 | |||
| 2633 | Ga0496126_0009232 | |||
| 2634 | Ga0496126_0011982 | |||
| 2635 | Ga0496126_0017284 | |||
| 2636 | Ga0496126_0018434 | |||
| 2637 | Ga0496126_0050363 | |||
| 2638 | Ga0496126_0060206 | |||
| 2639 | Ga0496126_0080523 | |||
| 2640 | Ga0496126_0086649 | |||
| 2641 | Ga0496126_1012005 | |||
| 2642 | Ga0495678_000062 | |||
| 2643 | Ga0495678_025362 | |||
| 2644 | Ga0495682_0000283 | |||
| 2645 | Ga0495682_0000341 | |||
| 2646 | Ga0495682_0000372 | |||
| 2647 | Ga0495682_0013547 | |||
| 2648 | Ga0501031_0002957 | |||
| 2649 | Ga0501031_0016767 | |||
| 2650 | Ga0501031_0047333 | |||
| 2651 | Ga0501031_0076103 | |||
| 2652 | Ga0501031_0117963 | |||
| 2653 | Ga0501031_0207521 | |||
| 2654 | Ga0501031_0357314 | |||
| 2655 | Ga0501032_0000485 | |||
| 2656 | Ga0501032_0004538 | |||
| 2657 | Ga0501032_0007187 | |||
| 2658 | Ga0501032_0042745 | |||
| 2659 | Ga0501032_0100806 | |||
| 2660 | Ga0501032_0174762 | |||
| 2661 | Ga0501032_0225935 | |||
| 2662 | Ga0501032_0589179 | |||
| 2663 | Ga0501033_0002332 | |||
| 2664 | Ga0501033_0002853 | |||
| 2665 | Ga0501033_0004295 | |||
| 2666 | Ga0501033_0005340 | |||
| 2667 | Ga0501033_0036768 | |||
| 2668 | Ga0501033_0265859 | |||
| 2669 | Ga0501034_0000544 | |||
| 2670 | Ga0501034_0001449 | |||
| 2671 | Ga0501034_0004230 | |||
| 2672 | Ga0501034_0006520 | |||
| 2673 | Ga0501034_0006867 | |||
| 2674 | Ga0501034_0010307 | |||
| 2675 | Ga0501034_0012391 | |||
| 2676 | Ga0501034_0042361 | |||
| 2677 | Ga0501034_0056437 | |||
| 2678 | Ga0501034_0073006 | |||
| 2679 | Ga0501034_0125919 | |||
| 2680 | Ga0501034_0141390 | |||
| 2681 | Ga0501034_0294235 | |||
| 2682 | Ga0501034_0356522 | |||
| 2683 | Ga0501034_0778465 | |||
| 2684 | Ga0501036_0008476 | |||
| 2685 | Ga0501036_0047433 | |||
| 2686 | Ga0501036_0108054 | |||
| 2687 | Ga0501036_0375127 | |||
| 2688 | Ga0501036_0579029 | |||
| 2689 | Ga0501036_0739410 | |||
| 2690 | Ga0501036_0794192 | |||
| 2691 | Ga0501037_0004806 | |||
| 2692 | Ga0501037_0028275 | |||
| 2693 | Ga0501037_0091448 | |||
| 2694 | Ga0501037_0096898 | |||
| 2695 | Ga0501037_0104567 | |||
| 2696 | Ga0501037_0206295 | |||
| 2697 | Ga0501037_0360052 | |||
| 2698 | Ga0501037_0388123 | |||
| 2699 | Ga0501037_0413500 | |||
| 2700 | Ga0501038_0000251 | |||
| 2701 | Ga0501038_0006634 | |||
| 2702 | Ga0501038_0011631 | |||
| 2703 | Ga0501038_0023411 | |||
| 2704 | Ga0501038_0220810 | |||
| 2705 | Ga0501038_0222956 | |||
| 2706 | Ga0501038_0489651 | |||
| 2707 | Ga0501039_0007491 | |||
| 2708 | Ga0501039_0055978 | |||
| 2709 | Ga0501039_0073969 | |||
| 2710 | Ga0501039_0144966 | |||
| 2711 | Ga0501039_0195532 | |||
| 2712 | Ga0501039_0223697 | |||
| 2713 | Ga0501040_0118373 | |||
| 2714 | Ga0501042_0398761 | |||
| 2715 | Ga0501043_0003128 | |||
| 2716 | Ga0501043_0003723 | |||
| 2717 | Ga0501043_0009046 | |||
| 2718 | Ga0501043_0014418 | |||
| 2719 | Ga0501043_0017421 | |||
| 2720 | Ga0501043_0019309 | |||
| 2721 | Ga0501043_0063840 | |||
| 2722 | Ga0501043_0129292 | |||
| 2723 | Ga0501043_0208162 | |||
| 2724 | Ga0501043_0252463 | |||
| 2725 | Ga0501046_0009056 | |||
| 2726 | Ga0501046_0013125 | |||
| 2727 | Ga0501046_0015580 | |||
| 2728 | Ga0501046_0024091 | |||
| 2729 | Ga0501046_0093130 | |||
| 2730 | Ga0501046_0124060 | |||
| 2731 | Ga0501046_0156218 | |||
| 2732 | Ga0501047_0000250 | |||
| 2733 | Ga0501047_0002064 | |||
| 2734 | Ga0501047_0004581 | |||
| 2735 | Ga0501047_0008714 | |||
| 2736 | Ga0501047_0050558 | |||
| 2737 | Ga0501047_0143168 | |||
| 2738 | Ga0501047_0167971 | |||
| 2739 | Ga0501047_0219175 | |||
| 2740 | Ga0501047_0220542 | |||
| 2741 | Ga0501047_0299928 | |||
| 2742 | Ga0501047_0311134 | |||
| 2743 | Ga0501047_0412210 | |||
| 2744 | Ga0501048_0017672 | |||
| 2745 | Ga0501048_0039385 | |||
| 2746 | Ga0501048_0112774 | |||
| 2747 | Ga0501067_0000560 | |||
| 2748 | Ga0501067_0008269 | |||
| 2749 | Ga0501068_0016281 | |||
| 2750 | Ga0501068_0031539 | |||
| 2751 | Ga0501068_0094355 | |||
| 2752 | Ga0501068_0094652 | |||
| 2753 | Ga0501068_0399129 | |||
| 2754 | Ga0501069_0016989 | |||
| 2755 | Ga0501069_0018450 | |||
| 2756 | Ga0501069_0024864 | |||
| 2757 | Ga0501069_0045605 | |||
| 2758 | Ga0501070_0003399 | |||
| 2759 | Ga0501070_0022970 | |||
| 2760 | Ga0501070_0026818 | |||
| 2761 | Ga0501070_0080766 | |||
| 2762 | Ga0501070_0149339 | |||
| 2763 | Ga0501070_0157905 | |||
| 2764 | Ga0501070_0240087 | |||
| 2765 | Ga0501070_0263973 | |||
| 2766 | Ga0501070_0727883 | |||
| 2767 | Ga0501071_0040096 | |||
| 2768 | Ga0501071_0205648 | |||
| 2769 | Ga0501072_0003501 | |||
| 2770 | Ga0501072_0016955 | |||
| 2771 | Ga0501073_0001096 | |||
| 2772 | Ga0501073_0003002 | |||
| 2773 | Ga0501073_0004205 | |||
| 2774 | Ga0501073_0110334 | |||
| 2775 | Ga0501073_0230488 | |||
| 2776 | Ga0501073_0351642 | |||
| 2777 | Ga0501073_0360338 | |||
| 2778 | Ga0501073_0658082 | |||
| 2779 | Ga0501074_0019562 | |||
| 2780 | Ga0501074_0034353 | |||
| 2781 | Ga0501074_0035175 | |||
| 2782 | Ga0501074_0049890 | |||
| 2783 | Ga0501074_0058058 | |||
| 2784 | Ga0501074_0067221 | |||
| 2785 | Ga0501074_0110530 | |||
| 2786 | Ga0501076_0571329 | |||
| 2787 | Ga0501077_0360496 | |||
| 2788 | Ga0501077_0393926 | |||
| 2789 | Ga0501202_016651 | |||
| 2790 | Ga0501079_0112934 | |||
| 2791 | Ga0501079_0120832 | |||
| 2792 | Ga0501079_0183846 | |||
| 2793 | Ga0501079_0270545 | |||
| 2794 | Ga0501079_0385713 | |||
| 2795 | Ga0501080_0000306 | |||
| 2796 | Ga0501080_0000320 | |||
| 2797 | Ga0501080_0001885 | |||
| 2798 | Ga0501080_0038508 | |||
| 2799 | Ga0501080_0051615 | |||
| 2800 | Ga0501080_0060509 | |||
| 2801 | Ga0501080_0095289 | |||
| 2802 | Ga0501080_0126272 | |||
| 2803 | Ga0501080_0197515 | |||
| 2804 | Ga0501080_0775118 | |||
| 2805 | Ga0501081_0086682 | |||
| 2806 | Ga0501083_0007488 | |||
| 2807 | Ga0501083_0068982 | |||
| 2808 | Ga0501266_011828 | |||
| 2809 | Ga0501269_035278 | |||
| 2810 | Ga0501035_0009752 | |||
| 2811 | Ga0501035_0016886 | |||
| 2812 | Ga0501035_0017379 | |||
| 2813 | Ga0501035_0025209 | |||
| 2814 | Ga0501035_0026599 | |||
| 2815 | Ga0501035_0034014 | |||
| 2816 | Ga0501035_0050395 | |||
| 2817 | Ga0501035_0055280 | |||
| 2818 | Ga0501035_0111994 | |||
| 2819 | Ga0501035_0385476 | |||
| 2820 | Ga0501035_0723091 | |||
| 2821 | Ga0501035_0780814 | |||
| 2822 | Ga0501044_0003969 | |||
| 2823 | Ga0501044_0005486 | |||
| 2824 | Ga0501044_0017657 | |||
| 2825 | Ga0501044_0028186 | |||
| 2826 | Ga0501044_0075598 | |||
| 2827 | Ga0501044_0107242 | |||
| 2828 | Ga0501044_0108743 | |||
| 2829 | Ga0501044_0140742 | |||
| 2830 | Ga0501044_0143207 | |||
| 2831 | Ga0501044_0174273 | |||
| 2832 | Ga0501044_0225483 | |||
| 2833 | Ga0501044_0295543 | |||
| 2834 | Ga0501044_0304012 | |||
| 2835 | Ga0501044_0323959 | |||
| 2836 | Ga0501044_0400469 | |||
| 2837 | Ga0501044_0462230 | |||
| 2838 | Ga0501044_0926429 | |||
| 2839 | Ga0501044_1144822 | |||
| 2840 | Ga0501045_0144308 | |||
| 2841 | Ga0501045_0591876 | |||
| 2842 | nmdc:mga05p37_32385_c1 | |||
| 2843 | nmdc:mga09592_180455_c1 | |||
| 2844 | nmdc:mga0sz30_16282_c1 | |||
| 2845 | Ga0500610_0003017 | |||
| 2846 | Ga0495619_0081142 | |||
| 2847 | Ga0500643_001605 | |||
| 2848 | Ga0500643_008552 | |||
| 2849 | Ga0500643_008927 | |||
| 2850 | Ga0500651_0002320 | |||
| 2851 | Ga0500651_0015083 | |||
| 2852 | Ga0500566_0191366 | |||
| 2853 | Ga0500641_0017442 | |||
| 2854 | Ga0500555_000235 | |||
| 2855 | Ga0500562_042424 | |||
| 2856 | Ga0500597_000019 | |||
| 2857 | Ga0500628_146496 | |||
| 2858 | Ga0500658_0005949 | |||
| 2859 | Ga0500559_0281522 | |||
| 2860 | Ga0500568_0001313 | |||
| 2861 | Ga0500577_0003758 | |||
| 2862 | Ga0500616_0044457 | |||
| 2863 | Ga0500636_0389787 | |||
| 2864 | Ga0500645_000167 | |||
| 2865 | Ga0501084_0015131 | |||
| 2866 | Ga0501084_0414703 | |||
| 2867 | Ga0501084_0645659 | |||
| 2868 | Ga0587073_0046370 | |||
| 2869 | Ga0501082_0000394 | |||
| 2870 | Ga0501082_0093743 | |||
| 2871 | Ga0501082_0124847 | |||
| 2872 | Ga0501082_0326672 | |||
| 2873 | Ga0466962_0001724 | |||
| 2874 | Ga0466962_0005053 | |||
| 2875 | 2538833768 | |||
| 2876 | 2572255430 | |||
| 2877 | 2595447285 | |||
| 2878 | 2595450067 | |||
| 2879 | 2600225624 | |||
| 2880 | 2643831102 | |||
| 2881 | 2643881487 | |||
| 2882 | 2643896863 | |||
| 2883 | 2644049895 | |||
| 2884 | 2644203319 | |||
| 2885 | 2644479067 | |||
| 2886 | 2644497671 | |||
| 2887 | 2644507094 | |||
| 2888 | 2644662624 | |||
| 2889 | 2644698422 | |||
| 2890 | 2687581894 | |||
| 2891 | 2739227158 | |||
| 2892 | 2739729813 | |||
| 2893 | 2819565670 | |||
| 2894 | 2819613378 | |||
| 2895 | 2837680697 | |||
| 2896 | 2842918322 | |||
| 2897 | 2884339425 | |||
| 2898 | 2884416050 | |||
| 2899 | 2894819112 | |||
| 2900 | 2895396287 | |||
| 2901 | 2904465954 | |||
| 2902 | 2919406608 | |||
| 2903 | 2928966003 | |||
| 2904 | 2939614796 | |||
| 2905 | 2941473178 | |||
| 2906 | 2953995650 | |||
| 2907 | 2989774652 | |||
| 2908 | 8002869637 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9803 | 1 | 176 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9798 | 2 | 179 |
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.9735 | 2 | 179 |
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9693 | 1 | 176 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9681 | 2 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2b9uD00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9596 | 2 | 179 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9595 | 3 | 179 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9591 | 1 | 177 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9523 | 3 | 180 | 2.60.120.10 |
| af_Q17993_17_190_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9492 | 12 | 180 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P5LJ26-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9958 | 2 | 143 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |
| AF-A0A435TQB2-F1-model_v4 | deleted | 0.9953 | 1 | 159 |
|
| AF-A0A2T0RTK2-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9931 | 2 | 186 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A069E616-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.993 | 1 | 186 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7W6WAL4-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9926 | 3 | 186 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |