F494089

General Info

Members Datasets Scaffolds Average Seq Length
1456 477 2912 264

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000279|Ga0213875_100002797
Length 315
Sequence LSDEVLRLRGVAVRRETSMLLRSIDWTAHEDERWIVIGPNGAGKTTLLQVAATLLFPTEGTVEVLGQRLGEVDVFDLRPRIGLTSAALAERVPAGEKVIDLVLTASYAILGRWKEEYESADVTRAVELLDALGCAHLIRRRFATLSEGERKRVQIARALMPDPELLLLDEPAAGLDLGGREDLLQRLSQLARNPKAPMMVLVTHHVEEVPDGFTHAMLLRRGSVLAAGPVADVFTARNLSKCFGIPLEIEYRRSRWSAFASPGGRPPGTPRLPAAVLAVASRGRRAVGEIPGREGVAGTLRRAPVPCTCRVVRAE

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
99 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
100 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
101 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
190 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
191 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
196 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
225 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
226 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
227 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
233 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
257 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
258 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
265 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
266 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
269 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
270 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
271 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
272 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
275 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
276 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
277 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
278 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
279 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
280 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
281 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
282 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
283 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
284 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
285 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
286 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
287 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
288 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
289 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
292 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
293 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
294 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
295 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
301 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
307 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
308 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
309 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
310 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
311 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
314 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
315 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
316 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
317 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
318 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
319 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
320 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
321 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
322 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
323 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
324 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
325 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
326 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
330 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
331 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
332 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
333 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
334 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
335 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
339 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
340 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
343 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
344 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
345 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
346 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
347 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
348 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
353 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
354 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
355 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
356 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
359 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
360 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
361 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
362 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
363 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
364 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
365 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
368 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
369 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
370 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
371 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
380 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
381 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
382 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
383 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
384 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
385 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
399 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
400 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
401 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
402 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
403 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
404 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
405 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
406 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
407 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
408 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
409 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
410 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
413 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
416 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
417 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
423 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
426 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
427 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
430 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
431 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
432 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
433 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
434 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
435 2643221711 Terrabacter sp. Root85 Isolate Unclassified
436 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
437 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
438 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
439 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
440 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
441 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
442 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
443 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
444 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
445 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
446 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
447 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
448 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
449 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
450 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
451 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
452 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
453 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
454 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
455 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
456 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
457 2891562705 Microbispora tritici MT50 Isolate Unclassified
458 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
459 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
460 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
461 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
462 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
463 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
464 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
465 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
466 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
467 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
468 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
469 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
470 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
471 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
472 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
473 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
474 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
475 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
476 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
477 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.09
Metatranscriptomes 0.82
Isolates 3.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0.07
Rhizoplane 6.87
Rhizosphere 87.64
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000279 3300021388 Bacteria 50175
2 JGI25152J39213_1000140 3300002773 Bacteria 49435
3 JGI25404J52841_10005090 3300003659 Bacteria 2704
4 JGI25404J52841_10026453 3300003659 Bacteria 1248
5 Ga0065714_10006475 3300005288 Bacteria 3278
6 Ga0070658_10037640 3300005327 Bacteria 3901
7 Ga0070658_10041079 3300005327 Bacteria 3732
8 Ga0070658_10365269 3300005327 Bacteria 1237
9 Ga0070676_10034801 3300005328 Bacteria 2893
10 Ga0070676_10066430 3300005328 Bacteria 2155
11 Ga0070676_10142671 3300005328 Bacteria 1526
12 Ga0070683_100001232 3300005329 Bacteria 19471
13 Ga0070683_100023183 3300005329 Bacteria 5551
14 Ga0070683_100038676 3300005329 Bacteria 4374
15 Ga0070683_100126071 3300005329 Bacteria 2421
16 Ga0070683_100399913 3300005329 Bacteria 1310
17 Ga0070690_100078081 3300005330 Bacteria 2162
18 Ga0070690_100094011 3300005330 Bacteria 1978
19 Ga0070670_100152472 3300005331 Bacteria 2000
20 Ga0068869_100048676 3300005334 Bacteria 3066
21 Ga0070666_10015201 3300005335 Bacteria 4908
22 Ga0070680_100020946 3300005336 Bacteria 5191
23 Ga0070680_100096329 3300005336 Bacteria 2453
24 Ga0070680_100261212 3300005336 Bacteria 1465
25 Ga0070680_100511273 3300005336 Bacteria 1028
26 Ga0070680_100560137 3300005336 Bacteria 980
27 Ga0070682_100007568 3300005337 Bacteria 6120
28 Ga0070682_100010252 3300005337 Bacteria 5315
29 Ga0070682_100041585 3300005337 Bacteria 2834
30 Ga0070682_100054771 3300005337 Bacteria 2504
31 Ga0070682_100177740 3300005337 Bacteria 1484
32 Ga0068868_100072693 3300005338 Bacteria 2744
33 Ga0068868_100088079 3300005338 Bacteria 2498
34 Ga0070660_100045964 3300005339 Bacteria 3345
35 Ga0070689_100122383 3300005340 Bacteria 2079
36 Ga0070691_10010867 3300005341 Bacteria 4155
37 Ga0070691_10030466 3300005341 Bacteria 2527
38 Ga0070687_100217974 3300005343 Bacteria 1167
39 Ga0070661_100065930 3300005344 Bacteria 2660
40 Ga0070661_100119649 3300005344 Bacteria 1972
41 Ga0070692_10049130 3300005345 Bacteria 2187
42 Ga0070692_10063335 3300005345 Bacteria 1953
43 Ga0070668_100150927 3300005347 Bacteria 1879
44 Ga0070668_100394332 3300005347 Bacteria 1181
45 Ga0070669_100129893 3300005353 Bacteria 1931
46 Ga0070675_100018324 3300005354 Bacteria 5573
47 Ga0070675_100039053 3300005354 Bacteria 3871
48 Ga0070671_100049585 3300005355 Bacteria 3493
49 Ga0070671_100142149 3300005355 Bacteria 2025
50 Ga0070673_100128824 3300005364 Bacteria 2120
51 Ga0070673_100521723 3300005364 Bacteria 1077
52 Ga0070673_100571776 3300005364 Bacteria 1028
53 Ga0070659_100048728 3300005366 Bacteria 3329
54 Ga0070659_100255916 3300005366 Bacteria 1452
55 Ga0070703_10006990 3300005406 Bacteria 3163
56 Ga0070709_10119243 3300005434 Bacteria 1786
57 Ga0070709_10132298 3300005434 Bacteria 1704
58 Ga0070714_100000106 3300005435 Bacteria 70067
59 Ga0070714_100003050 3300005435 Bacteria 12422
60 Ga0070714_100011007 3300005435 Bacteria 7165
61 Ga0070714_100068535 3300005435 Bacteria 3061
62 Ga0070714_100086279 3300005435 Bacteria 2743
63 Ga0070714_100089153 3300005435 Bacteria 2700
64 Ga0070714_100116118 3300005435 Bacteria 2376
65 Ga0070714_100215886 3300005435 Bacteria 1761
66 Ga0070714_100294787 3300005435 Bacteria 1510
67 Ga0070714_100368581 3300005435 Bacteria 1352
68 Ga0070714_100549624 3300005435 Bacteria 1105
69 Ga0070713_100002552 3300005436 Bacteria 11908
70 Ga0070713_100008841 3300005436 Bacteria 7171
71 Ga0070713_100010745 3300005436 Bacteria 6630
72 Ga0070713_100026673 3300005436 Bacteria 4539
73 Ga0070713_100041218 3300005436 Bacteria 3760
74 Ga0070713_100050651 3300005436 Bacteria 3431
75 Ga0070713_100070574 3300005436 Bacteria 2949
76 Ga0070713_100083862 3300005436 Bacteria 2725
77 Ga0070713_100251386 3300005436 Bacteria 1612
78 Ga0070713_100651521 3300005436 Bacteria 1003
79 Ga0070710_10007646 3300005437 Bacteria 5239
80 Ga0070710_10015638 3300005437 Bacteria 3844
81 Ga0070710_10024332 3300005437 Bacteria 3193
82 Ga0070710_10028942 3300005437 Bacteria 2968
83 Ga0070710_10065028 3300005437 Bacteria 2088
84 Ga0070710_10072542 3300005437 Bacteria 1988
85 Ga0070710_10074785 3300005437 Bacteria 1961
86 Ga0070701_10040585 3300005438 Bacteria 2367
87 Ga0070701_10060258 3300005438 Bacteria 1998
88 Ga0070711_100003698 3300005439 Bacteria 8957
89 Ga0070711_100159984 3300005439 Bacteria 1706
90 Ga0070705_100016297 3300005440 Bacteria 3861
91 Ga0070705_100021518 3300005440 Bacteria 3433
92 Ga0070705_100379451 3300005440 Bacteria 1040
93 Ga0070700_100000032 3300005441 Bacteria 114995
94 Ga0070700_100016501 3300005441 Bacteria 4207
95 Ga0070700_100088159 3300005441 Bacteria 2019
96 Ga0070694_100008433 3300005444 Bacteria 6305
97 Ga0070708_100004613 3300005445 Bacteria 10850
98 Ga0070708_100014087 3300005445 Bacteria 6572
99 Ga0070708_100030992 3300005445 Bacteria 4626
100 Ga0070708_100041624 3300005445 Bacteria 4028
101 Ga0070708_100063836 3300005445 Bacteria 3297
102 Ga0070708_100131996 3300005445 Bacteria 2312
103 Ga0070663_100002903 3300005455 Bacteria 9744
104 Ga0070663_100016265 3300005455 Bacteria 4825
105 Ga0070678_100003362 3300005456 Bacteria 8917
106 Ga0070678_100023732 3300005456 Bacteria 4093
107 Ga0070681_10265389 3300005458 Bacteria 1628
108 Ga0070681_10327749 3300005458 Bacteria 1441
109 Ga0070685_10097188 3300005466 Bacteria 1793
110 Ga0070706_100001339 3300005467 Bacteria 26189
111 Ga0070706_100002385 3300005467 Bacteria 18952
112 Ga0070706_100009601 3300005467 Bacteria 8998
113 Ga0070706_100012481 3300005467 Bacteria 7871
114 Ga0070706_100016812 3300005467 Bacteria 6758
115 Ga0070706_100022152 3300005467 Bacteria 5850
116 Ga0070706_100063501 3300005467 Bacteria 3413
117 Ga0070706_100066956 3300005467 Bacteria 3322
118 Ga0070706_100074265 3300005467 Bacteria 3147
119 Ga0070706_100160898 3300005467 Bacteria 2096
120 Ga0070706_100233845 3300005467 Bacteria 1716
121 Ga0070706_100251843 3300005467 Bacteria 1649
122 Ga0070707_100002030 3300005468 Bacteria 19371
123 Ga0070707_100002309 3300005468 Bacteria 18227
124 Ga0070707_100008144 3300005468 Bacteria 9724
125 Ga0070707_100033800 3300005468 Bacteria 4876
126 Ga0070707_100067555 3300005468 Bacteria 3439
127 Ga0070707_100075099 3300005468 Bacteria 3260
128 Ga0070707_100077254 3300005468 Bacteria 3212
129 Ga0070707_100100904 3300005468 Bacteria 2796
130 Ga0070707_100189752 3300005468 Bacteria 2004
131 Ga0070707_100231986 3300005468 Bacteria 1796
132 Ga0070698_100000546 3300005471 Bacteria 40175
133 Ga0070698_100000603 3300005471 Bacteria 38616
134 Ga0070698_100005898 3300005471 Bacteria 13363
135 Ga0070698_100007558 3300005471 Bacteria 11755
136 Ga0070698_100008876 3300005471 Bacteria 10807
137 Ga0070698_100029873 3300005471 Bacteria 5655
138 Ga0070698_100035273 3300005471 Bacteria 5173
139 Ga0070698_100039145 3300005471 Bacteria 4882
140 Ga0070698_100057134 3300005471 Bacteria 3950
141 Ga0070698_100064438 3300005471 Bacteria 3692
142 Ga0070698_100130505 3300005471 Bacteria 2468
143 Ga0070698_100152667 3300005471 Bacteria 2256
144 Ga0070698_100180223 3300005471 Bacteria 2051
145 Ga0070698_100226293 3300005471 Bacteria 1804
146 Ga0070699_100001575 3300005518 Bacteria 20852
147 Ga0070679_100023566 3300005530 Bacteria 6027
148 Ga0070679_100024087 3300005530 Bacteria 5963
149 Ga0070679_100097856 3300005530 Bacteria 2921
150 Ga0070679_100135810 3300005530 Bacteria 2440
151 Ga0070679_100259317 3300005530 Bacteria 1694
152 Ga0070684_100001567 3300005535 Bacteria 16507
153 Ga0070684_100025965 3300005535 Bacteria 4929
154 Ga0070684_100109092 3300005535 Bacteria 2480
155 Ga0070684_100183094 3300005535 Bacteria 1905
156 Ga0070684_100241134 3300005535 Bacteria 1652
157 Ga0070684_100431690 3300005535 Bacteria 1217
158 Ga0070697_100012968 3300005536 Bacteria 6531
159 Ga0070697_100056754 3300005536 Bacteria 3186
160 Ga0070697_100081358 3300005536 Bacteria 2669
161 Ga0070697_100124388 3300005536 Bacteria 2159
162 Ga0068853_100127427 3300005539 Bacteria 2275
163 Ga0070686_100023146 3300005544 Bacteria 3709
164 Ga0070686_100040954 3300005544 Bacteria 2892
165 Ga0070695_100007032 3300005545 Bacteria 6668
166 Ga0070695_100117539 3300005545 Bacteria 1814
167 Ga0070696_100000771 3300005546 Bacteria 20574
168 Ga0070696_100007537 3300005546 Bacteria 7279
169 Ga0070696_100033355 3300005546 Bacteria 3537
170 Ga0070693_100000790 3300005547 Bacteria 13964
171 Ga0070693_100038449 3300005547 Bacteria 2674
172 Ga0070665_100062161 3300005548 Bacteria 3744
173 Ga0070665_100128101 3300005548 Bacteria 2541
174 Ga0070665_100208501 3300005548 Bacteria 1955
175 Ga0070704_100103523 3300005549 Bacteria 2150
176 Ga0068855_100153052 3300005563 Bacteria 2621
177 Ga0068857_100455458 3300005577 Bacteria 1196
178 Ga0068854_100013646 3300005578 Bacteria 5338
179 Ga0068856_100058004 3300005614 Bacteria 3823
180 Ga0068856_100133415 3300005614 Bacteria 2488
181 Ga0068856_100279141 3300005614 Bacteria 1687
182 Ga0068856_100406768 3300005614 Bacteria 1380
183 Ga0070702_100004694 3300005615 Bacteria 6268
184 Ga0070702_100055450 3300005615 Bacteria 2285
185 Ga0068852_100083196 3300005616 Bacteria 2845
186 Ga0068852_100146623 3300005616 Bacteria 2190
187 Ga0068864_100009054 3300005618 Bacteria 8207
188 Ga0068864_100439866 3300005618 Bacteria 1245
189 Ga0068861_100298242 3300005719 Bacteria 1395
190 Ga0068870_10184942 3300005840 Bacteria 1253
191 Ga0068863_100031657 3300005841 Bacteria 5047
192 Ga0068863_100216938 3300005841 Bacteria 1843
193 Ga0068860_100095557 3300005843 Bacteria 2833
194 Ga0081455_10009965 3300005937 Bacteria 9715
195 Ga0081455_10122766 3300005937 Bacteria 2044
196 Ga0081455_10139456 3300005937 Bacteria 1885
197 Ga0081538_10001393 3300005981 Bacteria 24785
198 Ga0081540_1000345 3300005983 Bacteria 46912
199 Ga0081540_1002862 3300005983 Bacteria 13954
200 Ga0081540_1056961 3300005983 Bacteria 1893
201 Ga0070717_10004502 3300006028 Bacteria 10071
202 Ga0070717_10019476 3300006028 Bacteria 5322
203 Ga0070717_10027018 3300006028 Bacteria 4584
204 Ga0070717_10029071 3300006028 Bacteria 4431
205 Ga0070717_10223296 3300006028 Bacteria 1656
206 Ga0070717_10233681 3300006028 Bacteria 1619
207 Ga0070717_10235691 3300006028 Bacteria 1612
208 Ga0070717_10238522 3300006028 Bacteria 1603
209 Ga0075432_10001623 3300006058 Bacteria 7395
210 Ga0075432_10004430 3300006058 Bacteria 4784
211 Ga0075432_10103550 3300006058 Bacteria 1054
212 Ga0070715_10139307 3300006163 Bacteria 1176
213 Ga0070715_10154831 3300006163 Bacteria 1127
214 Ga0070716_100004563 3300006173 Bacteria 6638
215 Ga0070716_100074442 3300006173 Bacteria 2006
216 Ga0070716_100130020 3300006173 Bacteria 1590
217 Ga0070716_100348339 3300006173 Bacteria 1047
218 Ga0070712_100000686 3300006175 Bacteria 19993
219 Ga0070712_100012108 3300006175 Bacteria 5480
220 Ga0070712_100063385 3300006175 Bacteria 2617
221 Ga0070712_100346651 3300006175 Bacteria 1214
222 Ga0070712_100689965 3300006175 Bacteria 870
223 Ga0075367_10079522 3300006178 Bacteria 1982
224 Ga0075367_10297830 3300006178 Bacteria 1015
225 Ga0097621_100104682 3300006237 Bacteria 2385
226 Ga0068871_100098374 3300006358 Bacteria 2447
227 Ga0068871_100107880 3300006358 Bacteria 2339
228 Ga0075428_100000550 3300006844 Bacteria 38346
229 Ga0075428_100000883 3300006844 Bacteria 31556
230 Ga0075428_100090930 3300006844 Bacteria 3330
231 Ga0075428_100171638 3300006844 Bacteria 2350
232 Ga0075430_100137972 3300006846 Bacteria 2031
233 Ga0075431_100022433 3300006847 Bacteria 6453
234 Ga0075431_100066828 3300006847 Bacteria 3712
235 Ga0075431_100077379 3300006847 Bacteria 3434
236 Ga0075433_10019092 3300006852 Bacteria 5703
237 Ga0075433_10022654 3300006852 Bacteria 5275
238 Ga0075433_10042941 3300006852 Bacteria 3924
239 Ga0075433_10062467 3300006852 Bacteria 3262
240 Ga0075434_100024868 3300006871 Bacteria 5855
241 Ga0075434_100040248 3300006871 Bacteria 4629
242 Ga0075434_100171584 3300006871 Bacteria 2189
243 Ga0075434_100488771 3300006871 Bacteria 1252
244 Ga0075429_100260772 3300006880 Bacteria 1517
245 Ga0075429_100318478 3300006880 Bacteria 1361
246 Ga0075436_100000929 3300006914 Bacteria 19535
247 Ga0075436_100019491 3300006914 Bacteria 4649
248 Ga0075436_100058056 3300006914 Bacteria 2672
249 Ga0075436_100069714 3300006914 Bacteria 2430
250 Ga0075436_100103298 3300006914 Bacteria 1986
251 Ga0075435_100013427 3300007076 Bacteria 6094
252 Ga0075435_100085039 3300007076 Bacteria 2604
253 Ga0075435_100729832 3300007076 Bacteria 861
254 Ga0099794_10066788 3300007265 Bacteria 1755
255 Ga0111539_10000342 3300009094 Bacteria 57280
256 Ga0111539_10055497 3300009094 Bacteria 4709
257 Ga0105245_10023219 3300009098 Bacteria 5444
258 Ga0105245_10031225 3300009098 Bacteria 4713
259 Ga0105245_10068388 3300009098 Bacteria 3218
260 Ga0105245_10108505 3300009098 Bacteria 2578
261 Ga0105245_10123453 3300009098 Bacteria 2421
262 Ga0105245_10148480 3300009098 Bacteria 2214
263 Ga0105245_10296017 3300009098 Bacteria 1586
264 Ga0105245_10330414 3300009098 Bacteria 1504
265 Ga0105247_10035569 3300009101 Bacteria 3036
266 Ga0114129_10002267 3300009147 Bacteria 26615
267 Ga0114129_10143862 3300009147 Bacteria 3267
268 Ga0114129_10208890 3300009147 Bacteria 2640
269 Ga0114129_10291473 3300009147 Bacteria 2178
270 Ga0114129_10700278 3300009147 Bacteria 1302
271 Ga0114129_10971568 3300009147 Bacteria 1071
272 Ga0105243_10023631 3300009148 Bacteria 4683
273 Ga0105243_10097396 3300009148 Bacteria 2435
274 Ga0105243_10138265 3300009148 Bacteria 2075
275 Ga0105243_10274200 3300009148 Bacteria 1516
276 Ga0105241_10002632 3300009174 Bacteria 13450
277 Ga0105241_10171665 3300009174 Bacteria 1791
278 Ga0105241_10217135 3300009174 Bacteria 1605
279 Ga0105248_10035978 3300009177 Bacteria 5538
280 Ga0105248_10039070 3300009177 Bacteria 5314
281 Ga0105248_10111205 3300009177 Bacteria 3089
282 Ga0105248_10148860 3300009177 Bacteria 2641
283 Ga0105237_10092314 3300009545 Bacteria 3017
284 Ga0105237_10462450 3300009545 Bacteria 1275
285 Ga0105238_10089595 3300009551 Bacteria 3063
286 Ga0105238_10165729 3300009551 Bacteria 2185
287 Ga0105238_10166610 3300009551 Bacteria 2179
288 Ga0105239_10001401 3300010375 Bacteria 32259
289 Ga0105239_10183026 3300010375 Bacteria 2344
290 Ga0105246_10001050 3300011119 Bacteria 15950
291 Ga0105246_10002276 3300011119 Bacteria 11577
292 Ga0105246_10002387 3300011119 Bacteria 11335
293 Ga0105246_10178396 3300011119 Bacteria 1633
294 Ga0105246_10538941 3300011119 Bacteria 998
295 Ga0157340_1000795 3300012473 Bacteria 1306
296 Ga0157328_1003268 3300012478 Bacteria 836
297 Ga0157320_1001769 3300012481 Bacteria 1140
298 Ga0157326_1005455 3300012513 Bacteria 1346
299 Ga0157371_10005477 3300013102 Bacteria 10691
300 Ga0157370_10114716 3300013104 Bacteria 2517
301 Ga0157369_10041463 3300013105 Bacteria 5025
302 Ga0157369_10090991 3300013105 Bacteria 3257
303 Ga0157369_10131475 3300013105 Bacteria 2652
304 Ga0157369_10139130 3300013105 Bacteria 2569
305 Ga0157369_10196332 3300013105 Bacteria 2119
306 Ga0163162_10034522 3300013306 Bacteria 5033
307 Ga0163162_10583852 3300013306 Bacteria 1244
308 Ga0157372_10006117 3300013307 Bacteria 12793
309 Ga0157372_10253696 3300013307 Bacteria 2042
310 Ga0157372_10274844 3300013307 Bacteria 1958
311 Ga0157372_10656946 3300013307 Bacteria 1221
312 Ga0157375_10059104 3300013308 Bacteria 3796
313 Ga0157375_10154505 3300013308 Bacteria 2432
314 Ga0157375_10283563 3300013308 Bacteria 1820
315 Ga0157375_10473301 3300013308 Bacteria 1418
316 Ga0163163_10052099 3300014325 Bacteria 4036
317 Ga0163163_10187587 3300014325 Bacteria 2116
318 Ga0163163_10698475 3300014325 Bacteria 1078
319 Ga0157380_10159808 3300014326 Bacteria 1957
320 Ga0157377_10044266 3300014745 Bacteria 2481
321 Ga0157377_10053273 3300014745 Bacteria 2287
322 Ga0157379_10021747 3300014968 Bacteria 5681
323 Ga0157379_10398995 3300014968 Bacteria 1264
324 Ga0157376_10273075 3300014969 Bacteria 1589
325 Ga0163161_10020401 3300017792 Bacteria 4651
326 Ga0206356_10432907 3300020070 Bacteria 957
327 Ga0206351_10135569 3300020077 Bacteria 1314
328 Ga0206350_10042881 3300020080 Bacteria 889
329 Ga0206354_10464791 3300020081 Bacteria 2532
330 Ga0206353_10077479 3300020082 Bacteria 4434
331 Ga0206353_11124480 3300020082 Bacteria 1072
332 Ga0206353_11987931 3300020082 Bacteria 1289
333 Ga0154015_1296164 3300020610 Bacteria 1732
334 Ga0213874_10036320 3300021377 Bacteria 1452
335 Ga0213875_10000363 3300021388 Bacteria 42235
336 Ga0213875_10007999 3300021388 Bacteria 5433
337 Ga0213875_10027678 3300021388 Bacteria 2698
338 Ga0213875_10032344 3300021388 Bacteria 2472
339 Ga0213875_10044511 3300021388 Bacteria 2084
340 Ga0213875_10137709 3300021388 Bacteria 1142
341 Ga0224712_10021924 3300022467 Bacteria 2194
342 Ga0224712_10147916 3300022467 Bacteria 1039
343 Ga0209148_1002761 3300025254 Bacteria 5534
344 Ga0209129_1000067 3300025258 Bacteria 219974
345 Ga0209025_1001395 3300025294 Bacteria 32161
346 Ga0209051_1012946 3300025303 Bacteria 4000
347 Ga0207656_10056187 3300025321 Bacteria 1715
348 Ga0207653_10002967 3300025885 Bacteria 5382
349 Ga0207692_10003787 3300025898 Bacteria 5943
350 Ga0207692_10004622 3300025898 Bacteria 5459
351 Ga0207692_10020352 3300025898 Bacteria 3016
352 Ga0207692_10042308 3300025898 Bacteria 2260
353 Ga0207692_10129041 3300025898 Bacteria 1425
354 Ga0207692_10174450 3300025898 Bacteria 1248
355 Ga0207692_10237494 3300025898 Bacteria 1087
356 Ga0207710_10060560 3300025900 Bacteria 1716
357 Ga0207688_10003738 3300025901 Bacteria 8304
358 Ga0207688_10004765 3300025901 Bacteria 7387
359 Ga0207688_10064737 3300025901 Bacteria 2065
360 Ga0207688_10358762 3300025901 Bacteria 899
361 Ga0207647_10052049 3300025904 Bacteria 2528
362 Ga0207685_10000503 3300025905 Bacteria 6651
363 Ga0207685_10016331 3300025905 Bacteria 2374
364 Ga0207685_10123546 3300025905 Bacteria 1140
365 Ga0207699_10000988 3300025906 Bacteria 13528
366 Ga0207699_10003997 3300025906 Bacteria 7056
367 Ga0207699_10004908 3300025906 Bacteria 6399
368 Ga0207699_10011620 3300025906 Bacteria 4453
369 Ga0207645_10008076 3300025907 Bacteria 7382
370 Ga0207645_10075430 3300025907 Bacteria 2158
371 Ga0207645_10097895 3300025907 Bacteria 1891
372 Ga0207643_10000047 3300025908 Bacteria 79590
373 Ga0207643_10030020 3300025908 Bacteria 3024
374 Ga0207705_10035401 3300025909 Bacteria 3571
375 Ga0207705_10098161 3300025909 Bacteria 2152
376 Ga0207684_10000323 3300025910 Bacteria 67693
377 Ga0207684_10003999 3300025910 Bacteria 14104
378 Ga0207684_10010100 3300025910 Bacteria 8315
379 Ga0207684_10022827 3300025910 Bacteria 5343
380 Ga0207684_10029169 3300025910 Bacteria 4700
381 Ga0207684_10040467 3300025910 Bacteria 3951
382 Ga0207684_10045316 3300025910 Bacteria 3731
383 Ga0207684_10064461 3300025910 Bacteria 3111
384 Ga0207684_10067070 3300025910 Bacteria 3048
385 Ga0207684_10103170 3300025910 Bacteria 2438
386 Ga0207684_10127839 3300025910 Bacteria 2181
387 Ga0207684_10128721 3300025910 Bacteria 2173
388 Ga0207684_10251776 3300025910 Bacteria 1524
389 Ga0207707_10001352 3300025912 Bacteria 22855
390 Ga0207671_10109947 3300025914 Bacteria 2096
391 Ga0207693_10025677 3300025915 Bacteria 4669
392 Ga0207693_10044196 3300025915 Bacteria 3501
393 Ga0207693_10061577 3300025915 Bacteria 2939
394 Ga0207693_10159272 3300025915 Bacteria 1776
395 Ga0207693_10187925 3300025915 Bacteria 1626
396 Ga0207693_10199085 3300025915 Bacteria 1575
397 Ga0207693_10325018 3300025915 Bacteria 1204
398 Ga0207663_10001870 3300025916 Bacteria 9964
399 Ga0207663_10008539 3300025916 Bacteria 5364
400 Ga0207663_10031503 3300025916 Bacteria 3140
401 Ga0207663_10056765 3300025916 Bacteria 2464
402 Ga0207663_10109241 3300025916 Bacteria 1874
403 Ga0207663_10109409 3300025916 Bacteria 1873
404 Ga0207663_10189829 3300025916 Bacteria 1474
405 Ga0207660_10022130 3300025917 Bacteria 4281
406 Ga0207660_10048898 3300025917 Bacteria 2994
407 Ga0207660_10409184 3300025917 Bacteria 1093
408 Ga0207662_10068286 3300025918 Bacteria 2146
409 Ga0207657_10013739 3300025919 Bacteria 7926
410 Ga0207657_10041725 3300025919 Bacteria 4054
411 Ga0207657_10084590 3300025919 Bacteria 2658
412 Ga0207657_10089978 3300025919 Bacteria 2562
413 Ga0207649_10100127 3300025920 Bacteria 1916
414 Ga0207652_10102635 3300025921 Bacteria 2528
415 Ga0207652_10194305 3300025921 Bacteria 1825
416 Ga0207646_10000050 3300025922 Bacteria 171554
417 Ga0207646_10011796 3300025922 Bacteria 8441
418 Ga0207646_10014424 3300025922 Bacteria 7503
419 Ga0207646_10023656 3300025922 Bacteria 5641
420 Ga0207646_10027007 3300025922 Bacteria 5233
421 Ga0207646_10041129 3300025922 Bacteria 4157
422 Ga0207646_10453030 3300025922 Bacteria 1158
423 Ga0207646_10473784 3300025922 Bacteria 1129
424 Ga0207681_10015247 3300025923 Bacteria 4792
425 Ga0207694_10035588 3300025924 Bacteria 3821
426 Ga0207694_10082701 3300025924 Bacteria 2524
427 Ga0207650_10010952 3300025925 Bacteria 6233
428 Ga0207659_10066653 3300025926 Bacteria 2613
429 Ga0207659_10293346 3300025926 Bacteria 1333
430 Ga0207687_10030995 3300025927 Bacteria 3611
431 Ga0207700_10000216 3300025928 Bacteria 34369
432 Ga0207700_10000619 3300025928 Bacteria 20729
433 Ga0207700_10006986 3300025928 Bacteria 6870
434 Ga0207700_10014371 3300025928 Bacteria 5186
435 Ga0207700_10020739 3300025928 Bacteria 4471
436 Ga0207700_10039278 3300025928 Bacteria 3444
437 Ga0207700_10056216 3300025928 Bacteria 2961
438 Ga0207700_10089091 3300025928 Bacteria 2431
439 Ga0207700_10099220 3300025928 Bacteria 2318
440 Ga0207700_10101928 3300025928 Bacteria 2291
441 Ga0207700_10194885 3300025928 Bacteria 1704
442 Ga0207700_10230897 3300025928 Bacteria 1573
443 Ga0207700_10468992 3300025928 Bacteria 1111
444 Ga0207664_10000047 3300025929 Bacteria 139122
445 Ga0207664_10000379 3300025929 Bacteria 32303
446 Ga0207664_10000543 3300025929 Bacteria 26710
447 Ga0207664_10000594 3300025929 Bacteria 25078
448 Ga0207664_10002311 3300025929 Bacteria 12583
449 Ga0207664_10010461 3300025929 Bacteria 6554
450 Ga0207664_10024932 3300025929 Bacteria 4498
451 Ga0207664_10033956 3300025929 Bacteria 3925
452 Ga0207664_10060263 3300025929 Bacteria 3024
453 Ga0207664_10061428 3300025929 Bacteria 2998
454 Ga0207664_10074863 3300025929 Bacteria 2737
455 Ga0207664_10110371 3300025929 Bacteria 2287
456 Ga0207664_10176661 3300025929 Bacteria 1831
457 Ga0207664_10255494 3300025929 Bacteria 1531
458 Ga0207664_10332582 3300025929 Bacteria 1342
459 Ga0207664_10338737 3300025929 Bacteria 1329
460 Ga0207664_10425908 3300025929 Bacteria 1183
461 Ga0207664_10699689 3300025929 Bacteria 911
462 Ga0207644_10027196 3300025931 Bacteria 3951
463 Ga0207690_10053190 3300025932 Bacteria 2716
464 Ga0207690_10214901 3300025932 Bacteria 1468
465 Ga0207690_10430363 3300025932 Bacteria 1057
466 Ga0207686_10151336 3300025934 Bacteria 1616
467 Ga0207709_10011152 3300025935 Bacteria 4956
468 Ga0207709_10144620 3300025935 Bacteria 1639
469 Ga0207709_10330032 3300025935 Bacteria 1145
470 Ga0207670_10324473 3300025936 Bacteria 1212
471 Ga0207665_10001106 3300025939 Bacteria 18140
472 Ga0207665_10001519 3300025939 Bacteria 15611
473 Ga0207665_10001843 3300025939 Bacteria 14259
474 Ga0207665_10020336 3300025939 Bacteria 4360
475 Ga0207665_10022999 3300025939 Bacteria 4104
476 Ga0207665_10033589 3300025939 Bacteria 3402
477 Ga0207665_10171255 3300025939 Bacteria 1568
478 Ga0207691_10011415 3300025940 Bacteria 8524
479 Ga0207691_10035120 3300025940 Bacteria 4658
480 Ga0207689_10009034 3300025942 Bacteria 8629
481 Ga0207689_10026742 3300025942 Bacteria 4832
482 Ga0207661_10012478 3300025944 Bacteria 6174
483 Ga0207661_10038004 3300025944 Bacteria 3770
484 Ga0207661_10070137 3300025944 Bacteria 2860
485 Ga0207661_10182722 3300025944 Bacteria 1833
486 Ga0207661_10209366 3300025944 Bacteria 1718
487 Ga0207661_10366378 3300025944 Bacteria 1302
488 Ga0207661_10380131 3300025944 Bacteria 1278
489 Ga0207679_10003830 3300025945 Bacteria 9325
490 Ga0207679_10056484 3300025945 Bacteria 2898
491 Ga0207667_10108095 3300025949 Bacteria 2870
492 Ga0207667_10818001 3300025949 Bacteria 927
493 Ga0207651_10150573 3300025960 Bacteria 1810
494 Ga0207668_10148664 3300025972 Bacteria 1811
495 Ga0207640_10062340 3300025981 Bacteria 2473
496 Ga0207658_10048223 3300025986 Bacteria 3122
497 Ga0207658_10101344 3300025986 Bacteria 2256
498 Ga0207677_10047770 3300026023 Bacteria 2876
499 Ga0207677_10263260 3300026023 Bacteria 1406
500 Ga0207677_10539415 3300026023 Bacteria 1015
501 Ga0207703_10036637 3300026035 Bacteria 3905
502 Ga0207703_10175221 3300026035 Bacteria 1889
503 Ga0207639_10070751 3300026041 Bacteria 2726
504 Ga0207639_10101308 3300026041 Bacteria 2328
505 Ga0207678_10001956 3300026067 Bacteria 18784
506 Ga0207678_10007294 3300026067 Bacteria 9800
507 Ga0207678_10022190 3300026067 Bacteria 5562
508 Ga0207678_10439890 3300026067 Bacteria 1132
509 Ga0207708_10027364 3300026075 Bacteria 4316
510 Ga0207708_10074694 3300026075 Bacteria 2598
511 Ga0207702_10101267 3300026078 Bacteria 2543
512 Ga0207702_10205652 3300026078 Bacteria 1828
513 Ga0207702_10286343 3300026078 Bacteria 1559
514 Ga0207702_10418616 3300026078 Bacteria 1295
515 Ga0207641_10037314 3300026088 Bacteria 4057
516 Ga0207641_10089939 3300026088 Bacteria 2684
517 Ga0207676_10063866 3300026095 Bacteria 2925
518 Ga0207676_10077200 3300026095 Bacteria 2693
519 Ga0207674_10027421 3300026116 Bacteria 6025
520 Ga0207674_10028680 3300026116 Bacteria 5872
521 Ga0207674_10065923 3300026116 Bacteria 3649
522 Ga0207674_10192671 3300026116 Bacteria 1988
523 Ga0207675_100010057 3300026118 Bacteria 8870
524 Ga0207683_10001336 3300026121 Bacteria 22258
525 Ga0207683_10006321 3300026121 Bacteria 10147
526 Ga0207683_10007910 3300026121 Bacteria 9096
527 Ga0207683_10317592 3300026121 Bacteria 1426
528 Ga0207698_10203673 3300026142 Bacteria 1774
529 Ga0207698_10662167 3300026142 Bacteria 1035
530 Ga0207428_10000436 3300027907 Bacteria 51096
531 Ga0207428_10006188 3300027907 Bacteria 11060
532 Ga0207428_10243194 3300027907 Bacteria 1344
533 Ga0268266_10027769 3300028379 Bacteria 4812
534 Ga0268266_10191818 3300028379 Bacteria 1866
535 Ga0268264_10227381 3300028381 Bacteria 1721
536 Ga0265337_1002783 3300028556 Bacteria 7836
537 Ga0265319_1040619 3300028563 Bacteria 1572
538 Ga0265334_10028035 3300028573 Bacteria 2265
539 Ga0265318_10052844 3300028577 Bacteria 1524
540 Ga0265323_10032217 3300028653 Bacteria 1945
541 Ga0265322_10004808 3300028654 Bacteria 4003
542 Ga0265336_10006997 3300028666 Bacteria 4035
543 Ga0265336_10007124 3300028666 Bacteria 3995
544 Ga0307515_10228167 3300028794 Bacteria 1662
545 Ga0265338_10001346 3300028800 Bacteria 40029
546 Ga0265338_10006911 3300028800 Bacteria 14280
547 Ga0265338_10010558 3300028800 Bacteria 10802
548 Ga0265338_10025455 3300028800 Bacteria 6002
549 Ga0265324_10009688 3300029957 Bacteria 3748
550 Ga0316181_1287760 3300030744 Bacteria 1092
551 Ga0265760_10084872 3300031090 Bacteria 985
552 Ga0265332_10002184 3300031238 Bacteria 10071
553 Ga0265320_10042505 3300031240 Bacteria 2253
554 Ga0265340_10025062 3300031247 Bacteria 3024
555 Ga0265339_10015113 3300031249 Bacteria 4638
556 Ga0265316_10068929 3300031344 Bacteria 2730
557 Ga0307513_10001072 3300031456 Bacteria 39827
558 Ga0307509_10405746 3300031507 Bacteria 1068
559 Ga0307408_100002302 3300031548 Bacteria 13593
560 Ga0307408_100009943 3300031548 Bacteria 6265
561 Ga0307408_100023860 3300031548 Bacteria 4170
562 Ga0307408_100030294 3300031548 Bacteria 3756
563 Ga0307408_100042486 3300031548 Bacteria 3229
564 Ga0307408_100083312 3300031548 Bacteria 2396
565 Ga0307408_100111110 3300031548 Bacteria 2105
566 Ga0307408_100182329 3300031548 Bacteria 1685
567 Ga0265313_10006305 3300031595 Bacteria 8447
568 Ga0265313_10030774 3300031595 Bacteria 2758
569 Ga0316579_10004478 3300031691 Bacteria 5551
570 Ga0316579_10042337 3300031691 Bacteria 2115
571 Ga0265314_10017800 3300031711 Bacteria 5567
572 Ga0265314_10046623 3300031711 Bacteria 3056
573 Ga0265342_10012657 3300031712 Bacteria 5707
574 Ga0316576_10055510 3300031727 Bacteria 2891
575 Ga0316576_10074597 3300031727 Bacteria 2508
576 Ga0316576_10089022 3300031727 Bacteria 2298
577 Ga0316578_10106373 3300031728 Bacteria 1683
578 Ga0316578_10130603 3300031728 Bacteria 1511
579 Ga0307516_10360182 3300031730 Bacteria 1119
580 Ga0307405_10001740 3300031731 Bacteria 9293
581 Ga0307405_10080869 3300031731 Bacteria 2122
582 Ga0307405_10143594 3300031731 Bacteria 1668
583 Ga0307405_10492008 3300031731 Bacteria 981
584 Ga0316577_10004394 3300031733 Bacteria 7268
585 Ga0316577_10066283 3300031733 Bacteria 2016
586 Ga0307413_10009968 3300031824 Bacteria 4579
587 Ga0307413_10050142 3300031824 Bacteria 2506
588 Ga0307413_10073826 3300031824 Bacteria 2158
589 Ga0307413_10109312 3300031824 Bacteria 1847
590 Ga0307413_10128990 3300031824 Bacteria 1727
591 Ga0307410_10001200 3300031852 Bacteria 11496
592 Ga0307410_10010483 3300031852 Bacteria 5252
593 Ga0307410_10017746 3300031852 Bacteria 4282
594 Ga0307410_10063996 3300031852 Bacteria 2525
595 Ga0307410_10082752 3300031852 Bacteria 2258
596 Ga0307410_10240531 3300031852 Bacteria 1402
597 Ga0307406_10000241 3300031901 Bacteria 33132
598 Ga0307406_10018790 3300031901 Bacteria 4046
599 Ga0307406_10019670 3300031901 Bacteria 3965
600 Ga0307406_10040560 3300031901 Bacteria 2895
601 Ga0307406_10240116 3300031901 Bacteria 1358
602 Ga0307407_10002677 3300031903 Bacteria 7061
603 Ga0307407_10004684 3300031903 Bacteria 5842
604 Ga0307407_10045925 3300031903 Bacteria 2471
605 Ga0307407_10067460 3300031903 Bacteria 2114
606 Ga0307407_10337237 3300031903 Bacteria 1063
607 Ga0307412_10033871 3300031911 Bacteria 3250
608 Ga0307412_10156909 3300031911 Bacteria 1686
609 Ga0307409_100000403 3300031995 Bacteria 18419
610 Ga0307409_100007374 3300031995 Bacteria 6572
611 Ga0307409_100022171 3300031995 Bacteria 4371
612 Ga0307409_100027710 3300031995 Bacteria 4021
613 Ga0307409_100035514 3300031995 Bacteria 3654
614 Ga0307409_100036313 3300031995 Bacteria 3621
615 Ga0307409_100049765 3300031995 Bacteria 3197
616 Ga0307409_100056382 3300031995 Bacteria 3038
617 Ga0307409_100081847 3300031995 Bacteria 2611
618 Ga0307409_100111676 3300031995 Bacteria 2293
619 Ga0307409_100225590 3300031995 Bacteria 1694
620 Ga0307409_100231143 3300031995 Bacteria 1677
621 Ga0307409_100258484 3300031995 Bacteria 1596
622 Ga0307409_100507870 3300031995 Bacteria 1175
623 Ga0307416_100000079 3300032002 Bacteria 70731
624 Ga0307416_100003433 3300032002 Bacteria 9306
625 Ga0307416_100020205 3300032002 Bacteria 4745
626 Ga0307416_100054577 3300032002 Bacteria 3213
627 Ga0307416_100055863 3300032002 Bacteria 3182
628 Ga0307416_100056940 3300032002 Bacteria 3159
629 Ga0307416_100065826 3300032002 Bacteria 2980
630 Ga0307416_100092062 3300032002 Bacteria 2606
631 Ga0307416_100125879 3300032002 Bacteria 2295
632 Ga0307416_100181798 3300032002 Bacteria 1972
633 Ga0307416_100212282 3300032002 Bacteria 1847
634 Ga0307416_100575738 3300032002 Bacteria 1202
635 Ga0307416_100720352 3300032002 Bacteria 1088
636 Ga0307414_10001328 3300032004 Bacteria 12778
637 Ga0307414_10086137 3300032004 Bacteria 2317
638 Ga0307414_10095165 3300032004 Bacteria 2225
639 Ga0307414_10147376 3300032004 Unclassified 1852
640 Ga0307414_10192540 3300032004 Bacteria 1651
641 Ga0307414_10375124 3300032004 Bacteria 1228
642 Ga0307411_10001879 3300032005 Bacteria 8948
643 Ga0307411_10016592 3300032005 Bacteria 4171
644 Ga0307411_10035516 3300032005 Bacteria 3114
645 Ga0307411_10062628 3300032005 Bacteria 2482
646 Ga0307415_100026311 3300032126 Bacteria 3667
647 Ga0307415_100055891 3300032126 Bacteria 2703
648 Ga0307415_100061389 3300032126 Bacteria 2602
649 Ga0307415_100172409 3300032126 Bacteria 1688
650 Ga0307415_100183569 3300032126 Bacteria 1644
651 Ga0307415_100270370 3300032126 Bacteria 1392
652 Ga0307415_100363536 3300032126 Bacteria 1223
653 Ga0316583_10012370 3300032133 Bacteria 3078
654 Ga0316585_10019142 3300032137 Bacteria 2084
655 Ga0316580_10006211 3300032139 Bacteria 3521
656 Ga0316580_10055174 3300032139 Bacteria 1222
657 Ga0316212_1002393 3300033547 Bacteria 2672
658 Ga0373926_0006434 3300035083 Bacteria 3901
659 Ga0373926_0070539 3300035083 Bacteria 1283
660 Ga0373929_0027598 3300035085 Bacteria 1194
661 Ga0373934_0000032 3300035086 Bacteria 44940
662 Ga0373934_0004815 3300035086 Bacteria 4992
663 Ga0373934_0015706 3300035086 Bacteria 2874
664 Ga0373934_0045351 3300035086 Bacteria 1738
665 Ga0373934_0049421 3300035086 Bacteria 1665
666 Ga0373940_0089207 3300035088 Bacteria 921
667 Ga0373944_0000245 3300035089 Bacteria 11886
668 Ga0373944_0009505 3300035089 Bacteria 2638
669 Ga0373944_0018985 3300035089 Bacteria 1969
670 Ga0373923_0000558 3300035111 Bacteria 9135
671 Ga0373923_0022773 3300035111 Bacteria 2460
672 Ga0373923_0040387 3300035111 Bacteria 1920
673 Ga0373923_0052739 3300035111 Bacteria 1709
674 Ga0373923_0168404 3300035111 Bacteria 1002
675 Ga0373936_0000908 3300035113 Bacteria 10583
676 Ga0373936_0009917 3300035113 Bacteria 3594
677 Ga0373936_0010386 3300035113 Bacteria 3512
678 Ga0373936_0071039 3300035113 Bacteria 1435
679 Ga0373941_0019241 3300035115 Bacteria 1898
680 Ga0373945_0000949 3300035116 Bacteria 8633
681 Ga0373945_0001238 3300035116 Bacteria 7768
682 Ga0373945_0037134 3300035116 Bacteria 1748
683 Ga0373953_0000145 3300035117 Bacteria 18034
684 Ga0373953_0008206 3300035117 Bacteria 3536
685 Ga0373953_0010007 3300035117 Bacteria 3287
686 Ga0373953_0068792 3300035117 Bacteria 1457
687 Ga0373953_0069406 3300035117 Bacteria 1452
688 Ga0373954_0023062 3300035118 Bacteria 2827
689 Ga0373954_0050839 3300035118 Bacteria 1945
690 Ga0373954_0059263 3300035118 Bacteria 1804
691 Ga0373954_0091376 3300035118 Bacteria 1462
692 Ga0373954_0228590 3300035118 Bacteria 915
693 Ga0373956_0000096 3300035119 Bacteria 29760
694 Ga0373956_0009546 3300035119 Bacteria 3951
695 Ga0373956_0015945 3300035119 Bacteria 3152
696 Ga0373956_0017507 3300035119 Bacteria 3022
697 Ga0373956_0024516 3300035119 Bacteria 2600
698 Ga0373956_0065067 3300035119 Bacteria 1656
699 Ga0373957_0017156 3300035120 Bacteria 2517
700 Ga0373957_0104642 3300035120 Bacteria 1135
701 Ga0373960_0011769 3300035121 Bacteria 2162
702 Ga0373943_0000554 3300035170 Bacteria 16138
703 Ga0373943_0095187 3300035170 Bacteria 1548
704 Ga0373946_0000088 3300035171 Bacteria 25288
705 Ga0373946_0037577 3300035171 Bacteria 1968
706 Ga0373946_0080395 3300035171 Bacteria 1426
707 Ga0373955_0000015 3300035172 Bacteria 72056
708 Ga0373955_0021499 3300035172 Bacteria 3258
709 Ga0373955_0031472 3300035172 Bacteria 2779
710 Ga0373955_0053296 3300035172 Bacteria 2208
711 Ga0373955_0086690 3300035172 Bacteria 1778
712 Ga0373955_0102681 3300035172 Bacteria 1643
713 Ga0373955_0185831 3300035172 Bacteria 1234
714 Ga0373942_0003854 3300035207 Bacteria 3508
715 Ga0373961_0009430 3300035241 Bacteria 2388
716 Ga0373961_0066805 3300035241 Bacteria 1104
717 Ga0373962_0011474 3300035242 Bacteria 2222
718 Ga0373962_0016970 3300035242 Bacteria 1883
719 Ga0316574_0002969 3300035398 Bacteria 8633
720 Ga0316574_0027597 3300035398 Bacteria 3420
721 Ga0316574_0048143 3300035398 Bacteria 2646
722 Ga0373924_0003592 3300035410 Bacteria 5347
723 Ga0373924_0006043 3300035410 Bacteria 4320
724 Ga0373924_0006676 3300035410 Bacteria 4140
725 Ga0373924_0057313 3300035410 Bacteria 1624
726 Ga0373924_0063716 3300035410 Bacteria 1546
727 Ga0373924_0175103 3300035410 Bacteria 943
728 Ga0373931_0016392 3300035691 Bacteria 3646
729 Ga0373931_0039540 3300035691 Bacteria 2472
730 Ga0373931_0253756 3300035691 Bacteria 1070
731 Ga0373931_0344708 3300035691 Bacteria 931
732 Ga0373931_0385249 3300035691 Bacteria 885
733 Ga0373935_0005038 3300035692 Bacteria 7779
734 Ga0373935_0007971 3300035692 Bacteria 6350
735 Ga0373935_0032118 3300035692 Bacteria 3261
736 Ga0373935_0095527 3300035692 Bacteria 1952
737 Ga0373927_0002273 3300035695 Bacteria 14073
738 Ga0373927_0013177 3300035695 Bacteria 5499
739 Ga0373927_0183227 3300035695 Bacteria 1374
740 Ga0373933_0000004 3300035724 Bacteria 143741
741 Ga0373933_0001154 3300035724 Bacteria 15665
742 Ga0373933_0009139 3300035724 Bacteria 5410
743 Ga0373933_0026217 3300035724 Bacteria 3346
744 Ga0373933_0032220 3300035724 Bacteria 3045
745 Ga0373933_0087911 3300035724 Bacteria 1914
746 Ga0373933_0101986 3300035724 Bacteria 1781
747 Ga0373933_0138807 3300035724 Bacteria 1533
748 Ga0373933_0211310 3300035724 Bacteria 1243
749 Ga0373933_0242773 3300035724 Bacteria 1159
750 Ga0373947_0000116 3300035725 Bacteria 39945
751 Ga0373947_0000815 3300035725 Bacteria 18801
752 Ga0373947_0025713 3300035725 Bacteria 3433
753 Ga0373947_0100704 3300035725 Bacteria 1816
754 Ga0373947_0121269 3300035725 Bacteria 1661
755 Ga0373947_0284467 3300035725 Bacteria 1100
756 Ga0373937_0000012 3300036401 Bacteria 159418
757 Ga0373937_0063728 3300036401 Bacteria 3390
758 Ga0373937_0067438 3300036401 Bacteria 3296
759 Ga0373937_0068625 3300036401 Bacteria 3269
760 Ga0373937_0119951 3300036401 Bacteria 2450
761 Ga0373937_0168985 3300036401 Bacteria 2051
762 Ga0373937_0172163 3300036401 Bacteria 2031
763 Ga0373937_0402129 3300036401 Bacteria 1299
764 Ga0373937_0751607 3300036401 Bacteria 922
765 Ga0373937_0835469 3300036401 Bacteria 869
766 Ga0372808_006891 3300036459 Bacteria 1543
767 Ga0316582_0004867 3300036647 Bacteria 6855
768 Ga0316584_0009116 3300036712 Bacteria 6871
769 Ga0316584_0018850 3300036712 Bacteria 4982
770 Ga0316584_0051715 3300036712 Bacteria 3072
771 Ga0373925_0000021 3300037068 Bacteria 162277
772 Ga0373925_0003050 3300037068 Bacteria 13175
773 Ga0373925_0005539 3300037068 Bacteria 9400
774 Ga0373925_0073881 3300037068 Bacteria 2581
775 Ga0373925_0094353 3300037068 Bacteria 2291
776 Ga0373925_0112859 3300037068 Bacteria 2101
777 Ga0373925_0168389 3300037068 Bacteria 1729
778 Ga0395899_0016113 3300037312 Bacteria 5698
779 Ga0395899_0055732 3300037312 Bacteria 2923
780 Ga0395900_0007662 3300037418 Bacteria 11143
781 Ga0395900_0018014 3300037418 Bacteria 7211
782 Ga0395900_0018741 3300037418 Bacteria 7058
783 Ga0395900_0049923 3300037418 Bacteria 4310
784 Ga0395900_0057687 3300037418 Bacteria 3997
785 Ga0395900_0085090 3300037418 Bacteria 3250
786 Ga0395900_0113139 3300037418 Bacteria 2786
787 Ga0395898_0017683 3300037466 Bacteria 7276
788 Ga0395898_0032533 3300037466 Bacteria 5206
789 Ga0395898_0050546 3300037466 Bacteria 4068
790 Ga0395898_0073181 3300037466 Bacteria 3310
791 Ga0395898_0081435 3300037466 Bacteria 3121
792 Ga0395898_0083833 3300037466 Bacteria 3072
793 Ga0395898_0090890 3300037466 Bacteria 2937
794 Ga0395898_0133313 3300037466 Bacteria 2379
795 Ga0395905_0042768 3300037471 Bacteria 4250
796 Ga0395905_0088621 3300037471 Bacteria 2900
797 Ga0395905_0117457 3300037471 Bacteria 2500
798 Ga0316581_0016916 3300037588 Bacteria 2099
799 Ga0436364_0426348 3300037853 Bacteria 32972
800 Ga0436364_0549328 3300037853 Bacteria 13439
801 Ga0436364_0563172 3300037853 Bacteria 1191
802 Ga0436364_0896453 3300037853 Bacteria 3251
803 Ga0436364_0990552 3300037853 Bacteria 1280
804 Ga0436364_1292226 3300037853 Bacteria 2774
805 Ga0436364_1406831 3300037853 Bacteria 905
806 Ga0436364_1419792 3300037853 Bacteria 3447
807 Ga0436364_1427311 3300037853 Bacteria 97691
808 Ga0436364_1475022 3300037853 Bacteria 1410
809 Ga0395901_0003285 3300038443 Bacteria 16276
810 Ga0395901_0004509 3300038443 Bacteria 14043
811 Ga0395901_0008590 3300038443 Bacteria 10324
812 Ga0395901_0018051 3300038443 Bacteria 7201
813 Ga0395901_0020548 3300038443 Bacteria 6758
814 Ga0395901_0032466 3300038443 Bacteria 5387
815 Ga0395901_0048337 3300038443 Bacteria 4418
816 Ga0395901_0112405 3300038443 Bacteria 2860
817 Ga0395901_0167743 3300038443 Bacteria 2304
818 Ga0395901_0203548 3300038443 Bacteria 2074
819 Ga0395901_0224113 3300038443 Bacteria 1964
820 Ga0395901_0229433 3300038443 Bacteria 1939
821 Ga0436365_0471577 3300039437 Bacteria 2277
822 Ga0436365_0510277 3300039437 Bacteria 1278
823 Ga0436363_1571899 3300039450 Bacteria 3076
824 Ga0439436_0030917 3300041404 Bacteria 1555
825 Ga0439438_032040 3300041405 Bacteria 1395
826 Ga0439439_0007684 3300041406 Bacteria 2525
827 Ga0439466_0011359 3300041411 Bacteria 3295
828 Ga0439466_0015797 3300041411 Bacteria 2739
829 Ga0439465_0027389 3300041413 Bacteria 1805
830 Ga0451807_1174564 3300041486 Bacteria 1319
831 Ga0451833_0564772 3300041491 Bacteria 2104
832 Ga0451833_0913143 3300041491 Bacteria 4456
833 Ga0451837_0729638 3300041494 Bacteria 1961
834 Ga0451839_1288255 3300041496 Bacteria 1325
835 Ga0451843_0773603 3300041509 Bacteria 1940
836 Ga0451853_2585626 3300041512 Bacteria 2057
837 Ga0439431_0053821 3300041997 Bacteria 1048
838 Ga0439433_0000441 3300041999 Bacteria 7628
839 Ga0439433_0000451 3300041999 Bacteria 7557
840 Ga0439442_017474 3300042002 Bacteria 1480
841 Ga0439432_065575 3300042006 Bacteria 1113
842 Ga0439449_0008093 3300042007 Bacteria 3993
843 Ga0439449_0009742 3300042007 Bacteria 3634
844 Ga0439452_012151 3300042010 Bacteria 2457
845 Ga0439457_000675 3300042014 Bacteria 10082
846 Ga0439457_008987 3300042014 Bacteria 2337
847 Ga0439457_041047 3300042014 Bacteria 1031
848 Ga0439462_0000144 3300042015 Bacteria 11554
849 Ga0439462_0048724 3300042015 Bacteria 1137
850 Ga0450919_001721 3300042121 Bacteria 2857
851 Ga0450919_003706 3300042121 Bacteria 1899
852 Ga0450907_002582 3300042146 Bacteria 3401
853 Ga0439446_0002486 3300042156 Bacteria 4433
854 Ga0439458_0007512 3300042157 Bacteria 2427
855 Ga0450908_006499 3300042184 Bacteria 2217
856 Ga0439434_0003918 3300042435 Bacteria 4345
857 Ga0439460_0055304 3300042461 Bacteria 1199
858 Ga0466969_0116744 3300044656 Bacteria 1245
859 Ga0466965_0035061 3300044683 Bacteria 2457
860 Ga0466965_0039545 3300044683 Bacteria 2319
861 Ga0466965_0058778 3300044683 Bacteria 1918
862 Ga0466965_0068583 3300044683 Bacteria 1781
863 Ga0466965_0130882 3300044683 Bacteria 1301
864 Ga0466965_0172072 3300044683 Bacteria 1140
865 Ga0466966_0008166 3300044684 Bacteria 6938
866 Ga0466961_0040238 3300044693 Bacteria 2997
867 Ga0466961_0054074 3300044693 Bacteria 2561
868 Ga0466961_0198937 3300044693 Bacteria 1240
869 Ga0466963_0065730 3300044694 Bacteria 2432
870 Ga0466963_0066124 3300044694 Bacteria 2424
871 Ga0466963_0066850 3300044694 Bacteria 2411
872 Ga0466963_0091945 3300044694 Bacteria 2067
873 Ga0466963_0179436 3300044694 Bacteria 1478
874 Ga0466963_0385456 3300044694 Bacteria 988
875 Ga0466971_0020900 3300044719 Bacteria 2910
876 Ga0466971_0031798 3300044719 Bacteria 2364
877 Ga0466971_0120680 3300044719 Bacteria 1213
878 Ga0466970_0039673 3300044765 Bacteria 2499
879 Ga0466957_0006284 3300044842 Bacteria 6701
880 Ga0466957_0018448 3300044842 Bacteria 4098
881 Ga0466957_0053167 3300044842 Bacteria 2468
882 Ga0466957_0066043 3300044842 Bacteria 2229
883 Ga0466957_0070616 3300044842 Bacteria 2158
884 Ga0466957_0102187 3300044842 Bacteria 1808
885 Ga0466960_0009185 3300044901 Bacteria 4069
886 Ga0466960_0010549 3300044901 Bacteria 3840
887 Ga0466960_0118972 3300044901 Bacteria 1381
888 Ga0466960_0183016 3300044901 Bacteria 1137
889 Ga0466960_0188089 3300044901 Bacteria 1122
890 Ga0466960_0243029 3300044901 Bacteria 997
891 Ga0466959_0019251 3300045049 Bacteria 5019
892 Ga0466959_0124803 3300045049 Bacteria 1828
893 Ga0466959_0189639 3300045049 Bacteria 1435
894 Ga0451576_0002230 3300045051 Bacteria 29806
895 Ga0451576_0119161 3300045051 Bacteria 2748
896 Ga0466958_0025582 3300045836 Bacteria 3481
897 Ga0466958_0050689 3300045836 Bacteria 2513
898 Ga0466958_0055151 3300045836 Bacteria 2411
899 Ga0466958_0058272 3300045836 Bacteria 2348
900 Ga0466958_0129204 3300045836 Bacteria 1586
901 Ga0466967_0000342 3300045976 Bacteria 21461
902 Ga0466967_0004421 3300045976 Bacteria 9471
903 Ga0466967_0015132 3300045976 Bacteria 6039
904 Ga0466967_0032623 3300045976 Bacteria 4399
905 Ga0466967_0035022 3300045976 Bacteria 4268
906 Ga0466967_0041283 3300045976 Bacteria 3977
907 Ga0466967_0125829 3300045976 Bacteria 2374
908 Ga0466967_0142555 3300045976 Bacteria 2233
909 Ga0466967_0189077 3300045976 Bacteria 1945
910 Ga0466967_0258272 3300045976 Bacteria 1666
911 Ga0466967_0829156 3300045976 Bacteria 919
912 Ga0466967_1047879 3300045976 Bacteria 812
913 Ga0495592_0001038 3300046454 Bacteria 19287
914 Ga0495592_0031728 3300046454 Bacteria 3991
915 Ga0495592_0050439 3300046454 Bacteria 3092
916 Ga0495592_0078980 3300046454 Bacteria 2382
917 Ga0495592_0107092 3300046454 Bacteria 1983
918 Ga0495592_0239903 3300046454 Bacteria 1203
919 Ga0495592_0326828 3300046454 Bacteria 989
920 Ga0495603_0167973 3300046455 Bacteria 1271
921 Ga0495629_0007551 3300046459 Bacteria 8011
922 Ga0495629_0010631 3300046459 Bacteria 6695
923 Ga0495629_0013423 3300046459 Bacteria 5909
924 Ga0495629_0048167 3300046459 Bacteria 2988
925 Ga0495629_0062962 3300046459 Bacteria 2590
926 Ga0495629_0152261 3300046459 Bacteria 1607
927 Ga0495629_0163137 3300046459 Bacteria 1548
928 Ga0495641_0001864 3300046461 Bacteria 17302
929 Ga0495641_0013724 3300046461 Bacteria 4429
930 Ga0495641_0061386 3300046461 Bacteria 1696
931 Ga0495641_0106769 3300046461 Bacteria 1249
932 Ga0495651_0000007 3300046462 Bacteria 158577
933 Ga0495651_0004624 3300046462 Bacteria 10524
934 Ga0495651_0007200 3300046462 Bacteria 8508
935 Ga0495651_0017643 3300046462 Bacteria 5523
936 Ga0495651_0028199 3300046462 Bacteria 4375
937 Ga0495651_0035062 3300046462 Bacteria 3908
938 Ga0495651_0055772 3300046462 Bacteria 3035
939 Ga0495651_0100495 3300046462 Bacteria 2154
940 Ga0495651_0130321 3300046462 Bacteria 1836
941 Ga0495653_0002903 3300046463 Bacteria 13704
942 Ga0495653_0005400 3300046463 Bacteria 10403
943 Ga0495653_0044104 3300046463 Bacteria 3462
944 Ga0495653_0058305 3300046463 Bacteria 2935
945 Ga0495653_0071329 3300046463 Bacteria 2597
946 Ga0495653_0099008 3300046463 Bacteria 2116
947 Ga0495653_0107923 3300046463 Bacteria 2005
948 Ga0495653_0126719 3300046463 Bacteria 1812
949 Ga0495653_0182106 3300046463 Bacteria 1441
950 Ga0495653_0199359 3300046463 Bacteria 1359
951 Ga0495580_0004371 3300046472 Bacteria 11866
952 Ga0495580_0016668 3300046472 Bacteria 5514
953 Ga0495580_0036169 3300046472 Bacteria 3546
954 Ga0495580_0112747 3300046472 Bacteria 1888
955 Ga0495580_0171263 3300046472 Bacteria 1501
956 Ga0495582_0001211 3300046473 Bacteria 14514
957 Ga0495582_0008405 3300046473 Bacteria 5695
958 Ga0495582_0035034 3300046473 Bacteria 2759
959 Ga0495582_0089844 3300046473 Bacteria 1712
960 Ga0495639_0001832 3300046475 Bacteria 9421
961 Ga0495639_0021230 3300046475 Bacteria 2841
962 Ga0495639_0021980 3300046475 Bacteria 2796
963 Ga0495639_0093254 3300046475 Bacteria 1415
964 Ga0495662_0001706 3300046476 Bacteria 10980
965 Ga0495662_0005333 3300046476 Bacteria 6440
966 Ga0495662_0019268 3300046476 Bacteria 3299
967 Ga0495662_0056962 3300046476 Bacteria 1887
968 Ga0495662_0071230 3300046476 Bacteria 1684
969 Ga0495662_0190035 3300046476 Bacteria 1012
970 Ga0495664_0015997 3300046477 Bacteria 4271
971 Ga0495664_0017591 3300046477 Bacteria 4089
972 Ga0495664_0023104 3300046477 Bacteria 3606
973 Ga0495664_0023548 3300046477 Bacteria 3574
974 Ga0495664_0085245 3300046477 Bacteria 1896
975 Ga0495664_0088493 3300046477 Bacteria 1861
976 Ga0495664_0182922 3300046477 Bacteria 1270
977 Ga0495594_0055096 3300046499 Bacteria 2192
978 Ga0495594_0131569 3300046499 Bacteria 1417
979 Ga0495594_0176015 3300046499 Bacteria 1217
980 Ga0495608_0000015 3300046511 Bacteria 200266
981 Ga0495608_0003113 3300046511 Bacteria 11853
982 Ga0495608_0023384 3300046511 Bacteria 4235
983 Ga0495608_0035583 3300046511 Bacteria 3357
984 Ga0495608_0042228 3300046511 Bacteria 3049
985 Ga0495608_0173290 3300046511 Bacteria 1367
986 Ga0495610_0046672 3300046512 Bacteria 2136
987 Ga0495618_0010247 3300046514 Bacteria 5670
988 Ga0495618_0018166 3300046514 Bacteria 4317
989 Ga0495618_0032650 3300046514 Bacteria 3260
990 Ga0495618_0033505 3300046514 Bacteria 3220
991 Ga0495618_0046890 3300046514 Bacteria 2727
992 Ga0495618_0226819 3300046514 Bacteria 1177
993 Ga0495618_0259084 3300046514 Bacteria 1089
994 Ga0495620_0033763 3300046515 Bacteria 2319
995 Ga0495628_0000737 3300046516 Bacteria 30357
996 Ga0495628_0020395 3300046516 Bacteria 5467
997 Ga0495628_0093629 3300046516 Bacteria 2324
998 Ga0495628_0108065 3300046516 Bacteria 2141
999 Ga0495628_0109645 3300046516 Bacteria 2124
1000 Ga0495628_0225522 3300046516 Bacteria 1406
1001 Ga0495630_0014740 3300046517 Bacteria 5699
1002 Ga0495630_0016397 3300046517 Bacteria 5412
1003 Ga0495630_0055377 3300046517 Bacteria 2972
1004 Ga0495630_0073436 3300046517 Bacteria 2576
1005 Ga0495630_0101875 3300046517 Bacteria 2172
1006 Ga0495630_0143227 3300046517 Bacteria 1817
1007 Ga0495630_0186032 3300046517 Bacteria 1584
1008 Ga0495631_0025563 3300046518 Bacteria 2718
1009 Ga0495643_0049805 3300046522 Bacteria 2258
1010 Ga0495666_0047449 3300046526 Bacteria 2068
1011 Ga0495642_0050632 3300046528 Bacteria 1708
1012 Ga0495652_0000074 3300046529 Bacteria 105662
1013 Ga0495652_0040395 3300046529 Bacteria 4032
1014 Ga0495652_0059276 3300046529 Bacteria 3239
1015 Ga0495665_0000709 3300046531 Bacteria 17165
1016 Ga0495665_0012143 3300046531 Bacteria 4663
1017 Ga0495665_0013704 3300046531 Bacteria 4379
1018 Ga0495665_0028260 3300046531 Bacteria 3007
1019 Ga0495665_0063921 3300046531 Bacteria 1942
1020 Ga0495665_0074025 3300046531 Bacteria 1793
1021 Ga0495665_0272085 3300046531 Bacteria 870
1022 Ga0495640_0017253 3300046533 Bacteria 5383
1023 Ga0495640_0036412 3300046533 Bacteria 3477
1024 Ga0495640_0040539 3300046533 Bacteria 3260
1025 Ga0495640_0051504 3300046533 Bacteria 2830
1026 Ga0495640_0208143 3300046533 Bacteria 1237
1027 Ga0495640_0230679 3300046533 Bacteria 1164
1028 Ga0495586_0015922 3300046535 Bacteria 4001
1029 Ga0495586_0019276 3300046535 Bacteria 3628
1030 Ga0495586_0025942 3300046535 Bacteria 3135
1031 Ga0495586_0043843 3300046535 Bacteria 2409
1032 Ga0495586_0051127 3300046535 Bacteria 2236
1033 Ga0495586_0095013 3300046535 Bacteria 1649
1034 Ga0495586_0153479 3300046535 Bacteria 1296
1035 Ga0495586_0156678 3300046535 Bacteria 1283
1036 Ga0495587_0001582 3300046536 Bacteria 15162
1037 Ga0495587_0002197 3300046536 Bacteria 13041
1038 Ga0495587_0006439 3300046536 Bacteria 7654
1039 Ga0495587_0025644 3300046536 Bacteria 3601
1040 Ga0495587_0027425 3300046536 Bacteria 3468
1041 Ga0495587_0086010 3300046536 Bacteria 1820
1042 Ga0495587_0097585 3300046536 Bacteria 1694
1043 Ga0495645_0014511 3300046543 Bacteria 5592
1044 Ga0495645_0028722 3300046543 Bacteria 4042
1045 Ga0495645_0035518 3300046543 Bacteria 3633
1046 Ga0495645_0053202 3300046543 Bacteria 2943
1047 Ga0495645_0055341 3300046543 Bacteria 2880
1048 Ga0495645_0331087 3300046543 Bacteria 986
1049 Ga0495667_0000033 3300046559 Bacteria 143083
1050 Ga0495667_0003838 3300046559 Bacteria 10093
1051 Ga0495667_0006453 3300046559 Bacteria 7962
1052 Ga0495667_0015200 3300046559 Bacteria 5196
1053 Ga0495667_0026409 3300046559 Bacteria 3913
1054 Ga0495667_0050559 3300046559 Bacteria 2743
1055 Ga0495667_0054161 3300046559 Bacteria 2640
1056 Ga0495667_0063129 3300046559 Bacteria 2425
1057 Ga0495667_0173149 3300046559 Bacteria 1386
1058 Ga0495667_0202688 3300046559 Bacteria 1269
1059 Ga0495667_0233168 3300046559 Bacteria 1173
1060 Ga0495667_0371471 3300046559 Bacteria 902
1061 Ga0495656_0043226 3300046615 Bacteria 1891
1062 Ga0495634_0004914 3300046642 Bacteria 10344
1063 Ga0495634_0006863 3300046642 Bacteria 8611
1064 Ga0495634_0052289 3300046642 Bacteria 2738
1065 Ga0495634_0057233 3300046642 Bacteria 2603
1066 Ga0495634_0062630 3300046642 Bacteria 2469
1067 Ga0495635_0001151 3300046663 Bacteria 17639
1068 Ga0495635_0003052 3300046663 Bacteria 11507
1069 Ga0495635_0010933 3300046663 Bacteria 6364
1070 Ga0495635_0025589 3300046663 Bacteria 4111
1071 Ga0495635_0043517 3300046663 Bacteria 3099
1072 Ga0495635_0153485 3300046663 Bacteria 1568
1073 Ga0495635_0229102 3300046663 Bacteria 1255
1074 Ga0495659_0009118 3300046664 Bacteria 3164
1075 Ga0495588_0009692 3300046674 Bacteria 4463
1076 Ga0495588_0036359 3300046674 Bacteria 2498
1077 Ga0495588_0049669 3300046674 Bacteria 2157
1078 Ga0495657_0001345 3300046675 Bacteria 21381
1079 Ga0495657_0013216 3300046675 Bacteria 6098
1080 Ga0495657_0015858 3300046675 Bacteria 5502
1081 Ga0495657_0020960 3300046675 Bacteria 4696
1082 Ga0495657_0022556 3300046675 Bacteria 4507
1083 Ga0495657_0032716 3300046675 Bacteria 3627
1084 Ga0495657_0047774 3300046675 Bacteria 2891
1085 Ga0495657_0109004 3300046675 Bacteria 1756
1086 Ga0495599_0000018 3300046678 Bacteria 144334
1087 Ga0495599_0008300 3300046678 Bacteria 6317
1088 Ga0495599_0030869 3300046678 Bacteria 3364
1089 Ga0495599_0058667 3300046678 Bacteria 2407
1090 Ga0495599_0069816 3300046678 Bacteria 2192
1091 Ga0495599_0110027 3300046678 Bacteria 1716
1092 Ga0495599_0190784 3300046678 Bacteria 1261
1093 Ga0495623_0000075 3300046679 Bacteria 59383
1094 Ga0495623_0012733 3300046679 Bacteria 5447
1095 Ga0495623_0040315 3300046679 Bacteria 2982
1096 Ga0495623_0050129 3300046679 Bacteria 2645
1097 Ga0495623_0099298 3300046679 Bacteria 1775
1098 Ga0495623_0171860 3300046679 Bacteria 1265
1099 Ga0495646_0005199 3300046680 Bacteria 8208
1100 Ga0495646_0058945 3300046680 Bacteria 2294
1101 Ga0495646_0090788 3300046680 Bacteria 1764
1102 Ga0495646_0114864 3300046680 Bacteria 1529
1103 Ga0495646_0142086 3300046680 Bacteria 1341
1104 Ga0495658_0007844 3300046683 Bacteria 5286
1105 Ga0495658_0031150 3300046683 Bacteria 2902
1106 Ga0495613_0006775 3300046689 Bacteria 8552
1107 Ga0495613_0033390 3300046689 Bacteria 3824
1108 Ga0495613_0054248 3300046689 Bacteria 2947
1109 Ga0495613_0132890 3300046689 Bacteria 1781
1110 Ga0495613_0179312 3300046689 Bacteria 1500
1111 Ga0495613_0239717 3300046689 Bacteria 1268
1112 Ga0495624_0009190 3300046690 Bacteria 6853
1113 Ga0495624_0095250 3300046690 Bacteria 1835
1114 Ga0495624_0109554 3300046690 Bacteria 1698
1115 Ga0495624_0122669 3300046690 Bacteria 1595
1116 Ga0495624_0185385 3300046690 Bacteria 1267
1117 Ga0495600_0007035 3300046809 Bacteria 6873
1118 Ga0495600_0008415 3300046809 Bacteria 6334
1119 Ga0495600_0010982 3300046809 Bacteria 5635
1120 Ga0495600_0015979 3300046809 Bacteria 4757
1121 Ga0495600_0101597 3300046809 Bacteria 1874
1122 Ga0495600_0131703 3300046809 Bacteria 1625
1123 Ga0495600_0148859 3300046809 Bacteria 1516
1124 Ga0495600_0180257 3300046809 Bacteria 1361
1125 Ga0495581_0006935 3300047315 Bacteria 6562
1126 Ga0495581_0008284 3300047315 Bacteria 6027
1127 Ga0495581_0010908 3300047315 Bacteria 5253
1128 Ga0495581_0016572 3300047315 Bacteria 4282
1129 Ga0495581_0021236 3300047315 Bacteria 3765
1130 Ga0495581_0042980 3300047315 Bacteria 2614
1131 Ga0495581_0059559 3300047315 Bacteria 2206
1132 Ga0495604_0000025 3300047317 Bacteria 145481
1133 Ga0495604_0017705 3300047317 Bacteria 5702
1134 Ga0495604_0024002 3300047317 Bacteria 4868
1135 Ga0495604_0032506 3300047317 Bacteria 4134
1136 Ga0495604_0042546 3300047317 Bacteria 3559
1137 Ga0495604_0057467 3300047317 Bacteria 2991
1138 Ga0495604_0211629 3300047317 Bacteria 1339
1139 Ga0495636_0033001 3300047318 Bacteria 2125
1140 Ga0495674_0005960 3300047319 Bacteria 11689
1141 Ga0495674_0013242 3300047319 Bacteria 7754
1142 Ga0495674_0023719 3300047319 Bacteria 5650
1143 Ga0495674_0034845 3300047319 Bacteria 4547
1144 Ga0495674_0054121 3300047319 Bacteria 3525
1145 Ga0495674_0064350 3300047319 Bacteria 3188
1146 Ga0495672_0100302 3300047320 Bacteria 1572
1147 Ga0495676_0006692 3300047321 Bacteria 10614
1148 Ga0495676_0045371 3300047321 Bacteria 3578
1149 Ga0495676_0051299 3300047321 Bacteria 3302
1150 Ga0495680_0000015 3300047322 Bacteria 131335
1151 Ga0495680_0003725 3300047322 Bacteria 14867
1152 Ga0495680_0020712 3300047322 Bacteria 5523
1153 Ga0495680_0028691 3300047322 Bacteria 4561
1154 Ga0495680_0035526 3300047322 Bacteria 4013
1155 Ga0495680_0053573 3300047322 Bacteria 3138
1156 Ga0495680_0055477 3300047322 Bacteria 3073
1157 Ga0495680_0061328 3300047322 Bacteria 2894
1158 Ga0495680_0091614 3300047322 Bacteria 2278
1159 Ga0495680_0116839 3300047322 Bacteria 1972
1160 Ga0495680_0121746 3300047322 Bacteria 1925
1161 Ga0495680_0142002 3300047322 Bacteria 1756
1162 Ga0495675_0006002 3300047444 Bacteria 7427
1163 Ga0495675_0014139 3300047444 Bacteria 5046
1164 Ga0495675_0064853 3300047444 Bacteria 2310
1165 Ga0495675_0090742 3300047444 Bacteria 1918
1166 Ga0495675_0142855 3300047444 Bacteria 1482
1167 Ga0495675_0166250 3300047444 Bacteria 1356
1168 Ga0495685_074299 3300047447 Bacteria 1136
1169 Ga0495681_0054340 3300047470 Bacteria 1871
1170 Ga0495684_0004360 3300047471 Bacteria 11053
1171 Ga0495684_0012033 3300047471 Bacteria 6672
1172 Ga0495684_0023488 3300047471 Bacteria 4740
1173 Ga0495684_0027914 3300047471 Bacteria 4335
1174 Ga0495684_0116879 3300047471 Bacteria 2010
1175 Ga0495684_0125141 3300047471 Bacteria 1934
1176 Ga0495684_0156418 3300047471 Bacteria 1702
1177 Ga0495684_0217165 3300047471 Bacteria 1403
1178 Ga0495593_0002727 3300047673 Bacteria 10626
1179 Ga0495593_0005255 3300047673 Bacteria 7653
1180 Ga0495593_0018131 3300047673 Bacteria 3958
1181 Ga0495593_0020226 3300047673 Bacteria 3728
1182 Ga0495593_0073721 3300047673 Bacteria 1770
1183 Ga0495593_0081178 3300047673 Bacteria 1677
1184 Ga0495602_0000065 3300048088 Bacteria 104080
1185 Ga0495602_0015962 3300048088 Bacteria 7560
1186 Ga0495602_0028880 3300048088 Bacteria 5299
1187 Ga0495602_0035415 3300048088 Bacteria 4654
1188 Ga0495602_0046172 3300048088 Bacteria 3936
1189 Ga0495602_0054069 3300048088 Bacteria 3548
1190 Ga0495602_0071309 3300048088 Bacteria 2967
1191 Ga0495602_0433737 3300048088 Bacteria 930
1192 Ga0495614_0028717 3300048089 Bacteria 2394
1193 Ga0495614_0028970 3300048089 Bacteria 2384
1194 Ga0495614_0137722 3300048089 Bacteria 1083
1195 Ga0496100_0102894 3300048903 Bacteria 1971
1196 Ga0496100_0165139 3300048903 Bacteria 1590
1197 Ga0496100_0205013 3300048903 Bacteria 1439
1198 Ga0496101_0022411 3300048904 Bacteria 4348
1199 Ga0496101_0224310 3300048904 Bacteria 1459
1200 Ga0496102_0001147 3300048905 Bacteria 24210
1201 Ga0496102_0007743 3300048905 Bacteria 9179
1202 Ga0496102_0008038 3300048905 Bacteria 9020
1203 Ga0496102_0016570 3300048905 Bacteria 6441
1204 Ga0496102_0050376 3300048905 Bacteria 3791
1205 Ga0496102_0088675 3300048905 Bacteria 2860
1206 Ga0496102_0115613 3300048905 Bacteria 2503
1207 Ga0496102_0117750 3300048905 Bacteria 2479
1208 Ga0496102_0135005 3300048905 Bacteria 2312
1209 Ga0496102_0166647 3300048905 Bacteria 2073
1210 Ga0496102_0175818 3300048905 Bacteria 2016
1211 Ga0496102_0183895 3300048905 Bacteria 1969
1212 Ga0496102_0799468 3300048905 Bacteria 865
1213 Ga0496103_0004543 3300048906 Bacteria 8399
1214 Ga0496103_0009868 3300048906 Bacteria 5652
1215 Ga0496103_0015951 3300048906 Bacteria 4480
1216 Ga0496103_0047618 3300048906 Bacteria 2649
1217 Ga0496103_0070346 3300048906 Bacteria 2189
1218 Ga0496103_0079015 3300048906 Bacteria 2067
1219 Ga0496103_0093138 3300048906 Bacteria 1902
1220 Ga0496103_0138626 3300048906 Bacteria 1555
1221 Ga0496103_0343089 3300048906 Bacteria 960
1222 Ga0496104_0011195 3300048907 Bacteria 8027
1223 Ga0496104_0012344 3300048907 Bacteria 7679
1224 Ga0496104_0013954 3300048907 Bacteria 7247
1225 Ga0496104_0021920 3300048907 Bacteria 5867
1226 Ga0496104_0036361 3300048907 Bacteria 4603
1227 Ga0496104_0037130 3300048907 Bacteria 4556
1228 Ga0496104_0139773 3300048907 Bacteria 2327
1229 Ga0496104_0188275 3300048907 Bacteria 1975
1230 Ga0496104_0540981 3300048907 Bacteria 1075
1231 Ga0496104_0685495 3300048907 Bacteria 933
1232 Ga0496104_0704538 3300048907 Bacteria 917
1233 Ga0496105_0007335 3300048908 Bacteria 8522
1234 Ga0496105_0027946 3300048908 Bacteria 4613
1235 Ga0496105_0031980 3300048908 Bacteria 4315
1236 Ga0496105_0136872 3300048908 Bacteria 2017
1237 Ga0496105_0180562 3300048908 Bacteria 1728
1238 Ga0496105_0275585 3300048908 Bacteria 1358
1239 Ga0496105_0319177 3300048908 Bacteria 1245
1240 Ga0496105_0340263 3300048908 Bacteria 1200
1241 Ga0496105_0367523 3300048908 Bacteria 1146
1242 Ga0496105_0465627 3300048908 Bacteria 996
1243 Ga0496106_0030607 3300048909 Bacteria 4012
1244 Ga0496106_0081020 3300048909 Bacteria 2493
1245 Ga0496106_0082451 3300048909 Bacteria 2472
1246 Ga0496106_0134664 3300048909 Bacteria 1939
1247 Ga0496106_0213648 3300048909 Bacteria 1537
1248 Ga0496107_0031342 3300048910 Bacteria 3793
1249 Ga0496107_0072462 3300048910 Bacteria 2504
1250 Ga0496107_0092545 3300048910 Bacteria 2210
1251 Ga0496108_0003156 3300048911 Bacteria 13260
1252 Ga0496108_0014407 3300048911 Bacteria 6455
1253 Ga0496108_0018270 3300048911 Bacteria 5741
1254 Ga0496108_0025779 3300048911 Bacteria 4848
1255 Ga0496108_0214097 3300048911 Bacteria 1673
1256 Ga0496108_0668302 3300048911 Bacteria 902
1257 Ga0496109_0005308 3300048912 Bacteria 10767
1258 Ga0496109_0038020 3300048912 Bacteria 4350
1259 Ga0496109_0165228 3300048912 Bacteria 2075
1260 Ga0496109_0193317 3300048912 Bacteria 1912
1261 Ga0496109_0367757 3300048912 Bacteria 1358
1262 Ga0496109_0465062 3300048912 Bacteria 1194
1263 Ga0496110_0005523 3300048913 Bacteria 9924
1264 Ga0496110_0010037 3300048913 Bacteria 7684
1265 Ga0496110_0011132 3300048913 Bacteria 7348
1266 Ga0496110_0057940 3300048913 Bacteria 3411
1267 Ga0496110_0123817 3300048913 Bacteria 2331
1268 Ga0496110_0181973 3300048913 Bacteria 1908
1269 Ga0496110_0274224 3300048913 Bacteria 1536
1270 Ga0496110_0371266 3300048913 Bacteria 1303
1271 Ga0496111_0003277 3300048914 Bacteria 9999
1272 Ga0496111_0046277 3300048914 Bacteria 3132
1273 Ga0496111_0059149 3300048914 Bacteria 2776
1274 Ga0496111_0073915 3300048914 Bacteria 2482
1275 Ga0496112_0004018 3300048915 Bacteria 12333
1276 Ga0496112_0072079 3300048915 Bacteria 3414
1277 Ga0496112_0082862 3300048915 Bacteria 3171
1278 Ga0496112_0278771 3300048915 Bacteria 1619
1279 Ga0496112_0405126 3300048915 Bacteria 1303
1280 Ga0496113_0125781 3300048916 Bacteria 2007
1281 Ga0496113_0175342 3300048916 Bacteria 1699
1282 Ga0496113_0181358 3300048916 Bacteria 1669
1283 Ga0496113_0274747 3300048916 Bacteria 1347
1284 Ga0496114_0006337 3300048917 Bacteria 9309
1285 Ga0496114_0009161 3300048917 Bacteria 7848
1286 Ga0496114_0010117 3300048917 Bacteria 7503
1287 Ga0496114_0296046 3300048917 Bacteria 1428
1288 Ga0496114_0353241 3300048917 Bacteria 1300
1289 Ga0496114_0476973 3300048917 Bacteria 1104
1290 Ga0496114_0674913 3300048917 Bacteria 907
1291 Ga0496115_0109707 3300048918 Bacteria 2266
1292 Ga0496115_0114134 3300048918 Bacteria 2220
1293 Ga0496115_0194781 3300048918 Bacteria 1674
1294 Ga0496117_0130060 3300048920 Bacteria 1528
1295 Ga0496119_0039030 3300048922 Bacteria 3057
1296 Ga0496124_0075900 3300048927 Bacteria 2776
1297 Ga0496124_0195148 3300048927 Bacteria 1545
1298 Ga0496125_0140995 3300048928 Bacteria 1676
1299 Ga0496126_0007772 3300048929 Bacteria 11685
1300 Ga0496126_0124145 3300048929 Bacteria 2236
1301 Ga0496126_0319714 3300048929 Bacteria 1276
1302 Ga0501031_0053545 3300049568 Bacteria 2630
1303 Ga0501034_0028563 3300049571 Bacteria 5677
1304 Ga0501034_0388411 3300049571 Bacteria 1320
1305 Ga0501036_0006249 3300049572 Bacteria 9662
1306 Ga0501037_0035170 3300049573 Bacteria 3695
1307 Ga0501037_0046940 3300049573 Bacteria 3166
1308 Ga0501038_0001144 3300049574 Bacteria 24032
1309 Ga0501038_0101197 3300049574 Bacteria 2399
1310 Ga0501039_0073454 3300049575 Bacteria 2657
1311 Ga0501039_0093563 3300049575 Bacteria 2343
1312 Ga0501040_0005550 3300049576 Bacteria 8167
1313 Ga0501040_0129168 3300049576 Bacteria 1776
1314 Ga0501041_0000946 3300049577 Bacteria 15751
1315 Ga0501042_0006519 3300049578 Bacteria 7582
1316 Ga0501042_0007655 3300049578 Bacteria 7089
1317 Ga0501043_0012741 3300049579 Bacteria 6572
1318 Ga0501043_0068779 3300049579 Bacteria 2781
1319 Ga0501046_0011693 3300049580 Bacteria 7497
1320 Ga0501047_0000142 3300049581 Bacteria 87761
1321 Ga0501047_0034147 3300049581 Bacteria 4911
1322 Ga0501047_0320376 3300049581 Bacteria 1390
1323 Ga0501047_0368362 3300049581 Bacteria 1272
1324 Ga0501048_0040438 3300049582 Bacteria 3341
1325 Ga0501048_0056247 3300049582 Bacteria 2791
1326 Ga0501067_0025344 3300049583 Bacteria 3287
1327 Ga0501067_0049319 3300049583 Bacteria 2333
1328 Ga0501069_0020370 3300049585 Bacteria 3593
1329 Ga0501070_0114313 3300049586 Bacteria 2230
1330 Ga0501071_0000522 3300049587 Bacteria 19649
1331 Ga0501072_0007902 3300049588 Bacteria 8076
1332 Ga0501073_0007656 3300049589 Bacteria 8017
1333 Ga0501073_0180435 3300049589 Bacteria 1461
1334 Ga0501074_0001769 3300049590 Bacteria 14759
1335 Ga0501074_0012148 3300049590 Bacteria 6261
1336 Ga0501075_0052999 3300049591 Bacteria 3050
1337 Ga0501075_0309393 3300049591 Bacteria 1204
1338 Ga0501076_0001397 3300049592 Bacteria 16176
1339 Ga0501079_0007061 3300049741 Bacteria 8474
1340 Ga0501080_0036643 3300049742 Bacteria 4579
1341 Ga0501081_0033385 3300049743 Bacteria 3496
1342 Ga0501035_0073011 3300049822 Bacteria 3036
1343 Ga0501044_0057615 3300049823 Bacteria 3987
1344 Ga0501045_0001418 3300049824 Bacteria 15977
1345 Ga0501045_0128299 3300049824 Bacteria 1885
1346 Ga0501045_0143278 3300049824 Bacteria 1777
1347 nmdc:mga0yw44_327743_c1 3300050492 Bacteria 1029
1348 nmdc:mga0yw44_41168_c1 3300050492 Bacteria 2749
1349 nmdc:mga06z11_15499_c1 3300050494 Bacteria 3403
1350 nmdc:mga06z11_362014_c1 3300050494 Bacteria 869
1351 nmdc:mga05p37_1011693_c1 3300050507 Bacteria 881
1352 nmdc:mga05p37_11636_c1 3300050507 Bacteria 10487
1353 nmdc:mga05p37_203002_c1 3300050507 Bacteria 2399
1354 nmdc:mga05p37_493541_c1 3300050507 Bacteria 1407
1355 nmdc:mga05p37_64391_c1 3300050507 Bacteria 2615
1356 nmdc:mga05p37_815_c1 3300050507 Bacteria 34870
1357 nmdc:mga05p37_9788_c1 3300050507 Bacteria 11374
1358 nmdc:mga09592_108713_c1 3300050508 Bacteria 2379
1359 nmdc:mga09592_349381_c1 3300050508 Bacteria 1280
1360 nmdc:mga09592_96632_c1 3300050508 Bacteria 2527
1361 nmdc:mga0qj67_148242_c1 3300050509 Bacteria 1903
1362 nmdc:mga0qj67_341211_c1 3300050509 Bacteria 1212
1363 nmdc:mga06r32_120339_c1 3300050510 Bacteria 2589
1364 nmdc:mga06r32_269928_c1 3300050510 Bacteria 1689
1365 nmdc:mga06r32_484819_c1 3300050510 Bacteria 1214
1366 nmdc:mga06r32_555_c1 3300050510 Bacteria 32486
1367 nmdc:mga08y16_13789_c1 3300050511 Bacteria 8506
1368 nmdc:mga08y16_25766_c1 3300050511 Bacteria 6206
1369 nmdc:mga08y16_2869_c1 3300050511 Bacteria 17731
1370 nmdc:mga0n895_18318_c1 3300050512 Bacteria 6476
1371 nmdc:mga0n895_2559_c1 3300050512 Bacteria 14261
1372 nmdc:mga0n895_25683_c1 3300050512 Bacteria 5570
1373 nmdc:mga0n895_9919_c1 3300050512 Bacteria 8377
1374 nmdc:mga0rr50_218038_c1 3300050513 Bacteria 1575
1375 nmdc:mga08x19_2217_c1 3300050514 Bacteria 11868
1376 nmdc:mga08x19_24349_c1 3300050514 Bacteria 3761
1377 nmdc:mga08x19_282208_c1 3300050514 Bacteria 1151
1378 nmdc:mga08x19_461869_c1 3300050514 Bacteria 894
1379 nmdc:mga0a205_22726_c1 3300050515 Bacteria 5945
1380 nmdc:mga0a205_42649_c1 3300050515 Bacteria 4372
1381 nmdc:mga0a205_51921_c1 3300050515 Bacteria 3958
1382 nmdc:mga0a205_6990_c1 3300050515 Bacteria 10200
1383 Ga0495601_0026743 3300053077 Bacteria 3564
1384 Ga0495601_0064932 3300053077 Bacteria 2322
1385 Ga0495601_0082067 3300053077 Bacteria 2069
1386 Ga0495601_0086935 3300053077 Bacteria 2009
1387 Ga0495601_0192021 3300053077 Bacteria 1334
1388 Ga0495612_0000871 3300053078 Bacteria 12306
1389 Ga0495612_0017277 3300053078 Bacteria 2890
1390 Ga0495612_0026922 3300053078 Bacteria 2311
1391 Ga0495612_0039608 3300053078 Bacteria 1917
1392 Ga0495612_0049375 3300053078 Bacteria 1726
1393 Ga0495595_0001179 3300053084 Bacteria 10154
1394 Ga0495595_0006228 3300053084 Bacteria 4856
1395 Ga0495595_0025853 3300053084 Bacteria 2604
1396 Ga0495595_0051393 3300053084 Bacteria 1910
1397 Ga0495595_0190837 3300053084 Bacteria 1018
1398 Ga0495619_0039553 3300053085 Bacteria 3079
1399 Ga0495619_0084061 3300053085 Bacteria 2147
1400 Ga0495619_0231472 3300053085 Bacteria 1280
1401 Ga0501084_0003958 3300054114 Bacteria 12064
1402 Ga0590075_021409 3300059424 Bacteria 1613
1403 Ga0501082_0003209 3300060353 Bacteria 14258
1404 Ga0501082_0057334 3300060353 Bacteria 3356
1405 Ga0466962_0022908 3300061719 Bacteria 3001
1406 Ga0466962_0025908 3300061719 Bacteria 2815
1407 Ga0466962_0063119 3300061719 Bacteria 1769
1408 Ga0466962_0153770 3300061719 Bacteria 1116
1409 Ga0530510_0018420 3300061734 Bacteria 4950
1410 Ga0530510_0069360 3300061734 Bacteria 2558
1411 Ga0530510_0256115 3300061734 Bacteria 1304
1412 2537897869 2537561592 Bacteria 4348607
1413 2644526702 2643221694 Bacteria 4392972
1414 2644611205 2643221711 Bacteria 4865335
1415 2644670556 2643221722 Bacteria 4247614
1416 2676495084 2675903060 Bacteria 10051191
1417 2768646664 2767802112 Bacteria 6465194
1418 2775656908 2775506735 Bacteria 4556596
1419 2784472230 2784132109 Bacteria 3141763
1420 2808831129 2808606357 Bacteria 4466944
1421 2808852393 2808606360 Bacteria 4404006
1422 2808879315 2808606366 Bacteria 4415912
1423 2808896439 2808606371 Bacteria 4251511
1424 2810363754 2808606700 Bacteria 3482157
1425 2812321175 2811994871 Bacteria 4497550
1426 2812375004 2811994882 Bacteria 4688362
1427 2819427746 2818991318 Bacteria 5266538
1428 2819691759 2818991462 Bacteria 4320267
1429 2819729467 2818991469 Bacteria 4644110
1430 2856743494 2856741275 Bacteria 8096094
1431 2862706621 2862705112 Bacteria 6563286
1432 2873314945 2873314349 Bacteria 8512634
1433 2884694273 2884693830 Bacteria 11273186
1434 2891402564 2891395885 Bacteria 9251614
1435 2891554893 2891554331 Bacteria 8812224
1436 2891562797 2891562705 Bacteria 8039471
1437 2895435668 2895427314 Bacteria 13147766
1438 2895444713 2895442618 Bacteria 11027144
1439 2905930886 2905926851 Bacteria 4423176
1440 2932434693 2932431166 Bacteria 4215299
1441 2945918934 2945916053 Bacteria 4555517
1442 2946062785 2946059875 Bacteria 4386623
1443 2954000409 2953998280 Bacteria 4812144
1444 2974306914 2974302888 Bacteria 4369871
1445 2990044591 2990044586 Bacteria 6603797
1446 3001891493 3001889506 Bacteria 2975194
1447 3003002262 3002998708 Bacteria 11715108
1448 8004022743 8004021418 Bacteria 4313954
1449 8004029419 8004025490 Bacteria 4327753
1450 8008489218 8008485437 Bacteria 7198341
1451 8025527549 8025524527 Bacteria 7197316
1452 8053951764 8053945823 Bacteria 8962862
1453 8054612961 8054609563 Bacteria 5170090
1454 8055072627 8055066027 Bacteria 9479577
1455 8055175737 8055172936 Bacteria 9305943
1456 8056582024 8056579771 Bacteria 5840325
1457 Ga0213875_10000279
1458 JGI25152J39213_1000140
1459 JGI25404J52841_10005090
1460 JGI25404J52841_10026453
1461 Ga0065714_10006475
1462 Ga0070658_10037640
1463 Ga0070658_10041079
1464 Ga0070658_10365269
1465 Ga0070676_10034801
1466 Ga0070676_10066430
1467 Ga0070676_10142671
1468 Ga0070683_100001232
1469 Ga0070683_100023183
1470 Ga0070683_100038676
1471 Ga0070683_100126071
1472 Ga0070683_100399913
1473 Ga0070690_100078081
1474 Ga0070690_100094011
1475 Ga0070670_100152472
1476 Ga0068869_100048676
1477 Ga0070666_10015201
1478 Ga0070680_100020946
1479 Ga0070680_100096329
1480 Ga0070680_100261212
1481 Ga0070680_100511273
1482 Ga0070680_100560137
1483 Ga0070682_100007568
1484 Ga0070682_100010252
1485 Ga0070682_100041585
1486 Ga0070682_100054771
1487 Ga0070682_100177740
1488 Ga0068868_100072693
1489 Ga0068868_100088079
1490 Ga0070660_100045964
1491 Ga0070689_100122383
1492 Ga0070691_10010867
1493 Ga0070691_10030466
1494 Ga0070687_100217974
1495 Ga0070661_100065930
1496 Ga0070661_100119649
1497 Ga0070692_10049130
1498 Ga0070692_10063335
1499 Ga0070668_100150927
1500 Ga0070668_100394332
1501 Ga0070669_100129893
1502 Ga0070675_100018324
1503 Ga0070675_100039053
1504 Ga0070671_100049585
1505 Ga0070671_100142149
1506 Ga0070673_100128824
1507 Ga0070673_100521723
1508 Ga0070673_100571776
1509 Ga0070659_100048728
1510 Ga0070659_100255916
1511 Ga0070703_10006990
1512 Ga0070709_10119243
1513 Ga0070709_10132298
1514 Ga0070714_100000106
1515 Ga0070714_100003050
1516 Ga0070714_100011007
1517 Ga0070714_100068535
1518 Ga0070714_100086279
1519 Ga0070714_100089153
1520 Ga0070714_100116118
1521 Ga0070714_100215886
1522 Ga0070714_100294787
1523 Ga0070714_100368581
1524 Ga0070714_100549624
1525 Ga0070713_100002552
1526 Ga0070713_100008841
1527 Ga0070713_100010745
1528 Ga0070713_100026673
1529 Ga0070713_100041218
1530 Ga0070713_100050651
1531 Ga0070713_100070574
1532 Ga0070713_100083862
1533 Ga0070713_100251386
1534 Ga0070713_100651521
1535 Ga0070710_10007646
1536 Ga0070710_10015638
1537 Ga0070710_10024332
1538 Ga0070710_10028942
1539 Ga0070710_10065028
1540 Ga0070710_10072542
1541 Ga0070710_10074785
1542 Ga0070701_10040585
1543 Ga0070701_10060258
1544 Ga0070711_100003698
1545 Ga0070711_100159984
1546 Ga0070705_100016297
1547 Ga0070705_100021518
1548 Ga0070705_100379451
1549 Ga0070700_100000032
1550 Ga0070700_100016501
1551 Ga0070700_100088159
1552 Ga0070694_100008433
1553 Ga0070708_100004613
1554 Ga0070708_100014087
1555 Ga0070708_100030992
1556 Ga0070708_100041624
1557 Ga0070708_100063836
1558 Ga0070708_100131996
1559 Ga0070663_100002903
1560 Ga0070663_100016265
1561 Ga0070678_100003362
1562 Ga0070678_100023732
1563 Ga0070681_10265389
1564 Ga0070681_10327749
1565 Ga0070685_10097188
1566 Ga0070706_100001339
1567 Ga0070706_100002385
1568 Ga0070706_100009601
1569 Ga0070706_100012481
1570 Ga0070706_100016812
1571 Ga0070706_100022152
1572 Ga0070706_100063501
1573 Ga0070706_100066956
1574 Ga0070706_100074265
1575 Ga0070706_100160898
1576 Ga0070706_100233845
1577 Ga0070706_100251843
1578 Ga0070707_100002030
1579 Ga0070707_100002309
1580 Ga0070707_100008144
1581 Ga0070707_100033800
1582 Ga0070707_100067555
1583 Ga0070707_100075099
1584 Ga0070707_100077254
1585 Ga0070707_100100904
1586 Ga0070707_100189752
1587 Ga0070707_100231986
1588 Ga0070698_100000546
1589 Ga0070698_100000603
1590 Ga0070698_100005898
1591 Ga0070698_100007558
1592 Ga0070698_100008876
1593 Ga0070698_100029873
1594 Ga0070698_100035273
1595 Ga0070698_100039145
1596 Ga0070698_100057134
1597 Ga0070698_100064438
1598 Ga0070698_100130505
1599 Ga0070698_100152667
1600 Ga0070698_100180223
1601 Ga0070698_100226293
1602 Ga0070699_100001575
1603 Ga0070679_100023566
1604 Ga0070679_100024087
1605 Ga0070679_100097856
1606 Ga0070679_100135810
1607 Ga0070679_100259317
1608 Ga0070684_100001567
1609 Ga0070684_100025965
1610 Ga0070684_100109092
1611 Ga0070684_100183094
1612 Ga0070684_100241134
1613 Ga0070684_100431690
1614 Ga0070697_100012968
1615 Ga0070697_100056754
1616 Ga0070697_100081358
1617 Ga0070697_100124388
1618 Ga0068853_100127427
1619 Ga0070686_100023146
1620 Ga0070686_100040954
1621 Ga0070695_100007032
1622 Ga0070695_100117539
1623 Ga0070696_100000771
1624 Ga0070696_100007537
1625 Ga0070696_100033355
1626 Ga0070693_100000790
1627 Ga0070693_100038449
1628 Ga0070665_100062161
1629 Ga0070665_100128101
1630 Ga0070665_100208501
1631 Ga0070704_100103523
1632 Ga0068855_100153052
1633 Ga0068857_100455458
1634 Ga0068854_100013646
1635 Ga0068856_100058004
1636 Ga0068856_100133415
1637 Ga0068856_100279141
1638 Ga0068856_100406768
1639 Ga0070702_100004694
1640 Ga0070702_100055450
1641 Ga0068852_100083196
1642 Ga0068852_100146623
1643 Ga0068864_100009054
1644 Ga0068864_100439866
1645 Ga0068861_100298242
1646 Ga0068870_10184942
1647 Ga0068863_100031657
1648 Ga0068863_100216938
1649 Ga0068860_100095557
1650 Ga0081455_10009965
1651 Ga0081455_10122766
1652 Ga0081455_10139456
1653 Ga0081538_10001393
1654 Ga0081540_1000345
1655 Ga0081540_1002862
1656 Ga0081540_1056961
1657 Ga0070717_10004502
1658 Ga0070717_10019476
1659 Ga0070717_10027018
1660 Ga0070717_10029071
1661 Ga0070717_10223296
1662 Ga0070717_10233681
1663 Ga0070717_10235691
1664 Ga0070717_10238522
1665 Ga0075432_10001623
1666 Ga0075432_10004430
1667 Ga0075432_10103550
1668 Ga0070715_10139307
1669 Ga0070715_10154831
1670 Ga0070716_100004563
1671 Ga0070716_100074442
1672 Ga0070716_100130020
1673 Ga0070716_100348339
1674 Ga0070712_100000686
1675 Ga0070712_100012108
1676 Ga0070712_100063385
1677 Ga0070712_100346651
1678 Ga0070712_100689965
1679 Ga0075367_10079522
1680 Ga0075367_10297830
1681 Ga0097621_100104682
1682 Ga0068871_100098374
1683 Ga0068871_100107880
1684 Ga0075428_100000550
1685 Ga0075428_100000883
1686 Ga0075428_100090930
1687 Ga0075428_100171638
1688 Ga0075430_100137972
1689 Ga0075431_100022433
1690 Ga0075431_100066828
1691 Ga0075431_100077379
1692 Ga0075433_10019092
1693 Ga0075433_10022654
1694 Ga0075433_10042941
1695 Ga0075433_10062467
1696 Ga0075434_100024868
1697 Ga0075434_100040248
1698 Ga0075434_100171584
1699 Ga0075434_100488771
1700 Ga0075429_100260772
1701 Ga0075429_100318478
1702 Ga0075436_100000929
1703 Ga0075436_100019491
1704 Ga0075436_100058056
1705 Ga0075436_100069714
1706 Ga0075436_100103298
1707 Ga0075435_100013427
1708 Ga0075435_100085039
1709 Ga0075435_100729832
1710 Ga0099794_10066788
1711 Ga0111539_10000342
1712 Ga0111539_10055497
1713 Ga0105245_10023219
1714 Ga0105245_10031225
1715 Ga0105245_10068388
1716 Ga0105245_10108505
1717 Ga0105245_10123453
1718 Ga0105245_10148480
1719 Ga0105245_10296017
1720 Ga0105245_10330414
1721 Ga0105247_10035569
1722 Ga0114129_10002267
1723 Ga0114129_10143862
1724 Ga0114129_10208890
1725 Ga0114129_10291473
1726 Ga0114129_10700278
1727 Ga0114129_10971568
1728 Ga0105243_10023631
1729 Ga0105243_10097396
1730 Ga0105243_10138265
1731 Ga0105243_10274200
1732 Ga0105241_10002632
1733 Ga0105241_10171665
1734 Ga0105241_10217135
1735 Ga0105248_10035978
1736 Ga0105248_10039070
1737 Ga0105248_10111205
1738 Ga0105248_10148860
1739 Ga0105237_10092314
1740 Ga0105237_10462450
1741 Ga0105238_10089595
1742 Ga0105238_10165729
1743 Ga0105238_10166610
1744 Ga0105239_10001401
1745 Ga0105239_10183026
1746 Ga0105246_10001050
1747 Ga0105246_10002276
1748 Ga0105246_10002387
1749 Ga0105246_10178396
1750 Ga0105246_10538941
1751 Ga0157340_1000795
1752 Ga0157328_1003268
1753 Ga0157320_1001769
1754 Ga0157326_1005455
1755 Ga0157371_10005477
1756 Ga0157370_10114716
1757 Ga0157369_10041463
1758 Ga0157369_10090991
1759 Ga0157369_10131475
1760 Ga0157369_10139130
1761 Ga0157369_10196332
1762 Ga0163162_10034522
1763 Ga0163162_10583852
1764 Ga0157372_10006117
1765 Ga0157372_10253696
1766 Ga0157372_10274844
1767 Ga0157372_10656946
1768 Ga0157375_10059104
1769 Ga0157375_10154505
1770 Ga0157375_10283563
1771 Ga0157375_10473301
1772 Ga0163163_10052099
1773 Ga0163163_10187587
1774 Ga0163163_10698475
1775 Ga0157380_10159808
1776 Ga0157377_10044266
1777 Ga0157377_10053273
1778 Ga0157379_10021747
1779 Ga0157379_10398995
1780 Ga0157376_10273075
1781 Ga0163161_10020401
1782 Ga0206356_10432907
1783 Ga0206351_10135569
1784 Ga0206350_10042881
1785 Ga0206354_10464791
1786 Ga0206353_10077479
1787 Ga0206353_11124480
1788 Ga0206353_11987931
1789 Ga0154015_1296164
1790 Ga0213874_10036320
1791 Ga0213875_10000363
1792 Ga0213875_10007999
1793 Ga0213875_10027678
1794 Ga0213875_10032344
1795 Ga0213875_10044511
1796 Ga0213875_10137709
1797 Ga0224712_10021924
1798 Ga0224712_10147916
1799 Ga0209148_1002761
1800 Ga0209129_1000067
1801 Ga0209025_1001395
1802 Ga0209051_1012946
1803 Ga0207656_10056187
1804 Ga0207653_10002967
1805 Ga0207692_10003787
1806 Ga0207692_10004622
1807 Ga0207692_10020352
1808 Ga0207692_10042308
1809 Ga0207692_10129041
1810 Ga0207692_10174450
1811 Ga0207692_10237494
1812 Ga0207710_10060560
1813 Ga0207688_10003738
1814 Ga0207688_10004765
1815 Ga0207688_10064737
1816 Ga0207688_10358762
1817 Ga0207647_10052049
1818 Ga0207685_10000503
1819 Ga0207685_10016331
1820 Ga0207685_10123546
1821 Ga0207699_10000988
1822 Ga0207699_10003997
1823 Ga0207699_10004908
1824 Ga0207699_10011620
1825 Ga0207645_10008076
1826 Ga0207645_10075430
1827 Ga0207645_10097895
1828 Ga0207643_10000047
1829 Ga0207643_10030020
1830 Ga0207705_10035401
1831 Ga0207705_10098161
1832 Ga0207684_10000323
1833 Ga0207684_10003999
1834 Ga0207684_10010100
1835 Ga0207684_10022827
1836 Ga0207684_10029169
1837 Ga0207684_10040467
1838 Ga0207684_10045316
1839 Ga0207684_10064461
1840 Ga0207684_10067070
1841 Ga0207684_10103170
1842 Ga0207684_10127839
1843 Ga0207684_10128721
1844 Ga0207684_10251776
1845 Ga0207707_10001352
1846 Ga0207671_10109947
1847 Ga0207693_10025677
1848 Ga0207693_10044196
1849 Ga0207693_10061577
1850 Ga0207693_10159272
1851 Ga0207693_10187925
1852 Ga0207693_10199085
1853 Ga0207693_10325018
1854 Ga0207663_10001870
1855 Ga0207663_10008539
1856 Ga0207663_10031503
1857 Ga0207663_10056765
1858 Ga0207663_10109241
1859 Ga0207663_10109409
1860 Ga0207663_10189829
1861 Ga0207660_10022130
1862 Ga0207660_10048898
1863 Ga0207660_10409184
1864 Ga0207662_10068286
1865 Ga0207657_10013739
1866 Ga0207657_10041725
1867 Ga0207657_10084590
1868 Ga0207657_10089978
1869 Ga0207649_10100127
1870 Ga0207652_10102635
1871 Ga0207652_10194305
1872 Ga0207646_10000050
1873 Ga0207646_10011796
1874 Ga0207646_10014424
1875 Ga0207646_10023656
1876 Ga0207646_10027007
1877 Ga0207646_10041129
1878 Ga0207646_10453030
1879 Ga0207646_10473784
1880 Ga0207681_10015247
1881 Ga0207694_10035588
1882 Ga0207694_10082701
1883 Ga0207650_10010952
1884 Ga0207659_10066653
1885 Ga0207659_10293346
1886 Ga0207687_10030995
1887 Ga0207700_10000216
1888 Ga0207700_10000619
1889 Ga0207700_10006986
1890 Ga0207700_10014371
1891 Ga0207700_10020739
1892 Ga0207700_10039278
1893 Ga0207700_10056216
1894 Ga0207700_10089091
1895 Ga0207700_10099220
1896 Ga0207700_10101928
1897 Ga0207700_10194885
1898 Ga0207700_10230897
1899 Ga0207700_10468992
1900 Ga0207664_10000047
1901 Ga0207664_10000379
1902 Ga0207664_10000543
1903 Ga0207664_10000594
1904 Ga0207664_10002311
1905 Ga0207664_10010461
1906 Ga0207664_10024932
1907 Ga0207664_10033956
1908 Ga0207664_10060263
1909 Ga0207664_10061428
1910 Ga0207664_10074863
1911 Ga0207664_10110371
1912 Ga0207664_10176661
1913 Ga0207664_10255494
1914 Ga0207664_10332582
1915 Ga0207664_10338737
1916 Ga0207664_10425908
1917 Ga0207664_10699689
1918 Ga0207644_10027196
1919 Ga0207690_10053190
1920 Ga0207690_10214901
1921 Ga0207690_10430363
1922 Ga0207686_10151336
1923 Ga0207709_10011152
1924 Ga0207709_10144620
1925 Ga0207709_10330032
1926 Ga0207670_10324473
1927 Ga0207665_10001106
1928 Ga0207665_10001519
1929 Ga0207665_10001843
1930 Ga0207665_10020336
1931 Ga0207665_10022999
1932 Ga0207665_10033589
1933 Ga0207665_10171255
1934 Ga0207691_10011415
1935 Ga0207691_10035120
1936 Ga0207689_10009034
1937 Ga0207689_10026742
1938 Ga0207661_10012478
1939 Ga0207661_10038004
1940 Ga0207661_10070137
1941 Ga0207661_10182722
1942 Ga0207661_10209366
1943 Ga0207661_10366378
1944 Ga0207661_10380131
1945 Ga0207679_10003830
1946 Ga0207679_10056484
1947 Ga0207667_10108095
1948 Ga0207667_10818001
1949 Ga0207651_10150573
1950 Ga0207668_10148664
1951 Ga0207640_10062340
1952 Ga0207658_10048223
1953 Ga0207658_10101344
1954 Ga0207677_10047770
1955 Ga0207677_10263260
1956 Ga0207677_10539415
1957 Ga0207703_10036637
1958 Ga0207703_10175221
1959 Ga0207639_10070751
1960 Ga0207639_10101308
1961 Ga0207678_10001956
1962 Ga0207678_10007294
1963 Ga0207678_10022190
1964 Ga0207678_10439890
1965 Ga0207708_10027364
1966 Ga0207708_10074694
1967 Ga0207702_10101267
1968 Ga0207702_10205652
1969 Ga0207702_10286343
1970 Ga0207702_10418616
1971 Ga0207641_10037314
1972 Ga0207641_10089939
1973 Ga0207676_10063866
1974 Ga0207676_10077200
1975 Ga0207674_10027421
1976 Ga0207674_10028680
1977 Ga0207674_10065923
1978 Ga0207674_10192671
1979 Ga0207675_100010057
1980 Ga0207683_10001336
1981 Ga0207683_10006321
1982 Ga0207683_10007910
1983 Ga0207683_10317592
1984 Ga0207698_10203673
1985 Ga0207698_10662167
1986 Ga0207428_10000436
1987 Ga0207428_10006188
1988 Ga0207428_10243194
1989 Ga0268266_10027769
1990 Ga0268266_10191818
1991 Ga0268264_10227381
1992 Ga0265337_1002783
1993 Ga0265319_1040619
1994 Ga0265334_10028035
1995 Ga0265318_10052844
1996 Ga0265323_10032217
1997 Ga0265322_10004808
1998 Ga0265336_10006997
1999 Ga0265336_10007124
2000 Ga0307515_10228167
2001 Ga0265338_10001346
2002 Ga0265338_10006911
2003 Ga0265338_10010558
2004 Ga0265338_10025455
2005 Ga0265324_10009688
2006 Ga0316181_1287760
2007 Ga0265760_10084872
2008 Ga0265332_10002184
2009 Ga0265320_10042505
2010 Ga0265340_10025062
2011 Ga0265339_10015113
2012 Ga0265316_10068929
2013 Ga0307513_10001072
2014 Ga0307509_10405746
2015 Ga0307408_100002302
2016 Ga0307408_100009943
2017 Ga0307408_100023860
2018 Ga0307408_100030294
2019 Ga0307408_100042486
2020 Ga0307408_100083312
2021 Ga0307408_100111110
2022 Ga0307408_100182329
2023 Ga0265313_10006305
2024 Ga0265313_10030774
2025 Ga0316579_10004478
2026 Ga0316579_10042337
2027 Ga0265314_10017800
2028 Ga0265314_10046623
2029 Ga0265342_10012657
2030 Ga0316576_10055510
2031 Ga0316576_10074597
2032 Ga0316576_10089022
2033 Ga0316578_10106373
2034 Ga0316578_10130603
2035 Ga0307516_10360182
2036 Ga0307405_10001740
2037 Ga0307405_10080869
2038 Ga0307405_10143594
2039 Ga0307405_10492008
2040 Ga0316577_10004394
2041 Ga0316577_10066283
2042 Ga0307413_10009968
2043 Ga0307413_10050142
2044 Ga0307413_10073826
2045 Ga0307413_10109312
2046 Ga0307413_10128990
2047 Ga0307410_10001200
2048 Ga0307410_10010483
2049 Ga0307410_10017746
2050 Ga0307410_10063996
2051 Ga0307410_10082752
2052 Ga0307410_10240531
2053 Ga0307406_10000241
2054 Ga0307406_10018790
2055 Ga0307406_10019670
2056 Ga0307406_10040560
2057 Ga0307406_10240116
2058 Ga0307407_10002677
2059 Ga0307407_10004684
2060 Ga0307407_10045925
2061 Ga0307407_10067460
2062 Ga0307407_10337237
2063 Ga0307412_10033871
2064 Ga0307412_10156909
2065 Ga0307409_100000403
2066 Ga0307409_100007374
2067 Ga0307409_100022171
2068 Ga0307409_100027710
2069 Ga0307409_100035514
2070 Ga0307409_100036313
2071 Ga0307409_100049765
2072 Ga0307409_100056382
2073 Ga0307409_100081847
2074 Ga0307409_100111676
2075 Ga0307409_100225590
2076 Ga0307409_100231143
2077 Ga0307409_100258484
2078 Ga0307409_100507870
2079 Ga0307416_100000079
2080 Ga0307416_100003433
2081 Ga0307416_100020205
2082 Ga0307416_100054577
2083 Ga0307416_100055863
2084 Ga0307416_100056940
2085 Ga0307416_100065826
2086 Ga0307416_100092062
2087 Ga0307416_100125879
2088 Ga0307416_100181798
2089 Ga0307416_100212282
2090 Ga0307416_100575738
2091 Ga0307416_100720352
2092 Ga0307414_10001328
2093 Ga0307414_10086137
2094 Ga0307414_10095165
2095 Ga0307414_10147376
2096 Ga0307414_10192540
2097 Ga0307414_10375124
2098 Ga0307411_10001879
2099 Ga0307411_10016592
2100 Ga0307411_10035516
2101 Ga0307411_10062628
2102 Ga0307415_100026311
2103 Ga0307415_100055891
2104 Ga0307415_100061389
2105 Ga0307415_100172409
2106 Ga0307415_100183569
2107 Ga0307415_100270370
2108 Ga0307415_100363536
2109 Ga0316583_10012370
2110 Ga0316585_10019142
2111 Ga0316580_10006211
2112 Ga0316580_10055174
2113 Ga0316212_1002393
2114 Ga0373926_0006434
2115 Ga0373926_0070539
2116 Ga0373929_0027598
2117 Ga0373934_0000032
2118 Ga0373934_0004815
2119 Ga0373934_0015706
2120 Ga0373934_0045351
2121 Ga0373934_0049421
2122 Ga0373940_0089207
2123 Ga0373944_0000245
2124 Ga0373944_0009505
2125 Ga0373944_0018985
2126 Ga0373923_0000558
2127 Ga0373923_0022773
2128 Ga0373923_0040387
2129 Ga0373923_0052739
2130 Ga0373923_0168404
2131 Ga0373936_0000908
2132 Ga0373936_0009917
2133 Ga0373936_0010386
2134 Ga0373936_0071039
2135 Ga0373941_0019241
2136 Ga0373945_0000949
2137 Ga0373945_0001238
2138 Ga0373945_0037134
2139 Ga0373953_0000145
2140 Ga0373953_0008206
2141 Ga0373953_0010007
2142 Ga0373953_0068792
2143 Ga0373953_0069406
2144 Ga0373954_0023062
2145 Ga0373954_0050839
2146 Ga0373954_0059263
2147 Ga0373954_0091376
2148 Ga0373954_0228590
2149 Ga0373956_0000096
2150 Ga0373956_0009546
2151 Ga0373956_0015945
2152 Ga0373956_0017507
2153 Ga0373956_0024516
2154 Ga0373956_0065067
2155 Ga0373957_0017156
2156 Ga0373957_0104642
2157 Ga0373960_0011769
2158 Ga0373943_0000554
2159 Ga0373943_0095187
2160 Ga0373946_0000088
2161 Ga0373946_0037577
2162 Ga0373946_0080395
2163 Ga0373955_0000015
2164 Ga0373955_0021499
2165 Ga0373955_0031472
2166 Ga0373955_0053296
2167 Ga0373955_0086690
2168 Ga0373955_0102681
2169 Ga0373955_0185831
2170 Ga0373942_0003854
2171 Ga0373961_0009430
2172 Ga0373961_0066805
2173 Ga0373962_0011474
2174 Ga0373962_0016970
2175 Ga0316574_0002969
2176 Ga0316574_0027597
2177 Ga0316574_0048143
2178 Ga0373924_0003592
2179 Ga0373924_0006043
2180 Ga0373924_0006676
2181 Ga0373924_0057313
2182 Ga0373924_0063716
2183 Ga0373924_0175103
2184 Ga0373931_0016392
2185 Ga0373931_0039540
2186 Ga0373931_0253756
2187 Ga0373931_0344708
2188 Ga0373931_0385249
2189 Ga0373935_0005038
2190 Ga0373935_0007971
2191 Ga0373935_0032118
2192 Ga0373935_0095527
2193 Ga0373927_0002273
2194 Ga0373927_0013177
2195 Ga0373927_0183227
2196 Ga0373933_0000004
2197 Ga0373933_0001154
2198 Ga0373933_0009139
2199 Ga0373933_0026217
2200 Ga0373933_0032220
2201 Ga0373933_0087911
2202 Ga0373933_0101986
2203 Ga0373933_0138807
2204 Ga0373933_0211310
2205 Ga0373933_0242773
2206 Ga0373947_0000116
2207 Ga0373947_0000815
2208 Ga0373947_0025713
2209 Ga0373947_0100704
2210 Ga0373947_0121269
2211 Ga0373947_0284467
2212 Ga0373937_0000012
2213 Ga0373937_0063728
2214 Ga0373937_0067438
2215 Ga0373937_0068625
2216 Ga0373937_0119951
2217 Ga0373937_0168985
2218 Ga0373937_0172163
2219 Ga0373937_0402129
2220 Ga0373937_0751607
2221 Ga0373937_0835469
2222 Ga0372808_006891
2223 Ga0316582_0004867
2224 Ga0316584_0009116
2225 Ga0316584_0018850
2226 Ga0316584_0051715
2227 Ga0373925_0000021
2228 Ga0373925_0003050
2229 Ga0373925_0005539
2230 Ga0373925_0073881
2231 Ga0373925_0094353
2232 Ga0373925_0112859
2233 Ga0373925_0168389
2234 Ga0395899_0016113
2235 Ga0395899_0055732
2236 Ga0395900_0007662
2237 Ga0395900_0018014
2238 Ga0395900_0018741
2239 Ga0395900_0049923
2240 Ga0395900_0057687
2241 Ga0395900_0085090
2242 Ga0395900_0113139
2243 Ga0395898_0017683
2244 Ga0395898_0032533
2245 Ga0395898_0050546
2246 Ga0395898_0073181
2247 Ga0395898_0081435
2248 Ga0395898_0083833
2249 Ga0395898_0090890
2250 Ga0395898_0133313
2251 Ga0395905_0042768
2252 Ga0395905_0088621
2253 Ga0395905_0117457
2254 Ga0316581_0016916
2255 Ga0436364_0426348
2256 Ga0436364_0549328
2257 Ga0436364_0563172
2258 Ga0436364_0896453
2259 Ga0436364_0990552
2260 Ga0436364_1292226
2261 Ga0436364_1406831
2262 Ga0436364_1419792
2263 Ga0436364_1427311
2264 Ga0436364_1475022
2265 Ga0395901_0003285
2266 Ga0395901_0004509
2267 Ga0395901_0008590
2268 Ga0395901_0018051
2269 Ga0395901_0020548
2270 Ga0395901_0032466
2271 Ga0395901_0048337
2272 Ga0395901_0112405
2273 Ga0395901_0167743
2274 Ga0395901_0203548
2275 Ga0395901_0224113
2276 Ga0395901_0229433
2277 Ga0436365_0471577
2278 Ga0436365_0510277
2279 Ga0436363_1571899
2280 Ga0439436_0030917
2281 Ga0439438_032040
2282 Ga0439439_0007684
2283 Ga0439466_0011359
2284 Ga0439466_0015797
2285 Ga0439465_0027389
2286 Ga0451807_1174564
2287 Ga0451833_0564772
2288 Ga0451833_0913143
2289 Ga0451837_0729638
2290 Ga0451839_1288255
2291 Ga0451843_0773603
2292 Ga0451853_2585626
2293 Ga0439431_0053821
2294 Ga0439433_0000441
2295 Ga0439433_0000451
2296 Ga0439442_017474
2297 Ga0439432_065575
2298 Ga0439449_0008093
2299 Ga0439449_0009742
2300 Ga0439452_012151
2301 Ga0439457_000675
2302 Ga0439457_008987
2303 Ga0439457_041047
2304 Ga0439462_0000144
2305 Ga0439462_0048724
2306 Ga0450919_001721
2307 Ga0450919_003706
2308 Ga0450907_002582
2309 Ga0439446_0002486
2310 Ga0439458_0007512
2311 Ga0450908_006499
2312 Ga0439434_0003918
2313 Ga0439460_0055304
2314 Ga0466969_0116744
2315 Ga0466965_0035061
2316 Ga0466965_0039545
2317 Ga0466965_0058778
2318 Ga0466965_0068583
2319 Ga0466965_0130882
2320 Ga0466965_0172072
2321 Ga0466966_0008166
2322 Ga0466961_0040238
2323 Ga0466961_0054074
2324 Ga0466961_0198937
2325 Ga0466963_0065730
2326 Ga0466963_0066124
2327 Ga0466963_0066850
2328 Ga0466963_0091945
2329 Ga0466963_0179436
2330 Ga0466963_0385456
2331 Ga0466971_0020900
2332 Ga0466971_0031798
2333 Ga0466971_0120680
2334 Ga0466970_0039673
2335 Ga0466957_0006284
2336 Ga0466957_0018448
2337 Ga0466957_0053167
2338 Ga0466957_0066043
2339 Ga0466957_0070616
2340 Ga0466957_0102187
2341 Ga0466960_0009185
2342 Ga0466960_0010549
2343 Ga0466960_0118972
2344 Ga0466960_0183016
2345 Ga0466960_0188089
2346 Ga0466960_0243029
2347 Ga0466959_0019251
2348 Ga0466959_0124803
2349 Ga0466959_0189639
2350 Ga0451576_0002230
2351 Ga0451576_0119161
2352 Ga0466958_0025582
2353 Ga0466958_0050689
2354 Ga0466958_0055151
2355 Ga0466958_0058272
2356 Ga0466958_0129204
2357 Ga0466967_0000342
2358 Ga0466967_0004421
2359 Ga0466967_0015132
2360 Ga0466967_0032623
2361 Ga0466967_0035022
2362 Ga0466967_0041283
2363 Ga0466967_0125829
2364 Ga0466967_0142555
2365 Ga0466967_0189077
2366 Ga0466967_0258272
2367 Ga0466967_0829156
2368 Ga0466967_1047879
2369 Ga0495592_0001038
2370 Ga0495592_0031728
2371 Ga0495592_0050439
2372 Ga0495592_0078980
2373 Ga0495592_0107092
2374 Ga0495592_0239903
2375 Ga0495592_0326828
2376 Ga0495603_0167973
2377 Ga0495629_0007551
2378 Ga0495629_0010631
2379 Ga0495629_0013423
2380 Ga0495629_0048167
2381 Ga0495629_0062962
2382 Ga0495629_0152261
2383 Ga0495629_0163137
2384 Ga0495641_0001864
2385 Ga0495641_0013724
2386 Ga0495641_0061386
2387 Ga0495641_0106769
2388 Ga0495651_0000007
2389 Ga0495651_0004624
2390 Ga0495651_0007200
2391 Ga0495651_0017643
2392 Ga0495651_0028199
2393 Ga0495651_0035062
2394 Ga0495651_0055772
2395 Ga0495651_0100495
2396 Ga0495651_0130321
2397 Ga0495653_0002903
2398 Ga0495653_0005400
2399 Ga0495653_0044104
2400 Ga0495653_0058305
2401 Ga0495653_0071329
2402 Ga0495653_0099008
2403 Ga0495653_0107923
2404 Ga0495653_0126719
2405 Ga0495653_0182106
2406 Ga0495653_0199359
2407 Ga0495580_0004371
2408 Ga0495580_0016668
2409 Ga0495580_0036169
2410 Ga0495580_0112747
2411 Ga0495580_0171263
2412 Ga0495582_0001211
2413 Ga0495582_0008405
2414 Ga0495582_0035034
2415 Ga0495582_0089844
2416 Ga0495639_0001832
2417 Ga0495639_0021230
2418 Ga0495639_0021980
2419 Ga0495639_0093254
2420 Ga0495662_0001706
2421 Ga0495662_0005333
2422 Ga0495662_0019268
2423 Ga0495662_0056962
2424 Ga0495662_0071230
2425 Ga0495662_0190035
2426 Ga0495664_0015997
2427 Ga0495664_0017591
2428 Ga0495664_0023104
2429 Ga0495664_0023548
2430 Ga0495664_0085245
2431 Ga0495664_0088493
2432 Ga0495664_0182922
2433 Ga0495594_0055096
2434 Ga0495594_0131569
2435 Ga0495594_0176015
2436 Ga0495608_0000015
2437 Ga0495608_0003113
2438 Ga0495608_0023384
2439 Ga0495608_0035583
2440 Ga0495608_0042228
2441 Ga0495608_0173290
2442 Ga0495610_0046672
2443 Ga0495618_0010247
2444 Ga0495618_0018166
2445 Ga0495618_0032650
2446 Ga0495618_0033505
2447 Ga0495618_0046890
2448 Ga0495618_0226819
2449 Ga0495618_0259084
2450 Ga0495620_0033763
2451 Ga0495628_0000737
2452 Ga0495628_0020395
2453 Ga0495628_0093629
2454 Ga0495628_0108065
2455 Ga0495628_0109645
2456 Ga0495628_0225522
2457 Ga0495630_0014740
2458 Ga0495630_0016397
2459 Ga0495630_0055377
2460 Ga0495630_0073436
2461 Ga0495630_0101875
2462 Ga0495630_0143227
2463 Ga0495630_0186032
2464 Ga0495631_0025563
2465 Ga0495643_0049805
2466 Ga0495666_0047449
2467 Ga0495642_0050632
2468 Ga0495652_0000074
2469 Ga0495652_0040395
2470 Ga0495652_0059276
2471 Ga0495665_0000709
2472 Ga0495665_0012143
2473 Ga0495665_0013704
2474 Ga0495665_0028260
2475 Ga0495665_0063921
2476 Ga0495665_0074025
2477 Ga0495665_0272085
2478 Ga0495640_0017253
2479 Ga0495640_0036412
2480 Ga0495640_0040539
2481 Ga0495640_0051504
2482 Ga0495640_0208143
2483 Ga0495640_0230679
2484 Ga0495586_0015922
2485 Ga0495586_0019276
2486 Ga0495586_0025942
2487 Ga0495586_0043843
2488 Ga0495586_0051127
2489 Ga0495586_0095013
2490 Ga0495586_0153479
2491 Ga0495586_0156678
2492 Ga0495587_0001582
2493 Ga0495587_0002197
2494 Ga0495587_0006439
2495 Ga0495587_0025644
2496 Ga0495587_0027425
2497 Ga0495587_0086010
2498 Ga0495587_0097585
2499 Ga0495645_0014511
2500 Ga0495645_0028722
2501 Ga0495645_0035518
2502 Ga0495645_0053202
2503 Ga0495645_0055341
2504 Ga0495645_0331087
2505 Ga0495667_0000033
2506 Ga0495667_0003838
2507 Ga0495667_0006453
2508 Ga0495667_0015200
2509 Ga0495667_0026409
2510 Ga0495667_0050559
2511 Ga0495667_0054161
2512 Ga0495667_0063129
2513 Ga0495667_0173149
2514 Ga0495667_0202688
2515 Ga0495667_0233168
2516 Ga0495667_0371471
2517 Ga0495656_0043226
2518 Ga0495634_0004914
2519 Ga0495634_0006863
2520 Ga0495634_0052289
2521 Ga0495634_0057233
2522 Ga0495634_0062630
2523 Ga0495635_0001151
2524 Ga0495635_0003052
2525 Ga0495635_0010933
2526 Ga0495635_0025589
2527 Ga0495635_0043517
2528 Ga0495635_0153485
2529 Ga0495635_0229102
2530 Ga0495659_0009118
2531 Ga0495588_0009692
2532 Ga0495588_0036359
2533 Ga0495588_0049669
2534 Ga0495657_0001345
2535 Ga0495657_0013216
2536 Ga0495657_0015858
2537 Ga0495657_0020960
2538 Ga0495657_0022556
2539 Ga0495657_0032716
2540 Ga0495657_0047774
2541 Ga0495657_0109004
2542 Ga0495599_0000018
2543 Ga0495599_0008300
2544 Ga0495599_0030869
2545 Ga0495599_0058667
2546 Ga0495599_0069816
2547 Ga0495599_0110027
2548 Ga0495599_0190784
2549 Ga0495623_0000075
2550 Ga0495623_0012733
2551 Ga0495623_0040315
2552 Ga0495623_0050129
2553 Ga0495623_0099298
2554 Ga0495623_0171860
2555 Ga0495646_0005199
2556 Ga0495646_0058945
2557 Ga0495646_0090788
2558 Ga0495646_0114864
2559 Ga0495646_0142086
2560 Ga0495658_0007844
2561 Ga0495658_0031150
2562 Ga0495613_0006775
2563 Ga0495613_0033390
2564 Ga0495613_0054248
2565 Ga0495613_0132890
2566 Ga0495613_0179312
2567 Ga0495613_0239717
2568 Ga0495624_0009190
2569 Ga0495624_0095250
2570 Ga0495624_0109554
2571 Ga0495624_0122669
2572 Ga0495624_0185385
2573 Ga0495600_0007035
2574 Ga0495600_0008415
2575 Ga0495600_0010982
2576 Ga0495600_0015979
2577 Ga0495600_0101597
2578 Ga0495600_0131703
2579 Ga0495600_0148859
2580 Ga0495600_0180257
2581 Ga0495581_0006935
2582 Ga0495581_0008284
2583 Ga0495581_0010908
2584 Ga0495581_0016572
2585 Ga0495581_0021236
2586 Ga0495581_0042980
2587 Ga0495581_0059559
2588 Ga0495604_0000025
2589 Ga0495604_0017705
2590 Ga0495604_0024002
2591 Ga0495604_0032506
2592 Ga0495604_0042546
2593 Ga0495604_0057467
2594 Ga0495604_0211629
2595 Ga0495636_0033001
2596 Ga0495674_0005960
2597 Ga0495674_0013242
2598 Ga0495674_0023719
2599 Ga0495674_0034845
2600 Ga0495674_0054121
2601 Ga0495674_0064350
2602 Ga0495672_0100302
2603 Ga0495676_0006692
2604 Ga0495676_0045371
2605 Ga0495676_0051299
2606 Ga0495680_0000015
2607 Ga0495680_0003725
2608 Ga0495680_0020712
2609 Ga0495680_0028691
2610 Ga0495680_0035526
2611 Ga0495680_0053573
2612 Ga0495680_0055477
2613 Ga0495680_0061328
2614 Ga0495680_0091614
2615 Ga0495680_0116839
2616 Ga0495680_0121746
2617 Ga0495680_0142002
2618 Ga0495675_0006002
2619 Ga0495675_0014139
2620 Ga0495675_0064853
2621 Ga0495675_0090742
2622 Ga0495675_0142855
2623 Ga0495675_0166250
2624 Ga0495685_074299
2625 Ga0495681_0054340
2626 Ga0495684_0004360
2627 Ga0495684_0012033
2628 Ga0495684_0023488
2629 Ga0495684_0027914
2630 Ga0495684_0116879
2631 Ga0495684_0125141
2632 Ga0495684_0156418
2633 Ga0495684_0217165
2634 Ga0495593_0002727
2635 Ga0495593_0005255
2636 Ga0495593_0018131
2637 Ga0495593_0020226
2638 Ga0495593_0073721
2639 Ga0495593_0081178
2640 Ga0495602_0000065
2641 Ga0495602_0015962
2642 Ga0495602_0028880
2643 Ga0495602_0035415
2644 Ga0495602_0046172
2645 Ga0495602_0054069
2646 Ga0495602_0071309
2647 Ga0495602_0433737
2648 Ga0495614_0028717
2649 Ga0495614_0028970
2650 Ga0495614_0137722
2651 Ga0496100_0102894
2652 Ga0496100_0165139
2653 Ga0496100_0205013
2654 Ga0496101_0022411
2655 Ga0496101_0224310
2656 Ga0496102_0001147
2657 Ga0496102_0007743
2658 Ga0496102_0008038
2659 Ga0496102_0016570
2660 Ga0496102_0050376
2661 Ga0496102_0088675
2662 Ga0496102_0115613
2663 Ga0496102_0117750
2664 Ga0496102_0135005
2665 Ga0496102_0166647
2666 Ga0496102_0175818
2667 Ga0496102_0183895
2668 Ga0496102_0799468
2669 Ga0496103_0004543
2670 Ga0496103_0009868
2671 Ga0496103_0015951
2672 Ga0496103_0047618
2673 Ga0496103_0070346
2674 Ga0496103_0079015
2675 Ga0496103_0093138
2676 Ga0496103_0138626
2677 Ga0496103_0343089
2678 Ga0496104_0011195
2679 Ga0496104_0012344
2680 Ga0496104_0013954
2681 Ga0496104_0021920
2682 Ga0496104_0036361
2683 Ga0496104_0037130
2684 Ga0496104_0139773
2685 Ga0496104_0188275
2686 Ga0496104_0540981
2687 Ga0496104_0685495
2688 Ga0496104_0704538
2689 Ga0496105_0007335
2690 Ga0496105_0027946
2691 Ga0496105_0031980
2692 Ga0496105_0136872
2693 Ga0496105_0180562
2694 Ga0496105_0275585
2695 Ga0496105_0319177
2696 Ga0496105_0340263
2697 Ga0496105_0367523
2698 Ga0496105_0465627
2699 Ga0496106_0030607
2700 Ga0496106_0081020
2701 Ga0496106_0082451
2702 Ga0496106_0134664
2703 Ga0496106_0213648
2704 Ga0496107_0031342
2705 Ga0496107_0072462
2706 Ga0496107_0092545
2707 Ga0496108_0003156
2708 Ga0496108_0014407
2709 Ga0496108_0018270
2710 Ga0496108_0025779
2711 Ga0496108_0214097
2712 Ga0496108_0668302
2713 Ga0496109_0005308
2714 Ga0496109_0038020
2715 Ga0496109_0165228
2716 Ga0496109_0193317
2717 Ga0496109_0367757
2718 Ga0496109_0465062
2719 Ga0496110_0005523
2720 Ga0496110_0010037
2721 Ga0496110_0011132
2722 Ga0496110_0057940
2723 Ga0496110_0123817
2724 Ga0496110_0181973
2725 Ga0496110_0274224
2726 Ga0496110_0371266
2727 Ga0496111_0003277
2728 Ga0496111_0046277
2729 Ga0496111_0059149
2730 Ga0496111_0073915
2731 Ga0496112_0004018
2732 Ga0496112_0072079
2733 Ga0496112_0082862
2734 Ga0496112_0278771
2735 Ga0496112_0405126
2736 Ga0496113_0125781
2737 Ga0496113_0175342
2738 Ga0496113_0181358
2739 Ga0496113_0274747
2740 Ga0496114_0006337
2741 Ga0496114_0009161
2742 Ga0496114_0010117
2743 Ga0496114_0296046
2744 Ga0496114_0353241
2745 Ga0496114_0476973
2746 Ga0496114_0674913
2747 Ga0496115_0109707
2748 Ga0496115_0114134
2749 Ga0496115_0194781
2750 Ga0496117_0130060
2751 Ga0496119_0039030
2752 Ga0496124_0075900
2753 Ga0496124_0195148
2754 Ga0496125_0140995
2755 Ga0496126_0007772
2756 Ga0496126_0124145
2757 Ga0496126_0319714
2758 Ga0501031_0053545
2759 Ga0501034_0028563
2760 Ga0501034_0388411
2761 Ga0501036_0006249
2762 Ga0501037_0035170
2763 Ga0501037_0046940
2764 Ga0501038_0001144
2765 Ga0501038_0101197
2766 Ga0501039_0073454
2767 Ga0501039_0093563
2768 Ga0501040_0005550
2769 Ga0501040_0129168
2770 Ga0501041_0000946
2771 Ga0501042_0006519
2772 Ga0501042_0007655
2773 Ga0501043_0012741
2774 Ga0501043_0068779
2775 Ga0501046_0011693
2776 Ga0501047_0000142
2777 Ga0501047_0034147
2778 Ga0501047_0320376
2779 Ga0501047_0368362
2780 Ga0501048_0040438
2781 Ga0501048_0056247
2782 Ga0501067_0025344
2783 Ga0501067_0049319
2784 Ga0501069_0020370
2785 Ga0501070_0114313
2786 Ga0501071_0000522
2787 Ga0501072_0007902
2788 Ga0501073_0007656
2789 Ga0501073_0180435
2790 Ga0501074_0001769
2791 Ga0501074_0012148
2792 Ga0501075_0052999
2793 Ga0501075_0309393
2794 Ga0501076_0001397
2795 Ga0501079_0007061
2796 Ga0501080_0036643
2797 Ga0501081_0033385
2798 Ga0501035_0073011
2799 Ga0501044_0057615
2800 Ga0501045_0001418
2801 Ga0501045_0128299
2802 Ga0501045_0143278
2803 nmdc:mga0yw44_327743_c1
2804 nmdc:mga0yw44_41168_c1
2805 nmdc:mga06z11_15499_c1
2806 nmdc:mga06z11_362014_c1
2807 nmdc:mga05p37_1011693_c1
2808 nmdc:mga05p37_11636_c1
2809 nmdc:mga05p37_203002_c1
2810 nmdc:mga05p37_493541_c1
2811 nmdc:mga05p37_64391_c1
2812 nmdc:mga05p37_815_c1
2813 nmdc:mga05p37_9788_c1
2814 nmdc:mga09592_108713_c1
2815 nmdc:mga09592_349381_c1
2816 nmdc:mga09592_96632_c1
2817 nmdc:mga0qj67_148242_c1
2818 nmdc:mga0qj67_341211_c1
2819 nmdc:mga06r32_120339_c1
2820 nmdc:mga06r32_269928_c1
2821 nmdc:mga06r32_484819_c1
2822 nmdc:mga06r32_555_c1
2823 nmdc:mga08y16_13789_c1
2824 nmdc:mga08y16_25766_c1
2825 nmdc:mga08y16_2869_c1
2826 nmdc:mga0n895_18318_c1
2827 nmdc:mga0n895_2559_c1
2828 nmdc:mga0n895_25683_c1
2829 nmdc:mga0n895_9919_c1
2830 nmdc:mga0rr50_218038_c1
2831 nmdc:mga08x19_2217_c1
2832 nmdc:mga08x19_24349_c1
2833 nmdc:mga08x19_282208_c1
2834 nmdc:mga08x19_461869_c1
2835 nmdc:mga0a205_22726_c1
2836 nmdc:mga0a205_42649_c1
2837 nmdc:mga0a205_51921_c1
2838 nmdc:mga0a205_6990_c1
2839 Ga0495601_0026743
2840 Ga0495601_0064932
2841 Ga0495601_0082067
2842 Ga0495601_0086935
2843 Ga0495601_0192021
2844 Ga0495612_0000871
2845 Ga0495612_0017277
2846 Ga0495612_0026922
2847 Ga0495612_0039608
2848 Ga0495612_0049375
2849 Ga0495595_0001179
2850 Ga0495595_0006228
2851 Ga0495595_0025853
2852 Ga0495595_0051393
2853 Ga0495595_0190837
2854 Ga0495619_0039553
2855 Ga0495619_0084061
2856 Ga0495619_0231472
2857 Ga0501084_0003958
2858 Ga0590075_021409
2859 Ga0501082_0003209
2860 Ga0501082_0057334
2861 Ga0466962_0022908
2862 Ga0466962_0025908
2863 Ga0466962_0063119
2864 Ga0466962_0153770
2865 Ga0530510_0018420
2866 Ga0530510_0069360
2867 Ga0530510_0256115
2868 2537897869
2869 2644526702
2870 2644611205
2871 2644670556
2872 2676495084
2873 2768646664
2874 2775656908
2875 2784472230
2876 2808831129
2877 2808852393
2878 2808879315
2879 2808896439
2880 2810363754
2881 2812321175
2882 2812375004
2883 2819427746
2884 2819691759
2885 2819729467
2886 2856743494
2887 2862706621
2888 2873314945
2889 2884694273
2890 2891402564
2891 2891554893
2892 2891562797
2893 2895435668
2894 2895444713
2895 2905930886
2896 2932434693
2897 2945918934
2898 2946062785
2899 2954000409
2900 2974306914
2901 2990044591
2902 3001891493
2903 3003002262
2904 8004022743
2905 8004029419
2906 8008489218
2907 8025527549
2908 8053951764
2909 8054612961
2910 8055072627
2911 8055175737
2912 8056582024

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

173

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.943 2 260
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9393 2 260
2ihy-assembly1.cif.gz_B structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9315 1 260
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9293 1 232
4hzi-assembly1.cif.gz_A crystal structure of the leptospira interrogans atpase subunit of an orphan abc transporter 0.9065 2 261
ID Description Score Start End Superfamily
af_I6YF11_12_276_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9704 3 261 3.40.50.300
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9603 4 261 3.40.50.300
af_I6YF11_12_276_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9521 3 261 3.40.50.300
af_Q2FWA1_1_260_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9496 4 261 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9214 5 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7W7Y3Q6-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9239 5 232 GO:0005524
GO:0016887
AF-A0A2N6SMT4-F1-model_v4 ABC transporter 0.9206 4 260 GO:0005524
GO:0016887
AF-A0A352RIQ6-F1-model_v4 ABC transporter ATP-binding protein 0.916 5 227 GO:0005524
GO:0016887
AF-A0A7C4NAX2-F1-model_v4 Nitrous oxide reductase family maturation protein NosD 0.9142 5 238 GO:0005524
GO:0016887
AF-A0A7X7G2J4-F1-model_v4 ATP-binding cassette domain-containing protein 0.9123 5 233 GO:0005524
GO:0005886
GO:0016887

Map