F494083

General Info

Members Datasets Scaffolds Average Seq Length
1455 694 2910 315

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10017804|Ga0105240_100178048
Length 379
Sequence VALTRPPSGRAFGCAAFNVSGFETLAAACTKMIWEGTDGVQEGPSALLSPFKPLFSRPFFIGFPMTLVSIPANPVPENVVVGTIKTPDGADLRFARWAPPVGRRGTVCVFTGRGEQIEKYFETVRDLRDRGFAVAMIDWRGQGHSARRLRDPRKGYVRHFSDYEVDAETFVQQVVLPDCPPPFFALAHSMGGAVMLRIAHASKRWFDRIVLSAPMIDLPGRRTSFPVRTLLRTMRLMGQGGRYVPGGNDELVNTAPFVNNPLTSDPVRYARNAAILAEDPTLGIASPTVAWADTAFATMHGFRAVDYPSQIRQPLLMIAASNDTIVSTPAIEEFAYHLRAGSHLVIAGAKHEILQEQDRYRAQFWAAFDAFVPGTPLFQ

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
87 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
88 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
121 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
122 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
123 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
189 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
190 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
191 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
196 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
222 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
223 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
284 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
285 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
302 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
317 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
321 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
322 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
323 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
324 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
325 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
341 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
342 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
343 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
344 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
345 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
348 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
349 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
355 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
358 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
359 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
368 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
375 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
376 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
390 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
391 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
392 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
393 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
394 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
395 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
396 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
397 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
398 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
404 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
405 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
406 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
409 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
410 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
411 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
422 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
423 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
424 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
425 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
426 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
427 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
428 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
429 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
430 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
431 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
432 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
433 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
434 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
435 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
436 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
437 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
438 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
439 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
440 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
441 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
442 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
443 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
444 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
445 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
446 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
447 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
448 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
449 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
450 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
451 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
452 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
453 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
454 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
455 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
456 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
457 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
458 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
459 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
460 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
461 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
462 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
463 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
464 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
465 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
466 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
467 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
468 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
469 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
470 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
471 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
472 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
473 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
474 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
475 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
476 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
477 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
478 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
479 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
480 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
481 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
482 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
483 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
484 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
485 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
486 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
487 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
488 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
489 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
490 2643221651 Afipia sp. Root123D2 Isolate Unclassified
491 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
492 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
493 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
494 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
495 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
496 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
497 2791355199
498 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
499 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
500 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
501 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
502 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
503 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
504 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
505 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
506 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
507 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
508 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
509 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
510 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
511 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
512 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
513 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
514 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
515 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
516 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
517 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
518 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
519 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
520 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
521 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
522 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
523 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
524 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
525 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
526 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
527 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
528 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
529 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
530 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
531 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
532 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
533 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
534 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
535 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
536 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
537 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
538 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
539 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
540 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
541 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
542 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
543 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
544 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
545 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
546 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
547 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
548 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
549 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
550 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
551 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
552 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
553 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
554 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
555 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
556 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
557 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
558 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
559 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
560 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
561 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
562 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
563 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
564 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
565 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
566 2904699407
567 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
568 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
569 2906610324
570 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
571 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
572 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
573 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
574 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
575 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
576 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
577 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
578 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
579 2922368715
580 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
581 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
582 2922425934
583 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
584 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
585 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
586 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
587 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
588 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
589 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
590 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
591 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
592 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
593 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
594 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
595 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
596 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
597 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
598 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
599 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
600 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
601 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
602 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
603 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
604 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
605 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
606 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
607 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
608 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
609 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
610 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
611 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
612 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
613 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
614 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
615 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
616 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
617 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
618 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
619 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
620 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
621 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
622 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
623 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
624 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
625 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
626 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
627 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
628 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
629 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
630 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
631 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
632 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
633 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
634 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
635 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
636 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
637 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
638 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
639 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
640 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
641 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
642 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
643 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
644 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
645 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
646 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
647 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
648 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
649 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
650 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
651 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
652 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
653 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
654 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
655 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
656 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
657 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
658 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
659 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
660 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
661 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
662 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
663 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
664 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
665 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
666 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
667 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
668 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
669 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
670 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
671 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
672 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
673 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
674 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
675 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
676 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
677 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
678 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
679 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
680 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
681 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
682 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
683 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
684 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
685 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
686 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
687 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
688 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
689 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
690 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
691 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
692 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
693 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
694 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.06
Metatranscriptomes 0.14
Isolates 15.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.75
Nodule 12.58
Rhizoplane 6.53
Rhizosphere 57.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10017804 3300009093 Bacteria 9563
2 JGI24740J21852_10010307 3300001979 Bacteria 3609
3 JGI24739J22299_10060499 3300001989 Bacteria 1198
4 JGI25406J46586_10000118 3300003203 Bacteria 34503
5 JGI25153J46596_10002224 3300003215 Bacteria 11324
6 JGI25153J46596_10006933 3300003215 Bacteria 5650
7 JGI25153J46596_10007072 3300003215 Bacteria 5576
8 JGI25153J46596_10024593 3300003215 Bacteria 2169
9 rootH2_10188699 3300003320 Bacteria 1166
10 JGI25404J52841_10002320 3300003659 Bacteria 3581
11 Ga0055524_1016148 3300003775 Bacteria 2691
12 Ga0055531_10009477 3300003794 Bacteria 4971
13 Ga0065165_1002792 3300005262 Bacteria 13765
14 Ga0065165_1003284 3300005262 Bacteria 11658
15 Ga0065165_1021603 3300005262 Bacteria 2230
16 Ga0070658_10114808 3300005327 Bacteria 2233
17 Ga0070658_10212017 3300005327 Bacteria 1636
18 Ga0070683_100048202 3300005329 Bacteria 3938
19 Ga0070683_100074217 3300005329 Bacteria 3176
20 Ga0070670_100041202 3300005331 Bacteria 3969
21 Ga0068869_100087480 3300005334 Bacteria 2337
22 Ga0070680_100081738 3300005336 Bacteria 2666
23 Ga0070680_100186943 3300005336 Bacteria 1745
24 Ga0070680_100456634 3300005336 Bacteria 1091
25 Ga0070682_100073402 3300005337 Bacteria 2195
26 Ga0068868_100005183 3300005338 Bacteria 9148
27 Ga0068868_100017996 3300005338 Bacteria 5274
28 Ga0068868_100059948 3300005338 Bacteria 3012
29 Ga0068868_100326312 3300005338 Bacteria 1309
30 Ga0070660_100030247 3300005339 Bacteria 4062
31 Ga0070689_100330612 3300005340 Bacteria 1275
32 Ga0070661_100154164 3300005344 Bacteria 1738
33 Ga0070661_100210998 3300005344 Bacteria 1486
34 Ga0070668_100020491 3300005347 Bacteria 4991
35 Ga0070668_100046605 3300005347 Bacteria 3329
36 Ga0070668_100081859 3300005347 Bacteria 2531
37 Ga0070668_100154139 3300005347 Bacteria 1860
38 Ga0070671_100101143 3300005355 Bacteria 2418
39 Ga0070674_100060947 3300005356 Bacteria 2631
40 Ga0070674_100229679 3300005356 Bacteria 1447
41 Ga0070667_100225702 3300005367 Bacteria 1668
42 Ga0070709_10000796 3300005434 Bacteria 17649
43 Ga0070709_10001261 3300005434 Bacteria 13852
44 Ga0070709_10007358 3300005434 Bacteria 6032
45 Ga0070709_10010265 3300005434 Bacteria 5177
46 Ga0070709_10042951 3300005434 Bacteria 2794
47 Ga0070709_10129874 3300005434 Bacteria 1719
48 Ga0070714_100028362 3300005435 Bacteria 4644
49 Ga0070714_100131457 3300005435 Bacteria 2237
50 Ga0070713_100004513 3300005436 Bacteria 9368
51 Ga0070713_100024796 3300005436 Bacteria 4680
52 Ga0070713_100114641 3300005436 Bacteria 2355
53 Ga0070713_100114913 3300005436 Bacteria 2352
54 Ga0070713_100155528 3300005436 Bacteria 2038
55 Ga0070710_10000991 3300005437 Bacteria 13505
56 Ga0070710_10010597 3300005437 Bacteria 4531
57 Ga0070711_100005239 3300005439 Bacteria 7737
58 Ga0070711_100006676 3300005439 Bacteria 6977
59 Ga0070711_100008277 3300005439 Bacteria 6363
60 Ga0070711_100315304 3300005439 Bacteria 1247
61 Ga0070705_100137382 3300005440 Bacteria 1604
62 Ga0070700_100032431 3300005441 Bacteria 3139
63 Ga0070694_100279741 3300005444 Bacteria 1272
64 Ga0070663_100021710 3300005455 Bacteria 4276
65 Ga0070663_100027837 3300005455 Bacteria 3842
66 Ga0070663_100043121 3300005455 Bacteria 3173
67 Ga0070663_100123124 3300005455 Bacteria 1961
68 Ga0070678_100065174 3300005456 Bacteria 2703
69 Ga0070678_100084703 3300005456 Bacteria 2414
70 Ga0070678_100099892 3300005456 Bacteria 2246
71 Ga0070662_100195353 3300005457 Bacteria 1602
72 Ga0070681_10062271 3300005458 Bacteria 3704
73 Ga0070681_10163471 3300005458 Bacteria 2149
74 Ga0068867_100107078 3300005459 Bacteria 2142
75 Ga0070706_100089246 3300005467 Bacteria 2858
76 Ga0070698_100403197 3300005471 Bacteria 1301
77 Ga0070699_100227522 3300005518 Bacteria 1663
78 Ga0070679_100034610 3300005530 Bacteria 5006
79 Ga0070679_100047353 3300005530 Bacteria 4285
80 Ga0070679_100324799 3300005530 Bacteria 1488
81 Ga0070684_100008848 3300005535 Bacteria 7895
82 Ga0070684_100071224 3300005535 Bacteria 3060
83 Ga0068853_100007083 3300005539 Bacteria 8970
84 Ga0068853_100007085 3300005539 Bacteria 8969
85 Ga0068853_100032710 3300005539 Bacteria 4408
86 Ga0070696_100094591 3300005546 Bacteria 2133
87 Ga0070665_100007326 3300005548 Bacteria 11223
88 Ga0070665_100016280 3300005548 Bacteria 7461
89 Ga0070665_100021701 3300005548 Bacteria 6457
90 Ga0070665_100050261 3300005548 Bacteria 4183
91 Ga0070665_100057391 3300005548 Bacteria 3902
92 Ga0070665_100084638 3300005548 Bacteria 3176
93 Ga0070665_100137569 3300005548 Bacteria 2445
94 Ga0070665_100240889 3300005548 Bacteria 1809
95 Ga0070665_100347802 3300005548 Bacteria 1488
96 Ga0068855_100235778 3300005563 Bacteria 2046
97 Ga0068855_100299148 3300005563 Bacteria 1782
98 Ga0070664_100016211 3300005564 Bacteria 6108
99 Ga0070664_100156175 3300005564 Bacteria 2016
100 Ga0068857_100021428 3300005577 Bacteria 5689
101 Ga0068857_100113770 3300005577 Bacteria 2433
102 Ga0068857_100126040 3300005577 Bacteria 2307
103 Ga0068854_100009851 3300005578 Bacteria 6181
104 Ga0068854_100041116 3300005578 Bacteria 3265
105 Ga0068856_100000522 3300005614 Bacteria 42457
106 Ga0068856_100010527 3300005614 Bacteria 8980
107 Ga0068856_100030658 3300005614 Bacteria 5257
108 Ga0070702_100055555 3300005615 Bacteria 2283
109 Ga0068852_100020416 3300005616 Bacteria 5269
110 Ga0068852_100067275 3300005616 Bacteria 3132
111 Ga0068852_100341945 3300005616 Bacteria 1459
112 Ga0068859_100304741 3300005617 Bacteria 1686
113 Ga0068859_100643876 3300005617 Bacteria 1152
114 Ga0068864_100313875 3300005618 Bacteria 1470
115 Ga0068861_100088531 3300005719 Bacteria 2438
116 Ga0068851_10047299 3300005834 Bacteria 2178
117 Ga0068858_100127907 3300005842 Bacteria 2380
118 Ga0068860_100000441 3300005843 Bacteria 52446
119 Ga0068860_100155651 3300005843 Bacteria 2202
120 Ga0068862_100156535 3300005844 Bacteria 2031
121 Ga0068862_100215740 3300005844 Bacteria 1735
122 Ga0068862_100220550 3300005844 Bacteria 1717
123 Ga0081455_10000715 3300005937 Bacteria 43119
124 Ga0081455_10000774 3300005937 Bacteria 41248
125 Ga0081455_10003833 3300005937 Bacteria 17148
126 Ga0081455_10013479 3300005937 Bacteria 8073
127 Ga0081455_10028784 3300005937 Bacteria 5072
128 Ga0081455_10049450 3300005937 Bacteria 3625
129 Ga0081538_10029587 3300005981 Bacteria 3738
130 Ga0081538_10066454 3300005981 Bacteria 2022
131 Ga0081540_1002251 3300005983 Bacteria 15895
132 Ga0081540_1002343 3300005983 Bacteria 15504
133 Ga0081540_1003941 3300005983 Bacteria 11537
134 Ga0081540_1005884 3300005983 Bacteria 9064
135 Ga0081540_1014466 3300005983 Bacteria 5053
136 Ga0081540_1016536 3300005983 Bacteria 4609
137 Ga0081540_1022699 3300005983 Bacteria 3699
138 Ga0081540_1025221 3300005983 Bacteria 3428
139 Ga0081540_1026177 3300005983 Bacteria 3337
140 Ga0081540_1035117 3300005983 Bacteria 2693
141 Ga0081540_1065365 3300005983 Bacteria 1711
142 Ga0081540_1075776 3300005983 Bacteria 1536
143 Ga0081539_10000425 3300005985 Bacteria 89942
144 Ga0081539_10001114 3300005985 Bacteria 48756
145 Ga0081539_10053002 3300005985 Bacteria 2274
146 Ga0081539_10099924 3300005985 Bacteria 1481
147 Ga0081539_10109976 3300005985 Bacteria 1389
148 Ga0070717_10000325 3300006028 Bacteria 31034
149 Ga0070717_10084579 3300006028 Bacteria 2669
150 Ga0075365_10011659 3300006038 Bacteria 5179
151 Ga0075365_10026252 3300006038 Bacteria 3695
152 Ga0075365_10033426 3300006038 Bacteria 3314
153 Ga0075365_10040469 3300006038 Bacteria 3039
154 Ga0075365_10060412 3300006038 Bacteria 2529
155 Ga0075368_10007800 3300006042 Bacteria 3792
156 Ga0075368_10008135 3300006042 Bacteria 3723
157 Ga0075368_10012725 3300006042 Bacteria 3082
158 Ga0075368_10049183 3300006042 Bacteria 1672
159 Ga0075363_100001726 3300006048 Bacteria 8492
160 Ga0075363_100017481 3300006048 Bacteria 3557
161 Ga0075363_100088419 3300006048 Bacteria 1703
162 Ga0075363_100122224 3300006048 Bacteria 1455
163 Ga0075363_100176997 3300006048 Bacteria 1212
164 Ga0075364_10007861 3300006051 Bacteria 6347
165 Ga0075364_10010966 3300006051 Bacteria 5495
166 Ga0075364_10022059 3300006051 Bacteria 4018
167 Ga0075364_10043166 3300006051 Bacteria 2931
168 Ga0075432_10058339 3300006058 Bacteria 1371
169 Ga0070715_10000561 3300006163 Bacteria 9783
170 Ga0070715_10025862 3300006163 Bacteria 2329
171 Ga0070715_10103424 3300006163 Bacteria 1332
172 Ga0070716_100001763 3300006173 Bacteria 9784
173 Ga0070716_100171349 3300006173 Bacteria 1416
174 Ga0070712_100044490 3300006175 Bacteria 3062
175 Ga0070712_100167104 3300006175 Bacteria 1704
176 Ga0070712_100284740 3300006175 Bacteria 1332
177 Ga0075367_10040235 3300006178 Bacteria 2729
178 Ga0075367_10059339 3300006178 Bacteria 2278
179 Ga0075367_10075447 3300006178 Bacteria 2034
180 Ga0075367_10077676 3300006178 Bacteria 2004
181 Ga0075369_10002297 3300006186 Bacteria 6796
182 Ga0075369_10026891 3300006186 Bacteria 2401
183 Ga0075366_10006775 3300006195 Bacteria 6295
184 Ga0075366_10018597 3300006195 Bacteria 4013
185 Ga0075366_10035098 3300006195 Bacteria 2956
186 Ga0097621_100141141 3300006237 Bacteria 2058
187 Ga0097621_100375741 3300006237 Bacteria 1269
188 Ga0097621_100453462 3300006237 Bacteria 1156
189 Ga0075370_10017731 3300006353 Bacteria 3850
190 Ga0075370_10047609 3300006353 Bacteria 2428
191 Ga0075370_10047964 3300006353 Bacteria 2419
192 Ga0075370_10080144 3300006353 Bacteria 1876
193 Ga0068871_100113220 3300006358 Bacteria 2285
194 Ga0075428_100023204 3300006844 Bacteria 6862
195 Ga0075430_100382451 3300006846 Bacteria 1161
196 Ga0075431_100029253 3300006847 Bacteria 5669
197 Ga0075434_100020473 3300006871 Bacteria 6418
198 Ga0075434_100050474 3300006871 Bacteria 4133
199 Ga0075434_100074720 3300006871 Bacteria 3382
200 Ga0075434_100084478 3300006871 Bacteria 3173
201 Ga0068865_100150267 3300006881 Bacteria 1766
202 Ga0075436_100096406 3300006914 Bacteria 2058
203 Ga0097620_100304731 3300006931 Bacteria 1686
204 Ga0097620_100643933 3300006931 Bacteria 1152
205 Ga0099825_1019128 3300006941 Bacteria 5158
206 Ga0099824_1005278 3300006942 Bacteria 18259
207 Ga0099824_1017855 3300006942 Bacteria 6007
208 Ga0099822_1013722 3300006943 Bacteria 9448
209 Ga0099794_10009088 3300007265 Bacteria 4156
210 Ga0099795_10000836 3300007788 Bacteria 6125
211 Ga0099795_10024305 3300007788 Bacteria 2020
212 Ga0099795_10034455 3300007788 Bacteria 1764
213 Ga0105240_10002968 3300009093 Bacteria 26700
214 Ga0105240_10021771 3300009093 Bacteria 8518
215 Ga0105240_10033109 3300009093 Bacteria 6682
216 Ga0105240_10076367 3300009093 Bacteria 4130
217 Ga0105240_10146029 3300009093 Bacteria 2822
218 Ga0105240_10463304 3300009093 Bacteria 1416
219 Ga0105240_10477187 3300009093 Bacteria 1391
220 Ga0105240_10547751 3300009093 Bacteria 1280
221 Ga0105240_10644663 3300009093 Bacteria 1162
222 Ga0111539_10333654 3300009094 Bacteria 1765
223 Ga0105245_10011836 3300009098 Bacteria 7588
224 Ga0105245_10024933 3300009098 Bacteria 5256
225 Ga0105245_10030674 3300009098 Bacteria 4755
226 Ga0105245_10551186 3300009098 Bacteria 1175
227 Ga0105247_10135573 3300009101 Bacteria 1608
228 Ga0114129_10196005 3300009147 Bacteria 2739
229 Ga0114129_10228379 3300009147 Bacteria 2508
230 Ga0105243_10328556 3300009148 Bacteria 1396
231 Ga0105243_10424563 3300009148 Bacteria 1241
232 Ga0105241_10001388 3300009174 Bacteria 18512
233 Ga0105241_10016444 3300009174 Bacteria 5427
234 Ga0105241_10227892 3300009174 Bacteria 1570
235 Ga0105242_10179201 3300009176 Bacteria 1868
236 Ga0105248_10044195 3300009177 Bacteria 4996
237 Ga0105248_10073680 3300009177 Bacteria 3837
238 Ga0105248_10161310 3300009177 Bacteria 2529
239 Ga0105248_10264975 3300009177 Bacteria 1934
240 Ga0105248_10459244 3300009177 Bacteria 1436
241 Ga0105237_10009401 3300009545 Bacteria 10469
242 Ga0105237_10018051 3300009545 Bacteria 7307
243 Ga0105237_10019256 3300009545 Bacteria 7050
244 Ga0105237_10029341 3300009545 Bacteria 5593
245 Ga0105237_10063125 3300009545 Bacteria 3702
246 Ga0105237_10081504 3300009545 Bacteria 3227
247 Ga0105237_10117726 3300009545 Bacteria 2650
248 Ga0105237_10121493 3300009545 Bacteria 2606
249 Ga0105237_10219525 3300009545 Bacteria 1901
250 Ga0105237_10279682 3300009545 Bacteria 1671
251 Ga0105237_10302610 3300009545 Bacteria 1602
252 Ga0105237_10330910 3300009545 Bacteria 1527
253 Ga0105238_10007201 3300009551 Bacteria 11135
254 Ga0105238_10025146 3300009551 Bacteria 6068
255 Ga0105238_10028995 3300009551 Bacteria 5638
256 Ga0105238_10066871 3300009551 Bacteria 3595
257 Ga0105238_10083975 3300009551 Bacteria 3174
258 Ga0105238_10134821 3300009551 Bacteria 2447
259 Ga0105238_10140056 3300009551 Bacteria 2396
260 Ga0105249_10161283 3300009553 Bacteria 2167
261 Ga0099796_10000143 3300010159 Bacteria 10566
262 Ga0099796_10014081 3300010159 Bacteria 2301
263 Ga0099796_10049573 3300010159 Bacteria 1452
264 Ga0105239_10026237 3300010375 Bacteria 6414
265 Ga0105239_10054242 3300010375 Bacteria 4396
266 Ga0105239_10075076 3300010375 Bacteria 3717
267 Ga0105239_10108752 3300010375 Bacteria 3072
268 Ga0105239_10129571 3300010375 Bacteria 2805
269 Ga0105239_10132265 3300010375 Bacteria 2776
270 Ga0105239_10666468 3300010375 Bacteria 1189
271 Ga0105239_10745374 3300010375 Bacteria 1121
272 Ga0105246_10024946 3300011119 Bacteria 3893
273 Ga0157371_10231668 3300013102 Bacteria 1327
274 Ga0157370_10120699 3300013104 Bacteria 2447
275 Ga0157370_10140019 3300013104 Bacteria 2254
276 Ga0157369_10011069 3300013105 Bacteria 10263
277 Ga0157369_10022494 3300013105 Bacteria 7032
278 Ga0157369_10085496 3300013105 Bacteria 3370
279 Ga0157374_10025945 3300013296 Bacteria 5268
280 Ga0157374_10348201 3300013296 Bacteria 1472
281 Ga0157378_10019128 3300013297 Bacteria 6017
282 Ga0157378_10085139 3300013297 Bacteria 2864
283 Ga0163162_10020858 3300013306 Bacteria 6443
284 Ga0157372_10050306 3300013307 Bacteria 4636
285 Ga0157372_10680296 3300013307 Bacteria 1198
286 Ga0157375_10016660 3300013308 Bacteria 6610
287 Ga0163163_10063284 3300014325 Bacteria 3667
288 Ga0163163_10067838 3300014325 Bacteria 3548
289 Ga0163163_10069545 3300014325 Bacteria 3505
290 Ga0163163_10110804 3300014325 Bacteria 2773
291 Ga0163163_10115145 3300014325 Bacteria 2720
292 Ga0163163_10196568 3300014325 Bacteria 2065
293 Ga0157380_10212424 3300014326 Bacteria 1725
294 Ga0157377_10133442 3300014745 Bacteria 1519
295 Ga0157379_10012889 3300014968 Bacteria 7313
296 Ga0157379_10095943 3300014968 Bacteria 2661
297 Ga0157379_10129426 3300014968 Bacteria 2271
298 Ga0157379_10263968 3300014968 Bacteria 1565
299 Ga0157376_10008369 3300014969 Bacteria 7461
300 Ga0157376_10175361 3300014969 Bacteria 1955
301 Ga0163161_10113270 3300017792 Bacteria 2030
302 Ga0206353_10807201 3300020082 Bacteria 2646
303 Ga0214544_1000011 3300021320 Bacteria 262952
304 Ga0214542_1000009 3300021321 Bacteria 262861
305 Ga0214545_1000007 3300021324 Bacteria 262984
306 Ga0214543_1000020 3300021327 Bacteria 262861
307 Ga0213876_10008681 3300021384 Bacteria 5497
308 Ga0209563_103763 3300025230 Bacteria 3051
309 Ga0207425_1007458 3300025245 Bacteria 2883
310 Ga0209677_103733 3300025253 Bacteria 4760
311 Ga0209148_1000316 3300025254 Bacteria 68104
312 Ga0209148_1007100 3300025254 Bacteria 2356
313 Ga0209233_1016979 3300025261 Bacteria 1992
314 Ga0209455_1006070 3300025272 Bacteria 3631
315 Ga0209564_1000407 3300025295 Bacteria 76572
316 Ga0209564_1002075 3300025295 Bacteria 17222
317 Ga0209564_1005161 3300025295 Bacteria 7581
318 Ga0209564_1023569 3300025295 Bacteria 2132
319 Ga0209758_1000106 3300025297 Bacteria 218450
320 Ga0209758_1001012 3300025297 Bacteria 37211
321 Ga0209758_1001683 3300025297 Bacteria 24919
322 Ga0209758_1002332 3300025297 Bacteria 19594
323 Ga0209758_1002396 3300025297 Bacteria 19259
324 Ga0209758_1003816 3300025297 Bacteria 13250
325 Ga0209758_1007915 3300025297 Bacteria 7053
326 Ga0209758_1014959 3300025297 Bacteria 4065
327 Ga0209758_1029030 3300025297 Bacteria 2324
328 Ga0209758_1037061 3300025297 Bacteria 1891
329 Ga0209256_1002946 3300025299 Bacteria 12776
330 Ga0207426_1000374 3300025302 Bacteria 78498
331 Ga0207426_1001007 3300025302 Bacteria 27365
332 Ga0207426_1004033 3300025302 Bacteria 7438
333 Ga0209257_1001741 3300025304 Bacteria 24170
334 Ga0207692_10005299 3300025898 Bacteria 5157
335 Ga0207710_10086053 3300025900 Bacteria 1464
336 Ga0207688_10204097 3300025901 Bacteria 1186
337 Ga0207680_10221195 3300025903 Bacteria 1298
338 Ga0207647_10000972 3300025904 Bacteria 22175
339 Ga0207685_10018879 3300025905 Bacteria 2261
340 Ga0207685_10023611 3300025905 Bacteria 2096
341 Ga0207685_10077029 3300025905 Bacteria 1369
342 Ga0207699_10000363 3300025906 Bacteria 24040
343 Ga0207699_10002914 3300025906 Bacteria 8131
344 Ga0207699_10041739 3300025906 Bacteria 2652
345 Ga0207699_10082273 3300025906 Bacteria 2000
346 Ga0207645_10182413 3300025907 Bacteria 1377
347 Ga0207645_10192206 3300025907 Bacteria 1342
348 Ga0207645_10265271 3300025907 Bacteria 1138
349 Ga0207705_10033327 3300025909 Bacteria 3679
350 Ga0207705_10075543 3300025909 Bacteria 2447
351 Ga0207705_10194066 3300025909 Bacteria 1536
352 Ga0207684_10174378 3300025910 Bacteria 1854
353 Ga0207654_10000729 3300025911 Bacteria 18348
354 Ga0207654_10028175 3300025911 Bacteria 3061
355 Ga0207654_10030934 3300025911 Bacteria 2944
356 Ga0207654_10061268 3300025911 Bacteria 2201
357 Ga0207707_10000541 3300025912 Bacteria 38481
358 Ga0207707_10050125 3300025912 Bacteria 3638
359 Ga0207695_10000478 3300025913 Bacteria 86076
360 Ga0207695_10004497 3300025913 Bacteria 18978
361 Ga0207695_10017775 3300025913 Bacteria 8252
362 Ga0207695_10024109 3300025913 Bacteria 6854
363 Ga0207695_10191850 3300025913 Bacteria 1961
364 Ga0207671_10003084 3300025914 Bacteria 17008
365 Ga0207671_10133861 3300025914 Bacteria 1905
366 Ga0207671_10151954 3300025914 Bacteria 1789
367 Ga0207671_10184623 3300025914 Bacteria 1624
368 Ga0207693_10005512 3300025915 Bacteria 10533
369 Ga0207693_10008188 3300025915 Bacteria 8565
370 Ga0207693_10008624 3300025915 Bacteria 8342
371 Ga0207693_10020448 3300025915 Bacteria 5266
372 Ga0207693_10024640 3300025915 Bacteria 4772
373 Ga0207693_10076040 3300025915 Bacteria 2630
374 Ga0207663_10000425 3300025916 Bacteria 18308
375 Ga0207663_10031078 3300025916 Bacteria 3156
376 Ga0207663_10038050 3300025916 Bacteria 2905
377 Ga0207663_10069893 3300025916 Bacteria 2260
378 Ga0207660_10009028 3300025917 Bacteria 6454
379 Ga0207660_10210524 3300025917 Bacteria 1522
380 Ga0207657_10002950 3300025919 Bacteria 18254
381 Ga0207657_10014763 3300025919 Bacteria 7605
382 Ga0207657_10029326 3300025919 Bacteria 5010
383 Ga0207657_10080145 3300025919 Bacteria 2745
384 Ga0207649_10251963 3300025920 Bacteria 1272
385 Ga0207652_10007298 3300025921 Bacteria 8902
386 Ga0207652_10205326 3300025921 Bacteria 1773
387 Ga0207694_10000849 3300025924 Bacteria 27168
388 Ga0207694_10009743 3300025924 Bacteria 7248
389 Ga0207694_10049921 3300025924 Bacteria 3239
390 Ga0207694_10103254 3300025924 Bacteria 2260
391 Ga0207687_10106472 3300025927 Bacteria 2073
392 Ga0207687_10125264 3300025927 Bacteria 1928
393 Ga0207700_10008743 3300025928 Bacteria 6290
394 Ga0207700_10021069 3300025928 Bacteria 4443
395 Ga0207700_10077617 3300025928 Bacteria 2581
396 Ga0207700_10085514 3300025928 Bacteria 2476
397 Ga0207700_10095006 3300025928 Bacteria 2364
398 Ga0207700_10135559 3300025928 Bacteria 2016
399 Ga0207664_10006763 3300025929 Bacteria 7918
400 Ga0207664_10111058 3300025929 Bacteria 2280
401 Ga0207664_10209590 3300025929 Bacteria 1686
402 Ga0207644_10197868 3300025931 Bacteria 1584
403 Ga0207706_10033954 3300025933 Bacteria 4541
404 Ga0207706_10410092 3300025933 Bacteria 1174
405 Ga0207686_10040719 3300025934 Bacteria 2827
406 Ga0207709_10256227 3300025935 Bacteria 1281
407 Ga0207669_10240701 3300025937 Bacteria 1341
408 Ga0207669_10339047 3300025937 Bacteria 1157
409 Ga0207665_10003367 3300025939 Bacteria 10702
410 Ga0207665_10008013 3300025939 Bacteria 6969
411 Ga0207665_10009754 3300025939 Bacteria 6304
412 Ga0207665_10055096 3300025939 Bacteria 2682
413 Ga0207665_10186442 3300025939 Bacteria 1505
414 Ga0207665_10270161 3300025939 Bacteria 1262
415 Ga0207665_10275786 3300025939 Bacteria 1250
416 Ga0207691_10323914 3300025940 Bacteria 1321
417 Ga0207711_10061206 3300025941 Bacteria 3246
418 Ga0207689_10047666 3300025942 Bacteria 3536
419 Ga0207689_10073080 3300025942 Bacteria 2817
420 Ga0207689_10103200 3300025942 Bacteria 2343
421 Ga0207689_10343547 3300025942 Bacteria 1240
422 Ga0207661_10000109 3300025944 Bacteria 52179
423 Ga0207661_10029282 3300025944 Bacteria 4227
424 Ga0207661_10035452 3300025944 Bacteria 3888
425 Ga0207667_10003413 3300025949 Bacteria 19620
426 Ga0207667_10090006 3300025949 Bacteria 3171
427 Ga0207667_10139182 3300025949 Bacteria 2499
428 Ga0207667_10148280 3300025949 Bacteria 2415
429 Ga0207667_10193729 3300025949 Bacteria 2085
430 Ga0207651_10229428 3300025960 Bacteria 1506
431 Ga0207712_10162993 3300025961 Bacteria 1735
432 Ga0207668_10067563 3300025972 Bacteria 2538
433 Ga0207668_10070947 3300025972 Bacteria 2486
434 Ga0207668_10354060 3300025972 Bacteria 1228
435 Ga0207668_10442358 3300025972 Bacteria 1107
436 Ga0207640_10039426 3300025981 Bacteria 2990
437 Ga0207640_10101239 3300025981 Bacteria 2021
438 Ga0207640_10206678 3300025981 Bacteria 1492
439 Ga0207640_10272708 3300025981 Bacteria 1324
440 Ga0207658_10150905 3300025986 Bacteria 1893
441 Ga0207658_10280329 3300025986 Bacteria 1428
442 Ga0207677_10003182 3300026023 Bacteria 8665
443 Ga0207677_10008230 3300026023 Bacteria 5812
444 Ga0207677_10011875 3300026023 Bacteria 4984
445 Ga0207677_10023110 3300026023 Bacteria 3834
446 Ga0207677_10453452 3300026023 Bacteria 1099
447 Ga0207639_10025543 3300026041 Bacteria 4283
448 Ga0207639_10188415 3300026041 Bacteria 1760
449 Ga0207639_10418632 3300026041 Bacteria 1211
450 Ga0207678_10006080 3300026067 Bacteria 10738
451 Ga0207678_10025278 3300026067 Bacteria 5185
452 Ga0207678_10035705 3300026067 Bacteria 4328
453 Ga0207678_10045068 3300026067 Bacteria 3813
454 Ga0207678_10106641 3300026067 Bacteria 2390
455 Ga0207708_10117190 3300026075 Bacteria 2072
456 Ga0207702_10000003 3300026078 Bacteria 434196
457 Ga0207702_10000014 3300026078 Bacteria 253304
458 Ga0207702_10059058 3300026078 Bacteria 3266
459 Ga0207702_10108328 3300026078 Bacteria 2465
460 Ga0207641_10519200 3300026088 Bacteria 1158
461 Ga0207648_10011805 3300026089 Bacteria 8209
462 Ga0207648_10074325 3300026089 Bacteria 2962
463 Ga0207676_10104985 3300026095 Bacteria 2351
464 Ga0207674_10029977 3300026116 Bacteria 5723
465 Ga0207674_10033474 3300026116 Bacteria 5380
466 Ga0207674_10033728 3300026116 Bacteria 5358
467 Ga0207674_10064316 3300026116 Bacteria 3700
468 Ga0207675_100049152 3300026118 Bacteria 3937
469 Ga0207675_100067188 3300026118 Bacteria 3351
470 Ga0207683_10085838 3300026121 Bacteria 2798
471 Ga0207683_10102982 3300026121 Bacteria 2549
472 Ga0207683_10156685 3300026121 Bacteria 2057
473 Ga0207683_10186779 3300026121 Bacteria 1881
474 Ga0207698_10042042 3300026142 Bacteria 3411
475 Ga0207698_10274298 3300026142 Bacteria 1556
476 Ga0207698_10340597 3300026142 Bacteria 1412
477 Ga0209389_1000016 3300027296 Bacteria 184844
478 Ga0209389_1000027 3300027296 Bacteria 146917
479 Ga0209589_1000005 3300027357 Bacteria 530958
480 Ga0209589_1000031 3300027357 Bacteria 147054
481 Ga0209489_100005 3300027361 Bacteria 530958
482 Ga0209489_100057 3300027361 Bacteria 147398
483 Ga0209489_100063 3300027361 Bacteria 144408
484 Ga0209700_100006 3300027363 Bacteria 530958
485 Ga0209700_100012 3300027363 Bacteria 357892
486 Ga0268266_10004891 3300028379 Bacteria 12707
487 Ga0268266_10013890 3300028379 Bacteria 6934
488 Ga0268266_10029751 3300028379 Bacteria 4640
489 Ga0268266_10150134 3300028379 Bacteria 2099
490 Ga0268266_10239949 3300028379 Bacteria 1672
491 Ga0268266_10251298 3300028379 Bacteria 1635
492 Ga0268265_10031565 3300028380 Bacteria 3826
493 Ga0268265_10204273 3300028380 Bacteria 1716
494 Ga0268265_10287455 3300028380 Bacteria 1474
495 Ga0268264_10000042 3300028381 Bacteria 372069
496 Ga0265337_1033706 3300028556 Bacteria 1510
497 Ga0265323_10004217 3300028653 Bacteria 6219
498 Ga0307517_10000176 3300028786 Bacteria 105402
499 Ga0307515_10170151 3300028794 Bacteria 2176
500 Ga0307515_10170492 3300028794 Bacteria 2172
501 Ga0307515_10320650 3300028794 Bacteria 1216
502 Ga0265338_10000018 3300028800 Bacteria 338910
503 Ga0307511_10109053 3300030521 Bacteria 1772
504 Ga0265330_10017820 3300031235 Bacteria 3267
505 Ga0265332_10009331 3300031238 Bacteria 4382
506 Ga0265325_10005802 3300031241 Bacteria 7568
507 Ga0265340_10001337 3300031247 Bacteria 14130
508 Ga0265340_10025601 3300031247 Bacteria 2987
509 Ga0265339_10000383 3300031249 Bacteria 34934
510 Ga0265331_10116621 3300031250 Bacteria 1222
511 Ga0307513_10198053 3300031456 Bacteria 1853
512 Ga0307508_10000029 3300031616 Bacteria 168411
513 Ga0307508_10094048 3300031616 Bacteria 2588
514 Ga0307508_10208833 3300031616 Bacteria 1553
515 Ga0265314_10006665 3300031711 Bacteria 10147
516 Ga0265314_10008159 3300031711 Bacteria 9012
517 Ga0265342_10005588 3300031712 Bacteria 9535
518 Ga0307516_10010558 3300031730 Bacteria 10139
519 Ga0307516_10052151 3300031730 Bacteria 4006
520 Ga0307516_10159510 3300031730 Bacteria 2007
521 Ga0307516_10334755 3300031730 Bacteria 1182
522 Ga0307405_10126650 3300031731 Bacteria 1757
523 Ga0307413_10027580 3300031824 Bacteria 3149
524 Ga0307518_10172468 3300031838 Bacteria 1473
525 Ga0307407_10204728 3300031903 Bacteria 1325
526 Ga0307412_10317466 3300031911 Bacteria 1238
527 Ga0307409_100111072 3300031995 Bacteria 2298
528 Ga0307414_10206054 3300032004 Bacteria 1604
529 Ga0307415_100059081 3300032126 Bacteria 2643
530 Ga0307415_100255756 3300032126 Bacteria 1426
531 Ga0307507_10018699 3300033179 Bacteria 7861
532 Ga0307510_10010093 3300033180 Bacteria 11228
533 Ga0307510_10016909 3300033180 Bacteria 8604
534 Ga0307510_10069235 3300033180 Bacteria 3536
535 Ga0307510_10082122 3300033180 Bacteria 3120
536 Ga0307510_10092093 3300033180 Bacteria 2870
537 Ga0307510_10287697 3300033180 Bacteria 1111
538 Ga0315911_1000005 3300033442 Bacteria 426255
539 Ga0316215_1002174 3300033544 Bacteria 1854
540 Ga0373934_0008533 3300035086 Bacteria 3819
541 Ga0373923_0000376 3300035111 Bacteria 10201
542 Ga0373936_0042953 3300035113 Bacteria 1816
543 Ga0373936_0045036 3300035113 Bacteria 1776
544 Ga0373945_0013564 3300035116 Bacteria 2721
545 Ga0373953_0000156 3300035117 Bacteria 17676
546 Ga0373953_0008171 3300035117 Bacteria 3542
547 Ga0373953_0123191 3300035117 Bacteria 1102
548 Ga0373954_0007578 3300035118 Bacteria 4751
549 Ga0373954_0020449 3300035118 Bacteria 2994
550 Ga0373956_0002378 3300035119 Bacteria 7686
551 Ga0373956_0103597 3300035119 Bacteria 1322
552 Ga0373957_0017078 3300035120 Bacteria 2521
553 Ga0373957_0063987 3300035120 Bacteria 1429
554 Ga0373943_0040115 3300035170 Bacteria 2259
555 Ga0373943_0101959 3300035170 Bacteria 1502
556 Ga0373943_0134726 3300035170 Bacteria 1325
557 Ga0373946_0043204 3300035171 Bacteria 1856
558 Ga0373955_0000395 3300035172 Bacteria 18509
559 Ga0373955_0013079 3300035172 Bacteria 4003
560 Ga0373955_0022863 3300035172 Bacteria 3177
561 Ga0373962_0044677 3300035242 Bacteria 1259
562 Ga0373924_0010939 3300035410 Bacteria 3359
563 Ga0373924_0013913 3300035410 Bacteria 3031
564 Ga0373924_0055242 3300035410 Bacteria 1652
565 Ga0373931_0018329 3300035691 Bacteria 3480
566 Ga0373935_0055538 3300035692 Bacteria 2523
567 Ga0373927_0002702 3300035695 Bacteria 12926
568 Ga0373927_0004819 3300035695 Bacteria 9380
569 Ga0373927_0005543 3300035695 Bacteria 8684
570 Ga0373927_0007994 3300035695 Bacteria 7144
571 Ga0373927_0017690 3300035695 Bacteria 4689
572 Ga0373927_0043246 3300035695 Bacteria 2917
573 Ga0373933_0001227 3300035724 Bacteria 15171
574 Ga0373933_0004820 3300035724 Bacteria 7373
575 Ga0373933_0075719 3300035724 Bacteria 2055
576 Ga0373933_0193597 3300035724 Bacteria 1299
577 Ga0373947_0003219 3300035725 Bacteria 9692
578 Ga0373947_0006770 3300035725 Bacteria 6647
579 Ga0373947_0044253 3300035725 Bacteria 2660
580 Ga0373947_0050934 3300035725 Bacteria 2490
581 Ga0373937_0053490 3300036401 Bacteria 3703
582 Ga0373937_0096791 3300036401 Bacteria 2737
583 Ga0373937_0128821 3300036401 Bacteria 2362
584 Ga0372808_002595 3300036459 Bacteria 2107
585 Ga0373925_0009475 3300037068 Bacteria 7089
586 Ga0373925_0042948 3300037068 Bacteria 3354
587 Ga0373925_0053938 3300037068 Bacteria 3006
588 Ga0373925_0055671 3300037068 Bacteria 2961
589 Ga0373925_0099706 3300037068 Bacteria 2231
590 Ga0395899_0076124 3300037312 Bacteria 2450
591 Ga0395900_0047842 3300037418 Bacteria 4405
592 Ga0395900_0102016 3300037418 Bacteria 2947
593 Ga0395900_0112435 3300037418 Bacteria 2796
594 Ga0395900_0216970 3300037418 Bacteria 1930
595 Ga0395900_0229693 3300037418 Bacteria 1866
596 Ga0395900_0272758 3300037418 Bacteria 1686
597 Ga0395898_0017601 3300037466 Bacteria 7294
598 Ga0395898_0028587 3300037466 Bacteria 5587
599 Ga0395898_0088505 3300037466 Bacteria 2981
600 Ga0395898_0152606 3300037466 Bacteria 2210
601 Ga0395898_0195694 3300037466 Bacteria 1931
602 Ga0395905_0020329 3300037471 Bacteria 6289
603 Ga0395905_0046809 3300037471 Bacteria 4056
604 Ga0436364_0974159 3300037853 Bacteria 22406
605 Ga0395901_0008223 3300038443 Bacteria 10541
606 Ga0395901_0230018 3300038443 Bacteria 1936
607 Ga0395901_0248432 3300038443 Bacteria 1854
608 Ga0395901_0305113 3300038443 Bacteria 1650
609 Ga0436365_0902375 3300039437 Bacteria 4502
610 Ga0436365_1181574 3300039437 Bacteria 1670
611 Ga0436365_1371184 3300039437 Bacteria 10334
612 Ga0436365_1421230 3300039437 Bacteria 2143
613 Ga0436360_1202522 3300039438 Bacteria 1358
614 Ga0436361_0189402 3300039447 Bacteria 1894
615 Ga0436363_0012099 3300039450 Bacteria 11206
616 Ga0436363_0300253 3300039450 Bacteria 1244
617 Ga0436363_0351383 3300039450 Bacteria 1124
618 Ga0436363_0717611 3300039450 Bacteria 1331
619 Ga0436363_0972840 3300039450 Bacteria 1425
620 Ga0436362_0993687 3300039453 Bacteria 2478
621 Ga0439459_0027711 3300042438 Bacteria 1133
622 Ga0466972_0000177 3300044658 Bacteria 49318
623 Ga0466972_0009169 3300044658 Bacteria 4969
624 Ga0466965_0060131 3300044683 Bacteria 1897
625 Ga0466966_0008326 3300044684 Bacteria 6872
626 Ga0466966_0112238 3300044684 Bacteria 1680
627 Ga0466966_0127871 3300044684 Bacteria 1557
628 Ga0466961_0000023 3300044693 Bacteria 97134
629 Ga0466963_0139531 3300044694 Bacteria 1678
630 Ga0466963_0248798 3300044694 Bacteria 1247
631 Ga0466971_0050539 3300044719 Bacteria 1871
632 Ga0466968_0001025 3300044735 Bacteria 9854
633 Ga0466968_0063853 3300044735 Bacteria 1592
634 Ga0466957_0042855 3300044842 Bacteria 2739
635 Ga0466960_0039020 3300044901 Bacteria 2237
636 Ga0466959_0011640 3300045049 Bacteria 6326
637 Ga0466959_0030640 3300045049 Bacteria 3983
638 Ga0466967_0055936 3300045976 Bacteria 3477
639 Ga0466967_0121122 3300045976 Bacteria 2417
640 Ga0466967_0184510 3300045976 Bacteria 1969
641 Ga0466967_0235009 3300045976 Bacteria 1746
642 Ga0495617_022025 3300046452 Bacteria 2153
643 Ga0495617_044644 3300046452 Bacteria 1478
644 Ga0495592_0014358 3300046454 Bacteria 6013
645 Ga0495592_0030040 3300046454 Bacteria 4110
646 Ga0495592_0041543 3300046454 Bacteria 3446
647 Ga0495592_0064793 3300046454 Bacteria 2677
648 Ga0495603_0000521 3300046455 Bacteria 21337
649 Ga0495603_0001754 3300046455 Bacteria 12775
650 Ga0495603_0008860 3300046455 Bacteria 6082
651 Ga0495603_0025504 3300046455 Bacteria 3575
652 Ga0495603_0028412 3300046455 Bacteria 3373
653 Ga0495603_0029577 3300046455 Bacteria 3303
654 Ga0495603_0051688 3300046455 Bacteria 2441
655 Ga0495629_0000416 3300046459 Bacteria 35794
656 Ga0495629_0015774 3300046459 Bacteria 5425
657 Ga0495629_0027646 3300046459 Bacteria 4027
658 Ga0495629_0032989 3300046459 Bacteria 3664
659 Ga0495629_0252456 3300046459 Bacteria 1213
660 Ga0495638_0022170 3300046460 Bacteria 4171
661 Ga0495638_0038240 3300046460 Bacteria 3050
662 Ga0495638_0182674 3300046460 Bacteria 1195
663 Ga0495641_0002593 3300046461 Bacteria 14172
664 Ga0495641_0140642 3300046461 Bacteria 1078
665 Ga0495651_0017227 3300046462 Bacteria 5599
666 Ga0495651_0019582 3300046462 Bacteria 5248
667 Ga0495651_0080458 3300046462 Bacteria 2461
668 Ga0495653_0003573 3300046463 Bacteria 12536
669 Ga0495653_0023310 3300046463 Bacteria 5003
670 Ga0495653_0210320 3300046463 Bacteria 1314
671 Ga0495650_0039141 3300046471 Bacteria 2048
672 Ga0495580_0016728 3300046472 Bacteria 5504
673 Ga0495580_0039257 3300046472 Bacteria 3387
674 Ga0495580_0113133 3300046472 Bacteria 1885
675 Ga0495582_0002376 3300046473 Bacteria 10534
676 Ga0495582_0070470 3300046473 Bacteria 1934
677 Ga0495582_0080684 3300046473 Bacteria 1807
678 Ga0495605_0065220 3300046474 Bacteria 1732
679 Ga0495639_0001046 3300046475 Bacteria 12485
680 Ga0495639_0061572 3300046475 Bacteria 1721
681 Ga0495639_0096435 3300046475 Bacteria 1392
682 Ga0495662_0008728 3300046476 Bacteria 4984
683 Ga0495664_0009023 3300046477 Bacteria 5574
684 Ga0495664_0009265 3300046477 Bacteria 5505
685 Ga0495664_0050469 3300046477 Bacteria 2471
686 Ga0495664_0125425 3300046477 Bacteria 1553
687 Ga0495664_0126090 3300046477 Bacteria 1549
688 Ga0495584_0016300 3300046491 Bacteria 3790
689 Ga0495584_0080163 3300046491 Bacteria 1642
690 Ga0495585_0035154 3300046492 Bacteria 2833
691 Ga0495594_0000194 3300046499 Bacteria 29650
692 Ga0495594_0015448 3300046499 Bacteria 4011
693 Ga0495594_0074283 3300046499 Bacteria 1894
694 Ga0495596_0093615 3300046500 Bacteria 1166
695 Ga0495583_0028181 3300046506 Bacteria 2765
696 Ga0495583_0061572 3300046506 Bacteria 1674
697 Ga0495606_0002692 3300046507 Bacteria 20068
698 Ga0495606_0028857 3300046507 Bacteria 3906
699 Ga0495606_0212094 3300046507 Bacteria 1096
700 Ga0495608_0005104 3300046511 Bacteria 9377
701 Ga0495608_0031821 3300046511 Bacteria 3565
702 Ga0495608_0032235 3300046511 Bacteria 3542
703 Ga0495608_0032328 3300046511 Bacteria 3536
704 Ga0495608_0172333 3300046511 Bacteria 1372
705 Ga0495610_0027743 3300046512 Bacteria 3004
706 Ga0495610_0037091 3300046512 Bacteria 2484
707 Ga0495618_0049985 3300046514 Bacteria 2640
708 Ga0495618_0060411 3300046514 Bacteria 2403
709 Ga0495618_0075508 3300046514 Bacteria 2147
710 Ga0495620_0010396 3300046515 Bacteria 4912
711 Ga0495620_0033954 3300046515 Bacteria 2310
712 Ga0495628_0044263 3300046516 Bacteria 3542
713 Ga0495628_0058442 3300046516 Bacteria 3030
714 Ga0495628_0106350 3300046516 Bacteria 2161
715 Ga0495628_0321080 3300046516 Bacteria 1142
716 Ga0495630_0006451 3300046517 Bacteria 8344
717 Ga0495630_0097184 3300046517 Bacteria 2227
718 Ga0495630_0134827 3300046517 Bacteria 1876
719 Ga0495630_0333958 3300046517 Bacteria 1159
720 Ga0495632_0077742 3300046519 Bacteria 1586
721 Ga0495643_0076774 3300046522 Bacteria 1746
722 Ga0495643_0168421 3300046522 Bacteria 1073
723 Ga0495644_0012613 3300046523 Bacteria 3250
724 Ga0495644_0028145 3300046523 Bacteria 2127
725 Ga0495644_0052933 3300046523 Bacteria 1525
726 Ga0495648_0000640 3300046524 Bacteria 37287
727 Ga0495648_0004726 3300046524 Bacteria 11536
728 Ga0495648_0031996 3300046524 Bacteria 3458
729 Ga0495648_0093792 3300046524 Bacteria 1673
730 Ga0495648_0155220 3300046524 Bacteria 1189
731 Ga0495652_0010465 3300046529 Bacteria 8405
732 Ga0495652_0030338 3300046529 Bacteria 4743
733 Ga0495652_0046863 3300046529 Bacteria 3709
734 Ga0495652_0062849 3300046529 Bacteria 3128
735 Ga0495652_0075223 3300046529 Bacteria 2806
736 Ga0495652_0094913 3300046529 Bacteria 2432
737 Ga0495665_0028025 3300046531 Bacteria 3022
738 Ga0495640_0006591 3300046533 Bacteria 9166
739 Ga0495640_0011385 3300046533 Bacteria 6843
740 Ga0495640_0020972 3300046533 Bacteria 4803
741 Ga0495640_0030206 3300046533 Bacteria 3882
742 Ga0495586_0175358 3300046535 Bacteria 1212
743 Ga0495587_0010857 3300046536 Bacteria 5781
744 Ga0495587_0035814 3300046536 Bacteria 2988
745 Ga0495587_0082267 3300046536 Bacteria 1866
746 Ga0495598_0080814 3300046537 Bacteria 1042
747 Ga0495609_0024989 3300046538 Bacteria 2739
748 Ga0495621_0045917 3300046539 Bacteria 1548
749 Ga0495597_0089847 3300046542 Bacteria 1305
750 Ga0495645_0012719 3300046543 Bacteria 5938
751 Ga0495645_0012763 3300046543 Bacteria 5928
752 Ga0495622_0002024 3300046557 Bacteria 9908
753 Ga0495622_0060394 3300046557 Bacteria 1755
754 Ga0495633_0035962 3300046558 Bacteria 2375
755 Ga0495633_0036957 3300046558 Bacteria 2338
756 Ga0495667_0009312 3300046559 Bacteria 6655
757 Ga0495667_0020357 3300046559 Bacteria 4477
758 Ga0495667_0030759 3300046559 Bacteria 3607
759 Ga0495667_0114893 3300046559 Bacteria 1739
760 Ga0495667_0196348 3300046559 Bacteria 1292
761 Ga0495667_0256126 3300046559 Bacteria 1113
762 Ga0495656_0005884 3300046615 Bacteria 4266
763 Ga0495656_0014228 3300046615 Bacteria 2979
764 Ga0495656_0021610 3300046615 Bacteria 2507
765 Ga0495656_0038955 3300046615 Bacteria 1972
766 Ga0495668_0013742 3300046616 Bacteria 4764
767 Ga0495668_0091403 3300046616 Bacteria 1668
768 Ga0495668_0099536 3300046616 Bacteria 1590
769 Ga0495634_0000602 3300046642 Bacteria 34812
770 Ga0495634_0029561 3300046642 Bacteria 3793
771 Ga0495634_0031702 3300046642 Bacteria 3639
772 Ga0495625_0012900 3300046660 Bacteria 6751
773 Ga0495625_0068905 3300046660 Bacteria 2486
774 Ga0495635_0002469 3300046663 Bacteria 12625
775 Ga0495635_0003077 3300046663 Bacteria 11477
776 Ga0495635_0047928 3300046663 Bacteria 2945
777 Ga0495635_0116781 3300046663 Bacteria 1821
778 Ga0495635_0247729 3300046663 Bacteria 1201
779 Ga0495659_0025775 3300046664 Bacteria 2014
780 Ga0495661_0078336 3300046665 Bacteria 1912
781 Ga0495661_0108046 3300046665 Bacteria 1555
782 Ga0495588_0025303 3300046674 Bacteria 2956
783 Ga0495588_0037312 3300046674 Bacteria 2468
784 Ga0495588_0119203 3300046674 Bacteria 1391
785 Ga0495657_0004929 3300046675 Bacteria 10619
786 Ga0495657_0021231 3300046675 Bacteria 4660
787 Ga0495657_0026420 3300046675 Bacteria 4110
788 Ga0495657_0044079 3300046675 Bacteria 3037
789 Ga0495599_0006110 3300046678 Bacteria 7252
790 Ga0495599_0006329 3300046678 Bacteria 7136
791 Ga0495599_0011625 3300046678 Bacteria 5415
792 Ga0495623_0004956 3300046679 Bacteria 8733
793 Ga0495623_0011109 3300046679 Bacteria 5828
794 Ga0495623_0016712 3300046679 Bacteria 4740
795 Ga0495646_0048818 3300046680 Bacteria 2570
796 Ga0495646_0060074 3300046680 Bacteria 2268
797 Ga0495646_0076660 3300046680 Bacteria 1957
798 Ga0495646_0108652 3300046680 Bacteria 1581
799 Ga0495647_0000414 3300046681 Bacteria 12222
800 Ga0495658_0002719 3300046683 Bacteria 8895
801 Ga0495658_0028724 3300046683 Bacteria 3004
802 Ga0495658_0183068 3300046683 Bacteria 1300
803 Ga0495669_0044936 3300046684 Bacteria 1968
804 Ga0495613_0022972 3300046689 Bacteria 4647
805 Ga0495613_0033323 3300046689 Bacteria 3828
806 Ga0495613_0148239 3300046689 Bacteria 1674
807 Ga0495613_0188071 3300046689 Bacteria 1460
808 Ga0495613_0208217 3300046689 Bacteria 1376
809 Ga0495624_0003072 3300046690 Bacteria 12498
810 Ga0495624_0038315 3300046690 Bacteria 3080
811 Ga0495624_0068957 3300046690 Bacteria 2204
812 Ga0495670_0001065 3300046691 Bacteria 13316
813 Ga0495670_0043819 3300046691 Bacteria 2233
814 Ga0495671_0065512 3300046692 Bacteria 1788
815 Ga0495649_0026167 3300046694 Bacteria 3247
816 Ga0495649_0046915 3300046694 Bacteria 2351
817 Ga0495589_0022229 3300046794 Bacteria 3238
818 Ga0495600_0012415 3300046809 Bacteria 5326
819 Ga0495600_0012561 3300046809 Bacteria 5298
820 Ga0495600_0038915 3300046809 Bacteria 3096
821 Ga0495600_0081594 3300046809 Bacteria 2111
822 Ga0495581_0000133 3300047315 Bacteria 32384
823 Ga0495581_0132153 3300047315 Bacteria 1454
824 Ga0495581_0150227 3300047315 Bacteria 1360
825 Ga0495581_0202051 3300047315 Bacteria 1162
826 Ga0495581_0256787 3300047315 Bacteria 1022
827 Ga0495604_0013217 3300047317 Bacteria 6575
828 Ga0495604_0054319 3300047317 Bacteria 3091
829 Ga0495604_0089599 3300047317 Bacteria 2286
830 Ga0495674_0000874 3300047319 Bacteria 28828
831 Ga0495674_0012220 3300047319 Bacteria 8091
832 Ga0495674_0054204 3300047319 Bacteria 3522
833 Ga0495674_0317188 3300047319 Bacteria 1271
834 Ga0495672_0025641 3300047320 Bacteria 3768
835 Ga0495672_0035311 3300047320 Bacteria 3079
836 Ga0495676_0015692 3300047321 Bacteria 6736
837 Ga0495676_0064310 3300047321 Bacteria 2854
838 Ga0495676_0120501 3300047321 Bacteria 1909
839 Ga0495676_0134248 3300047321 Bacteria 1782
840 Ga0495680_0017277 3300047322 Bacteria 6164
841 Ga0495680_0053089 3300047322 Bacteria 3156
842 Ga0495680_0258365 3300047322 Bacteria 1232
843 Ga0495687_013529 3300047443 Bacteria 4253
844 Ga0495675_0001856 3300047444 Bacteria 12578
845 Ga0495675_0014102 3300047444 Bacteria 5052
846 Ga0495675_0014120 3300047444 Bacteria 5049
847 Ga0495673_0004092 3300047469 Bacteria 9261
848 Ga0495684_0000294 3300047471 Bacteria 40596
849 Ga0495684_0020080 3300047471 Bacteria 5146
850 Ga0495684_0025060 3300047471 Bacteria 4588
851 Ga0495684_0049052 3300047471 Bacteria 3227
852 Ga0495686_0180977 3300047472 Bacteria 1221
853 Ga0495593_0000022 3300047673 Bacteria 69741
854 Ga0495593_0000744 3300047673 Bacteria 18938
855 Ga0495593_0009120 3300047673 Bacteria 5754
856 Ga0495593_0016629 3300047673 Bacteria 4147
857 Ga0495593_0032757 3300047673 Bacteria 2832
858 Ga0495602_0030626 3300048088 Bacteria 5100
859 Ga0495602_0060623 3300048088 Bacteria 3295
860 Ga0495602_0156786 3300048088 Bacteria 1782
861 Ga0495602_0209035 3300048088 Bacteria 1483
862 Ga0495602_0230461 3300048088 Bacteria 1392
863 Ga0495602_0271777 3300048088 Bacteria 1252
864 Ga0495614_0022860 3300048089 Bacteria 2695
865 Ga0496100_0003499 3300048903 Bacteria 8201
866 Ga0496100_0147031 3300048903 Bacteria 1677
867 Ga0496101_0009124 3300048904 Bacteria 6509
868 Ga0496101_0056421 3300048904 Bacteria 2840
869 Ga0496101_0153683 3300048904 Bacteria 1761
870 Ga0496101_0349734 3300048904 Bacteria 1161
871 Ga0496102_0006184 3300048905 Bacteria 10206
872 Ga0496102_0029606 3300048905 Bacteria 4900
873 Ga0496102_0059757 3300048905 Bacteria 3486
874 Ga0496102_0073409 3300048905 Bacteria 3144
875 Ga0496102_0159376 3300048905 Bacteria 2122
876 Ga0496102_0160810 3300048905 Bacteria 2113
877 Ga0496102_0307848 3300048905 Bacteria 1493
878 Ga0496103_0006862 3300048906 Bacteria 6799
879 Ga0496103_0061923 3300048906 Bacteria 2328
880 Ga0496103_0165405 3300048906 Bacteria 1419
881 Ga0496103_0210261 3300048906 Bacteria 1251
882 Ga0496104_0002005 3300048907 Bacteria 17670
883 Ga0496104_0030942 3300048907 Bacteria 4976
884 Ga0496104_0039125 3300048907 Bacteria 4439
885 Ga0496104_0043721 3300048907 Bacteria 4207
886 Ga0496104_0070616 3300048907 Bacteria 3320
887 Ga0496104_0110978 3300048907 Bacteria 2629
888 Ga0496104_0164368 3300048907 Bacteria 2128
889 Ga0496104_0166508 3300048907 Bacteria 2114
890 Ga0496105_0015812 3300048908 Bacteria 6019
891 Ga0496105_0018819 3300048908 Bacteria 5561
892 Ga0496105_0026728 3300048908 Bacteria 4710
893 Ga0496105_0127943 3300048908 Bacteria 2094
894 Ga0496105_0239545 3300048908 Bacteria 1473
895 Ga0496106_0003691 3300048909 Bacteria 11418
896 Ga0496106_0007852 3300048909 Bacteria 7895
897 Ga0496106_0009940 3300048909 Bacteria 7024
898 Ga0496106_0010150 3300048909 Bacteria 6957
899 Ga0496106_0038934 3300048909 Bacteria 3560
900 Ga0496106_0309438 3300048909 Bacteria 1267
901 Ga0496106_0413790 3300048909 Bacteria 1084
902 Ga0496107_0020799 3300048910 Bacteria 4637
903 Ga0496107_0042505 3300048910 Bacteria 3264
904 Ga0496107_0063392 3300048910 Bacteria 2678
905 Ga0496107_0122472 3300048910 Bacteria 1916
906 Ga0496107_0315214 3300048910 Bacteria 1164
907 Ga0496108_0024899 3300048911 Bacteria 4929
908 Ga0496108_0068090 3300048911 Bacteria 3003
909 Ga0496108_0079127 3300048911 Bacteria 2783
910 Ga0496108_0150464 3300048911 Bacteria 2008
911 Ga0496108_0215261 3300048911 Bacteria 1668
912 Ga0496109_0000910 3300048912 Bacteria 24624
913 Ga0496109_0010481 3300048912 Bacteria 7919
914 Ga0496109_0016308 3300048912 Bacteria 6493
915 Ga0496109_0016600 3300048912 Bacteria 6439
916 Ga0496109_0061904 3300048912 Bacteria 3422
917 Ga0496109_0157729 3300048912 Bacteria 2126
918 Ga0496109_0593720 3300048912 Bacteria 1043
919 Ga0496110_0039029 3300048913 Bacteria 4134
920 Ga0496110_0074770 3300048913 Bacteria 3010
921 Ga0496110_0145765 3300048913 Bacteria 2141
922 Ga0496110_0275393 3300048913 Bacteria 1532
923 Ga0496111_0011896 3300048914 Bacteria 5879
924 Ga0496111_0094046 3300048914 Bacteria 2198
925 Ga0496111_0267495 3300048914 Bacteria 1268
926 Ga0496111_0361996 3300048914 Bacteria 1073
927 Ga0496112_0000022 3300048915 Bacteria 156255
928 Ga0496112_0008650 3300048915 Bacteria 9128
929 Ga0496112_0020467 3300048915 Bacteria 6273
930 Ga0496112_0020945 3300048915 Bacteria 6208
931 Ga0496112_0029523 3300048915 Bacteria 5303
932 Ga0496112_0035183 3300048915 Bacteria 4877
933 Ga0496112_0039089 3300048915 Bacteria 4634
934 Ga0496112_0067762 3300048915 Bacteria 3523
935 Ga0496112_0113658 3300048915 Bacteria 2678
936 Ga0496112_0162367 3300048915 Bacteria 2201
937 Ga0496112_0318263 3300048915 Bacteria 1500
938 Ga0496113_0001596 3300048916 Bacteria 12741
939 Ga0496113_0021222 3300048916 Bacteria 4579
940 Ga0496113_0026536 3300048916 Bacteria 4142
941 Ga0496113_0094105 3300048916 Bacteria 2314
942 Ga0496113_0131651 3300048916 Bacteria 1963
943 Ga0496114_0072883 3300048917 Bacteria 2889
944 Ga0496114_0116982 3300048917 Bacteria 2289
945 Ga0496114_0310704 3300048917 Bacteria 1392
946 Ga0496114_0397536 3300048917 Bacteria 1220
947 Ga0496115_0032084 3300048918 Bacteria 4143
948 Ga0496115_0037994 3300048918 Bacteria 3819
949 Ga0496115_0043743 3300048918 Bacteria 3571
950 Ga0496115_0043883 3300048918 Bacteria 3565
951 Ga0496115_0047207 3300048918 Bacteria 3443
952 Ga0496115_0083801 3300048918 Bacteria 2599
953 Ga0496115_0122982 3300048918 Bacteria 2136
954 Ga0496115_0126130 3300048918 Bacteria 2108
955 Ga0496115_0133100 3300048918 Bacteria 2050
956 Ga0496115_0161714 3300048918 Bacteria 1850
957 Ga0496115_0328247 3300048918 Bacteria 1250
958 Ga0496116_0004251 3300048919 Bacteria 13742
959 Ga0496117_0012698 3300048920 Bacteria 7397
960 Ga0496117_0028820 3300048920 Bacteria 4292
961 Ga0496118_0016505 3300048921 Bacteria 6773
962 Ga0496118_0031958 3300048921 Bacteria 4348
963 Ga0496118_0032185 3300048921 Bacteria 4328
964 Ga0496119_0022613 3300048922 Bacteria 4493
965 Ga0496119_0022773 3300048922 Bacteria 4471
966 Ga0496119_0023433 3300048922 Bacteria 4377
967 Ga0496120_0021002 3300048923 Bacteria 4133
968 Ga0496120_0059770 3300048923 Bacteria 2135
969 Ga0496120_0076022 3300048923 Bacteria 1831
970 Ga0496121_0000146 3300048924 Bacteria 154459
971 Ga0496121_0000254 3300048924 Bacteria 113314
972 Ga0496121_0001567 3300048924 Bacteria 38104
973 Ga0496121_0019232 3300048924 Bacteria 6840
974 Ga0496121_0024814 3300048924 Bacteria 5718
975 Ga0496121_0069007 3300048924 Bacteria 2856
976 Ga0496121_0080649 3300048924 Bacteria 2579
977 Ga0496121_0094782 3300048924 Bacteria 2321
978 Ga0496121_0099020 3300048924 Bacteria 2254
979 Ga0496121_0111711 3300048924 Bacteria 2083
980 Ga0496121_0123657 3300048924 Bacteria 1949
981 Ga0496121_0157723 3300048924 Bacteria 1663
982 Ga0496121_0170222 3300048924 Bacteria 1583
983 Ga0496121_0258583 3300048924 Bacteria 1203
984 Ga0496121_0300586 3300048924 Bacteria 1089
985 Ga0496122_0009335 3300048925 Bacteria 10359
986 Ga0496122_0044528 3300048925 Bacteria 3461
987 Ga0496122_0051764 3300048925 Bacteria 3116
988 Ga0496122_0194241 3300048925 Bacteria 1194
989 Ga0496124_0001236 3300048927 Bacteria 39269
990 Ga0496124_0067274 3300048927 Bacteria 2982
991 Ga0496124_0102995 3300048927 Bacteria 2309
992 Ga0496124_0340978 3300048927 Bacteria 1064
993 Ga0496125_0000099 3300048928 Bacteria 203333
994 Ga0496125_0002791 3300048928 Bacteria 22081
995 Ga0496125_0010906 3300048928 Bacteria 9137
996 Ga0496125_0015991 3300048928 Bacteria 7225
997 Ga0496125_0029525 3300048928 Bacteria 4926
998 Ga0496125_0043420 3300048928 Bacteria 3816
999 Ga0496125_0053712 3300048928 Bacteria 3300
1000 Ga0496126_0007002 3300048929 Bacteria 12454
1001 Ga0496126_0012504 3300048929 Bacteria 8690
1002 Ga0496126_0017287 3300048929 Bacteria 7187
1003 Ga0496126_0027699 3300048929 Bacteria 5408
1004 Ga0496126_0031094 3300048929 Bacteria 5048
1005 Ga0496126_0038428 3300048929 Bacteria 4454
1006 Ga0496126_0039889 3300048929 Bacteria 4354
1007 Ga0496126_0043377 3300048929 Bacteria 4149
1008 Ga0496126_0047403 3300048929 Bacteria 3934
1009 Ga0496126_0052470 3300048929 Bacteria 3705
1010 Ga0496126_0054860 3300048929 Bacteria 3607
1011 Ga0496126_0072997 3300048929 Bacteria 3051
1012 Ga0496126_0074489 3300048929 Bacteria 3015
1013 Ga0496126_0085828 3300048929 Bacteria 2774
1014 Ga0496126_0088703 3300048929 Bacteria 2724
1015 Ga0496126_0117052 3300048929 Bacteria 2315
1016 Ga0496126_0157571 3300048929 Bacteria 1942
1017 Ga0496126_0181511 3300048929 Bacteria 1788
1018 Ga0496126_0228793 3300048929 Bacteria 1558
1019 Ga0496126_0277747 3300048929 Bacteria 1388
1020 Ga0495678_045022 3300049459 Bacteria 1743
1021 Ga0495678_076933 3300049459 Bacteria 1208
1022 Ga0495682_0054436 3300049460 Bacteria 1452
1023 Ga0495682_0074821 3300049460 Bacteria 1218
1024 Ga0501031_0038957 3300049568 Bacteria 3100
1025 Ga0501031_0128997 3300049568 Bacteria 1652
1026 Ga0501033_0017918 3300049570 Bacteria 5347
1027 Ga0501033_0152040 3300049570 Bacteria 1669
1028 Ga0501033_0301708 3300049570 Bacteria 1127
1029 Ga0501034_0051004 3300049571 Bacteria 4173
1030 Ga0501034_0076053 3300049571 Bacteria 3364
1031 Ga0501034_0140986 3300049571 Bacteria 2390
1032 Ga0501034_0190086 3300049571 Bacteria 2016
1033 Ga0501034_0290059 3300049571 Bacteria 1574
1034 Ga0501034_0425660 3300049571 Bacteria 1248
1035 Ga0501036_0080538 3300049572 Bacteria 2753
1036 Ga0501036_0427198 3300049572 Bacteria 1104
1037 Ga0501037_0045907 3300049573 Bacteria 3205
1038 Ga0501037_0063104 3300049573 Bacteria 2701
1039 Ga0501037_0170333 3300049573 Bacteria 1548
1040 Ga0501037_0233594 3300049573 Bacteria 1290
1041 Ga0501038_0003347 3300049574 Bacteria 14952
1042 Ga0501038_0127264 3300049574 Bacteria 2095
1043 Ga0501038_0265321 3300049574 Bacteria 1355
1044 Ga0501039_0058689 3300049575 Bacteria 2980
1045 Ga0501039_0132838 3300049575 Bacteria 1953
1046 Ga0501039_0154459 3300049575 Bacteria 1803
1047 Ga0501039_0173689 3300049575 Bacteria 1694
1048 Ga0501040_0024640 3300049576 Bacteria 4039
1049 Ga0501042_0092237 3300049578 Bacteria 2174
1050 Ga0501043_0022652 3300049579 Bacteria 4925
1051 Ga0501043_0035798 3300049579 Bacteria 3906
1052 Ga0501043_0063091 3300049579 Bacteria 2909
1053 Ga0501043_0115915 3300049579 Bacteria 2103
1054 Ga0501046_0080691 3300049580 Bacteria 2513
1055 Ga0501046_0097458 3300049580 Bacteria 2259
1056 Ga0501046_0104382 3300049580 Bacteria 2172
1057 Ga0501046_0123973 3300049580 Bacteria 1964
1058 Ga0501047_0074414 3300049581 Bacteria 3270
1059 Ga0501048_0048652 3300049582 Bacteria 3023
1060 Ga0501048_0064298 3300049582 Bacteria 2595
1061 Ga0501067_0002459 3300049583 Bacteria 10222
1062 Ga0501067_0042939 3300049583 Bacteria 2511
1063 Ga0501068_0014532 3300049584 Bacteria 4502
1064 Ga0501069_0066775 3300049585 Bacteria 2011
1065 Ga0501069_0085199 3300049585 Bacteria 1783
1066 Ga0501070_0057445 3300049586 Bacteria 3225
1067 Ga0501070_0080344 3300049586 Bacteria 2698
1068 Ga0501070_0150891 3300049586 Bacteria 1917
1069 Ga0501071_0013466 3300049587 Bacteria 5575
1070 Ga0501072_0032282 3300049588 Bacteria 4101
1071 Ga0501072_0135256 3300049588 Bacteria 1965
1072 Ga0501073_0028457 3300049589 Bacteria 3994
1073 Ga0501073_0032066 3300049589 Bacteria 3747
1074 Ga0501073_0194538 3300049589 Bacteria 1403
1075 Ga0501073_0203203 3300049589 Bacteria 1370
1076 Ga0501074_0064390 3300049590 Bacteria 2639
1077 Ga0501077_0077753 3300049593 Bacteria 2102
1078 Ga0501079_0118133 3300049741 Bacteria 2061
1079 Ga0501080_0063191 3300049742 Bacteria 3446
1080 Ga0501083_0041501 3300049744 Bacteria 3120
1081 Ga0501035_0084000 3300049822 Bacteria 2809
1082 Ga0501035_0090339 3300049822 Bacteria 2696
1083 Ga0501035_0110125 3300049822 Bacteria 2413
1084 Ga0501035_0170282 3300049822 Bacteria 1882
1085 Ga0501035_0411886 3300049822 Bacteria 1123
1086 Ga0501044_0032392 3300049823 Bacteria 5496
1087 Ga0501044_0037782 3300049823 Bacteria 5046
1088 Ga0501044_0038321 3300049823 Bacteria 5005
1089 Ga0501044_0088359 3300049823 Bacteria 3128
1090 Ga0501044_0138564 3300049823 Bacteria 2422
1091 Ga0501044_0223236 3300049823 Bacteria 1834
1092 Ga0501044_0240445 3300049823 Bacteria 1754
1093 Ga0501044_0565022 3300049823 Bacteria 1033
1094 Ga0501045_0024317 3300049824 Bacteria 4348
1095 nmdc:mga03683_101559_c1 3300050489 Bacteria 1264
1096 nmdc:mga03683_60325_c1 3300050489 Bacteria 1602
1097 nmdc:mga03n38_2791_c1 3300050490 Bacteria 5486
1098 nmdc:mga03n38_71308_c1 3300050490 Bacteria 1609
1099 nmdc:mga00v17_4195_c1 3300050491 Bacteria 6144
1100 nmdc:mga00v17_70029_c1 3300050491 Bacteria 2172
1101 nmdc:mga00v17_7814_c1 3300050491 Bacteria 5733
1102 nmdc:mga0yw44_27245_c1 3300050492 Bacteria 3271
1103 nmdc:mga0yw44_51316_c1 3300050492 Bacteria 2497
1104 nmdc:mga0yw44_66487_c1 3300050492 Bacteria 2225
1105 nmdc:mga0yw44_69816_c1 3300050492 Bacteria 2177
1106 nmdc:mga0yw44_73238_c1 3300050492 Bacteria 2131
1107 nmdc:mga0yw44_8369_c1 3300050492 Bacteria 5149
1108 nmdc:mga0yw44_97315_c1 3300050492 Bacteria 1869
1109 nmdc:mga0k408_100867_c1 3300050493 Bacteria 1702
1110 nmdc:mga0k408_40338_c1 3300050493 Bacteria 2686
1111 nmdc:mga0k408_60219_c1 3300050493 Bacteria 2206
1112 nmdc:mga06z11_12111_c1 3300050494 Bacteria 3741
1113 nmdc:mga06z11_22737_c1 3300050494 Bacteria 2933
1114 nmdc:mga06z11_228368_c1 3300050494 Bacteria 1090
1115 nmdc:mga06z11_2940_c1 3300050494 Bacteria 6558
1116 nmdc:mga06z11_63873_c1 3300050494 Bacteria 1928
1117 nmdc:mga07m45_104960_c1 3300050496 Bacteria 1625
1118 nmdc:mga07m45_14891_c1 3300050496 Bacteria 4153
1119 nmdc:mga07m45_4272_c1 3300050496 Bacteria 6990
1120 nmdc:mga07m45_66119_c1 3300050496 Bacteria 2054
1121 nmdc:mga07m45_6917_c1 3300050496 Bacteria 5770
1122 nmdc:mga05p37_20147_c1 3300050507 Bacteria 8072
1123 nmdc:mga05p37_72277_c1 3300050507 Bacteria 4244
1124 nmdc:mga0qj67_101885_c1 3300050509 Bacteria 2315
1125 nmdc:mga06r32_56945_c1 3300050510 Bacteria 3754
1126 nmdc:mga0n895_33569_c1 3300050512 Bacteria 4933
1127 nmdc:mga0n895_348159_c1 3300050512 Bacteria 1500
1128 nmdc:mga0n895_71602_c1 3300050512 Bacteria 3438
1129 nmdc:mga0sz30_1155_c1 3300050516 Bacteria 9461
1130 nmdc:mga0sz30_2482_c1 3300050516 Bacteria 6223
1131 Ga0495601_0004994 3300053077 Bacteria 7698
1132 Ga0495601_0013942 3300053077 Bacteria 4840
1133 Ga0495601_0170591 3300053077 Bacteria 1422
1134 Ga0495601_0187674 3300053077 Bacteria 1351
1135 Ga0495612_0011892 3300053078 Bacteria 3508
1136 Ga0495612_0030072 3300053078 Bacteria 2188
1137 Ga0500635_0011261 3300053080 Bacteria 2537
1138 Ga0495595_0000670 3300053084 Bacteria 13076
1139 Ga0495595_0016585 3300053084 Bacteria 3155
1140 Ga0495619_0026443 3300053085 Bacteria 3733
1141 Ga0495619_0035364 3300053085 Bacteria 3248
1142 Ga0495619_0095687 3300053085 Bacteria 2015
1143 Ga0500578_0206155 3300053086 Bacteria 1201
1144 Ga0500643_000052 3300053087 Bacteria 144656
1145 Ga0500651_0014169 3300053093 Bacteria 4875
1146 Ga0500566_0002331 3300053094 Bacteria 11235
1147 Ga0500566_0002512 3300053094 Bacteria 10894
1148 Ga0500566_0002754 3300053094 Bacteria 10472
1149 Ga0500566_0011017 3300053094 Bacteria 5327
1150 Ga0500566_0054199 3300053094 Bacteria 2287
1151 Ga0500641_0037727 3300053096 Bacteria 1938
1152 Ga0500641_0091352 3300053096 Bacteria 1300
1153 Ga0500556_0000035 3300053104 Bacteria 145357
1154 Ga0500557_000057 3300053105 Bacteria 47849
1155 Ga0500562_019096 3300053108 Bacteria 1771
1156 Ga0500572_000655 3300053111 Bacteria 11430
1157 Ga0500572_003541 3300053111 Bacteria 3557
1158 Ga0500591_058871 3300053115 Bacteria 1778
1159 Ga0500594_0002896 3300053118 Bacteria 3744
1160 Ga0500595_002818 3300053119 Bacteria 8361
1161 Ga0500595_004352 3300053119 Bacteria 6371
1162 Ga0500595_028193 3300053119 Bacteria 1916
1163 Ga0500595_034967 3300053119 Bacteria 1658
1164 Ga0500595_062917 3300053119 Bacteria 1116
1165 Ga0500607_109387 3300053121 Bacteria 1357
1166 Ga0500608_000780 3300053122 Bacteria 11633
1167 Ga0500614_003528 3300053123 Bacteria 3363
1168 Ga0500618_004716 3300053125 Bacteria 4280
1169 Ga0500642_0000027 3300053130 Bacteria 119688
1170 Ga0500642_0000263 3300053130 Bacteria 19627
1171 Ga0500642_0112543 3300053130 Bacteria 1271
1172 Ga0500652_000934 3300053131 Bacteria 9664
1173 Ga0500559_0000064 3300053136 Bacteria 85844
1174 Ga0500559_0000486 3300053136 Bacteria 28052
1175 Ga0500559_0003342 3300053136 Bacteria 7941
1176 Ga0500559_0015332 3300053136 Bacteria 3236
1177 Ga0500559_0070038 3300053136 Bacteria 1577
1178 Ga0500568_0001465 3300053139 Bacteria 15127
1179 Ga0500568_0022037 3300053139 Bacteria 2732
1180 Ga0500577_0000035 3300053142 Bacteria 31742
1181 Ga0500588_0053235 3300053146 Bacteria 1270
1182 Ga0500589_041912 3300053147 Bacteria 2135
1183 Ga0500590_017886 3300053148 Bacteria 3666
1184 Ga0500590_054044 3300053148 Bacteria 2034
1185 Ga0500603_000667 3300053150 Bacteria 8359
1186 Ga0500603_001350 3300053150 Bacteria 5626
1187 Ga0500604_0002237 3300053151 Bacteria 5296
1188 Ga0500604_0053553 3300053151 Bacteria 1251
1189 Ga0500616_0000028 3300053153 Bacteria 435722
1190 Ga0500616_0000054 3300053153 Bacteria 290186
1191 Ga0500622_0003626 3300053156 Bacteria 10145
1192 Ga0500622_0006780 3300053156 Bacteria 6591
1193 Ga0500627_0002332 3300053158 Bacteria 5603
1194 Ga0500634_0017216 3300053161 Bacteria 3868
1195 Ga0500634_0042983 3300053161 Bacteria 2450
1196 Ga0500634_0121455 3300053161 Bacteria 1270
1197 Ga0500638_044057 3300053162 Bacteria 2166
1198 Ga0500639_001074 3300053163 Bacteria 13945
1199 Ga0500639_132718 3300053163 Bacteria 1177
1200 Ga0500636_0026615 3300053177 Bacteria 3416
1201 Ga0500636_0030405 3300053177 Bacteria 3193
1202 Ga0500636_0043902 3300053177 Bacteria 2638
1203 Ga0500636_0067038 3300053177 Bacteria 2085
1204 Ga0500636_0126036 3300053177 Bacteria 1431
1205 Ga0500636_0220568 3300053177 Bacteria 988
1206 Ga0500637_0001280 3300053178 Bacteria 10539
1207 Ga0500637_0001814 3300053178 Bacteria 9236
1208 Ga0500637_0138128 3300053178 Bacteria 1411
1209 Ga0500625_118975 3300053729 Bacteria 1066
1210 Ga0500645_014952 3300053730 Bacteria 2466
1211 Ga0500645_041853 3300053730 Bacteria 1352
1212 Ga0500609_006142 3300053731 Bacteria 1637
1213 Ga0500596_000644 3300053735 Bacteria 6723
1214 Ga0500596_008419 3300053735 Bacteria 1645
1215 Ga0500599_002539 3300053736 Bacteria 2191
1216 Ga0500601_003142 3300053737 Bacteria 1785
1217 Ga0501084_0005438 3300054114 Bacteria 10447
1218 Ga0500661_001546 3300055283 Bacteria 4330
1219 Ga0501082_0000040 3300060353 Bacteria 91596
1220 Ga0501082_0018483 3300060353 Bacteria 6004
1221 2507504329 2507262055 Bacteria 8048963
1222 2508545763 2508501009 Bacteria 7784016
1223 2508694588 2508501042 Bacteria 8719808
1224 2511398407 2511231028 Bacteria 8046582
1225 2513624499 2513237092 Bacteria 8341956
1226 2513638637 2513237094 Bacteria 8789602
1227 2513649974 2513237095 Bacteria 8976980
1228 2513655412 2513237096 Bacteria 8722461
1229 2513697537 2513237101 Bacteria 7952346
1230 2513703218 2513237102 Bacteria 7703324
1231 2513716819 2513237104 Bacteria 10034502
1232 2513860024 2513237137 Bacteria 9558895
1233 2513874267 2513237139 Bacteria 8737671
1234 2513892378 2513237141 Bacteria 8496279
1235 2513916510 2513237145 Bacteria 8979722
1236 2514009967 2513237161 Bacteria 8871253
1237 2515624483 2515154112 Bacteria 8294334
1238 2517104587 2517093001 Bacteria 9002274
1239 2517889899 2517572143 Bacteria 9484767
1240 2524438544 2524023205 Bacteria 8918781
1241 2524470516 2524023210 Bacteria 9029266
1242 2524532912 2524023228 Bacteria 10118060
1243 2528850393 2528768022 Bacteria 10457665
1244 2603860613 2602042107 Bacteria 6226103
1245 2617354172 2617270735 Bacteria 9163226
1246 2617374670 2617270741 Bacteria 8201522
1247 2644290205 2643221651 Bacteria 4798932
1248 2671121077 2667528175 Bacteria 7532676
1249 2723842580 2721755755 Bacteria 8322773
1250 2728751703 2728368998 Bacteria 8720350
1251 2745077231 2744054633 Bacteria 8678936
1252 2793059402 2791355196 Bacteria 7323613
1253 2793068153 2791355197 Bacteria 8420563
1254 2793077886
1255 2793078549
1256 2805916033 2802429603 Bacteria 8777136
1257 2818240974 2816332527 Bacteria 8933356
1258 2824604424 2824600985 Bacteria 8488197
1259 2824615035 2824609381 Bacteria 8672835
1260 2824626176 2824617872 Bacteria 8814715
1261 2824633229 2824626560 Bacteria 8813858
1262 2824643189 2824635225 Bacteria 8785348
1263 2824651380 2824644064 Bacteria 8743947
1264 2824659181 2824653114 Bacteria 8493680
1265 2824665225 2824661429 Bacteria 9877870
1266 2824676380 2824671348 Bacteria 8369588
1267 2824687070 2824679649 Bacteria 8248951
1268 2824692702 2824687955 Bacteria 8360029
1269 2824703725 2824696289 Bacteria 8335049
1270 2824713910 2824704595 Bacteria 9667483
1271 2824722721 2824714736 Bacteria 8717648
1272 2824731413 2824723954 Bacteria 8758240
1273 2824738367 2824732956 Bacteria 7810675
1274 2824751268 2824746037 Bacteria 7911610
1275 2824761105 2824753945 Bacteria 9787441
1276 2824771778 2824763712 Bacteria 9792355
1277 2824778250 2824773399 Bacteria 8360218
1278 2838126128 2838122688 Bacteria 8803140
1279 2841942479 2841941048 Bacteria 8688029
1280 2841953174 2841949485 Bacteria 8680857
1281 2841960681 2841957949 Bacteria 8652217
1282 2841970801 2841966195 Bacteria 8673214
1283 2841977940 2841974524 Bacteria 8931498
1284 2841984499 2841983080 Bacteria 8395090
1285 2842041781 2842038055 Bacteria 8002051
1286 2842049823 2842045827 Bacteria 8006841
1287 2844321335 2844315083 Bacteria 8138177
1288 2847932075 2847930680 Bacteria 9342022
1289 2847943312 2847939898 Bacteria 8606328
1290 2849077040 2849076700 Bacteria 7039503
1291 2857514686 2857509624 Bacteria 7472071
1292 2857525571 2857524615 Bacteria 6615449
1293 2874595714 2874590934 Bacteria 8299676
1294 2874606736 2874604998 Bacteria 7834745
1295 2874620286 2874612657 Bacteria 8252029
1296 2874624222 2874620515 Bacteria 8290088
1297 2874630306 2874628541 Bacteria 8630250
1298 2874651654 2874645413 Bacteria 8214782
1299 2876767662 2876761206 Bacteria 10111113
1300 2876775909 2876771140 Bacteria 8287509
1301 2876816682 2876808645 Bacteria 8824342
1302 2876821549 2876818435 Bacteria 8274608
1303 2879080000 2879074833 Bacteria 8279565
1304 2879085750 2879083081 Bacteria 8587928
1305 2879100582 2879099564 Bacteria 10442239
1306 2879113553 2879110137 Bacteria 8907982
1307 2879114941 2879110137 Bacteria 8907982
1308 2879134083 2879127579 Bacteria 8294491
1309 2879148568 2879142872 Bacteria 8267021
1310 2881367722 2881364244 Bacteria 7710352
1311 2881669315 2881665667 Bacteria 8175609
1312 2885374483 2885366525 Bacteria 8326213
1313 2885379427 2885374607 Bacteria 8927485
1314 2885388230 2885383462 Bacteria 9473874
1315 2885412168 2885409591 Bacteria 9235467
1316 2888387633 2888378607 Bacteria 9652610
1317 2888391529 2888388044 Bacteria 7304136
1318 2888426849 2888419890 Bacteria 7857137
1319 2889034135 2889033259 Bacteria 9099371
1320 2889037708 2889033259 Bacteria 9099371
1321 2893070710 2893066018 Bacteria 6158120
1322 2903731475 2903727486 Bacteria 8281579
1323 2903750746 2903748898 Bacteria 9972761
1324 2904670933 2904666416 Bacteria 8226587
1325 2904692663 2904690495 Bacteria 9412302
1326 2904711120
1327 2904713561 2904711408 Bacteria 9771557
1328 2906607949 2906602504 Bacteria 8295279
1329 2906612363
1330 2906633079 2906626472 Bacteria 8826946
1331 2906638311 2906635258 Bacteria 8601019
1332 2906650128 2906643746 Bacteria 8722424
1333 2906663404 2906660503 Bacteria 8595048
1334 2908739764 2908739725 Bacteria 8628932
1335 2908757875 2908756301 Bacteria 8864324
1336 2908777151 2908775508 Bacteria 8092255
1337 2919074621 2919073203 Bacteria 6531949
1338 2922367533 2922361189 Bacteria 7436256
1339 2922376617
1340 2922391508 2922386360 Bacteria 7017218
1341 2922398567 2922393267 Bacteria 8285685
1342 2922426932
1343 2929619878 2929615660 Bacteria 9193770
1344 2929629190 2929624759 Bacteria 9339455
1345 2932789677 2932784394 Bacteria 9704911
1346 2932796655 2932794094 Bacteria 7915132
1347 2932802565 2932801729 Bacteria 7987968
1348 2932814816 2932809354 Bacteria 9135765
1349 2932824327 2932818245 Bacteria 9955613
1350 2932833946 2932828146 Bacteria 9745859
1351 2933581796 2933577622 Bacteria 9116884
1352 2935613256 2935608549 Bacteria 8203142
1353 2935623664 2935616580 Bacteria 9032984
1354 2935633091 2935630451 Bacteria 8169952
1355 2935645052 2935638405 Bacteria 10015038
1356 2935656630 2935648319 Bacteria 8801166
1357 2935665446 2935656913 Bacteria 8965014
1358 2935672101 2935665750 Bacteria 9571747
1359 2935684093 2935675223 Bacteria 9928132
1360 2935689141 2935684952 Bacteria 9590419
1361 2935697598 2935694250 Bacteria 9291695
1362 2935711377 2935703347 Bacteria 10242284
1363 2935720087 2935713505 Bacteria 9608509
1364 2935728296 2935722832 Bacteria 9608746
1365 2935737107 2935732158 Bacteria 9706831
1366 2935746832 2935741537 Bacteria 9707219
1367 2935757799 2935750917 Bacteria 9590372
1368 2935764178 2935760218 Bacteria 9817913
1369 2935775195 2935769743 Bacteria 7878163
1370 2935780097 2935777560 Bacteria 8077691
1371 2935790219 2935785616 Bacteria 7962367
1372 2935798739 2935793552 Bacteria 8012592
1373 2935808764 2935801545 Bacteria 9301974
1374 2935817561 2935810662 Bacteria 9401221
1375 2935824890 2935819856 Bacteria 8261050
1376 2935834102 2935827899 Bacteria 10038562
1377 2935844705 2935837841 Bacteria 9454360
1378 2935852110 2935847175 Bacteria 8228321
1379 2935861729 2935855204 Bacteria 9035059
1380 2935868635 2935864058 Bacteria 9784707
1381 2935879409 2935873716 Bacteria 9632195
1382 2935886995 2935883170 Bacteria 7964738
1383 2935911457 2935908558 Bacteria 8568796
1384 2935920992 2935916978 Bacteria 9113783
1385 2935928486 2935926038 Bacteria 8601059
1386 2935938131 2935934488 Bacteria 8602579
1387 2935945413 2935942939 Bacteria 8599779
1388 2935954081 2935951376 Bacteria 8602333
1389 2935965460 2935959822 Bacteria 7869783
1390 2935971651 2935967501 Bacteria 8603075
1391 2935980055 2935975950 Bacteria 8347125
1392 2935989483 2935984226 Bacteria 8302647
1393 2935998423 2935992306 Bacteria 9802711
1394 2936009116 2936002035 Bacteria 9362176
1395 2936019493 2936011229 Bacteria 8801034
1396 2936028097 2936019824 Bacteria 8804134
1397 2936036931 2936028420 Bacteria 8965941
1398 2936044358 2936037263 Bacteria 9446081
1399 2936054954 2936046547 Bacteria 8903709
1400 2936060739 2936055302 Bacteria 8785755
1401 2940563379 2940556831 Bacteria 9590747
1402 2941509607 2941507105 Bacteria 8166816
1403 2941517436 2941515067 Bacteria 8166720
1404 2941526611 2941523033 Bacteria 8169134
1405 2941531908 2941531003 Bacteria 7653939
1406 2941545400 2941538514 Bacteria 9402094
1407 3005476116 3005474847 Bacteria 9259049
1408 3005486005 3005483717 Bacteria 7877331
1409 3005506672 3005506211 Bacteria 6943378
1410 3005592743 3005587118 Bacteria 7794411
1411 3005601687 3005594810 Bacteria 8716512
1412 3005717424 3005710791 Bacteria 7622528
1413 3005724369 3005718088 Bacteria 8283608
1414 8006932549 8006926726 Bacteria 6749210
1415 8006937430 8006933436 Bacteria 10410654
1416 8006965879 8006964411 Bacteria 8966052
1417 8006977459 8006973647 Bacteria 10679141
1418 8006984730 8006984368 Bacteria 9651211
1419 8006986203 8006984368 Bacteria 9651211
1420 8006999143 8006994254 Bacteria 8309700
1421 8016519220 8016511872 Bacteria 9921665
1422 8016525102 8016522445 Bacteria 8156687
1423 8016538678 8016530956 Bacteria 8155261
1424 8016542967 8016539877 Bacteria 8155419
1425 8016550326 8016548790 Bacteria 8155074
1426 8016558733 8016557553 Bacteria 8154380
1427 8016568365 8016566248 Bacteria 8158151
1428 8016581023 8016575299 Bacteria 8154085
1429 8016587702 8016583857 Bacteria 10421953
1430 8016596708 8016595262 Bacteria 8149947
1431 8016607583 8016603502 Bacteria 8731218
1432 8016619376 8016613128 Bacteria 8794220
1433 8016630216 8016622563 Bacteria 7999408
1434 8016636935 8016630954 Bacteria 9217207
1435 8017066289 8017057580 Bacteria 10023680
1436 8019538350 8019530166 Bacteria 8155624
1437 8019541472 8019538911 Bacteria 7872763
1438 8019549156 8019547302 Bacteria 7996444
1439 8019561195 8019555841 Bacteria 9642137
1440 8019571285 8019565922 Bacteria 9639779
1441 8019596371 8019586578 Bacteria 10212056
1442 8019605331 8019597564 Bacteria 10041141
1443 8019613211 8019608314 Bacteria 10042931
1444 8019623895 8019619141 Bacteria 9218857
1445 8019638146 8019629233 Bacteria 8687553
1446 8019641490 8019638758 Bacteria 9062356
1447 8019651551 8019648815 Bacteria 10014479
1448 8019666061 8019659431 Bacteria 8577854
1449 8019675578 8019668869 Bacteria 8791617
1450 8019680521 8019678201 Bacteria 8863603
1451 8055750370 8055742211 Bacteria 9226248
1452 8056678862 8056673599 Bacteria 7871253
1453 8056685977 8056681323 Bacteria 8472857
1454 8056691991 8056689827 Bacteria 6712655
1455 8056976139 8056967851 Bacteria 9038162
1456 Ga0105240_10017804
1457 JGI24740J21852_10010307
1458 JGI24739J22299_10060499
1459 JGI25406J46586_10000118
1460 JGI25153J46596_10002224
1461 JGI25153J46596_10006933
1462 JGI25153J46596_10007072
1463 JGI25153J46596_10024593
1464 rootH2_10188699
1465 JGI25404J52841_10002320
1466 Ga0055524_1016148
1467 Ga0055531_10009477
1468 Ga0065165_1002792
1469 Ga0065165_1003284
1470 Ga0065165_1021603
1471 Ga0070658_10114808
1472 Ga0070658_10212017
1473 Ga0070683_100048202
1474 Ga0070683_100074217
1475 Ga0070670_100041202
1476 Ga0068869_100087480
1477 Ga0070680_100081738
1478 Ga0070680_100186943
1479 Ga0070680_100456634
1480 Ga0070682_100073402
1481 Ga0068868_100005183
1482 Ga0068868_100017996
1483 Ga0068868_100059948
1484 Ga0068868_100326312
1485 Ga0070660_100030247
1486 Ga0070689_100330612
1487 Ga0070661_100154164
1488 Ga0070661_100210998
1489 Ga0070668_100020491
1490 Ga0070668_100046605
1491 Ga0070668_100081859
1492 Ga0070668_100154139
1493 Ga0070671_100101143
1494 Ga0070674_100060947
1495 Ga0070674_100229679
1496 Ga0070667_100225702
1497 Ga0070709_10000796
1498 Ga0070709_10001261
1499 Ga0070709_10007358
1500 Ga0070709_10010265
1501 Ga0070709_10042951
1502 Ga0070709_10129874
1503 Ga0070714_100028362
1504 Ga0070714_100131457
1505 Ga0070713_100004513
1506 Ga0070713_100024796
1507 Ga0070713_100114641
1508 Ga0070713_100114913
1509 Ga0070713_100155528
1510 Ga0070710_10000991
1511 Ga0070710_10010597
1512 Ga0070711_100005239
1513 Ga0070711_100006676
1514 Ga0070711_100008277
1515 Ga0070711_100315304
1516 Ga0070705_100137382
1517 Ga0070700_100032431
1518 Ga0070694_100279741
1519 Ga0070663_100021710
1520 Ga0070663_100027837
1521 Ga0070663_100043121
1522 Ga0070663_100123124
1523 Ga0070678_100065174
1524 Ga0070678_100084703
1525 Ga0070678_100099892
1526 Ga0070662_100195353
1527 Ga0070681_10062271
1528 Ga0070681_10163471
1529 Ga0068867_100107078
1530 Ga0070706_100089246
1531 Ga0070698_100403197
1532 Ga0070699_100227522
1533 Ga0070679_100034610
1534 Ga0070679_100047353
1535 Ga0070679_100324799
1536 Ga0070684_100008848
1537 Ga0070684_100071224
1538 Ga0068853_100007083
1539 Ga0068853_100007085
1540 Ga0068853_100032710
1541 Ga0070696_100094591
1542 Ga0070665_100007326
1543 Ga0070665_100016280
1544 Ga0070665_100021701
1545 Ga0070665_100050261
1546 Ga0070665_100057391
1547 Ga0070665_100084638
1548 Ga0070665_100137569
1549 Ga0070665_100240889
1550 Ga0070665_100347802
1551 Ga0068855_100235778
1552 Ga0068855_100299148
1553 Ga0070664_100016211
1554 Ga0070664_100156175
1555 Ga0068857_100021428
1556 Ga0068857_100113770
1557 Ga0068857_100126040
1558 Ga0068854_100009851
1559 Ga0068854_100041116
1560 Ga0068856_100000522
1561 Ga0068856_100010527
1562 Ga0068856_100030658
1563 Ga0070702_100055555
1564 Ga0068852_100020416
1565 Ga0068852_100067275
1566 Ga0068852_100341945
1567 Ga0068859_100304741
1568 Ga0068859_100643876
1569 Ga0068864_100313875
1570 Ga0068861_100088531
1571 Ga0068851_10047299
1572 Ga0068858_100127907
1573 Ga0068860_100000441
1574 Ga0068860_100155651
1575 Ga0068862_100156535
1576 Ga0068862_100215740
1577 Ga0068862_100220550
1578 Ga0081455_10000715
1579 Ga0081455_10000774
1580 Ga0081455_10003833
1581 Ga0081455_10013479
1582 Ga0081455_10028784
1583 Ga0081455_10049450
1584 Ga0081538_10029587
1585 Ga0081538_10066454
1586 Ga0081540_1002251
1587 Ga0081540_1002343
1588 Ga0081540_1003941
1589 Ga0081540_1005884
1590 Ga0081540_1014466
1591 Ga0081540_1016536
1592 Ga0081540_1022699
1593 Ga0081540_1025221
1594 Ga0081540_1026177
1595 Ga0081540_1035117
1596 Ga0081540_1065365
1597 Ga0081540_1075776
1598 Ga0081539_10000425
1599 Ga0081539_10001114
1600 Ga0081539_10053002
1601 Ga0081539_10099924
1602 Ga0081539_10109976
1603 Ga0070717_10000325
1604 Ga0070717_10084579
1605 Ga0075365_10011659
1606 Ga0075365_10026252
1607 Ga0075365_10033426
1608 Ga0075365_10040469
1609 Ga0075365_10060412
1610 Ga0075368_10007800
1611 Ga0075368_10008135
1612 Ga0075368_10012725
1613 Ga0075368_10049183
1614 Ga0075363_100001726
1615 Ga0075363_100017481
1616 Ga0075363_100088419
1617 Ga0075363_100122224
1618 Ga0075363_100176997
1619 Ga0075364_10007861
1620 Ga0075364_10010966
1621 Ga0075364_10022059
1622 Ga0075364_10043166
1623 Ga0075432_10058339
1624 Ga0070715_10000561
1625 Ga0070715_10025862
1626 Ga0070715_10103424
1627 Ga0070716_100001763
1628 Ga0070716_100171349
1629 Ga0070712_100044490
1630 Ga0070712_100167104
1631 Ga0070712_100284740
1632 Ga0075367_10040235
1633 Ga0075367_10059339
1634 Ga0075367_10075447
1635 Ga0075367_10077676
1636 Ga0075369_10002297
1637 Ga0075369_10026891
1638 Ga0075366_10006775
1639 Ga0075366_10018597
1640 Ga0075366_10035098
1641 Ga0097621_100141141
1642 Ga0097621_100375741
1643 Ga0097621_100453462
1644 Ga0075370_10017731
1645 Ga0075370_10047609
1646 Ga0075370_10047964
1647 Ga0075370_10080144
1648 Ga0068871_100113220
1649 Ga0075428_100023204
1650 Ga0075430_100382451
1651 Ga0075431_100029253
1652 Ga0075434_100020473
1653 Ga0075434_100050474
1654 Ga0075434_100074720
1655 Ga0075434_100084478
1656 Ga0068865_100150267
1657 Ga0075436_100096406
1658 Ga0097620_100304731
1659 Ga0097620_100643933
1660 Ga0099825_1019128
1661 Ga0099824_1005278
1662 Ga0099824_1017855
1663 Ga0099822_1013722
1664 Ga0099794_10009088
1665 Ga0099795_10000836
1666 Ga0099795_10024305
1667 Ga0099795_10034455
1668 Ga0105240_10002968
1669 Ga0105240_10021771
1670 Ga0105240_10033109
1671 Ga0105240_10076367
1672 Ga0105240_10146029
1673 Ga0105240_10463304
1674 Ga0105240_10477187
1675 Ga0105240_10547751
1676 Ga0105240_10644663
1677 Ga0111539_10333654
1678 Ga0105245_10011836
1679 Ga0105245_10024933
1680 Ga0105245_10030674
1681 Ga0105245_10551186
1682 Ga0105247_10135573
1683 Ga0114129_10196005
1684 Ga0114129_10228379
1685 Ga0105243_10328556
1686 Ga0105243_10424563
1687 Ga0105241_10001388
1688 Ga0105241_10016444
1689 Ga0105241_10227892
1690 Ga0105242_10179201
1691 Ga0105248_10044195
1692 Ga0105248_10073680
1693 Ga0105248_10161310
1694 Ga0105248_10264975
1695 Ga0105248_10459244
1696 Ga0105237_10009401
1697 Ga0105237_10018051
1698 Ga0105237_10019256
1699 Ga0105237_10029341
1700 Ga0105237_10063125
1701 Ga0105237_10081504
1702 Ga0105237_10117726
1703 Ga0105237_10121493
1704 Ga0105237_10219525
1705 Ga0105237_10279682
1706 Ga0105237_10302610
1707 Ga0105237_10330910
1708 Ga0105238_10007201
1709 Ga0105238_10025146
1710 Ga0105238_10028995
1711 Ga0105238_10066871
1712 Ga0105238_10083975
1713 Ga0105238_10134821
1714 Ga0105238_10140056
1715 Ga0105249_10161283
1716 Ga0099796_10000143
1717 Ga0099796_10014081
1718 Ga0099796_10049573
1719 Ga0105239_10026237
1720 Ga0105239_10054242
1721 Ga0105239_10075076
1722 Ga0105239_10108752
1723 Ga0105239_10129571
1724 Ga0105239_10132265
1725 Ga0105239_10666468
1726 Ga0105239_10745374
1727 Ga0105246_10024946
1728 Ga0157371_10231668
1729 Ga0157370_10120699
1730 Ga0157370_10140019
1731 Ga0157369_10011069
1732 Ga0157369_10022494
1733 Ga0157369_10085496
1734 Ga0157374_10025945
1735 Ga0157374_10348201
1736 Ga0157378_10019128
1737 Ga0157378_10085139
1738 Ga0163162_10020858
1739 Ga0157372_10050306
1740 Ga0157372_10680296
1741 Ga0157375_10016660
1742 Ga0163163_10063284
1743 Ga0163163_10067838
1744 Ga0163163_10069545
1745 Ga0163163_10110804
1746 Ga0163163_10115145
1747 Ga0163163_10196568
1748 Ga0157380_10212424
1749 Ga0157377_10133442
1750 Ga0157379_10012889
1751 Ga0157379_10095943
1752 Ga0157379_10129426
1753 Ga0157379_10263968
1754 Ga0157376_10008369
1755 Ga0157376_10175361
1756 Ga0163161_10113270
1757 Ga0206353_10807201
1758 Ga0214544_1000011
1759 Ga0214542_1000009
1760 Ga0214545_1000007
1761 Ga0214543_1000020
1762 Ga0213876_10008681
1763 Ga0209563_103763
1764 Ga0207425_1007458
1765 Ga0209677_103733
1766 Ga0209148_1000316
1767 Ga0209148_1007100
1768 Ga0209233_1016979
1769 Ga0209455_1006070
1770 Ga0209564_1000407
1771 Ga0209564_1002075
1772 Ga0209564_1005161
1773 Ga0209564_1023569
1774 Ga0209758_1000106
1775 Ga0209758_1001012
1776 Ga0209758_1001683
1777 Ga0209758_1002332
1778 Ga0209758_1002396
1779 Ga0209758_1003816
1780 Ga0209758_1007915
1781 Ga0209758_1014959
1782 Ga0209758_1029030
1783 Ga0209758_1037061
1784 Ga0209256_1002946
1785 Ga0207426_1000374
1786 Ga0207426_1001007
1787 Ga0207426_1004033
1788 Ga0209257_1001741
1789 Ga0207692_10005299
1790 Ga0207710_10086053
1791 Ga0207688_10204097
1792 Ga0207680_10221195
1793 Ga0207647_10000972
1794 Ga0207685_10018879
1795 Ga0207685_10023611
1796 Ga0207685_10077029
1797 Ga0207699_10000363
1798 Ga0207699_10002914
1799 Ga0207699_10041739
1800 Ga0207699_10082273
1801 Ga0207645_10182413
1802 Ga0207645_10192206
1803 Ga0207645_10265271
1804 Ga0207705_10033327
1805 Ga0207705_10075543
1806 Ga0207705_10194066
1807 Ga0207684_10174378
1808 Ga0207654_10000729
1809 Ga0207654_10028175
1810 Ga0207654_10030934
1811 Ga0207654_10061268
1812 Ga0207707_10000541
1813 Ga0207707_10050125
1814 Ga0207695_10000478
1815 Ga0207695_10004497
1816 Ga0207695_10017775
1817 Ga0207695_10024109
1818 Ga0207695_10191850
1819 Ga0207671_10003084
1820 Ga0207671_10133861
1821 Ga0207671_10151954
1822 Ga0207671_10184623
1823 Ga0207693_10005512
1824 Ga0207693_10008188
1825 Ga0207693_10008624
1826 Ga0207693_10020448
1827 Ga0207693_10024640
1828 Ga0207693_10076040
1829 Ga0207663_10000425
1830 Ga0207663_10031078
1831 Ga0207663_10038050
1832 Ga0207663_10069893
1833 Ga0207660_10009028
1834 Ga0207660_10210524
1835 Ga0207657_10002950
1836 Ga0207657_10014763
1837 Ga0207657_10029326
1838 Ga0207657_10080145
1839 Ga0207649_10251963
1840 Ga0207652_10007298
1841 Ga0207652_10205326
1842 Ga0207694_10000849
1843 Ga0207694_10009743
1844 Ga0207694_10049921
1845 Ga0207694_10103254
1846 Ga0207687_10106472
1847 Ga0207687_10125264
1848 Ga0207700_10008743
1849 Ga0207700_10021069
1850 Ga0207700_10077617
1851 Ga0207700_10085514
1852 Ga0207700_10095006
1853 Ga0207700_10135559
1854 Ga0207664_10006763
1855 Ga0207664_10111058
1856 Ga0207664_10209590
1857 Ga0207644_10197868
1858 Ga0207706_10033954
1859 Ga0207706_10410092
1860 Ga0207686_10040719
1861 Ga0207709_10256227
1862 Ga0207669_10240701
1863 Ga0207669_10339047
1864 Ga0207665_10003367
1865 Ga0207665_10008013
1866 Ga0207665_10009754
1867 Ga0207665_10055096
1868 Ga0207665_10186442
1869 Ga0207665_10270161
1870 Ga0207665_10275786
1871 Ga0207691_10323914
1872 Ga0207711_10061206
1873 Ga0207689_10047666
1874 Ga0207689_10073080
1875 Ga0207689_10103200
1876 Ga0207689_10343547
1877 Ga0207661_10000109
1878 Ga0207661_10029282
1879 Ga0207661_10035452
1880 Ga0207667_10003413
1881 Ga0207667_10090006
1882 Ga0207667_10139182
1883 Ga0207667_10148280
1884 Ga0207667_10193729
1885 Ga0207651_10229428
1886 Ga0207712_10162993
1887 Ga0207668_10067563
1888 Ga0207668_10070947
1889 Ga0207668_10354060
1890 Ga0207668_10442358
1891 Ga0207640_10039426
1892 Ga0207640_10101239
1893 Ga0207640_10206678
1894 Ga0207640_10272708
1895 Ga0207658_10150905
1896 Ga0207658_10280329
1897 Ga0207677_10003182
1898 Ga0207677_10008230
1899 Ga0207677_10011875
1900 Ga0207677_10023110
1901 Ga0207677_10453452
1902 Ga0207639_10025543
1903 Ga0207639_10188415
1904 Ga0207639_10418632
1905 Ga0207678_10006080
1906 Ga0207678_10025278
1907 Ga0207678_10035705
1908 Ga0207678_10045068
1909 Ga0207678_10106641
1910 Ga0207708_10117190
1911 Ga0207702_10000003
1912 Ga0207702_10000014
1913 Ga0207702_10059058
1914 Ga0207702_10108328
1915 Ga0207641_10519200
1916 Ga0207648_10011805
1917 Ga0207648_10074325
1918 Ga0207676_10104985
1919 Ga0207674_10029977
1920 Ga0207674_10033474
1921 Ga0207674_10033728
1922 Ga0207674_10064316
1923 Ga0207675_100049152
1924 Ga0207675_100067188
1925 Ga0207683_10085838
1926 Ga0207683_10102982
1927 Ga0207683_10156685
1928 Ga0207683_10186779
1929 Ga0207698_10042042
1930 Ga0207698_10274298
1931 Ga0207698_10340597
1932 Ga0209389_1000016
1933 Ga0209389_1000027
1934 Ga0209589_1000005
1935 Ga0209589_1000031
1936 Ga0209489_100005
1937 Ga0209489_100057
1938 Ga0209489_100063
1939 Ga0209700_100006
1940 Ga0209700_100012
1941 Ga0268266_10004891
1942 Ga0268266_10013890
1943 Ga0268266_10029751
1944 Ga0268266_10150134
1945 Ga0268266_10239949
1946 Ga0268266_10251298
1947 Ga0268265_10031565
1948 Ga0268265_10204273
1949 Ga0268265_10287455
1950 Ga0268264_10000042
1951 Ga0265337_1033706
1952 Ga0265323_10004217
1953 Ga0307517_10000176
1954 Ga0307515_10170151
1955 Ga0307515_10170492
1956 Ga0307515_10320650
1957 Ga0265338_10000018
1958 Ga0307511_10109053
1959 Ga0265330_10017820
1960 Ga0265332_10009331
1961 Ga0265325_10005802
1962 Ga0265340_10001337
1963 Ga0265340_10025601
1964 Ga0265339_10000383
1965 Ga0265331_10116621
1966 Ga0307513_10198053
1967 Ga0307508_10000029
1968 Ga0307508_10094048
1969 Ga0307508_10208833
1970 Ga0265314_10006665
1971 Ga0265314_10008159
1972 Ga0265342_10005588
1973 Ga0307516_10010558
1974 Ga0307516_10052151
1975 Ga0307516_10159510
1976 Ga0307516_10334755
1977 Ga0307405_10126650
1978 Ga0307413_10027580
1979 Ga0307518_10172468
1980 Ga0307407_10204728
1981 Ga0307412_10317466
1982 Ga0307409_100111072
1983 Ga0307414_10206054
1984 Ga0307415_100059081
1985 Ga0307415_100255756
1986 Ga0307507_10018699
1987 Ga0307510_10010093
1988 Ga0307510_10016909
1989 Ga0307510_10069235
1990 Ga0307510_10082122
1991 Ga0307510_10092093
1992 Ga0307510_10287697
1993 Ga0315911_1000005
1994 Ga0316215_1002174
1995 Ga0373934_0008533
1996 Ga0373923_0000376
1997 Ga0373936_0042953
1998 Ga0373936_0045036
1999 Ga0373945_0013564
2000 Ga0373953_0000156
2001 Ga0373953_0008171
2002 Ga0373953_0123191
2003 Ga0373954_0007578
2004 Ga0373954_0020449
2005 Ga0373956_0002378
2006 Ga0373956_0103597
2007 Ga0373957_0017078
2008 Ga0373957_0063987
2009 Ga0373943_0040115
2010 Ga0373943_0101959
2011 Ga0373943_0134726
2012 Ga0373946_0043204
2013 Ga0373955_0000395
2014 Ga0373955_0013079
2015 Ga0373955_0022863
2016 Ga0373962_0044677
2017 Ga0373924_0010939
2018 Ga0373924_0013913
2019 Ga0373924_0055242
2020 Ga0373931_0018329
2021 Ga0373935_0055538
2022 Ga0373927_0002702
2023 Ga0373927_0004819
2024 Ga0373927_0005543
2025 Ga0373927_0007994
2026 Ga0373927_0017690
2027 Ga0373927_0043246
2028 Ga0373933_0001227
2029 Ga0373933_0004820
2030 Ga0373933_0075719
2031 Ga0373933_0193597
2032 Ga0373947_0003219
2033 Ga0373947_0006770
2034 Ga0373947_0044253
2035 Ga0373947_0050934
2036 Ga0373937_0053490
2037 Ga0373937_0096791
2038 Ga0373937_0128821
2039 Ga0372808_002595
2040 Ga0373925_0009475
2041 Ga0373925_0042948
2042 Ga0373925_0053938
2043 Ga0373925_0055671
2044 Ga0373925_0099706
2045 Ga0395899_0076124
2046 Ga0395900_0047842
2047 Ga0395900_0102016
2048 Ga0395900_0112435
2049 Ga0395900_0216970
2050 Ga0395900_0229693
2051 Ga0395900_0272758
2052 Ga0395898_0017601
2053 Ga0395898_0028587
2054 Ga0395898_0088505
2055 Ga0395898_0152606
2056 Ga0395898_0195694
2057 Ga0395905_0020329
2058 Ga0395905_0046809
2059 Ga0436364_0974159
2060 Ga0395901_0008223
2061 Ga0395901_0230018
2062 Ga0395901_0248432
2063 Ga0395901_0305113
2064 Ga0436365_0902375
2065 Ga0436365_1181574
2066 Ga0436365_1371184
2067 Ga0436365_1421230
2068 Ga0436360_1202522
2069 Ga0436361_0189402
2070 Ga0436363_0012099
2071 Ga0436363_0300253
2072 Ga0436363_0351383
2073 Ga0436363_0717611
2074 Ga0436363_0972840
2075 Ga0436362_0993687
2076 Ga0439459_0027711
2077 Ga0466972_0000177
2078 Ga0466972_0009169
2079 Ga0466965_0060131
2080 Ga0466966_0008326
2081 Ga0466966_0112238
2082 Ga0466966_0127871
2083 Ga0466961_0000023
2084 Ga0466963_0139531
2085 Ga0466963_0248798
2086 Ga0466971_0050539
2087 Ga0466968_0001025
2088 Ga0466968_0063853
2089 Ga0466957_0042855
2090 Ga0466960_0039020
2091 Ga0466959_0011640
2092 Ga0466959_0030640
2093 Ga0466967_0055936
2094 Ga0466967_0121122
2095 Ga0466967_0184510
2096 Ga0466967_0235009
2097 Ga0495617_022025
2098 Ga0495617_044644
2099 Ga0495592_0014358
2100 Ga0495592_0030040
2101 Ga0495592_0041543
2102 Ga0495592_0064793
2103 Ga0495603_0000521
2104 Ga0495603_0001754
2105 Ga0495603_0008860
2106 Ga0495603_0025504
2107 Ga0495603_0028412
2108 Ga0495603_0029577
2109 Ga0495603_0051688
2110 Ga0495629_0000416
2111 Ga0495629_0015774
2112 Ga0495629_0027646
2113 Ga0495629_0032989
2114 Ga0495629_0252456
2115 Ga0495638_0022170
2116 Ga0495638_0038240
2117 Ga0495638_0182674
2118 Ga0495641_0002593
2119 Ga0495641_0140642
2120 Ga0495651_0017227
2121 Ga0495651_0019582
2122 Ga0495651_0080458
2123 Ga0495653_0003573
2124 Ga0495653_0023310
2125 Ga0495653_0210320
2126 Ga0495650_0039141
2127 Ga0495580_0016728
2128 Ga0495580_0039257
2129 Ga0495580_0113133
2130 Ga0495582_0002376
2131 Ga0495582_0070470
2132 Ga0495582_0080684
2133 Ga0495605_0065220
2134 Ga0495639_0001046
2135 Ga0495639_0061572
2136 Ga0495639_0096435
2137 Ga0495662_0008728
2138 Ga0495664_0009023
2139 Ga0495664_0009265
2140 Ga0495664_0050469
2141 Ga0495664_0125425
2142 Ga0495664_0126090
2143 Ga0495584_0016300
2144 Ga0495584_0080163
2145 Ga0495585_0035154
2146 Ga0495594_0000194
2147 Ga0495594_0015448
2148 Ga0495594_0074283
2149 Ga0495596_0093615
2150 Ga0495583_0028181
2151 Ga0495583_0061572
2152 Ga0495606_0002692
2153 Ga0495606_0028857
2154 Ga0495606_0212094
2155 Ga0495608_0005104
2156 Ga0495608_0031821
2157 Ga0495608_0032235
2158 Ga0495608_0032328
2159 Ga0495608_0172333
2160 Ga0495610_0027743
2161 Ga0495610_0037091
2162 Ga0495618_0049985
2163 Ga0495618_0060411
2164 Ga0495618_0075508
2165 Ga0495620_0010396
2166 Ga0495620_0033954
2167 Ga0495628_0044263
2168 Ga0495628_0058442
2169 Ga0495628_0106350
2170 Ga0495628_0321080
2171 Ga0495630_0006451
2172 Ga0495630_0097184
2173 Ga0495630_0134827
2174 Ga0495630_0333958
2175 Ga0495632_0077742
2176 Ga0495643_0076774
2177 Ga0495643_0168421
2178 Ga0495644_0012613
2179 Ga0495644_0028145
2180 Ga0495644_0052933
2181 Ga0495648_0000640
2182 Ga0495648_0004726
2183 Ga0495648_0031996
2184 Ga0495648_0093792
2185 Ga0495648_0155220
2186 Ga0495652_0010465
2187 Ga0495652_0030338
2188 Ga0495652_0046863
2189 Ga0495652_0062849
2190 Ga0495652_0075223
2191 Ga0495652_0094913
2192 Ga0495665_0028025
2193 Ga0495640_0006591
2194 Ga0495640_0011385
2195 Ga0495640_0020972
2196 Ga0495640_0030206
2197 Ga0495586_0175358
2198 Ga0495587_0010857
2199 Ga0495587_0035814
2200 Ga0495587_0082267
2201 Ga0495598_0080814
2202 Ga0495609_0024989
2203 Ga0495621_0045917
2204 Ga0495597_0089847
2205 Ga0495645_0012719
2206 Ga0495645_0012763
2207 Ga0495622_0002024
2208 Ga0495622_0060394
2209 Ga0495633_0035962
2210 Ga0495633_0036957
2211 Ga0495667_0009312
2212 Ga0495667_0020357
2213 Ga0495667_0030759
2214 Ga0495667_0114893
2215 Ga0495667_0196348
2216 Ga0495667_0256126
2217 Ga0495656_0005884
2218 Ga0495656_0014228
2219 Ga0495656_0021610
2220 Ga0495656_0038955
2221 Ga0495668_0013742
2222 Ga0495668_0091403
2223 Ga0495668_0099536
2224 Ga0495634_0000602
2225 Ga0495634_0029561
2226 Ga0495634_0031702
2227 Ga0495625_0012900
2228 Ga0495625_0068905
2229 Ga0495635_0002469
2230 Ga0495635_0003077
2231 Ga0495635_0047928
2232 Ga0495635_0116781
2233 Ga0495635_0247729
2234 Ga0495659_0025775
2235 Ga0495661_0078336
2236 Ga0495661_0108046
2237 Ga0495588_0025303
2238 Ga0495588_0037312
2239 Ga0495588_0119203
2240 Ga0495657_0004929
2241 Ga0495657_0021231
2242 Ga0495657_0026420
2243 Ga0495657_0044079
2244 Ga0495599_0006110
2245 Ga0495599_0006329
2246 Ga0495599_0011625
2247 Ga0495623_0004956
2248 Ga0495623_0011109
2249 Ga0495623_0016712
2250 Ga0495646_0048818
2251 Ga0495646_0060074
2252 Ga0495646_0076660
2253 Ga0495646_0108652
2254 Ga0495647_0000414
2255 Ga0495658_0002719
2256 Ga0495658_0028724
2257 Ga0495658_0183068
2258 Ga0495669_0044936
2259 Ga0495613_0022972
2260 Ga0495613_0033323
2261 Ga0495613_0148239
2262 Ga0495613_0188071
2263 Ga0495613_0208217
2264 Ga0495624_0003072
2265 Ga0495624_0038315
2266 Ga0495624_0068957
2267 Ga0495670_0001065
2268 Ga0495670_0043819
2269 Ga0495671_0065512
2270 Ga0495649_0026167
2271 Ga0495649_0046915
2272 Ga0495589_0022229
2273 Ga0495600_0012415
2274 Ga0495600_0012561
2275 Ga0495600_0038915
2276 Ga0495600_0081594
2277 Ga0495581_0000133
2278 Ga0495581_0132153
2279 Ga0495581_0150227
2280 Ga0495581_0202051
2281 Ga0495581_0256787
2282 Ga0495604_0013217
2283 Ga0495604_0054319
2284 Ga0495604_0089599
2285 Ga0495674_0000874
2286 Ga0495674_0012220
2287 Ga0495674_0054204
2288 Ga0495674_0317188
2289 Ga0495672_0025641
2290 Ga0495672_0035311
2291 Ga0495676_0015692
2292 Ga0495676_0064310
2293 Ga0495676_0120501
2294 Ga0495676_0134248
2295 Ga0495680_0017277
2296 Ga0495680_0053089
2297 Ga0495680_0258365
2298 Ga0495687_013529
2299 Ga0495675_0001856
2300 Ga0495675_0014102
2301 Ga0495675_0014120
2302 Ga0495673_0004092
2303 Ga0495684_0000294
2304 Ga0495684_0020080
2305 Ga0495684_0025060
2306 Ga0495684_0049052
2307 Ga0495686_0180977
2308 Ga0495593_0000022
2309 Ga0495593_0000744
2310 Ga0495593_0009120
2311 Ga0495593_0016629
2312 Ga0495593_0032757
2313 Ga0495602_0030626
2314 Ga0495602_0060623
2315 Ga0495602_0156786
2316 Ga0495602_0209035
2317 Ga0495602_0230461
2318 Ga0495602_0271777
2319 Ga0495614_0022860
2320 Ga0496100_0003499
2321 Ga0496100_0147031
2322 Ga0496101_0009124
2323 Ga0496101_0056421
2324 Ga0496101_0153683
2325 Ga0496101_0349734
2326 Ga0496102_0006184
2327 Ga0496102_0029606
2328 Ga0496102_0059757
2329 Ga0496102_0073409
2330 Ga0496102_0159376
2331 Ga0496102_0160810
2332 Ga0496102_0307848
2333 Ga0496103_0006862
2334 Ga0496103_0061923
2335 Ga0496103_0165405
2336 Ga0496103_0210261
2337 Ga0496104_0002005
2338 Ga0496104_0030942
2339 Ga0496104_0039125
2340 Ga0496104_0043721
2341 Ga0496104_0070616
2342 Ga0496104_0110978
2343 Ga0496104_0164368
2344 Ga0496104_0166508
2345 Ga0496105_0015812
2346 Ga0496105_0018819
2347 Ga0496105_0026728
2348 Ga0496105_0127943
2349 Ga0496105_0239545
2350 Ga0496106_0003691
2351 Ga0496106_0007852
2352 Ga0496106_0009940
2353 Ga0496106_0010150
2354 Ga0496106_0038934
2355 Ga0496106_0309438
2356 Ga0496106_0413790
2357 Ga0496107_0020799
2358 Ga0496107_0042505
2359 Ga0496107_0063392
2360 Ga0496107_0122472
2361 Ga0496107_0315214
2362 Ga0496108_0024899
2363 Ga0496108_0068090
2364 Ga0496108_0079127
2365 Ga0496108_0150464
2366 Ga0496108_0215261
2367 Ga0496109_0000910
2368 Ga0496109_0010481
2369 Ga0496109_0016308
2370 Ga0496109_0016600
2371 Ga0496109_0061904
2372 Ga0496109_0157729
2373 Ga0496109_0593720
2374 Ga0496110_0039029
2375 Ga0496110_0074770
2376 Ga0496110_0145765
2377 Ga0496110_0275393
2378 Ga0496111_0011896
2379 Ga0496111_0094046
2380 Ga0496111_0267495
2381 Ga0496111_0361996
2382 Ga0496112_0000022
2383 Ga0496112_0008650
2384 Ga0496112_0020467
2385 Ga0496112_0020945
2386 Ga0496112_0029523
2387 Ga0496112_0035183
2388 Ga0496112_0039089
2389 Ga0496112_0067762
2390 Ga0496112_0113658
2391 Ga0496112_0162367
2392 Ga0496112_0318263
2393 Ga0496113_0001596
2394 Ga0496113_0021222
2395 Ga0496113_0026536
2396 Ga0496113_0094105
2397 Ga0496113_0131651
2398 Ga0496114_0072883
2399 Ga0496114_0116982
2400 Ga0496114_0310704
2401 Ga0496114_0397536
2402 Ga0496115_0032084
2403 Ga0496115_0037994
2404 Ga0496115_0043743
2405 Ga0496115_0043883
2406 Ga0496115_0047207
2407 Ga0496115_0083801
2408 Ga0496115_0122982
2409 Ga0496115_0126130
2410 Ga0496115_0133100
2411 Ga0496115_0161714
2412 Ga0496115_0328247
2413 Ga0496116_0004251
2414 Ga0496117_0012698
2415 Ga0496117_0028820
2416 Ga0496118_0016505
2417 Ga0496118_0031958
2418 Ga0496118_0032185
2419 Ga0496119_0022613
2420 Ga0496119_0022773
2421 Ga0496119_0023433
2422 Ga0496120_0021002
2423 Ga0496120_0059770
2424 Ga0496120_0076022
2425 Ga0496121_0000146
2426 Ga0496121_0000254
2427 Ga0496121_0001567
2428 Ga0496121_0019232
2429 Ga0496121_0024814
2430 Ga0496121_0069007
2431 Ga0496121_0080649
2432 Ga0496121_0094782
2433 Ga0496121_0099020
2434 Ga0496121_0111711
2435 Ga0496121_0123657
2436 Ga0496121_0157723
2437 Ga0496121_0170222
2438 Ga0496121_0258583
2439 Ga0496121_0300586
2440 Ga0496122_0009335
2441 Ga0496122_0044528
2442 Ga0496122_0051764
2443 Ga0496122_0194241
2444 Ga0496124_0001236
2445 Ga0496124_0067274
2446 Ga0496124_0102995
2447 Ga0496124_0340978
2448 Ga0496125_0000099
2449 Ga0496125_0002791
2450 Ga0496125_0010906
2451 Ga0496125_0015991
2452 Ga0496125_0029525
2453 Ga0496125_0043420
2454 Ga0496125_0053712
2455 Ga0496126_0007002
2456 Ga0496126_0012504
2457 Ga0496126_0017287
2458 Ga0496126_0027699
2459 Ga0496126_0031094
2460 Ga0496126_0038428
2461 Ga0496126_0039889
2462 Ga0496126_0043377
2463 Ga0496126_0047403
2464 Ga0496126_0052470
2465 Ga0496126_0054860
2466 Ga0496126_0072997
2467 Ga0496126_0074489
2468 Ga0496126_0085828
2469 Ga0496126_0088703
2470 Ga0496126_0117052
2471 Ga0496126_0157571
2472 Ga0496126_0181511
2473 Ga0496126_0228793
2474 Ga0496126_0277747
2475 Ga0495678_045022
2476 Ga0495678_076933
2477 Ga0495682_0054436
2478 Ga0495682_0074821
2479 Ga0501031_0038957
2480 Ga0501031_0128997
2481 Ga0501033_0017918
2482 Ga0501033_0152040
2483 Ga0501033_0301708
2484 Ga0501034_0051004
2485 Ga0501034_0076053
2486 Ga0501034_0140986
2487 Ga0501034_0190086
2488 Ga0501034_0290059
2489 Ga0501034_0425660
2490 Ga0501036_0080538
2491 Ga0501036_0427198
2492 Ga0501037_0045907
2493 Ga0501037_0063104
2494 Ga0501037_0170333
2495 Ga0501037_0233594
2496 Ga0501038_0003347
2497 Ga0501038_0127264
2498 Ga0501038_0265321
2499 Ga0501039_0058689
2500 Ga0501039_0132838
2501 Ga0501039_0154459
2502 Ga0501039_0173689
2503 Ga0501040_0024640
2504 Ga0501042_0092237
2505 Ga0501043_0022652
2506 Ga0501043_0035798
2507 Ga0501043_0063091
2508 Ga0501043_0115915
2509 Ga0501046_0080691
2510 Ga0501046_0097458
2511 Ga0501046_0104382
2512 Ga0501046_0123973
2513 Ga0501047_0074414
2514 Ga0501048_0048652
2515 Ga0501048_0064298
2516 Ga0501067_0002459
2517 Ga0501067_0042939
2518 Ga0501068_0014532
2519 Ga0501069_0066775
2520 Ga0501069_0085199
2521 Ga0501070_0057445
2522 Ga0501070_0080344
2523 Ga0501070_0150891
2524 Ga0501071_0013466
2525 Ga0501072_0032282
2526 Ga0501072_0135256
2527 Ga0501073_0028457
2528 Ga0501073_0032066
2529 Ga0501073_0194538
2530 Ga0501073_0203203
2531 Ga0501074_0064390
2532 Ga0501077_0077753
2533 Ga0501079_0118133
2534 Ga0501080_0063191
2535 Ga0501083_0041501
2536 Ga0501035_0084000
2537 Ga0501035_0090339
2538 Ga0501035_0110125
2539 Ga0501035_0170282
2540 Ga0501035_0411886
2541 Ga0501044_0032392
2542 Ga0501044_0037782
2543 Ga0501044_0038321
2544 Ga0501044_0088359
2545 Ga0501044_0138564
2546 Ga0501044_0223236
2547 Ga0501044_0240445
2548 Ga0501044_0565022
2549 Ga0501045_0024317
2550 nmdc:mga03683_101559_c1
2551 nmdc:mga03683_60325_c1
2552 nmdc:mga03n38_2791_c1
2553 nmdc:mga03n38_71308_c1
2554 nmdc:mga00v17_4195_c1
2555 nmdc:mga00v17_70029_c1
2556 nmdc:mga00v17_7814_c1
2557 nmdc:mga0yw44_27245_c1
2558 nmdc:mga0yw44_51316_c1
2559 nmdc:mga0yw44_66487_c1
2560 nmdc:mga0yw44_69816_c1
2561 nmdc:mga0yw44_73238_c1
2562 nmdc:mga0yw44_8369_c1
2563 nmdc:mga0yw44_97315_c1
2564 nmdc:mga0k408_100867_c1
2565 nmdc:mga0k408_40338_c1
2566 nmdc:mga0k408_60219_c1
2567 nmdc:mga06z11_12111_c1
2568 nmdc:mga06z11_22737_c1
2569 nmdc:mga06z11_228368_c1
2570 nmdc:mga06z11_2940_c1
2571 nmdc:mga06z11_63873_c1
2572 nmdc:mga07m45_104960_c1
2573 nmdc:mga07m45_14891_c1
2574 nmdc:mga07m45_4272_c1
2575 nmdc:mga07m45_66119_c1
2576 nmdc:mga07m45_6917_c1
2577 nmdc:mga05p37_20147_c1
2578 nmdc:mga05p37_72277_c1
2579 nmdc:mga0qj67_101885_c1
2580 nmdc:mga06r32_56945_c1
2581 nmdc:mga0n895_33569_c1
2582 nmdc:mga0n895_348159_c1
2583 nmdc:mga0n895_71602_c1
2584 nmdc:mga0sz30_1155_c1
2585 nmdc:mga0sz30_2482_c1
2586 Ga0495601_0004994
2587 Ga0495601_0013942
2588 Ga0495601_0170591
2589 Ga0495601_0187674
2590 Ga0495612_0011892
2591 Ga0495612_0030072
2592 Ga0500635_0011261
2593 Ga0495595_0000670
2594 Ga0495595_0016585
2595 Ga0495619_0026443
2596 Ga0495619_0035364
2597 Ga0495619_0095687
2598 Ga0500578_0206155
2599 Ga0500643_000052
2600 Ga0500651_0014169
2601 Ga0500566_0002331
2602 Ga0500566_0002512
2603 Ga0500566_0002754
2604 Ga0500566_0011017
2605 Ga0500566_0054199
2606 Ga0500641_0037727
2607 Ga0500641_0091352
2608 Ga0500556_0000035
2609 Ga0500557_000057
2610 Ga0500562_019096
2611 Ga0500572_000655
2612 Ga0500572_003541
2613 Ga0500591_058871
2614 Ga0500594_0002896
2615 Ga0500595_002818
2616 Ga0500595_004352
2617 Ga0500595_028193
2618 Ga0500595_034967
2619 Ga0500595_062917
2620 Ga0500607_109387
2621 Ga0500608_000780
2622 Ga0500614_003528
2623 Ga0500618_004716
2624 Ga0500642_0000027
2625 Ga0500642_0000263
2626 Ga0500642_0112543
2627 Ga0500652_000934
2628 Ga0500559_0000064
2629 Ga0500559_0000486
2630 Ga0500559_0003342
2631 Ga0500559_0015332
2632 Ga0500559_0070038
2633 Ga0500568_0001465
2634 Ga0500568_0022037
2635 Ga0500577_0000035
2636 Ga0500588_0053235
2637 Ga0500589_041912
2638 Ga0500590_017886
2639 Ga0500590_054044
2640 Ga0500603_000667
2641 Ga0500603_001350
2642 Ga0500604_0002237
2643 Ga0500604_0053553
2644 Ga0500616_0000028
2645 Ga0500616_0000054
2646 Ga0500622_0003626
2647 Ga0500622_0006780
2648 Ga0500627_0002332
2649 Ga0500634_0017216
2650 Ga0500634_0042983
2651 Ga0500634_0121455
2652 Ga0500638_044057
2653 Ga0500639_001074
2654 Ga0500639_132718
2655 Ga0500636_0026615
2656 Ga0500636_0030405
2657 Ga0500636_0043902
2658 Ga0500636_0067038
2659 Ga0500636_0126036
2660 Ga0500636_0220568
2661 Ga0500637_0001280
2662 Ga0500637_0001814
2663 Ga0500637_0138128
2664 Ga0500625_118975
2665 Ga0500645_014952
2666 Ga0500645_041853
2667 Ga0500609_006142
2668 Ga0500596_000644
2669 Ga0500596_008419
2670 Ga0500599_002539
2671 Ga0500601_003142
2672 Ga0501084_0005438
2673 Ga0500661_001546
2674 Ga0501082_0000040
2675 Ga0501082_0018483
2676 2507504329
2677 2508545763
2678 2508694588
2679 2511398407
2680 2513624499
2681 2513638637
2682 2513649974
2683 2513655412
2684 2513697537
2685 2513703218
2686 2513716819
2687 2513860024
2688 2513874267
2689 2513892378
2690 2513916510
2691 2514009967
2692 2515624483
2693 2517104587
2694 2517889899
2695 2524438544
2696 2524470516
2697 2524532912
2698 2528850393
2699 2603860613
2700 2617354172
2701 2617374670
2702 2644290205
2703 2671121077
2704 2723842580
2705 2728751703
2706 2745077231
2707 2793059402
2708 2793068153
2709 2793077886
2710 2793078549
2711 2805916033
2712 2818240974
2713 2824604424
2714 2824615035
2715 2824626176
2716 2824633229
2717 2824643189
2718 2824651380
2719 2824659181
2720 2824665225
2721 2824676380
2722 2824687070
2723 2824692702
2724 2824703725
2725 2824713910
2726 2824722721
2727 2824731413
2728 2824738367
2729 2824751268
2730 2824761105
2731 2824771778
2732 2824778250
2733 2838126128
2734 2841942479
2735 2841953174
2736 2841960681
2737 2841970801
2738 2841977940
2739 2841984499
2740 2842041781
2741 2842049823
2742 2844321335
2743 2847932075
2744 2847943312
2745 2849077040
2746 2857514686
2747 2857525571
2748 2874595714
2749 2874606736
2750 2874620286
2751 2874624222
2752 2874630306
2753 2874651654
2754 2876767662
2755 2876775909
2756 2876816682
2757 2876821549
2758 2879080000
2759 2879085750
2760 2879100582
2761 2879113553
2762 2879114941
2763 2879134083
2764 2879148568
2765 2881367722
2766 2881669315
2767 2885374483
2768 2885379427
2769 2885388230
2770 2885412168
2771 2888387633
2772 2888391529
2773 2888426849
2774 2889034135
2775 2889037708
2776 2893070710
2777 2903731475
2778 2903750746
2779 2904670933
2780 2904692663
2781 2904711120
2782 2904713561
2783 2906607949
2784 2906612363
2785 2906633079
2786 2906638311
2787 2906650128
2788 2906663404
2789 2908739764
2790 2908757875
2791 2908777151
2792 2919074621
2793 2922367533
2794 2922376617
2795 2922391508
2796 2922398567
2797 2922426932
2798 2929619878
2799 2929629190
2800 2932789677
2801 2932796655
2802 2932802565
2803 2932814816
2804 2932824327
2805 2932833946
2806 2933581796
2807 2935613256
2808 2935623664
2809 2935633091
2810 2935645052
2811 2935656630
2812 2935665446
2813 2935672101
2814 2935684093
2815 2935689141
2816 2935697598
2817 2935711377
2818 2935720087
2819 2935728296
2820 2935737107
2821 2935746832
2822 2935757799
2823 2935764178
2824 2935775195
2825 2935780097
2826 2935790219
2827 2935798739
2828 2935808764
2829 2935817561
2830 2935824890
2831 2935834102
2832 2935844705
2833 2935852110
2834 2935861729
2835 2935868635
2836 2935879409
2837 2935886995
2838 2935911457
2839 2935920992
2840 2935928486
2841 2935938131
2842 2935945413
2843 2935954081
2844 2935965460
2845 2935971651
2846 2935980055
2847 2935989483
2848 2935998423
2849 2936009116
2850 2936019493
2851 2936028097
2852 2936036931
2853 2936044358
2854 2936054954
2855 2936060739
2856 2940563379
2857 2941509607
2858 2941517436
2859 2941526611
2860 2941531908
2861 2941545400
2862 3005476116
2863 3005486005
2864 3005506672
2865 3005592743
2866 3005601687
2867 3005717424
2868 3005724369
2869 8006932549
2870 8006937430
2871 8006965879
2872 8006977459
2873 8006984730
2874 8006986203
2875 8006999143
2876 8016519220
2877 8016525102
2878 8016538678
2879 8016542967
2880 8016550326
2881 8016558733
2882 8016568365
2883 8016581023
2884 8016587702
2885 8016596708
2886 8016607583
2887 8016619376
2888 8016630216
2889 8016636935
2890 8017066289
2891 8019538350
2892 8019541472
2893 8019549156
2894 8019561195
2895 8019571285
2896 8019596371
2897 8019605331
2898 8019613211
2899 8019623895
2900 8019638146
2901 8019641490
2902 8019651551
2903 8019666061
2904 8019675578
2905 8019680521
2906 8055750370
2907 8056678862
2908 8056685977
2909 8056691991
2910 8056976139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

102

358

0.94

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

105

358

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

114

364

0.51

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8617 15 306
7l4u-assembly1.cif.gz_A crystal structure of human monoacylglycerol lipase in complex with compound 1h 0.8539 17 309
3jw8-assembly1.cif.gz_A crystal structure of human mono-glyceride lipase 0.852 17 309
7p0y-assembly2.cif.gz_B crystal structure of mtbmgl k74a (substrate analog complex) 0.8453 16 306
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.8418 15 306
ID Description Score Start End Superfamily
af_P07000_24_333_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9237 14 312 3.40.50.1820
af_P07000_24_333_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8894 14 312 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8779 16 151 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8634 15 306 3.40.50.1820
3hjuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8468 17 309 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A8B6M5C1-F1-model_v4 Alpha/beta hydrolase 0.9808 1 314 GO:0016787
AF-A0A2H6J2D2-F1-model_v4 Lysophospholipase L2 0.9782 20 311
AF-A0A7X3MT80-F1-model_v4 Alpha/beta fold hydrolase 0.9761 1 312 GO:0016787
AF-A0A4R2GU98-F1-model_v4 Lysophospholipase 0.9752 1 311
AF-A0A8B6M5C1-F1-model_v4 Alpha/beta hydrolase 0.9747 1 314 GO:0016787

Map