F494089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1456 | 477 | 2912 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000279|Ga0213875_100002797 |
| Length | 315 |
| Sequence | LSDEVLRLRGVAVRRETSMLLRSIDWTAHEDERWIVIGPNGAGKTTLLQVAATLLFPTEGTVEVLGQRLGEVDVFDLRPRIGLTSAALAERVPAGEKVIDLVLTASYAILGRWKEEYESADVTRAVELLDALGCAHLIRRRFATLSEGERKRVQIARALMPDPELLLLDEPAAGLDLGGREDLLQRLSQLARNPKAPMMVLVTHHVEEVPDGFTHAMLLRRGSVLAAGPVADVFTARNLSKCFGIPLEIEYRRSRWSAFASPGGRPPGTPRLPAAVLAVASRGRRAVGEIPGREGVAGTLRRAPVPCTCRVVRAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 99 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 100 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 101 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 196 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 210 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 225 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 226 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 227 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 241 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 257 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 258 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 265 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 266 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 269 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 270 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 271 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 272 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 273 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 274 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 276 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 277 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 278 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 279 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 280 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 281 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 282 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 283 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 284 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 285 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 286 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 287 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 288 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 289 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 292 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 293 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 294 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 295 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 301 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 302 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 303 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 304 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 305 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 306 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 307 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 308 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 367 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 368 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 369 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 370 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 371 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 372 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 375 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 376 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 377 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 378 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 379 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 380 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 381 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 382 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 383 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 384 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 385 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 414 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 430 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 432 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 433 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 434 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 435 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 436 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 437 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 438 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 439 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 440 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 441 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 442 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 443 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 444 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 445 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 446 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 447 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 448 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 449 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 450 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 451 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 452 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 453 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 454 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 455 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 456 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 457 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 458 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 459 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 460 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 461 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 462 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 463 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 464 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 465 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 466 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 467 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 468 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 469 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 470 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 471 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 472 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 473 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 474 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 475 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 476 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 477 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.09 |
| Metatranscriptomes | 0.82 |
| Isolates | 3.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.76 |
| Nodule | 0.07 |
| Rhizoplane | 6.87 |
| Rhizosphere | 87.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213875_10000279 | 3300021388 | Bacteria | 50175 |
| 2 | JGI25152J39213_1000140 | 3300002773 | Bacteria | 49435 |
| 3 | JGI25404J52841_10005090 | 3300003659 | Bacteria | 2704 |
| 4 | JGI25404J52841_10026453 | 3300003659 | Bacteria | 1248 |
| 5 | Ga0065714_10006475 | 3300005288 | Bacteria | 3278 |
| 6 | Ga0070658_10037640 | 3300005327 | Bacteria | 3901 |
| 7 | Ga0070658_10041079 | 3300005327 | Bacteria | 3732 |
| 8 | Ga0070658_10365269 | 3300005327 | Bacteria | 1237 |
| 9 | Ga0070676_10034801 | 3300005328 | Bacteria | 2893 |
| 10 | Ga0070676_10066430 | 3300005328 | Bacteria | 2155 |
| 11 | Ga0070676_10142671 | 3300005328 | Bacteria | 1526 |
| 12 | Ga0070683_100001232 | 3300005329 | Bacteria | 19471 |
| 13 | Ga0070683_100023183 | 3300005329 | Bacteria | 5551 |
| 14 | Ga0070683_100038676 | 3300005329 | Bacteria | 4374 |
| 15 | Ga0070683_100126071 | 3300005329 | Bacteria | 2421 |
| 16 | Ga0070683_100399913 | 3300005329 | Bacteria | 1310 |
| 17 | Ga0070690_100078081 | 3300005330 | Bacteria | 2162 |
| 18 | Ga0070690_100094011 | 3300005330 | Bacteria | 1978 |
| 19 | Ga0070670_100152472 | 3300005331 | Bacteria | 2000 |
| 20 | Ga0068869_100048676 | 3300005334 | Bacteria | 3066 |
| 21 | Ga0070666_10015201 | 3300005335 | Bacteria | 4908 |
| 22 | Ga0070680_100020946 | 3300005336 | Bacteria | 5191 |
| 23 | Ga0070680_100096329 | 3300005336 | Bacteria | 2453 |
| 24 | Ga0070680_100261212 | 3300005336 | Bacteria | 1465 |
| 25 | Ga0070680_100511273 | 3300005336 | Bacteria | 1028 |
| 26 | Ga0070680_100560137 | 3300005336 | Bacteria | 980 |
| 27 | Ga0070682_100007568 | 3300005337 | Bacteria | 6120 |
| 28 | Ga0070682_100010252 | 3300005337 | Bacteria | 5315 |
| 29 | Ga0070682_100041585 | 3300005337 | Bacteria | 2834 |
| 30 | Ga0070682_100054771 | 3300005337 | Bacteria | 2504 |
| 31 | Ga0070682_100177740 | 3300005337 | Bacteria | 1484 |
| 32 | Ga0068868_100072693 | 3300005338 | Bacteria | 2744 |
| 33 | Ga0068868_100088079 | 3300005338 | Bacteria | 2498 |
| 34 | Ga0070660_100045964 | 3300005339 | Bacteria | 3345 |
| 35 | Ga0070689_100122383 | 3300005340 | Bacteria | 2079 |
| 36 | Ga0070691_10010867 | 3300005341 | Bacteria | 4155 |
| 37 | Ga0070691_10030466 | 3300005341 | Bacteria | 2527 |
| 38 | Ga0070687_100217974 | 3300005343 | Bacteria | 1167 |
| 39 | Ga0070661_100065930 | 3300005344 | Bacteria | 2660 |
| 40 | Ga0070661_100119649 | 3300005344 | Bacteria | 1972 |
| 41 | Ga0070692_10049130 | 3300005345 | Bacteria | 2187 |
| 42 | Ga0070692_10063335 | 3300005345 | Bacteria | 1953 |
| 43 | Ga0070668_100150927 | 3300005347 | Bacteria | 1879 |
| 44 | Ga0070668_100394332 | 3300005347 | Bacteria | 1181 |
| 45 | Ga0070669_100129893 | 3300005353 | Bacteria | 1931 |
| 46 | Ga0070675_100018324 | 3300005354 | Bacteria | 5573 |
| 47 | Ga0070675_100039053 | 3300005354 | Bacteria | 3871 |
| 48 | Ga0070671_100049585 | 3300005355 | Bacteria | 3493 |
| 49 | Ga0070671_100142149 | 3300005355 | Bacteria | 2025 |
| 50 | Ga0070673_100128824 | 3300005364 | Bacteria | 2120 |
| 51 | Ga0070673_100521723 | 3300005364 | Bacteria | 1077 |
| 52 | Ga0070673_100571776 | 3300005364 | Bacteria | 1028 |
| 53 | Ga0070659_100048728 | 3300005366 | Bacteria | 3329 |
| 54 | Ga0070659_100255916 | 3300005366 | Bacteria | 1452 |
| 55 | Ga0070703_10006990 | 3300005406 | Bacteria | 3163 |
| 56 | Ga0070709_10119243 | 3300005434 | Bacteria | 1786 |
| 57 | Ga0070709_10132298 | 3300005434 | Bacteria | 1704 |
| 58 | Ga0070714_100000106 | 3300005435 | Bacteria | 70067 |
| 59 | Ga0070714_100003050 | 3300005435 | Bacteria | 12422 |
| 60 | Ga0070714_100011007 | 3300005435 | Bacteria | 7165 |
| 61 | Ga0070714_100068535 | 3300005435 | Bacteria | 3061 |
| 62 | Ga0070714_100086279 | 3300005435 | Bacteria | 2743 |
| 63 | Ga0070714_100089153 | 3300005435 | Bacteria | 2700 |
| 64 | Ga0070714_100116118 | 3300005435 | Bacteria | 2376 |
| 65 | Ga0070714_100215886 | 3300005435 | Bacteria | 1761 |
| 66 | Ga0070714_100294787 | 3300005435 | Bacteria | 1510 |
| 67 | Ga0070714_100368581 | 3300005435 | Bacteria | 1352 |
| 68 | Ga0070714_100549624 | 3300005435 | Bacteria | 1105 |
| 69 | Ga0070713_100002552 | 3300005436 | Bacteria | 11908 |
| 70 | Ga0070713_100008841 | 3300005436 | Bacteria | 7171 |
| 71 | Ga0070713_100010745 | 3300005436 | Bacteria | 6630 |
| 72 | Ga0070713_100026673 | 3300005436 | Bacteria | 4539 |
| 73 | Ga0070713_100041218 | 3300005436 | Bacteria | 3760 |
| 74 | Ga0070713_100050651 | 3300005436 | Bacteria | 3431 |
| 75 | Ga0070713_100070574 | 3300005436 | Bacteria | 2949 |
| 76 | Ga0070713_100083862 | 3300005436 | Bacteria | 2725 |
| 77 | Ga0070713_100251386 | 3300005436 | Bacteria | 1612 |
| 78 | Ga0070713_100651521 | 3300005436 | Bacteria | 1003 |
| 79 | Ga0070710_10007646 | 3300005437 | Bacteria | 5239 |
| 80 | Ga0070710_10015638 | 3300005437 | Bacteria | 3844 |
| 81 | Ga0070710_10024332 | 3300005437 | Bacteria | 3193 |
| 82 | Ga0070710_10028942 | 3300005437 | Bacteria | 2968 |
| 83 | Ga0070710_10065028 | 3300005437 | Bacteria | 2088 |
| 84 | Ga0070710_10072542 | 3300005437 | Bacteria | 1988 |
| 85 | Ga0070710_10074785 | 3300005437 | Bacteria | 1961 |
| 86 | Ga0070701_10040585 | 3300005438 | Bacteria | 2367 |
| 87 | Ga0070701_10060258 | 3300005438 | Bacteria | 1998 |
| 88 | Ga0070711_100003698 | 3300005439 | Bacteria | 8957 |
| 89 | Ga0070711_100159984 | 3300005439 | Bacteria | 1706 |
| 90 | Ga0070705_100016297 | 3300005440 | Bacteria | 3861 |
| 91 | Ga0070705_100021518 | 3300005440 | Bacteria | 3433 |
| 92 | Ga0070705_100379451 | 3300005440 | Bacteria | 1040 |
| 93 | Ga0070700_100000032 | 3300005441 | Bacteria | 114995 |
| 94 | Ga0070700_100016501 | 3300005441 | Bacteria | 4207 |
| 95 | Ga0070700_100088159 | 3300005441 | Bacteria | 2019 |
| 96 | Ga0070694_100008433 | 3300005444 | Bacteria | 6305 |
| 97 | Ga0070708_100004613 | 3300005445 | Bacteria | 10850 |
| 98 | Ga0070708_100014087 | 3300005445 | Bacteria | 6572 |
| 99 | Ga0070708_100030992 | 3300005445 | Bacteria | 4626 |
| 100 | Ga0070708_100041624 | 3300005445 | Bacteria | 4028 |
| 101 | Ga0070708_100063836 | 3300005445 | Bacteria | 3297 |
| 102 | Ga0070708_100131996 | 3300005445 | Bacteria | 2312 |
| 103 | Ga0070663_100002903 | 3300005455 | Bacteria | 9744 |
| 104 | Ga0070663_100016265 | 3300005455 | Bacteria | 4825 |
| 105 | Ga0070678_100003362 | 3300005456 | Bacteria | 8917 |
| 106 | Ga0070678_100023732 | 3300005456 | Bacteria | 4093 |
| 107 | Ga0070681_10265389 | 3300005458 | Bacteria | 1628 |
| 108 | Ga0070681_10327749 | 3300005458 | Bacteria | 1441 |
| 109 | Ga0070685_10097188 | 3300005466 | Bacteria | 1793 |
| 110 | Ga0070706_100001339 | 3300005467 | Bacteria | 26189 |
| 111 | Ga0070706_100002385 | 3300005467 | Bacteria | 18952 |
| 112 | Ga0070706_100009601 | 3300005467 | Bacteria | 8998 |
| 113 | Ga0070706_100012481 | 3300005467 | Bacteria | 7871 |
| 114 | Ga0070706_100016812 | 3300005467 | Bacteria | 6758 |
| 115 | Ga0070706_100022152 | 3300005467 | Bacteria | 5850 |
| 116 | Ga0070706_100063501 | 3300005467 | Bacteria | 3413 |
| 117 | Ga0070706_100066956 | 3300005467 | Bacteria | 3322 |
| 118 | Ga0070706_100074265 | 3300005467 | Bacteria | 3147 |
| 119 | Ga0070706_100160898 | 3300005467 | Bacteria | 2096 |
| 120 | Ga0070706_100233845 | 3300005467 | Bacteria | 1716 |
| 121 | Ga0070706_100251843 | 3300005467 | Bacteria | 1649 |
| 122 | Ga0070707_100002030 | 3300005468 | Bacteria | 19371 |
| 123 | Ga0070707_100002309 | 3300005468 | Bacteria | 18227 |
| 124 | Ga0070707_100008144 | 3300005468 | Bacteria | 9724 |
| 125 | Ga0070707_100033800 | 3300005468 | Bacteria | 4876 |
| 126 | Ga0070707_100067555 | 3300005468 | Bacteria | 3439 |
| 127 | Ga0070707_100075099 | 3300005468 | Bacteria | 3260 |
| 128 | Ga0070707_100077254 | 3300005468 | Bacteria | 3212 |
| 129 | Ga0070707_100100904 | 3300005468 | Bacteria | 2796 |
| 130 | Ga0070707_100189752 | 3300005468 | Bacteria | 2004 |
| 131 | Ga0070707_100231986 | 3300005468 | Bacteria | 1796 |
| 132 | Ga0070698_100000546 | 3300005471 | Bacteria | 40175 |
| 133 | Ga0070698_100000603 | 3300005471 | Bacteria | 38616 |
| 134 | Ga0070698_100005898 | 3300005471 | Bacteria | 13363 |
| 135 | Ga0070698_100007558 | 3300005471 | Bacteria | 11755 |
| 136 | Ga0070698_100008876 | 3300005471 | Bacteria | 10807 |
| 137 | Ga0070698_100029873 | 3300005471 | Bacteria | 5655 |
| 138 | Ga0070698_100035273 | 3300005471 | Bacteria | 5173 |
| 139 | Ga0070698_100039145 | 3300005471 | Bacteria | 4882 |
| 140 | Ga0070698_100057134 | 3300005471 | Bacteria | 3950 |
| 141 | Ga0070698_100064438 | 3300005471 | Bacteria | 3692 |
| 142 | Ga0070698_100130505 | 3300005471 | Bacteria | 2468 |
| 143 | Ga0070698_100152667 | 3300005471 | Bacteria | 2256 |
| 144 | Ga0070698_100180223 | 3300005471 | Bacteria | 2051 |
| 145 | Ga0070698_100226293 | 3300005471 | Bacteria | 1804 |
| 146 | Ga0070699_100001575 | 3300005518 | Bacteria | 20852 |
| 147 | Ga0070679_100023566 | 3300005530 | Bacteria | 6027 |
| 148 | Ga0070679_100024087 | 3300005530 | Bacteria | 5963 |
| 149 | Ga0070679_100097856 | 3300005530 | Bacteria | 2921 |
| 150 | Ga0070679_100135810 | 3300005530 | Bacteria | 2440 |
| 151 | Ga0070679_100259317 | 3300005530 | Bacteria | 1694 |
| 152 | Ga0070684_100001567 | 3300005535 | Bacteria | 16507 |
| 153 | Ga0070684_100025965 | 3300005535 | Bacteria | 4929 |
| 154 | Ga0070684_100109092 | 3300005535 | Bacteria | 2480 |
| 155 | Ga0070684_100183094 | 3300005535 | Bacteria | 1905 |
| 156 | Ga0070684_100241134 | 3300005535 | Bacteria | 1652 |
| 157 | Ga0070684_100431690 | 3300005535 | Bacteria | 1217 |
| 158 | Ga0070697_100012968 | 3300005536 | Bacteria | 6531 |
| 159 | Ga0070697_100056754 | 3300005536 | Bacteria | 3186 |
| 160 | Ga0070697_100081358 | 3300005536 | Bacteria | 2669 |
| 161 | Ga0070697_100124388 | 3300005536 | Bacteria | 2159 |
| 162 | Ga0068853_100127427 | 3300005539 | Bacteria | 2275 |
| 163 | Ga0070686_100023146 | 3300005544 | Bacteria | 3709 |
| 164 | Ga0070686_100040954 | 3300005544 | Bacteria | 2892 |
| 165 | Ga0070695_100007032 | 3300005545 | Bacteria | 6668 |
| 166 | Ga0070695_100117539 | 3300005545 | Bacteria | 1814 |
| 167 | Ga0070696_100000771 | 3300005546 | Bacteria | 20574 |
| 168 | Ga0070696_100007537 | 3300005546 | Bacteria | 7279 |
| 169 | Ga0070696_100033355 | 3300005546 | Bacteria | 3537 |
| 170 | Ga0070693_100000790 | 3300005547 | Bacteria | 13964 |
| 171 | Ga0070693_100038449 | 3300005547 | Bacteria | 2674 |
| 172 | Ga0070665_100062161 | 3300005548 | Bacteria | 3744 |
| 173 | Ga0070665_100128101 | 3300005548 | Bacteria | 2541 |
| 174 | Ga0070665_100208501 | 3300005548 | Bacteria | 1955 |
| 175 | Ga0070704_100103523 | 3300005549 | Bacteria | 2150 |
| 176 | Ga0068855_100153052 | 3300005563 | Bacteria | 2621 |
| 177 | Ga0068857_100455458 | 3300005577 | Bacteria | 1196 |
| 178 | Ga0068854_100013646 | 3300005578 | Bacteria | 5338 |
| 179 | Ga0068856_100058004 | 3300005614 | Bacteria | 3823 |
| 180 | Ga0068856_100133415 | 3300005614 | Bacteria | 2488 |
| 181 | Ga0068856_100279141 | 3300005614 | Bacteria | 1687 |
| 182 | Ga0068856_100406768 | 3300005614 | Bacteria | 1380 |
| 183 | Ga0070702_100004694 | 3300005615 | Bacteria | 6268 |
| 184 | Ga0070702_100055450 | 3300005615 | Bacteria | 2285 |
| 185 | Ga0068852_100083196 | 3300005616 | Bacteria | 2845 |
| 186 | Ga0068852_100146623 | 3300005616 | Bacteria | 2190 |
| 187 | Ga0068864_100009054 | 3300005618 | Bacteria | 8207 |
| 188 | Ga0068864_100439866 | 3300005618 | Bacteria | 1245 |
| 189 | Ga0068861_100298242 | 3300005719 | Bacteria | 1395 |
| 190 | Ga0068870_10184942 | 3300005840 | Bacteria | 1253 |
| 191 | Ga0068863_100031657 | 3300005841 | Bacteria | 5047 |
| 192 | Ga0068863_100216938 | 3300005841 | Bacteria | 1843 |
| 193 | Ga0068860_100095557 | 3300005843 | Bacteria | 2833 |
| 194 | Ga0081455_10009965 | 3300005937 | Bacteria | 9715 |
| 195 | Ga0081455_10122766 | 3300005937 | Bacteria | 2044 |
| 196 | Ga0081455_10139456 | 3300005937 | Bacteria | 1885 |
| 197 | Ga0081538_10001393 | 3300005981 | Bacteria | 24785 |
| 198 | Ga0081540_1000345 | 3300005983 | Bacteria | 46912 |
| 199 | Ga0081540_1002862 | 3300005983 | Bacteria | 13954 |
| 200 | Ga0081540_1056961 | 3300005983 | Bacteria | 1893 |
| 201 | Ga0070717_10004502 | 3300006028 | Bacteria | 10071 |
| 202 | Ga0070717_10019476 | 3300006028 | Bacteria | 5322 |
| 203 | Ga0070717_10027018 | 3300006028 | Bacteria | 4584 |
| 204 | Ga0070717_10029071 | 3300006028 | Bacteria | 4431 |
| 205 | Ga0070717_10223296 | 3300006028 | Bacteria | 1656 |
| 206 | Ga0070717_10233681 | 3300006028 | Bacteria | 1619 |
| 207 | Ga0070717_10235691 | 3300006028 | Bacteria | 1612 |
| 208 | Ga0070717_10238522 | 3300006028 | Bacteria | 1603 |
| 209 | Ga0075432_10001623 | 3300006058 | Bacteria | 7395 |
| 210 | Ga0075432_10004430 | 3300006058 | Bacteria | 4784 |
| 211 | Ga0075432_10103550 | 3300006058 | Bacteria | 1054 |
| 212 | Ga0070715_10139307 | 3300006163 | Bacteria | 1176 |
| 213 | Ga0070715_10154831 | 3300006163 | Bacteria | 1127 |
| 214 | Ga0070716_100004563 | 3300006173 | Bacteria | 6638 |
| 215 | Ga0070716_100074442 | 3300006173 | Bacteria | 2006 |
| 216 | Ga0070716_100130020 | 3300006173 | Bacteria | 1590 |
| 217 | Ga0070716_100348339 | 3300006173 | Bacteria | 1047 |
| 218 | Ga0070712_100000686 | 3300006175 | Bacteria | 19993 |
| 219 | Ga0070712_100012108 | 3300006175 | Bacteria | 5480 |
| 220 | Ga0070712_100063385 | 3300006175 | Bacteria | 2617 |
| 221 | Ga0070712_100346651 | 3300006175 | Bacteria | 1214 |
| 222 | Ga0070712_100689965 | 3300006175 | Bacteria | 870 |
| 223 | Ga0075367_10079522 | 3300006178 | Bacteria | 1982 |
| 224 | Ga0075367_10297830 | 3300006178 | Bacteria | 1015 |
| 225 | Ga0097621_100104682 | 3300006237 | Bacteria | 2385 |
| 226 | Ga0068871_100098374 | 3300006358 | Bacteria | 2447 |
| 227 | Ga0068871_100107880 | 3300006358 | Bacteria | 2339 |
| 228 | Ga0075428_100000550 | 3300006844 | Bacteria | 38346 |
| 229 | Ga0075428_100000883 | 3300006844 | Bacteria | 31556 |
| 230 | Ga0075428_100090930 | 3300006844 | Bacteria | 3330 |
| 231 | Ga0075428_100171638 | 3300006844 | Bacteria | 2350 |
| 232 | Ga0075430_100137972 | 3300006846 | Bacteria | 2031 |
| 233 | Ga0075431_100022433 | 3300006847 | Bacteria | 6453 |
| 234 | Ga0075431_100066828 | 3300006847 | Bacteria | 3712 |
| 235 | Ga0075431_100077379 | 3300006847 | Bacteria | 3434 |
| 236 | Ga0075433_10019092 | 3300006852 | Bacteria | 5703 |
| 237 | Ga0075433_10022654 | 3300006852 | Bacteria | 5275 |
| 238 | Ga0075433_10042941 | 3300006852 | Bacteria | 3924 |
| 239 | Ga0075433_10062467 | 3300006852 | Bacteria | 3262 |
| 240 | Ga0075434_100024868 | 3300006871 | Bacteria | 5855 |
| 241 | Ga0075434_100040248 | 3300006871 | Bacteria | 4629 |
| 242 | Ga0075434_100171584 | 3300006871 | Bacteria | 2189 |
| 243 | Ga0075434_100488771 | 3300006871 | Bacteria | 1252 |
| 244 | Ga0075429_100260772 | 3300006880 | Bacteria | 1517 |
| 245 | Ga0075429_100318478 | 3300006880 | Bacteria | 1361 |
| 246 | Ga0075436_100000929 | 3300006914 | Bacteria | 19535 |
| 247 | Ga0075436_100019491 | 3300006914 | Bacteria | 4649 |
| 248 | Ga0075436_100058056 | 3300006914 | Bacteria | 2672 |
| 249 | Ga0075436_100069714 | 3300006914 | Bacteria | 2430 |
| 250 | Ga0075436_100103298 | 3300006914 | Bacteria | 1986 |
| 251 | Ga0075435_100013427 | 3300007076 | Bacteria | 6094 |
| 252 | Ga0075435_100085039 | 3300007076 | Bacteria | 2604 |
| 253 | Ga0075435_100729832 | 3300007076 | Bacteria | 861 |
| 254 | Ga0099794_10066788 | 3300007265 | Bacteria | 1755 |
| 255 | Ga0111539_10000342 | 3300009094 | Bacteria | 57280 |
| 256 | Ga0111539_10055497 | 3300009094 | Bacteria | 4709 |
| 257 | Ga0105245_10023219 | 3300009098 | Bacteria | 5444 |
| 258 | Ga0105245_10031225 | 3300009098 | Bacteria | 4713 |
| 259 | Ga0105245_10068388 | 3300009098 | Bacteria | 3218 |
| 260 | Ga0105245_10108505 | 3300009098 | Bacteria | 2578 |
| 261 | Ga0105245_10123453 | 3300009098 | Bacteria | 2421 |
| 262 | Ga0105245_10148480 | 3300009098 | Bacteria | 2214 |
| 263 | Ga0105245_10296017 | 3300009098 | Bacteria | 1586 |
| 264 | Ga0105245_10330414 | 3300009098 | Bacteria | 1504 |
| 265 | Ga0105247_10035569 | 3300009101 | Bacteria | 3036 |
| 266 | Ga0114129_10002267 | 3300009147 | Bacteria | 26615 |
| 267 | Ga0114129_10143862 | 3300009147 | Bacteria | 3267 |
| 268 | Ga0114129_10208890 | 3300009147 | Bacteria | 2640 |
| 269 | Ga0114129_10291473 | 3300009147 | Bacteria | 2178 |
| 270 | Ga0114129_10700278 | 3300009147 | Bacteria | 1302 |
| 271 | Ga0114129_10971568 | 3300009147 | Bacteria | 1071 |
| 272 | Ga0105243_10023631 | 3300009148 | Bacteria | 4683 |
| 273 | Ga0105243_10097396 | 3300009148 | Bacteria | 2435 |
| 274 | Ga0105243_10138265 | 3300009148 | Bacteria | 2075 |
| 275 | Ga0105243_10274200 | 3300009148 | Bacteria | 1516 |
| 276 | Ga0105241_10002632 | 3300009174 | Bacteria | 13450 |
| 277 | Ga0105241_10171665 | 3300009174 | Bacteria | 1791 |
| 278 | Ga0105241_10217135 | 3300009174 | Bacteria | 1605 |
| 279 | Ga0105248_10035978 | 3300009177 | Bacteria | 5538 |
| 280 | Ga0105248_10039070 | 3300009177 | Bacteria | 5314 |
| 281 | Ga0105248_10111205 | 3300009177 | Bacteria | 3089 |
| 282 | Ga0105248_10148860 | 3300009177 | Bacteria | 2641 |
| 283 | Ga0105237_10092314 | 3300009545 | Bacteria | 3017 |
| 284 | Ga0105237_10462450 | 3300009545 | Bacteria | 1275 |
| 285 | Ga0105238_10089595 | 3300009551 | Bacteria | 3063 |
| 286 | Ga0105238_10165729 | 3300009551 | Bacteria | 2185 |
| 287 | Ga0105238_10166610 | 3300009551 | Bacteria | 2179 |
| 288 | Ga0105239_10001401 | 3300010375 | Bacteria | 32259 |
| 289 | Ga0105239_10183026 | 3300010375 | Bacteria | 2344 |
| 290 | Ga0105246_10001050 | 3300011119 | Bacteria | 15950 |
| 291 | Ga0105246_10002276 | 3300011119 | Bacteria | 11577 |
| 292 | Ga0105246_10002387 | 3300011119 | Bacteria | 11335 |
| 293 | Ga0105246_10178396 | 3300011119 | Bacteria | 1633 |
| 294 | Ga0105246_10538941 | 3300011119 | Bacteria | 998 |
| 295 | Ga0157340_1000795 | 3300012473 | Bacteria | 1306 |
| 296 | Ga0157328_1003268 | 3300012478 | Bacteria | 836 |
| 297 | Ga0157320_1001769 | 3300012481 | Bacteria | 1140 |
| 298 | Ga0157326_1005455 | 3300012513 | Bacteria | 1346 |
| 299 | Ga0157371_10005477 | 3300013102 | Bacteria | 10691 |
| 300 | Ga0157370_10114716 | 3300013104 | Bacteria | 2517 |
| 301 | Ga0157369_10041463 | 3300013105 | Bacteria | 5025 |
| 302 | Ga0157369_10090991 | 3300013105 | Bacteria | 3257 |
| 303 | Ga0157369_10131475 | 3300013105 | Bacteria | 2652 |
| 304 | Ga0157369_10139130 | 3300013105 | Bacteria | 2569 |
| 305 | Ga0157369_10196332 | 3300013105 | Bacteria | 2119 |
| 306 | Ga0163162_10034522 | 3300013306 | Bacteria | 5033 |
| 307 | Ga0163162_10583852 | 3300013306 | Bacteria | 1244 |
| 308 | Ga0157372_10006117 | 3300013307 | Bacteria | 12793 |
| 309 | Ga0157372_10253696 | 3300013307 | Bacteria | 2042 |
| 310 | Ga0157372_10274844 | 3300013307 | Bacteria | 1958 |
| 311 | Ga0157372_10656946 | 3300013307 | Bacteria | 1221 |
| 312 | Ga0157375_10059104 | 3300013308 | Bacteria | 3796 |
| 313 | Ga0157375_10154505 | 3300013308 | Bacteria | 2432 |
| 314 | Ga0157375_10283563 | 3300013308 | Bacteria | 1820 |
| 315 | Ga0157375_10473301 | 3300013308 | Bacteria | 1418 |
| 316 | Ga0163163_10052099 | 3300014325 | Bacteria | 4036 |
| 317 | Ga0163163_10187587 | 3300014325 | Bacteria | 2116 |
| 318 | Ga0163163_10698475 | 3300014325 | Bacteria | 1078 |
| 319 | Ga0157380_10159808 | 3300014326 | Bacteria | 1957 |
| 320 | Ga0157377_10044266 | 3300014745 | Bacteria | 2481 |
| 321 | Ga0157377_10053273 | 3300014745 | Bacteria | 2287 |
| 322 | Ga0157379_10021747 | 3300014968 | Bacteria | 5681 |
| 323 | Ga0157379_10398995 | 3300014968 | Bacteria | 1264 |
| 324 | Ga0157376_10273075 | 3300014969 | Bacteria | 1589 |
| 325 | Ga0163161_10020401 | 3300017792 | Bacteria | 4651 |
| 326 | Ga0206356_10432907 | 3300020070 | Bacteria | 957 |
| 327 | Ga0206351_10135569 | 3300020077 | Bacteria | 1314 |
| 328 | Ga0206350_10042881 | 3300020080 | Bacteria | 889 |
| 329 | Ga0206354_10464791 | 3300020081 | Bacteria | 2532 |
| 330 | Ga0206353_10077479 | 3300020082 | Bacteria | 4434 |
| 331 | Ga0206353_11124480 | 3300020082 | Bacteria | 1072 |
| 332 | Ga0206353_11987931 | 3300020082 | Bacteria | 1289 |
| 333 | Ga0154015_1296164 | 3300020610 | Bacteria | 1732 |
| 334 | Ga0213874_10036320 | 3300021377 | Bacteria | 1452 |
| 335 | Ga0213875_10000363 | 3300021388 | Bacteria | 42235 |
| 336 | Ga0213875_10007999 | 3300021388 | Bacteria | 5433 |
| 337 | Ga0213875_10027678 | 3300021388 | Bacteria | 2698 |
| 338 | Ga0213875_10032344 | 3300021388 | Bacteria | 2472 |
| 339 | Ga0213875_10044511 | 3300021388 | Bacteria | 2084 |
| 340 | Ga0213875_10137709 | 3300021388 | Bacteria | 1142 |
| 341 | Ga0224712_10021924 | 3300022467 | Bacteria | 2194 |
| 342 | Ga0224712_10147916 | 3300022467 | Bacteria | 1039 |
| 343 | Ga0209148_1002761 | 3300025254 | Bacteria | 5534 |
| 344 | Ga0209129_1000067 | 3300025258 | Bacteria | 219974 |
| 345 | Ga0209025_1001395 | 3300025294 | Bacteria | 32161 |
| 346 | Ga0209051_1012946 | 3300025303 | Bacteria | 4000 |
| 347 | Ga0207656_10056187 | 3300025321 | Bacteria | 1715 |
| 348 | Ga0207653_10002967 | 3300025885 | Bacteria | 5382 |
| 349 | Ga0207692_10003787 | 3300025898 | Bacteria | 5943 |
| 350 | Ga0207692_10004622 | 3300025898 | Bacteria | 5459 |
| 351 | Ga0207692_10020352 | 3300025898 | Bacteria | 3016 |
| 352 | Ga0207692_10042308 | 3300025898 | Bacteria | 2260 |
| 353 | Ga0207692_10129041 | 3300025898 | Bacteria | 1425 |
| 354 | Ga0207692_10174450 | 3300025898 | Bacteria | 1248 |
| 355 | Ga0207692_10237494 | 3300025898 | Bacteria | 1087 |
| 356 | Ga0207710_10060560 | 3300025900 | Bacteria | 1716 |
| 357 | Ga0207688_10003738 | 3300025901 | Bacteria | 8304 |
| 358 | Ga0207688_10004765 | 3300025901 | Bacteria | 7387 |
| 359 | Ga0207688_10064737 | 3300025901 | Bacteria | 2065 |
| 360 | Ga0207688_10358762 | 3300025901 | Bacteria | 899 |
| 361 | Ga0207647_10052049 | 3300025904 | Bacteria | 2528 |
| 362 | Ga0207685_10000503 | 3300025905 | Bacteria | 6651 |
| 363 | Ga0207685_10016331 | 3300025905 | Bacteria | 2374 |
| 364 | Ga0207685_10123546 | 3300025905 | Bacteria | 1140 |
| 365 | Ga0207699_10000988 | 3300025906 | Bacteria | 13528 |
| 366 | Ga0207699_10003997 | 3300025906 | Bacteria | 7056 |
| 367 | Ga0207699_10004908 | 3300025906 | Bacteria | 6399 |
| 368 | Ga0207699_10011620 | 3300025906 | Bacteria | 4453 |
| 369 | Ga0207645_10008076 | 3300025907 | Bacteria | 7382 |
| 370 | Ga0207645_10075430 | 3300025907 | Bacteria | 2158 |
| 371 | Ga0207645_10097895 | 3300025907 | Bacteria | 1891 |
| 372 | Ga0207643_10000047 | 3300025908 | Bacteria | 79590 |
| 373 | Ga0207643_10030020 | 3300025908 | Bacteria | 3024 |
| 374 | Ga0207705_10035401 | 3300025909 | Bacteria | 3571 |
| 375 | Ga0207705_10098161 | 3300025909 | Bacteria | 2152 |
| 376 | Ga0207684_10000323 | 3300025910 | Bacteria | 67693 |
| 377 | Ga0207684_10003999 | 3300025910 | Bacteria | 14104 |
| 378 | Ga0207684_10010100 | 3300025910 | Bacteria | 8315 |
| 379 | Ga0207684_10022827 | 3300025910 | Bacteria | 5343 |
| 380 | Ga0207684_10029169 | 3300025910 | Bacteria | 4700 |
| 381 | Ga0207684_10040467 | 3300025910 | Bacteria | 3951 |
| 382 | Ga0207684_10045316 | 3300025910 | Bacteria | 3731 |
| 383 | Ga0207684_10064461 | 3300025910 | Bacteria | 3111 |
| 384 | Ga0207684_10067070 | 3300025910 | Bacteria | 3048 |
| 385 | Ga0207684_10103170 | 3300025910 | Bacteria | 2438 |
| 386 | Ga0207684_10127839 | 3300025910 | Bacteria | 2181 |
| 387 | Ga0207684_10128721 | 3300025910 | Bacteria | 2173 |
| 388 | Ga0207684_10251776 | 3300025910 | Bacteria | 1524 |
| 389 | Ga0207707_10001352 | 3300025912 | Bacteria | 22855 |
| 390 | Ga0207671_10109947 | 3300025914 | Bacteria | 2096 |
| 391 | Ga0207693_10025677 | 3300025915 | Bacteria | 4669 |
| 392 | Ga0207693_10044196 | 3300025915 | Bacteria | 3501 |
| 393 | Ga0207693_10061577 | 3300025915 | Bacteria | 2939 |
| 394 | Ga0207693_10159272 | 3300025915 | Bacteria | 1776 |
| 395 | Ga0207693_10187925 | 3300025915 | Bacteria | 1626 |
| 396 | Ga0207693_10199085 | 3300025915 | Bacteria | 1575 |
| 397 | Ga0207693_10325018 | 3300025915 | Bacteria | 1204 |
| 398 | Ga0207663_10001870 | 3300025916 | Bacteria | 9964 |
| 399 | Ga0207663_10008539 | 3300025916 | Bacteria | 5364 |
| 400 | Ga0207663_10031503 | 3300025916 | Bacteria | 3140 |
| 401 | Ga0207663_10056765 | 3300025916 | Bacteria | 2464 |
| 402 | Ga0207663_10109241 | 3300025916 | Bacteria | 1874 |
| 403 | Ga0207663_10109409 | 3300025916 | Bacteria | 1873 |
| 404 | Ga0207663_10189829 | 3300025916 | Bacteria | 1474 |
| 405 | Ga0207660_10022130 | 3300025917 | Bacteria | 4281 |
| 406 | Ga0207660_10048898 | 3300025917 | Bacteria | 2994 |
| 407 | Ga0207660_10409184 | 3300025917 | Bacteria | 1093 |
| 408 | Ga0207662_10068286 | 3300025918 | Bacteria | 2146 |
| 409 | Ga0207657_10013739 | 3300025919 | Bacteria | 7926 |
| 410 | Ga0207657_10041725 | 3300025919 | Bacteria | 4054 |
| 411 | Ga0207657_10084590 | 3300025919 | Bacteria | 2658 |
| 412 | Ga0207657_10089978 | 3300025919 | Bacteria | 2562 |
| 413 | Ga0207649_10100127 | 3300025920 | Bacteria | 1916 |
| 414 | Ga0207652_10102635 | 3300025921 | Bacteria | 2528 |
| 415 | Ga0207652_10194305 | 3300025921 | Bacteria | 1825 |
| 416 | Ga0207646_10000050 | 3300025922 | Bacteria | 171554 |
| 417 | Ga0207646_10011796 | 3300025922 | Bacteria | 8441 |
| 418 | Ga0207646_10014424 | 3300025922 | Bacteria | 7503 |
| 419 | Ga0207646_10023656 | 3300025922 | Bacteria | 5641 |
| 420 | Ga0207646_10027007 | 3300025922 | Bacteria | 5233 |
| 421 | Ga0207646_10041129 | 3300025922 | Bacteria | 4157 |
| 422 | Ga0207646_10453030 | 3300025922 | Bacteria | 1158 |
| 423 | Ga0207646_10473784 | 3300025922 | Bacteria | 1129 |
| 424 | Ga0207681_10015247 | 3300025923 | Bacteria | 4792 |
| 425 | Ga0207694_10035588 | 3300025924 | Bacteria | 3821 |
| 426 | Ga0207694_10082701 | 3300025924 | Bacteria | 2524 |
| 427 | Ga0207650_10010952 | 3300025925 | Bacteria | 6233 |
| 428 | Ga0207659_10066653 | 3300025926 | Bacteria | 2613 |
| 429 | Ga0207659_10293346 | 3300025926 | Bacteria | 1333 |
| 430 | Ga0207687_10030995 | 3300025927 | Bacteria | 3611 |
| 431 | Ga0207700_10000216 | 3300025928 | Bacteria | 34369 |
| 432 | Ga0207700_10000619 | 3300025928 | Bacteria | 20729 |
| 433 | Ga0207700_10006986 | 3300025928 | Bacteria | 6870 |
| 434 | Ga0207700_10014371 | 3300025928 | Bacteria | 5186 |
| 435 | Ga0207700_10020739 | 3300025928 | Bacteria | 4471 |
| 436 | Ga0207700_10039278 | 3300025928 | Bacteria | 3444 |
| 437 | Ga0207700_10056216 | 3300025928 | Bacteria | 2961 |
| 438 | Ga0207700_10089091 | 3300025928 | Bacteria | 2431 |
| 439 | Ga0207700_10099220 | 3300025928 | Bacteria | 2318 |
| 440 | Ga0207700_10101928 | 3300025928 | Bacteria | 2291 |
| 441 | Ga0207700_10194885 | 3300025928 | Bacteria | 1704 |
| 442 | Ga0207700_10230897 | 3300025928 | Bacteria | 1573 |
| 443 | Ga0207700_10468992 | 3300025928 | Bacteria | 1111 |
| 444 | Ga0207664_10000047 | 3300025929 | Bacteria | 139122 |
| 445 | Ga0207664_10000379 | 3300025929 | Bacteria | 32303 |
| 446 | Ga0207664_10000543 | 3300025929 | Bacteria | 26710 |
| 447 | Ga0207664_10000594 | 3300025929 | Bacteria | 25078 |
| 448 | Ga0207664_10002311 | 3300025929 | Bacteria | 12583 |
| 449 | Ga0207664_10010461 | 3300025929 | Bacteria | 6554 |
| 450 | Ga0207664_10024932 | 3300025929 | Bacteria | 4498 |
| 451 | Ga0207664_10033956 | 3300025929 | Bacteria | 3925 |
| 452 | Ga0207664_10060263 | 3300025929 | Bacteria | 3024 |
| 453 | Ga0207664_10061428 | 3300025929 | Bacteria | 2998 |
| 454 | Ga0207664_10074863 | 3300025929 | Bacteria | 2737 |
| 455 | Ga0207664_10110371 | 3300025929 | Bacteria | 2287 |
| 456 | Ga0207664_10176661 | 3300025929 | Bacteria | 1831 |
| 457 | Ga0207664_10255494 | 3300025929 | Bacteria | 1531 |
| 458 | Ga0207664_10332582 | 3300025929 | Bacteria | 1342 |
| 459 | Ga0207664_10338737 | 3300025929 | Bacteria | 1329 |
| 460 | Ga0207664_10425908 | 3300025929 | Bacteria | 1183 |
| 461 | Ga0207664_10699689 | 3300025929 | Bacteria | 911 |
| 462 | Ga0207644_10027196 | 3300025931 | Bacteria | 3951 |
| 463 | Ga0207690_10053190 | 3300025932 | Bacteria | 2716 |
| 464 | Ga0207690_10214901 | 3300025932 | Bacteria | 1468 |
| 465 | Ga0207690_10430363 | 3300025932 | Bacteria | 1057 |
| 466 | Ga0207686_10151336 | 3300025934 | Bacteria | 1616 |
| 467 | Ga0207709_10011152 | 3300025935 | Bacteria | 4956 |
| 468 | Ga0207709_10144620 | 3300025935 | Bacteria | 1639 |
| 469 | Ga0207709_10330032 | 3300025935 | Bacteria | 1145 |
| 470 | Ga0207670_10324473 | 3300025936 | Bacteria | 1212 |
| 471 | Ga0207665_10001106 | 3300025939 | Bacteria | 18140 |
| 472 | Ga0207665_10001519 | 3300025939 | Bacteria | 15611 |
| 473 | Ga0207665_10001843 | 3300025939 | Bacteria | 14259 |
| 474 | Ga0207665_10020336 | 3300025939 | Bacteria | 4360 |
| 475 | Ga0207665_10022999 | 3300025939 | Bacteria | 4104 |
| 476 | Ga0207665_10033589 | 3300025939 | Bacteria | 3402 |
| 477 | Ga0207665_10171255 | 3300025939 | Bacteria | 1568 |
| 478 | Ga0207691_10011415 | 3300025940 | Bacteria | 8524 |
| 479 | Ga0207691_10035120 | 3300025940 | Bacteria | 4658 |
| 480 | Ga0207689_10009034 | 3300025942 | Bacteria | 8629 |
| 481 | Ga0207689_10026742 | 3300025942 | Bacteria | 4832 |
| 482 | Ga0207661_10012478 | 3300025944 | Bacteria | 6174 |
| 483 | Ga0207661_10038004 | 3300025944 | Bacteria | 3770 |
| 484 | Ga0207661_10070137 | 3300025944 | Bacteria | 2860 |
| 485 | Ga0207661_10182722 | 3300025944 | Bacteria | 1833 |
| 486 | Ga0207661_10209366 | 3300025944 | Bacteria | 1718 |
| 487 | Ga0207661_10366378 | 3300025944 | Bacteria | 1302 |
| 488 | Ga0207661_10380131 | 3300025944 | Bacteria | 1278 |
| 489 | Ga0207679_10003830 | 3300025945 | Bacteria | 9325 |
| 490 | Ga0207679_10056484 | 3300025945 | Bacteria | 2898 |
| 491 | Ga0207667_10108095 | 3300025949 | Bacteria | 2870 |
| 492 | Ga0207667_10818001 | 3300025949 | Bacteria | 927 |
| 493 | Ga0207651_10150573 | 3300025960 | Bacteria | 1810 |
| 494 | Ga0207668_10148664 | 3300025972 | Bacteria | 1811 |
| 495 | Ga0207640_10062340 | 3300025981 | Bacteria | 2473 |
| 496 | Ga0207658_10048223 | 3300025986 | Bacteria | 3122 |
| 497 | Ga0207658_10101344 | 3300025986 | Bacteria | 2256 |
| 498 | Ga0207677_10047770 | 3300026023 | Bacteria | 2876 |
| 499 | Ga0207677_10263260 | 3300026023 | Bacteria | 1406 |
| 500 | Ga0207677_10539415 | 3300026023 | Bacteria | 1015 |
| 501 | Ga0207703_10036637 | 3300026035 | Bacteria | 3905 |
| 502 | Ga0207703_10175221 | 3300026035 | Bacteria | 1889 |
| 503 | Ga0207639_10070751 | 3300026041 | Bacteria | 2726 |
| 504 | Ga0207639_10101308 | 3300026041 | Bacteria | 2328 |
| 505 | Ga0207678_10001956 | 3300026067 | Bacteria | 18784 |
| 506 | Ga0207678_10007294 | 3300026067 | Bacteria | 9800 |
| 507 | Ga0207678_10022190 | 3300026067 | Bacteria | 5562 |
| 508 | Ga0207678_10439890 | 3300026067 | Bacteria | 1132 |
| 509 | Ga0207708_10027364 | 3300026075 | Bacteria | 4316 |
| 510 | Ga0207708_10074694 | 3300026075 | Bacteria | 2598 |
| 511 | Ga0207702_10101267 | 3300026078 | Bacteria | 2543 |
| 512 | Ga0207702_10205652 | 3300026078 | Bacteria | 1828 |
| 513 | Ga0207702_10286343 | 3300026078 | Bacteria | 1559 |
| 514 | Ga0207702_10418616 | 3300026078 | Bacteria | 1295 |
| 515 | Ga0207641_10037314 | 3300026088 | Bacteria | 4057 |
| 516 | Ga0207641_10089939 | 3300026088 | Bacteria | 2684 |
| 517 | Ga0207676_10063866 | 3300026095 | Bacteria | 2925 |
| 518 | Ga0207676_10077200 | 3300026095 | Bacteria | 2693 |
| 519 | Ga0207674_10027421 | 3300026116 | Bacteria | 6025 |
| 520 | Ga0207674_10028680 | 3300026116 | Bacteria | 5872 |
| 521 | Ga0207674_10065923 | 3300026116 | Bacteria | 3649 |
| 522 | Ga0207674_10192671 | 3300026116 | Bacteria | 1988 |
| 523 | Ga0207675_100010057 | 3300026118 | Bacteria | 8870 |
| 524 | Ga0207683_10001336 | 3300026121 | Bacteria | 22258 |
| 525 | Ga0207683_10006321 | 3300026121 | Bacteria | 10147 |
| 526 | Ga0207683_10007910 | 3300026121 | Bacteria | 9096 |
| 527 | Ga0207683_10317592 | 3300026121 | Bacteria | 1426 |
| 528 | Ga0207698_10203673 | 3300026142 | Bacteria | 1774 |
| 529 | Ga0207698_10662167 | 3300026142 | Bacteria | 1035 |
| 530 | Ga0207428_10000436 | 3300027907 | Bacteria | 51096 |
| 531 | Ga0207428_10006188 | 3300027907 | Bacteria | 11060 |
| 532 | Ga0207428_10243194 | 3300027907 | Bacteria | 1344 |
| 533 | Ga0268266_10027769 | 3300028379 | Bacteria | 4812 |
| 534 | Ga0268266_10191818 | 3300028379 | Bacteria | 1866 |
| 535 | Ga0268264_10227381 | 3300028381 | Bacteria | 1721 |
| 536 | Ga0265337_1002783 | 3300028556 | Bacteria | 7836 |
| 537 | Ga0265319_1040619 | 3300028563 | Bacteria | 1572 |
| 538 | Ga0265334_10028035 | 3300028573 | Bacteria | 2265 |
| 539 | Ga0265318_10052844 | 3300028577 | Bacteria | 1524 |
| 540 | Ga0265323_10032217 | 3300028653 | Bacteria | 1945 |
| 541 | Ga0265322_10004808 | 3300028654 | Bacteria | 4003 |
| 542 | Ga0265336_10006997 | 3300028666 | Bacteria | 4035 |
| 543 | Ga0265336_10007124 | 3300028666 | Bacteria | 3995 |
| 544 | Ga0307515_10228167 | 3300028794 | Bacteria | 1662 |
| 545 | Ga0265338_10001346 | 3300028800 | Bacteria | 40029 |
| 546 | Ga0265338_10006911 | 3300028800 | Bacteria | 14280 |
| 547 | Ga0265338_10010558 | 3300028800 | Bacteria | 10802 |
| 548 | Ga0265338_10025455 | 3300028800 | Bacteria | 6002 |
| 549 | Ga0265324_10009688 | 3300029957 | Bacteria | 3748 |
| 550 | Ga0316181_1287760 | 3300030744 | Bacteria | 1092 |
| 551 | Ga0265760_10084872 | 3300031090 | Bacteria | 985 |
| 552 | Ga0265332_10002184 | 3300031238 | Bacteria | 10071 |
| 553 | Ga0265320_10042505 | 3300031240 | Bacteria | 2253 |
| 554 | Ga0265340_10025062 | 3300031247 | Bacteria | 3024 |
| 555 | Ga0265339_10015113 | 3300031249 | Bacteria | 4638 |
| 556 | Ga0265316_10068929 | 3300031344 | Bacteria | 2730 |
| 557 | Ga0307513_10001072 | 3300031456 | Bacteria | 39827 |
| 558 | Ga0307509_10405746 | 3300031507 | Bacteria | 1068 |
| 559 | Ga0307408_100002302 | 3300031548 | Bacteria | 13593 |
| 560 | Ga0307408_100009943 | 3300031548 | Bacteria | 6265 |
| 561 | Ga0307408_100023860 | 3300031548 | Bacteria | 4170 |
| 562 | Ga0307408_100030294 | 3300031548 | Bacteria | 3756 |
| 563 | Ga0307408_100042486 | 3300031548 | Bacteria | 3229 |
| 564 | Ga0307408_100083312 | 3300031548 | Bacteria | 2396 |
| 565 | Ga0307408_100111110 | 3300031548 | Bacteria | 2105 |
| 566 | Ga0307408_100182329 | 3300031548 | Bacteria | 1685 |
| 567 | Ga0265313_10006305 | 3300031595 | Bacteria | 8447 |
| 568 | Ga0265313_10030774 | 3300031595 | Bacteria | 2758 |
| 569 | Ga0316579_10004478 | 3300031691 | Bacteria | 5551 |
| 570 | Ga0316579_10042337 | 3300031691 | Bacteria | 2115 |
| 571 | Ga0265314_10017800 | 3300031711 | Bacteria | 5567 |
| 572 | Ga0265314_10046623 | 3300031711 | Bacteria | 3056 |
| 573 | Ga0265342_10012657 | 3300031712 | Bacteria | 5707 |
| 574 | Ga0316576_10055510 | 3300031727 | Bacteria | 2891 |
| 575 | Ga0316576_10074597 | 3300031727 | Bacteria | 2508 |
| 576 | Ga0316576_10089022 | 3300031727 | Bacteria | 2298 |
| 577 | Ga0316578_10106373 | 3300031728 | Bacteria | 1683 |
| 578 | Ga0316578_10130603 | 3300031728 | Bacteria | 1511 |
| 579 | Ga0307516_10360182 | 3300031730 | Bacteria | 1119 |
| 580 | Ga0307405_10001740 | 3300031731 | Bacteria | 9293 |
| 581 | Ga0307405_10080869 | 3300031731 | Bacteria | 2122 |
| 582 | Ga0307405_10143594 | 3300031731 | Bacteria | 1668 |
| 583 | Ga0307405_10492008 | 3300031731 | Bacteria | 981 |
| 584 | Ga0316577_10004394 | 3300031733 | Bacteria | 7268 |
| 585 | Ga0316577_10066283 | 3300031733 | Bacteria | 2016 |
| 586 | Ga0307413_10009968 | 3300031824 | Bacteria | 4579 |
| 587 | Ga0307413_10050142 | 3300031824 | Bacteria | 2506 |
| 588 | Ga0307413_10073826 | 3300031824 | Bacteria | 2158 |
| 589 | Ga0307413_10109312 | 3300031824 | Bacteria | 1847 |
| 590 | Ga0307413_10128990 | 3300031824 | Bacteria | 1727 |
| 591 | Ga0307410_10001200 | 3300031852 | Bacteria | 11496 |
| 592 | Ga0307410_10010483 | 3300031852 | Bacteria | 5252 |
| 593 | Ga0307410_10017746 | 3300031852 | Bacteria | 4282 |
| 594 | Ga0307410_10063996 | 3300031852 | Bacteria | 2525 |
| 595 | Ga0307410_10082752 | 3300031852 | Bacteria | 2258 |
| 596 | Ga0307410_10240531 | 3300031852 | Bacteria | 1402 |
| 597 | Ga0307406_10000241 | 3300031901 | Bacteria | 33132 |
| 598 | Ga0307406_10018790 | 3300031901 | Bacteria | 4046 |
| 599 | Ga0307406_10019670 | 3300031901 | Bacteria | 3965 |
| 600 | Ga0307406_10040560 | 3300031901 | Bacteria | 2895 |
| 601 | Ga0307406_10240116 | 3300031901 | Bacteria | 1358 |
| 602 | Ga0307407_10002677 | 3300031903 | Bacteria | 7061 |
| 603 | Ga0307407_10004684 | 3300031903 | Bacteria | 5842 |
| 604 | Ga0307407_10045925 | 3300031903 | Bacteria | 2471 |
| 605 | Ga0307407_10067460 | 3300031903 | Bacteria | 2114 |
| 606 | Ga0307407_10337237 | 3300031903 | Bacteria | 1063 |
| 607 | Ga0307412_10033871 | 3300031911 | Bacteria | 3250 |
| 608 | Ga0307412_10156909 | 3300031911 | Bacteria | 1686 |
| 609 | Ga0307409_100000403 | 3300031995 | Bacteria | 18419 |
| 610 | Ga0307409_100007374 | 3300031995 | Bacteria | 6572 |
| 611 | Ga0307409_100022171 | 3300031995 | Bacteria | 4371 |
| 612 | Ga0307409_100027710 | 3300031995 | Bacteria | 4021 |
| 613 | Ga0307409_100035514 | 3300031995 | Bacteria | 3654 |
| 614 | Ga0307409_100036313 | 3300031995 | Bacteria | 3621 |
| 615 | Ga0307409_100049765 | 3300031995 | Bacteria | 3197 |
| 616 | Ga0307409_100056382 | 3300031995 | Bacteria | 3038 |
| 617 | Ga0307409_100081847 | 3300031995 | Bacteria | 2611 |
| 618 | Ga0307409_100111676 | 3300031995 | Bacteria | 2293 |
| 619 | Ga0307409_100225590 | 3300031995 | Bacteria | 1694 |
| 620 | Ga0307409_100231143 | 3300031995 | Bacteria | 1677 |
| 621 | Ga0307409_100258484 | 3300031995 | Bacteria | 1596 |
| 622 | Ga0307409_100507870 | 3300031995 | Bacteria | 1175 |
| 623 | Ga0307416_100000079 | 3300032002 | Bacteria | 70731 |
| 624 | Ga0307416_100003433 | 3300032002 | Bacteria | 9306 |
| 625 | Ga0307416_100020205 | 3300032002 | Bacteria | 4745 |
| 626 | Ga0307416_100054577 | 3300032002 | Bacteria | 3213 |
| 627 | Ga0307416_100055863 | 3300032002 | Bacteria | 3182 |
| 628 | Ga0307416_100056940 | 3300032002 | Bacteria | 3159 |
| 629 | Ga0307416_100065826 | 3300032002 | Bacteria | 2980 |
| 630 | Ga0307416_100092062 | 3300032002 | Bacteria | 2606 |
| 631 | Ga0307416_100125879 | 3300032002 | Bacteria | 2295 |
| 632 | Ga0307416_100181798 | 3300032002 | Bacteria | 1972 |
| 633 | Ga0307416_100212282 | 3300032002 | Bacteria | 1847 |
| 634 | Ga0307416_100575738 | 3300032002 | Bacteria | 1202 |
| 635 | Ga0307416_100720352 | 3300032002 | Bacteria | 1088 |
| 636 | Ga0307414_10001328 | 3300032004 | Bacteria | 12778 |
| 637 | Ga0307414_10086137 | 3300032004 | Bacteria | 2317 |
| 638 | Ga0307414_10095165 | 3300032004 | Bacteria | 2225 |
| 639 | Ga0307414_10147376 | 3300032004 | Unclassified | 1852 |
| 640 | Ga0307414_10192540 | 3300032004 | Bacteria | 1651 |
| 641 | Ga0307414_10375124 | 3300032004 | Bacteria | 1228 |
| 642 | Ga0307411_10001879 | 3300032005 | Bacteria | 8948 |
| 643 | Ga0307411_10016592 | 3300032005 | Bacteria | 4171 |
| 644 | Ga0307411_10035516 | 3300032005 | Bacteria | 3114 |
| 645 | Ga0307411_10062628 | 3300032005 | Bacteria | 2482 |
| 646 | Ga0307415_100026311 | 3300032126 | Bacteria | 3667 |
| 647 | Ga0307415_100055891 | 3300032126 | Bacteria | 2703 |
| 648 | Ga0307415_100061389 | 3300032126 | Bacteria | 2602 |
| 649 | Ga0307415_100172409 | 3300032126 | Bacteria | 1688 |
| 650 | Ga0307415_100183569 | 3300032126 | Bacteria | 1644 |
| 651 | Ga0307415_100270370 | 3300032126 | Bacteria | 1392 |
| 652 | Ga0307415_100363536 | 3300032126 | Bacteria | 1223 |
| 653 | Ga0316583_10012370 | 3300032133 | Bacteria | 3078 |
| 654 | Ga0316585_10019142 | 3300032137 | Bacteria | 2084 |
| 655 | Ga0316580_10006211 | 3300032139 | Bacteria | 3521 |
| 656 | Ga0316580_10055174 | 3300032139 | Bacteria | 1222 |
| 657 | Ga0316212_1002393 | 3300033547 | Bacteria | 2672 |
| 658 | Ga0373926_0006434 | 3300035083 | Bacteria | 3901 |
| 659 | Ga0373926_0070539 | 3300035083 | Bacteria | 1283 |
| 660 | Ga0373929_0027598 | 3300035085 | Bacteria | 1194 |
| 661 | Ga0373934_0000032 | 3300035086 | Bacteria | 44940 |
| 662 | Ga0373934_0004815 | 3300035086 | Bacteria | 4992 |
| 663 | Ga0373934_0015706 | 3300035086 | Bacteria | 2874 |
| 664 | Ga0373934_0045351 | 3300035086 | Bacteria | 1738 |
| 665 | Ga0373934_0049421 | 3300035086 | Bacteria | 1665 |
| 666 | Ga0373940_0089207 | 3300035088 | Bacteria | 921 |
| 667 | Ga0373944_0000245 | 3300035089 | Bacteria | 11886 |
| 668 | Ga0373944_0009505 | 3300035089 | Bacteria | 2638 |
| 669 | Ga0373944_0018985 | 3300035089 | Bacteria | 1969 |
| 670 | Ga0373923_0000558 | 3300035111 | Bacteria | 9135 |
| 671 | Ga0373923_0022773 | 3300035111 | Bacteria | 2460 |
| 672 | Ga0373923_0040387 | 3300035111 | Bacteria | 1920 |
| 673 | Ga0373923_0052739 | 3300035111 | Bacteria | 1709 |
| 674 | Ga0373923_0168404 | 3300035111 | Bacteria | 1002 |
| 675 | Ga0373936_0000908 | 3300035113 | Bacteria | 10583 |
| 676 | Ga0373936_0009917 | 3300035113 | Bacteria | 3594 |
| 677 | Ga0373936_0010386 | 3300035113 | Bacteria | 3512 |
| 678 | Ga0373936_0071039 | 3300035113 | Bacteria | 1435 |
| 679 | Ga0373941_0019241 | 3300035115 | Bacteria | 1898 |
| 680 | Ga0373945_0000949 | 3300035116 | Bacteria | 8633 |
| 681 | Ga0373945_0001238 | 3300035116 | Bacteria | 7768 |
| 682 | Ga0373945_0037134 | 3300035116 | Bacteria | 1748 |
| 683 | Ga0373953_0000145 | 3300035117 | Bacteria | 18034 |
| 684 | Ga0373953_0008206 | 3300035117 | Bacteria | 3536 |
| 685 | Ga0373953_0010007 | 3300035117 | Bacteria | 3287 |
| 686 | Ga0373953_0068792 | 3300035117 | Bacteria | 1457 |
| 687 | Ga0373953_0069406 | 3300035117 | Bacteria | 1452 |
| 688 | Ga0373954_0023062 | 3300035118 | Bacteria | 2827 |
| 689 | Ga0373954_0050839 | 3300035118 | Bacteria | 1945 |
| 690 | Ga0373954_0059263 | 3300035118 | Bacteria | 1804 |
| 691 | Ga0373954_0091376 | 3300035118 | Bacteria | 1462 |
| 692 | Ga0373954_0228590 | 3300035118 | Bacteria | 915 |
| 693 | Ga0373956_0000096 | 3300035119 | Bacteria | 29760 |
| 694 | Ga0373956_0009546 | 3300035119 | Bacteria | 3951 |
| 695 | Ga0373956_0015945 | 3300035119 | Bacteria | 3152 |
| 696 | Ga0373956_0017507 | 3300035119 | Bacteria | 3022 |
| 697 | Ga0373956_0024516 | 3300035119 | Bacteria | 2600 |
| 698 | Ga0373956_0065067 | 3300035119 | Bacteria | 1656 |
| 699 | Ga0373957_0017156 | 3300035120 | Bacteria | 2517 |
| 700 | Ga0373957_0104642 | 3300035120 | Bacteria | 1135 |
| 701 | Ga0373960_0011769 | 3300035121 | Bacteria | 2162 |
| 702 | Ga0373943_0000554 | 3300035170 | Bacteria | 16138 |
| 703 | Ga0373943_0095187 | 3300035170 | Bacteria | 1548 |
| 704 | Ga0373946_0000088 | 3300035171 | Bacteria | 25288 |
| 705 | Ga0373946_0037577 | 3300035171 | Bacteria | 1968 |
| 706 | Ga0373946_0080395 | 3300035171 | Bacteria | 1426 |
| 707 | Ga0373955_0000015 | 3300035172 | Bacteria | 72056 |
| 708 | Ga0373955_0021499 | 3300035172 | Bacteria | 3258 |
| 709 | Ga0373955_0031472 | 3300035172 | Bacteria | 2779 |
| 710 | Ga0373955_0053296 | 3300035172 | Bacteria | 2208 |
| 711 | Ga0373955_0086690 | 3300035172 | Bacteria | 1778 |
| 712 | Ga0373955_0102681 | 3300035172 | Bacteria | 1643 |
| 713 | Ga0373955_0185831 | 3300035172 | Bacteria | 1234 |
| 714 | Ga0373942_0003854 | 3300035207 | Bacteria | 3508 |
| 715 | Ga0373961_0009430 | 3300035241 | Bacteria | 2388 |
| 716 | Ga0373961_0066805 | 3300035241 | Bacteria | 1104 |
| 717 | Ga0373962_0011474 | 3300035242 | Bacteria | 2222 |
| 718 | Ga0373962_0016970 | 3300035242 | Bacteria | 1883 |
| 719 | Ga0316574_0002969 | 3300035398 | Bacteria | 8633 |
| 720 | Ga0316574_0027597 | 3300035398 | Bacteria | 3420 |
| 721 | Ga0316574_0048143 | 3300035398 | Bacteria | 2646 |
| 722 | Ga0373924_0003592 | 3300035410 | Bacteria | 5347 |
| 723 | Ga0373924_0006043 | 3300035410 | Bacteria | 4320 |
| 724 | Ga0373924_0006676 | 3300035410 | Bacteria | 4140 |
| 725 | Ga0373924_0057313 | 3300035410 | Bacteria | 1624 |
| 726 | Ga0373924_0063716 | 3300035410 | Bacteria | 1546 |
| 727 | Ga0373924_0175103 | 3300035410 | Bacteria | 943 |
| 728 | Ga0373931_0016392 | 3300035691 | Bacteria | 3646 |
| 729 | Ga0373931_0039540 | 3300035691 | Bacteria | 2472 |
| 730 | Ga0373931_0253756 | 3300035691 | Bacteria | 1070 |
| 731 | Ga0373931_0344708 | 3300035691 | Bacteria | 931 |
| 732 | Ga0373931_0385249 | 3300035691 | Bacteria | 885 |
| 733 | Ga0373935_0005038 | 3300035692 | Bacteria | 7779 |
| 734 | Ga0373935_0007971 | 3300035692 | Bacteria | 6350 |
| 735 | Ga0373935_0032118 | 3300035692 | Bacteria | 3261 |
| 736 | Ga0373935_0095527 | 3300035692 | Bacteria | 1952 |
| 737 | Ga0373927_0002273 | 3300035695 | Bacteria | 14073 |
| 738 | Ga0373927_0013177 | 3300035695 | Bacteria | 5499 |
| 739 | Ga0373927_0183227 | 3300035695 | Bacteria | 1374 |
| 740 | Ga0373933_0000004 | 3300035724 | Bacteria | 143741 |
| 741 | Ga0373933_0001154 | 3300035724 | Bacteria | 15665 |
| 742 | Ga0373933_0009139 | 3300035724 | Bacteria | 5410 |
| 743 | Ga0373933_0026217 | 3300035724 | Bacteria | 3346 |
| 744 | Ga0373933_0032220 | 3300035724 | Bacteria | 3045 |
| 745 | Ga0373933_0087911 | 3300035724 | Bacteria | 1914 |
| 746 | Ga0373933_0101986 | 3300035724 | Bacteria | 1781 |
| 747 | Ga0373933_0138807 | 3300035724 | Bacteria | 1533 |
| 748 | Ga0373933_0211310 | 3300035724 | Bacteria | 1243 |
| 749 | Ga0373933_0242773 | 3300035724 | Bacteria | 1159 |
| 750 | Ga0373947_0000116 | 3300035725 | Bacteria | 39945 |
| 751 | Ga0373947_0000815 | 3300035725 | Bacteria | 18801 |
| 752 | Ga0373947_0025713 | 3300035725 | Bacteria | 3433 |
| 753 | Ga0373947_0100704 | 3300035725 | Bacteria | 1816 |
| 754 | Ga0373947_0121269 | 3300035725 | Bacteria | 1661 |
| 755 | Ga0373947_0284467 | 3300035725 | Bacteria | 1100 |
| 756 | Ga0373937_0000012 | 3300036401 | Bacteria | 159418 |
| 757 | Ga0373937_0063728 | 3300036401 | Bacteria | 3390 |
| 758 | Ga0373937_0067438 | 3300036401 | Bacteria | 3296 |
| 759 | Ga0373937_0068625 | 3300036401 | Bacteria | 3269 |
| 760 | Ga0373937_0119951 | 3300036401 | Bacteria | 2450 |
| 761 | Ga0373937_0168985 | 3300036401 | Bacteria | 2051 |
| 762 | Ga0373937_0172163 | 3300036401 | Bacteria | 2031 |
| 763 | Ga0373937_0402129 | 3300036401 | Bacteria | 1299 |
| 764 | Ga0373937_0751607 | 3300036401 | Bacteria | 922 |
| 765 | Ga0373937_0835469 | 3300036401 | Bacteria | 869 |
| 766 | Ga0372808_006891 | 3300036459 | Bacteria | 1543 |
| 767 | Ga0316582_0004867 | 3300036647 | Bacteria | 6855 |
| 768 | Ga0316584_0009116 | 3300036712 | Bacteria | 6871 |
| 769 | Ga0316584_0018850 | 3300036712 | Bacteria | 4982 |
| 770 | Ga0316584_0051715 | 3300036712 | Bacteria | 3072 |
| 771 | Ga0373925_0000021 | 3300037068 | Bacteria | 162277 |
| 772 | Ga0373925_0003050 | 3300037068 | Bacteria | 13175 |
| 773 | Ga0373925_0005539 | 3300037068 | Bacteria | 9400 |
| 774 | Ga0373925_0073881 | 3300037068 | Bacteria | 2581 |
| 775 | Ga0373925_0094353 | 3300037068 | Bacteria | 2291 |
| 776 | Ga0373925_0112859 | 3300037068 | Bacteria | 2101 |
| 777 | Ga0373925_0168389 | 3300037068 | Bacteria | 1729 |
| 778 | Ga0395899_0016113 | 3300037312 | Bacteria | 5698 |
| 779 | Ga0395899_0055732 | 3300037312 | Bacteria | 2923 |
| 780 | Ga0395900_0007662 | 3300037418 | Bacteria | 11143 |
| 781 | Ga0395900_0018014 | 3300037418 | Bacteria | 7211 |
| 782 | Ga0395900_0018741 | 3300037418 | Bacteria | 7058 |
| 783 | Ga0395900_0049923 | 3300037418 | Bacteria | 4310 |
| 784 | Ga0395900_0057687 | 3300037418 | Bacteria | 3997 |
| 785 | Ga0395900_0085090 | 3300037418 | Bacteria | 3250 |
| 786 | Ga0395900_0113139 | 3300037418 | Bacteria | 2786 |
| 787 | Ga0395898_0017683 | 3300037466 | Bacteria | 7276 |
| 788 | Ga0395898_0032533 | 3300037466 | Bacteria | 5206 |
| 789 | Ga0395898_0050546 | 3300037466 | Bacteria | 4068 |
| 790 | Ga0395898_0073181 | 3300037466 | Bacteria | 3310 |
| 791 | Ga0395898_0081435 | 3300037466 | Bacteria | 3121 |
| 792 | Ga0395898_0083833 | 3300037466 | Bacteria | 3072 |
| 793 | Ga0395898_0090890 | 3300037466 | Bacteria | 2937 |
| 794 | Ga0395898_0133313 | 3300037466 | Bacteria | 2379 |
| 795 | Ga0395905_0042768 | 3300037471 | Bacteria | 4250 |
| 796 | Ga0395905_0088621 | 3300037471 | Bacteria | 2900 |
| 797 | Ga0395905_0117457 | 3300037471 | Bacteria | 2500 |
| 798 | Ga0316581_0016916 | 3300037588 | Bacteria | 2099 |
| 799 | Ga0436364_0426348 | 3300037853 | Bacteria | 32972 |
| 800 | Ga0436364_0549328 | 3300037853 | Bacteria | 13439 |
| 801 | Ga0436364_0563172 | 3300037853 | Bacteria | 1191 |
| 802 | Ga0436364_0896453 | 3300037853 | Bacteria | 3251 |
| 803 | Ga0436364_0990552 | 3300037853 | Bacteria | 1280 |
| 804 | Ga0436364_1292226 | 3300037853 | Bacteria | 2774 |
| 805 | Ga0436364_1406831 | 3300037853 | Bacteria | 905 |
| 806 | Ga0436364_1419792 | 3300037853 | Bacteria | 3447 |
| 807 | Ga0436364_1427311 | 3300037853 | Bacteria | 97691 |
| 808 | Ga0436364_1475022 | 3300037853 | Bacteria | 1410 |
| 809 | Ga0395901_0003285 | 3300038443 | Bacteria | 16276 |
| 810 | Ga0395901_0004509 | 3300038443 | Bacteria | 14043 |
| 811 | Ga0395901_0008590 | 3300038443 | Bacteria | 10324 |
| 812 | Ga0395901_0018051 | 3300038443 | Bacteria | 7201 |
| 813 | Ga0395901_0020548 | 3300038443 | Bacteria | 6758 |
| 814 | Ga0395901_0032466 | 3300038443 | Bacteria | 5387 |
| 815 | Ga0395901_0048337 | 3300038443 | Bacteria | 4418 |
| 816 | Ga0395901_0112405 | 3300038443 | Bacteria | 2860 |
| 817 | Ga0395901_0167743 | 3300038443 | Bacteria | 2304 |
| 818 | Ga0395901_0203548 | 3300038443 | Bacteria | 2074 |
| 819 | Ga0395901_0224113 | 3300038443 | Bacteria | 1964 |
| 820 | Ga0395901_0229433 | 3300038443 | Bacteria | 1939 |
| 821 | Ga0436365_0471577 | 3300039437 | Bacteria | 2277 |
| 822 | Ga0436365_0510277 | 3300039437 | Bacteria | 1278 |
| 823 | Ga0436363_1571899 | 3300039450 | Bacteria | 3076 |
| 824 | Ga0439436_0030917 | 3300041404 | Bacteria | 1555 |
| 825 | Ga0439438_032040 | 3300041405 | Bacteria | 1395 |
| 826 | Ga0439439_0007684 | 3300041406 | Bacteria | 2525 |
| 827 | Ga0439466_0011359 | 3300041411 | Bacteria | 3295 |
| 828 | Ga0439466_0015797 | 3300041411 | Bacteria | 2739 |
| 829 | Ga0439465_0027389 | 3300041413 | Bacteria | 1805 |
| 830 | Ga0451807_1174564 | 3300041486 | Bacteria | 1319 |
| 831 | Ga0451833_0564772 | 3300041491 | Bacteria | 2104 |
| 832 | Ga0451833_0913143 | 3300041491 | Bacteria | 4456 |
| 833 | Ga0451837_0729638 | 3300041494 | Bacteria | 1961 |
| 834 | Ga0451839_1288255 | 3300041496 | Bacteria | 1325 |
| 835 | Ga0451843_0773603 | 3300041509 | Bacteria | 1940 |
| 836 | Ga0451853_2585626 | 3300041512 | Bacteria | 2057 |
| 837 | Ga0439431_0053821 | 3300041997 | Bacteria | 1048 |
| 838 | Ga0439433_0000441 | 3300041999 | Bacteria | 7628 |
| 839 | Ga0439433_0000451 | 3300041999 | Bacteria | 7557 |
| 840 | Ga0439442_017474 | 3300042002 | Bacteria | 1480 |
| 841 | Ga0439432_065575 | 3300042006 | Bacteria | 1113 |
| 842 | Ga0439449_0008093 | 3300042007 | Bacteria | 3993 |
| 843 | Ga0439449_0009742 | 3300042007 | Bacteria | 3634 |
| 844 | Ga0439452_012151 | 3300042010 | Bacteria | 2457 |
| 845 | Ga0439457_000675 | 3300042014 | Bacteria | 10082 |
| 846 | Ga0439457_008987 | 3300042014 | Bacteria | 2337 |
| 847 | Ga0439457_041047 | 3300042014 | Bacteria | 1031 |
| 848 | Ga0439462_0000144 | 3300042015 | Bacteria | 11554 |
| 849 | Ga0439462_0048724 | 3300042015 | Bacteria | 1137 |
| 850 | Ga0450919_001721 | 3300042121 | Bacteria | 2857 |
| 851 | Ga0450919_003706 | 3300042121 | Bacteria | 1899 |
| 852 | Ga0450907_002582 | 3300042146 | Bacteria | 3401 |
| 853 | Ga0439446_0002486 | 3300042156 | Bacteria | 4433 |
| 854 | Ga0439458_0007512 | 3300042157 | Bacteria | 2427 |
| 855 | Ga0450908_006499 | 3300042184 | Bacteria | 2217 |
| 856 | Ga0439434_0003918 | 3300042435 | Bacteria | 4345 |
| 857 | Ga0439460_0055304 | 3300042461 | Bacteria | 1199 |
| 858 | Ga0466969_0116744 | 3300044656 | Bacteria | 1245 |
| 859 | Ga0466965_0035061 | 3300044683 | Bacteria | 2457 |
| 860 | Ga0466965_0039545 | 3300044683 | Bacteria | 2319 |
| 861 | Ga0466965_0058778 | 3300044683 | Bacteria | 1918 |
| 862 | Ga0466965_0068583 | 3300044683 | Bacteria | 1781 |
| 863 | Ga0466965_0130882 | 3300044683 | Bacteria | 1301 |
| 864 | Ga0466965_0172072 | 3300044683 | Bacteria | 1140 |
| 865 | Ga0466966_0008166 | 3300044684 | Bacteria | 6938 |
| 866 | Ga0466961_0040238 | 3300044693 | Bacteria | 2997 |
| 867 | Ga0466961_0054074 | 3300044693 | Bacteria | 2561 |
| 868 | Ga0466961_0198937 | 3300044693 | Bacteria | 1240 |
| 869 | Ga0466963_0065730 | 3300044694 | Bacteria | 2432 |
| 870 | Ga0466963_0066124 | 3300044694 | Bacteria | 2424 |
| 871 | Ga0466963_0066850 | 3300044694 | Bacteria | 2411 |
| 872 | Ga0466963_0091945 | 3300044694 | Bacteria | 2067 |
| 873 | Ga0466963_0179436 | 3300044694 | Bacteria | 1478 |
| 874 | Ga0466963_0385456 | 3300044694 | Bacteria | 988 |
| 875 | Ga0466971_0020900 | 3300044719 | Bacteria | 2910 |
| 876 | Ga0466971_0031798 | 3300044719 | Bacteria | 2364 |
| 877 | Ga0466971_0120680 | 3300044719 | Bacteria | 1213 |
| 878 | Ga0466970_0039673 | 3300044765 | Bacteria | 2499 |
| 879 | Ga0466957_0006284 | 3300044842 | Bacteria | 6701 |
| 880 | Ga0466957_0018448 | 3300044842 | Bacteria | 4098 |
| 881 | Ga0466957_0053167 | 3300044842 | Bacteria | 2468 |
| 882 | Ga0466957_0066043 | 3300044842 | Bacteria | 2229 |
| 883 | Ga0466957_0070616 | 3300044842 | Bacteria | 2158 |
| 884 | Ga0466957_0102187 | 3300044842 | Bacteria | 1808 |
| 885 | Ga0466960_0009185 | 3300044901 | Bacteria | 4069 |
| 886 | Ga0466960_0010549 | 3300044901 | Bacteria | 3840 |
| 887 | Ga0466960_0118972 | 3300044901 | Bacteria | 1381 |
| 888 | Ga0466960_0183016 | 3300044901 | Bacteria | 1137 |
| 889 | Ga0466960_0188089 | 3300044901 | Bacteria | 1122 |
| 890 | Ga0466960_0243029 | 3300044901 | Bacteria | 997 |
| 891 | Ga0466959_0019251 | 3300045049 | Bacteria | 5019 |
| 892 | Ga0466959_0124803 | 3300045049 | Bacteria | 1828 |
| 893 | Ga0466959_0189639 | 3300045049 | Bacteria | 1435 |
| 894 | Ga0451576_0002230 | 3300045051 | Bacteria | 29806 |
| 895 | Ga0451576_0119161 | 3300045051 | Bacteria | 2748 |
| 896 | Ga0466958_0025582 | 3300045836 | Bacteria | 3481 |
| 897 | Ga0466958_0050689 | 3300045836 | Bacteria | 2513 |
| 898 | Ga0466958_0055151 | 3300045836 | Bacteria | 2411 |
| 899 | Ga0466958_0058272 | 3300045836 | Bacteria | 2348 |
| 900 | Ga0466958_0129204 | 3300045836 | Bacteria | 1586 |
| 901 | Ga0466967_0000342 | 3300045976 | Bacteria | 21461 |
| 902 | Ga0466967_0004421 | 3300045976 | Bacteria | 9471 |
| 903 | Ga0466967_0015132 | 3300045976 | Bacteria | 6039 |
| 904 | Ga0466967_0032623 | 3300045976 | Bacteria | 4399 |
| 905 | Ga0466967_0035022 | 3300045976 | Bacteria | 4268 |
| 906 | Ga0466967_0041283 | 3300045976 | Bacteria | 3977 |
| 907 | Ga0466967_0125829 | 3300045976 | Bacteria | 2374 |
| 908 | Ga0466967_0142555 | 3300045976 | Bacteria | 2233 |
| 909 | Ga0466967_0189077 | 3300045976 | Bacteria | 1945 |
| 910 | Ga0466967_0258272 | 3300045976 | Bacteria | 1666 |
| 911 | Ga0466967_0829156 | 3300045976 | Bacteria | 919 |
| 912 | Ga0466967_1047879 | 3300045976 | Bacteria | 812 |
| 913 | Ga0495592_0001038 | 3300046454 | Bacteria | 19287 |
| 914 | Ga0495592_0031728 | 3300046454 | Bacteria | 3991 |
| 915 | Ga0495592_0050439 | 3300046454 | Bacteria | 3092 |
| 916 | Ga0495592_0078980 | 3300046454 | Bacteria | 2382 |
| 917 | Ga0495592_0107092 | 3300046454 | Bacteria | 1983 |
| 918 | Ga0495592_0239903 | 3300046454 | Bacteria | 1203 |
| 919 | Ga0495592_0326828 | 3300046454 | Bacteria | 989 |
| 920 | Ga0495603_0167973 | 3300046455 | Bacteria | 1271 |
| 921 | Ga0495629_0007551 | 3300046459 | Bacteria | 8011 |
| 922 | Ga0495629_0010631 | 3300046459 | Bacteria | 6695 |
| 923 | Ga0495629_0013423 | 3300046459 | Bacteria | 5909 |
| 924 | Ga0495629_0048167 | 3300046459 | Bacteria | 2988 |
| 925 | Ga0495629_0062962 | 3300046459 | Bacteria | 2590 |
| 926 | Ga0495629_0152261 | 3300046459 | Bacteria | 1607 |
| 927 | Ga0495629_0163137 | 3300046459 | Bacteria | 1548 |
| 928 | Ga0495641_0001864 | 3300046461 | Bacteria | 17302 |
| 929 | Ga0495641_0013724 | 3300046461 | Bacteria | 4429 |
| 930 | Ga0495641_0061386 | 3300046461 | Bacteria | 1696 |
| 931 | Ga0495641_0106769 | 3300046461 | Bacteria | 1249 |
| 932 | Ga0495651_0000007 | 3300046462 | Bacteria | 158577 |
| 933 | Ga0495651_0004624 | 3300046462 | Bacteria | 10524 |
| 934 | Ga0495651_0007200 | 3300046462 | Bacteria | 8508 |
| 935 | Ga0495651_0017643 | 3300046462 | Bacteria | 5523 |
| 936 | Ga0495651_0028199 | 3300046462 | Bacteria | 4375 |
| 937 | Ga0495651_0035062 | 3300046462 | Bacteria | 3908 |
| 938 | Ga0495651_0055772 | 3300046462 | Bacteria | 3035 |
| 939 | Ga0495651_0100495 | 3300046462 | Bacteria | 2154 |
| 940 | Ga0495651_0130321 | 3300046462 | Bacteria | 1836 |
| 941 | Ga0495653_0002903 | 3300046463 | Bacteria | 13704 |
| 942 | Ga0495653_0005400 | 3300046463 | Bacteria | 10403 |
| 943 | Ga0495653_0044104 | 3300046463 | Bacteria | 3462 |
| 944 | Ga0495653_0058305 | 3300046463 | Bacteria | 2935 |
| 945 | Ga0495653_0071329 | 3300046463 | Bacteria | 2597 |
| 946 | Ga0495653_0099008 | 3300046463 | Bacteria | 2116 |
| 947 | Ga0495653_0107923 | 3300046463 | Bacteria | 2005 |
| 948 | Ga0495653_0126719 | 3300046463 | Bacteria | 1812 |
| 949 | Ga0495653_0182106 | 3300046463 | Bacteria | 1441 |
| 950 | Ga0495653_0199359 | 3300046463 | Bacteria | 1359 |
| 951 | Ga0495580_0004371 | 3300046472 | Bacteria | 11866 |
| 952 | Ga0495580_0016668 | 3300046472 | Bacteria | 5514 |
| 953 | Ga0495580_0036169 | 3300046472 | Bacteria | 3546 |
| 954 | Ga0495580_0112747 | 3300046472 | Bacteria | 1888 |
| 955 | Ga0495580_0171263 | 3300046472 | Bacteria | 1501 |
| 956 | Ga0495582_0001211 | 3300046473 | Bacteria | 14514 |
| 957 | Ga0495582_0008405 | 3300046473 | Bacteria | 5695 |
| 958 | Ga0495582_0035034 | 3300046473 | Bacteria | 2759 |
| 959 | Ga0495582_0089844 | 3300046473 | Bacteria | 1712 |
| 960 | Ga0495639_0001832 | 3300046475 | Bacteria | 9421 |
| 961 | Ga0495639_0021230 | 3300046475 | Bacteria | 2841 |
| 962 | Ga0495639_0021980 | 3300046475 | Bacteria | 2796 |
| 963 | Ga0495639_0093254 | 3300046475 | Bacteria | 1415 |
| 964 | Ga0495662_0001706 | 3300046476 | Bacteria | 10980 |
| 965 | Ga0495662_0005333 | 3300046476 | Bacteria | 6440 |
| 966 | Ga0495662_0019268 | 3300046476 | Bacteria | 3299 |
| 967 | Ga0495662_0056962 | 3300046476 | Bacteria | 1887 |
| 968 | Ga0495662_0071230 | 3300046476 | Bacteria | 1684 |
| 969 | Ga0495662_0190035 | 3300046476 | Bacteria | 1012 |
| 970 | Ga0495664_0015997 | 3300046477 | Bacteria | 4271 |
| 971 | Ga0495664_0017591 | 3300046477 | Bacteria | 4089 |
| 972 | Ga0495664_0023104 | 3300046477 | Bacteria | 3606 |
| 973 | Ga0495664_0023548 | 3300046477 | Bacteria | 3574 |
| 974 | Ga0495664_0085245 | 3300046477 | Bacteria | 1896 |
| 975 | Ga0495664_0088493 | 3300046477 | Bacteria | 1861 |
| 976 | Ga0495664_0182922 | 3300046477 | Bacteria | 1270 |
| 977 | Ga0495594_0055096 | 3300046499 | Bacteria | 2192 |
| 978 | Ga0495594_0131569 | 3300046499 | Bacteria | 1417 |
| 979 | Ga0495594_0176015 | 3300046499 | Bacteria | 1217 |
| 980 | Ga0495608_0000015 | 3300046511 | Bacteria | 200266 |
| 981 | Ga0495608_0003113 | 3300046511 | Bacteria | 11853 |
| 982 | Ga0495608_0023384 | 3300046511 | Bacteria | 4235 |
| 983 | Ga0495608_0035583 | 3300046511 | Bacteria | 3357 |
| 984 | Ga0495608_0042228 | 3300046511 | Bacteria | 3049 |
| 985 | Ga0495608_0173290 | 3300046511 | Bacteria | 1367 |
| 986 | Ga0495610_0046672 | 3300046512 | Bacteria | 2136 |
| 987 | Ga0495618_0010247 | 3300046514 | Bacteria | 5670 |
| 988 | Ga0495618_0018166 | 3300046514 | Bacteria | 4317 |
| 989 | Ga0495618_0032650 | 3300046514 | Bacteria | 3260 |
| 990 | Ga0495618_0033505 | 3300046514 | Bacteria | 3220 |
| 991 | Ga0495618_0046890 | 3300046514 | Bacteria | 2727 |
| 992 | Ga0495618_0226819 | 3300046514 | Bacteria | 1177 |
| 993 | Ga0495618_0259084 | 3300046514 | Bacteria | 1089 |
| 994 | Ga0495620_0033763 | 3300046515 | Bacteria | 2319 |
| 995 | Ga0495628_0000737 | 3300046516 | Bacteria | 30357 |
| 996 | Ga0495628_0020395 | 3300046516 | Bacteria | 5467 |
| 997 | Ga0495628_0093629 | 3300046516 | Bacteria | 2324 |
| 998 | Ga0495628_0108065 | 3300046516 | Bacteria | 2141 |
| 999 | Ga0495628_0109645 | 3300046516 | Bacteria | 2124 |
| 1000 | Ga0495628_0225522 | 3300046516 | Bacteria | 1406 |
| 1001 | Ga0495630_0014740 | 3300046517 | Bacteria | 5699 |
| 1002 | Ga0495630_0016397 | 3300046517 | Bacteria | 5412 |
| 1003 | Ga0495630_0055377 | 3300046517 | Bacteria | 2972 |
| 1004 | Ga0495630_0073436 | 3300046517 | Bacteria | 2576 |
| 1005 | Ga0495630_0101875 | 3300046517 | Bacteria | 2172 |
| 1006 | Ga0495630_0143227 | 3300046517 | Bacteria | 1817 |
| 1007 | Ga0495630_0186032 | 3300046517 | Bacteria | 1584 |
| 1008 | Ga0495631_0025563 | 3300046518 | Bacteria | 2718 |
| 1009 | Ga0495643_0049805 | 3300046522 | Bacteria | 2258 |
| 1010 | Ga0495666_0047449 | 3300046526 | Bacteria | 2068 |
| 1011 | Ga0495642_0050632 | 3300046528 | Bacteria | 1708 |
| 1012 | Ga0495652_0000074 | 3300046529 | Bacteria | 105662 |
| 1013 | Ga0495652_0040395 | 3300046529 | Bacteria | 4032 |
| 1014 | Ga0495652_0059276 | 3300046529 | Bacteria | 3239 |
| 1015 | Ga0495665_0000709 | 3300046531 | Bacteria | 17165 |
| 1016 | Ga0495665_0012143 | 3300046531 | Bacteria | 4663 |
| 1017 | Ga0495665_0013704 | 3300046531 | Bacteria | 4379 |
| 1018 | Ga0495665_0028260 | 3300046531 | Bacteria | 3007 |
| 1019 | Ga0495665_0063921 | 3300046531 | Bacteria | 1942 |
| 1020 | Ga0495665_0074025 | 3300046531 | Bacteria | 1793 |
| 1021 | Ga0495665_0272085 | 3300046531 | Bacteria | 870 |
| 1022 | Ga0495640_0017253 | 3300046533 | Bacteria | 5383 |
| 1023 | Ga0495640_0036412 | 3300046533 | Bacteria | 3477 |
| 1024 | Ga0495640_0040539 | 3300046533 | Bacteria | 3260 |
| 1025 | Ga0495640_0051504 | 3300046533 | Bacteria | 2830 |
| 1026 | Ga0495640_0208143 | 3300046533 | Bacteria | 1237 |
| 1027 | Ga0495640_0230679 | 3300046533 | Bacteria | 1164 |
| 1028 | Ga0495586_0015922 | 3300046535 | Bacteria | 4001 |
| 1029 | Ga0495586_0019276 | 3300046535 | Bacteria | 3628 |
| 1030 | Ga0495586_0025942 | 3300046535 | Bacteria | 3135 |
| 1031 | Ga0495586_0043843 | 3300046535 | Bacteria | 2409 |
| 1032 | Ga0495586_0051127 | 3300046535 | Bacteria | 2236 |
| 1033 | Ga0495586_0095013 | 3300046535 | Bacteria | 1649 |
| 1034 | Ga0495586_0153479 | 3300046535 | Bacteria | 1296 |
| 1035 | Ga0495586_0156678 | 3300046535 | Bacteria | 1283 |
| 1036 | Ga0495587_0001582 | 3300046536 | Bacteria | 15162 |
| 1037 | Ga0495587_0002197 | 3300046536 | Bacteria | 13041 |
| 1038 | Ga0495587_0006439 | 3300046536 | Bacteria | 7654 |
| 1039 | Ga0495587_0025644 | 3300046536 | Bacteria | 3601 |
| 1040 | Ga0495587_0027425 | 3300046536 | Bacteria | 3468 |
| 1041 | Ga0495587_0086010 | 3300046536 | Bacteria | 1820 |
| 1042 | Ga0495587_0097585 | 3300046536 | Bacteria | 1694 |
| 1043 | Ga0495645_0014511 | 3300046543 | Bacteria | 5592 |
| 1044 | Ga0495645_0028722 | 3300046543 | Bacteria | 4042 |
| 1045 | Ga0495645_0035518 | 3300046543 | Bacteria | 3633 |
| 1046 | Ga0495645_0053202 | 3300046543 | Bacteria | 2943 |
| 1047 | Ga0495645_0055341 | 3300046543 | Bacteria | 2880 |
| 1048 | Ga0495645_0331087 | 3300046543 | Bacteria | 986 |
| 1049 | Ga0495667_0000033 | 3300046559 | Bacteria | 143083 |
| 1050 | Ga0495667_0003838 | 3300046559 | Bacteria | 10093 |
| 1051 | Ga0495667_0006453 | 3300046559 | Bacteria | 7962 |
| 1052 | Ga0495667_0015200 | 3300046559 | Bacteria | 5196 |
| 1053 | Ga0495667_0026409 | 3300046559 | Bacteria | 3913 |
| 1054 | Ga0495667_0050559 | 3300046559 | Bacteria | 2743 |
| 1055 | Ga0495667_0054161 | 3300046559 | Bacteria | 2640 |
| 1056 | Ga0495667_0063129 | 3300046559 | Bacteria | 2425 |
| 1057 | Ga0495667_0173149 | 3300046559 | Bacteria | 1386 |
| 1058 | Ga0495667_0202688 | 3300046559 | Bacteria | 1269 |
| 1059 | Ga0495667_0233168 | 3300046559 | Bacteria | 1173 |
| 1060 | Ga0495667_0371471 | 3300046559 | Bacteria | 902 |
| 1061 | Ga0495656_0043226 | 3300046615 | Bacteria | 1891 |
| 1062 | Ga0495634_0004914 | 3300046642 | Bacteria | 10344 |
| 1063 | Ga0495634_0006863 | 3300046642 | Bacteria | 8611 |
| 1064 | Ga0495634_0052289 | 3300046642 | Bacteria | 2738 |
| 1065 | Ga0495634_0057233 | 3300046642 | Bacteria | 2603 |
| 1066 | Ga0495634_0062630 | 3300046642 | Bacteria | 2469 |
| 1067 | Ga0495635_0001151 | 3300046663 | Bacteria | 17639 |
| 1068 | Ga0495635_0003052 | 3300046663 | Bacteria | 11507 |
| 1069 | Ga0495635_0010933 | 3300046663 | Bacteria | 6364 |
| 1070 | Ga0495635_0025589 | 3300046663 | Bacteria | 4111 |
| 1071 | Ga0495635_0043517 | 3300046663 | Bacteria | 3099 |
| 1072 | Ga0495635_0153485 | 3300046663 | Bacteria | 1568 |
| 1073 | Ga0495635_0229102 | 3300046663 | Bacteria | 1255 |
| 1074 | Ga0495659_0009118 | 3300046664 | Bacteria | 3164 |
| 1075 | Ga0495588_0009692 | 3300046674 | Bacteria | 4463 |
| 1076 | Ga0495588_0036359 | 3300046674 | Bacteria | 2498 |
| 1077 | Ga0495588_0049669 | 3300046674 | Bacteria | 2157 |
| 1078 | Ga0495657_0001345 | 3300046675 | Bacteria | 21381 |
| 1079 | Ga0495657_0013216 | 3300046675 | Bacteria | 6098 |
| 1080 | Ga0495657_0015858 | 3300046675 | Bacteria | 5502 |
| 1081 | Ga0495657_0020960 | 3300046675 | Bacteria | 4696 |
| 1082 | Ga0495657_0022556 | 3300046675 | Bacteria | 4507 |
| 1083 | Ga0495657_0032716 | 3300046675 | Bacteria | 3627 |
| 1084 | Ga0495657_0047774 | 3300046675 | Bacteria | 2891 |
| 1085 | Ga0495657_0109004 | 3300046675 | Bacteria | 1756 |
| 1086 | Ga0495599_0000018 | 3300046678 | Bacteria | 144334 |
| 1087 | Ga0495599_0008300 | 3300046678 | Bacteria | 6317 |
| 1088 | Ga0495599_0030869 | 3300046678 | Bacteria | 3364 |
| 1089 | Ga0495599_0058667 | 3300046678 | Bacteria | 2407 |
| 1090 | Ga0495599_0069816 | 3300046678 | Bacteria | 2192 |
| 1091 | Ga0495599_0110027 | 3300046678 | Bacteria | 1716 |
| 1092 | Ga0495599_0190784 | 3300046678 | Bacteria | 1261 |
| 1093 | Ga0495623_0000075 | 3300046679 | Bacteria | 59383 |
| 1094 | Ga0495623_0012733 | 3300046679 | Bacteria | 5447 |
| 1095 | Ga0495623_0040315 | 3300046679 | Bacteria | 2982 |
| 1096 | Ga0495623_0050129 | 3300046679 | Bacteria | 2645 |
| 1097 | Ga0495623_0099298 | 3300046679 | Bacteria | 1775 |
| 1098 | Ga0495623_0171860 | 3300046679 | Bacteria | 1265 |
| 1099 | Ga0495646_0005199 | 3300046680 | Bacteria | 8208 |
| 1100 | Ga0495646_0058945 | 3300046680 | Bacteria | 2294 |
| 1101 | Ga0495646_0090788 | 3300046680 | Bacteria | 1764 |
| 1102 | Ga0495646_0114864 | 3300046680 | Bacteria | 1529 |
| 1103 | Ga0495646_0142086 | 3300046680 | Bacteria | 1341 |
| 1104 | Ga0495658_0007844 | 3300046683 | Bacteria | 5286 |
| 1105 | Ga0495658_0031150 | 3300046683 | Bacteria | 2902 |
| 1106 | Ga0495613_0006775 | 3300046689 | Bacteria | 8552 |
| 1107 | Ga0495613_0033390 | 3300046689 | Bacteria | 3824 |
| 1108 | Ga0495613_0054248 | 3300046689 | Bacteria | 2947 |
| 1109 | Ga0495613_0132890 | 3300046689 | Bacteria | 1781 |
| 1110 | Ga0495613_0179312 | 3300046689 | Bacteria | 1500 |
| 1111 | Ga0495613_0239717 | 3300046689 | Bacteria | 1268 |
| 1112 | Ga0495624_0009190 | 3300046690 | Bacteria | 6853 |
| 1113 | Ga0495624_0095250 | 3300046690 | Bacteria | 1835 |
| 1114 | Ga0495624_0109554 | 3300046690 | Bacteria | 1698 |
| 1115 | Ga0495624_0122669 | 3300046690 | Bacteria | 1595 |
| 1116 | Ga0495624_0185385 | 3300046690 | Bacteria | 1267 |
| 1117 | Ga0495600_0007035 | 3300046809 | Bacteria | 6873 |
| 1118 | Ga0495600_0008415 | 3300046809 | Bacteria | 6334 |
| 1119 | Ga0495600_0010982 | 3300046809 | Bacteria | 5635 |
| 1120 | Ga0495600_0015979 | 3300046809 | Bacteria | 4757 |
| 1121 | Ga0495600_0101597 | 3300046809 | Bacteria | 1874 |
| 1122 | Ga0495600_0131703 | 3300046809 | Bacteria | 1625 |
| 1123 | Ga0495600_0148859 | 3300046809 | Bacteria | 1516 |
| 1124 | Ga0495600_0180257 | 3300046809 | Bacteria | 1361 |
| 1125 | Ga0495581_0006935 | 3300047315 | Bacteria | 6562 |
| 1126 | Ga0495581_0008284 | 3300047315 | Bacteria | 6027 |
| 1127 | Ga0495581_0010908 | 3300047315 | Bacteria | 5253 |
| 1128 | Ga0495581_0016572 | 3300047315 | Bacteria | 4282 |
| 1129 | Ga0495581_0021236 | 3300047315 | Bacteria | 3765 |
| 1130 | Ga0495581_0042980 | 3300047315 | Bacteria | 2614 |
| 1131 | Ga0495581_0059559 | 3300047315 | Bacteria | 2206 |
| 1132 | Ga0495604_0000025 | 3300047317 | Bacteria | 145481 |
| 1133 | Ga0495604_0017705 | 3300047317 | Bacteria | 5702 |
| 1134 | Ga0495604_0024002 | 3300047317 | Bacteria | 4868 |
| 1135 | Ga0495604_0032506 | 3300047317 | Bacteria | 4134 |
| 1136 | Ga0495604_0042546 | 3300047317 | Bacteria | 3559 |
| 1137 | Ga0495604_0057467 | 3300047317 | Bacteria | 2991 |
| 1138 | Ga0495604_0211629 | 3300047317 | Bacteria | 1339 |
| 1139 | Ga0495636_0033001 | 3300047318 | Bacteria | 2125 |
| 1140 | Ga0495674_0005960 | 3300047319 | Bacteria | 11689 |
| 1141 | Ga0495674_0013242 | 3300047319 | Bacteria | 7754 |
| 1142 | Ga0495674_0023719 | 3300047319 | Bacteria | 5650 |
| 1143 | Ga0495674_0034845 | 3300047319 | Bacteria | 4547 |
| 1144 | Ga0495674_0054121 | 3300047319 | Bacteria | 3525 |
| 1145 | Ga0495674_0064350 | 3300047319 | Bacteria | 3188 |
| 1146 | Ga0495672_0100302 | 3300047320 | Bacteria | 1572 |
| 1147 | Ga0495676_0006692 | 3300047321 | Bacteria | 10614 |
| 1148 | Ga0495676_0045371 | 3300047321 | Bacteria | 3578 |
| 1149 | Ga0495676_0051299 | 3300047321 | Bacteria | 3302 |
| 1150 | Ga0495680_0000015 | 3300047322 | Bacteria | 131335 |
| 1151 | Ga0495680_0003725 | 3300047322 | Bacteria | 14867 |
| 1152 | Ga0495680_0020712 | 3300047322 | Bacteria | 5523 |
| 1153 | Ga0495680_0028691 | 3300047322 | Bacteria | 4561 |
| 1154 | Ga0495680_0035526 | 3300047322 | Bacteria | 4013 |
| 1155 | Ga0495680_0053573 | 3300047322 | Bacteria | 3138 |
| 1156 | Ga0495680_0055477 | 3300047322 | Bacteria | 3073 |
| 1157 | Ga0495680_0061328 | 3300047322 | Bacteria | 2894 |
| 1158 | Ga0495680_0091614 | 3300047322 | Bacteria | 2278 |
| 1159 | Ga0495680_0116839 | 3300047322 | Bacteria | 1972 |
| 1160 | Ga0495680_0121746 | 3300047322 | Bacteria | 1925 |
| 1161 | Ga0495680_0142002 | 3300047322 | Bacteria | 1756 |
| 1162 | Ga0495675_0006002 | 3300047444 | Bacteria | 7427 |
| 1163 | Ga0495675_0014139 | 3300047444 | Bacteria | 5046 |
| 1164 | Ga0495675_0064853 | 3300047444 | Bacteria | 2310 |
| 1165 | Ga0495675_0090742 | 3300047444 | Bacteria | 1918 |
| 1166 | Ga0495675_0142855 | 3300047444 | Bacteria | 1482 |
| 1167 | Ga0495675_0166250 | 3300047444 | Bacteria | 1356 |
| 1168 | Ga0495685_074299 | 3300047447 | Bacteria | 1136 |
| 1169 | Ga0495681_0054340 | 3300047470 | Bacteria | 1871 |
| 1170 | Ga0495684_0004360 | 3300047471 | Bacteria | 11053 |
| 1171 | Ga0495684_0012033 | 3300047471 | Bacteria | 6672 |
| 1172 | Ga0495684_0023488 | 3300047471 | Bacteria | 4740 |
| 1173 | Ga0495684_0027914 | 3300047471 | Bacteria | 4335 |
| 1174 | Ga0495684_0116879 | 3300047471 | Bacteria | 2010 |
| 1175 | Ga0495684_0125141 | 3300047471 | Bacteria | 1934 |
| 1176 | Ga0495684_0156418 | 3300047471 | Bacteria | 1702 |
| 1177 | Ga0495684_0217165 | 3300047471 | Bacteria | 1403 |
| 1178 | Ga0495593_0002727 | 3300047673 | Bacteria | 10626 |
| 1179 | Ga0495593_0005255 | 3300047673 | Bacteria | 7653 |
| 1180 | Ga0495593_0018131 | 3300047673 | Bacteria | 3958 |
| 1181 | Ga0495593_0020226 | 3300047673 | Bacteria | 3728 |
| 1182 | Ga0495593_0073721 | 3300047673 | Bacteria | 1770 |
| 1183 | Ga0495593_0081178 | 3300047673 | Bacteria | 1677 |
| 1184 | Ga0495602_0000065 | 3300048088 | Bacteria | 104080 |
| 1185 | Ga0495602_0015962 | 3300048088 | Bacteria | 7560 |
| 1186 | Ga0495602_0028880 | 3300048088 | Bacteria | 5299 |
| 1187 | Ga0495602_0035415 | 3300048088 | Bacteria | 4654 |
| 1188 | Ga0495602_0046172 | 3300048088 | Bacteria | 3936 |
| 1189 | Ga0495602_0054069 | 3300048088 | Bacteria | 3548 |
| 1190 | Ga0495602_0071309 | 3300048088 | Bacteria | 2967 |
| 1191 | Ga0495602_0433737 | 3300048088 | Bacteria | 930 |
| 1192 | Ga0495614_0028717 | 3300048089 | Bacteria | 2394 |
| 1193 | Ga0495614_0028970 | 3300048089 | Bacteria | 2384 |
| 1194 | Ga0495614_0137722 | 3300048089 | Bacteria | 1083 |
| 1195 | Ga0496100_0102894 | 3300048903 | Bacteria | 1971 |
| 1196 | Ga0496100_0165139 | 3300048903 | Bacteria | 1590 |
| 1197 | Ga0496100_0205013 | 3300048903 | Bacteria | 1439 |
| 1198 | Ga0496101_0022411 | 3300048904 | Bacteria | 4348 |
| 1199 | Ga0496101_0224310 | 3300048904 | Bacteria | 1459 |
| 1200 | Ga0496102_0001147 | 3300048905 | Bacteria | 24210 |
| 1201 | Ga0496102_0007743 | 3300048905 | Bacteria | 9179 |
| 1202 | Ga0496102_0008038 | 3300048905 | Bacteria | 9020 |
| 1203 | Ga0496102_0016570 | 3300048905 | Bacteria | 6441 |
| 1204 | Ga0496102_0050376 | 3300048905 | Bacteria | 3791 |
| 1205 | Ga0496102_0088675 | 3300048905 | Bacteria | 2860 |
| 1206 | Ga0496102_0115613 | 3300048905 | Bacteria | 2503 |
| 1207 | Ga0496102_0117750 | 3300048905 | Bacteria | 2479 |
| 1208 | Ga0496102_0135005 | 3300048905 | Bacteria | 2312 |
| 1209 | Ga0496102_0166647 | 3300048905 | Bacteria | 2073 |
| 1210 | Ga0496102_0175818 | 3300048905 | Bacteria | 2016 |
| 1211 | Ga0496102_0183895 | 3300048905 | Bacteria | 1969 |
| 1212 | Ga0496102_0799468 | 3300048905 | Bacteria | 865 |
| 1213 | Ga0496103_0004543 | 3300048906 | Bacteria | 8399 |
| 1214 | Ga0496103_0009868 | 3300048906 | Bacteria | 5652 |
| 1215 | Ga0496103_0015951 | 3300048906 | Bacteria | 4480 |
| 1216 | Ga0496103_0047618 | 3300048906 | Bacteria | 2649 |
| 1217 | Ga0496103_0070346 | 3300048906 | Bacteria | 2189 |
| 1218 | Ga0496103_0079015 | 3300048906 | Bacteria | 2067 |
| 1219 | Ga0496103_0093138 | 3300048906 | Bacteria | 1902 |
| 1220 | Ga0496103_0138626 | 3300048906 | Bacteria | 1555 |
| 1221 | Ga0496103_0343089 | 3300048906 | Bacteria | 960 |
| 1222 | Ga0496104_0011195 | 3300048907 | Bacteria | 8027 |
| 1223 | Ga0496104_0012344 | 3300048907 | Bacteria | 7679 |
| 1224 | Ga0496104_0013954 | 3300048907 | Bacteria | 7247 |
| 1225 | Ga0496104_0021920 | 3300048907 | Bacteria | 5867 |
| 1226 | Ga0496104_0036361 | 3300048907 | Bacteria | 4603 |
| 1227 | Ga0496104_0037130 | 3300048907 | Bacteria | 4556 |
| 1228 | Ga0496104_0139773 | 3300048907 | Bacteria | 2327 |
| 1229 | Ga0496104_0188275 | 3300048907 | Bacteria | 1975 |
| 1230 | Ga0496104_0540981 | 3300048907 | Bacteria | 1075 |
| 1231 | Ga0496104_0685495 | 3300048907 | Bacteria | 933 |
| 1232 | Ga0496104_0704538 | 3300048907 | Bacteria | 917 |
| 1233 | Ga0496105_0007335 | 3300048908 | Bacteria | 8522 |
| 1234 | Ga0496105_0027946 | 3300048908 | Bacteria | 4613 |
| 1235 | Ga0496105_0031980 | 3300048908 | Bacteria | 4315 |
| 1236 | Ga0496105_0136872 | 3300048908 | Bacteria | 2017 |
| 1237 | Ga0496105_0180562 | 3300048908 | Bacteria | 1728 |
| 1238 | Ga0496105_0275585 | 3300048908 | Bacteria | 1358 |
| 1239 | Ga0496105_0319177 | 3300048908 | Bacteria | 1245 |
| 1240 | Ga0496105_0340263 | 3300048908 | Bacteria | 1200 |
| 1241 | Ga0496105_0367523 | 3300048908 | Bacteria | 1146 |
| 1242 | Ga0496105_0465627 | 3300048908 | Bacteria | 996 |
| 1243 | Ga0496106_0030607 | 3300048909 | Bacteria | 4012 |
| 1244 | Ga0496106_0081020 | 3300048909 | Bacteria | 2493 |
| 1245 | Ga0496106_0082451 | 3300048909 | Bacteria | 2472 |
| 1246 | Ga0496106_0134664 | 3300048909 | Bacteria | 1939 |
| 1247 | Ga0496106_0213648 | 3300048909 | Bacteria | 1537 |
| 1248 | Ga0496107_0031342 | 3300048910 | Bacteria | 3793 |
| 1249 | Ga0496107_0072462 | 3300048910 | Bacteria | 2504 |
| 1250 | Ga0496107_0092545 | 3300048910 | Bacteria | 2210 |
| 1251 | Ga0496108_0003156 | 3300048911 | Bacteria | 13260 |
| 1252 | Ga0496108_0014407 | 3300048911 | Bacteria | 6455 |
| 1253 | Ga0496108_0018270 | 3300048911 | Bacteria | 5741 |
| 1254 | Ga0496108_0025779 | 3300048911 | Bacteria | 4848 |
| 1255 | Ga0496108_0214097 | 3300048911 | Bacteria | 1673 |
| 1256 | Ga0496108_0668302 | 3300048911 | Bacteria | 902 |
| 1257 | Ga0496109_0005308 | 3300048912 | Bacteria | 10767 |
| 1258 | Ga0496109_0038020 | 3300048912 | Bacteria | 4350 |
| 1259 | Ga0496109_0165228 | 3300048912 | Bacteria | 2075 |
| 1260 | Ga0496109_0193317 | 3300048912 | Bacteria | 1912 |
| 1261 | Ga0496109_0367757 | 3300048912 | Bacteria | 1358 |
| 1262 | Ga0496109_0465062 | 3300048912 | Bacteria | 1194 |
| 1263 | Ga0496110_0005523 | 3300048913 | Bacteria | 9924 |
| 1264 | Ga0496110_0010037 | 3300048913 | Bacteria | 7684 |
| 1265 | Ga0496110_0011132 | 3300048913 | Bacteria | 7348 |
| 1266 | Ga0496110_0057940 | 3300048913 | Bacteria | 3411 |
| 1267 | Ga0496110_0123817 | 3300048913 | Bacteria | 2331 |
| 1268 | Ga0496110_0181973 | 3300048913 | Bacteria | 1908 |
| 1269 | Ga0496110_0274224 | 3300048913 | Bacteria | 1536 |
| 1270 | Ga0496110_0371266 | 3300048913 | Bacteria | 1303 |
| 1271 | Ga0496111_0003277 | 3300048914 | Bacteria | 9999 |
| 1272 | Ga0496111_0046277 | 3300048914 | Bacteria | 3132 |
| 1273 | Ga0496111_0059149 | 3300048914 | Bacteria | 2776 |
| 1274 | Ga0496111_0073915 | 3300048914 | Bacteria | 2482 |
| 1275 | Ga0496112_0004018 | 3300048915 | Bacteria | 12333 |
| 1276 | Ga0496112_0072079 | 3300048915 | Bacteria | 3414 |
| 1277 | Ga0496112_0082862 | 3300048915 | Bacteria | 3171 |
| 1278 | Ga0496112_0278771 | 3300048915 | Bacteria | 1619 |
| 1279 | Ga0496112_0405126 | 3300048915 | Bacteria | 1303 |
| 1280 | Ga0496113_0125781 | 3300048916 | Bacteria | 2007 |
| 1281 | Ga0496113_0175342 | 3300048916 | Bacteria | 1699 |
| 1282 | Ga0496113_0181358 | 3300048916 | Bacteria | 1669 |
| 1283 | Ga0496113_0274747 | 3300048916 | Bacteria | 1347 |
| 1284 | Ga0496114_0006337 | 3300048917 | Bacteria | 9309 |
| 1285 | Ga0496114_0009161 | 3300048917 | Bacteria | 7848 |
| 1286 | Ga0496114_0010117 | 3300048917 | Bacteria | 7503 |
| 1287 | Ga0496114_0296046 | 3300048917 | Bacteria | 1428 |
| 1288 | Ga0496114_0353241 | 3300048917 | Bacteria | 1300 |
| 1289 | Ga0496114_0476973 | 3300048917 | Bacteria | 1104 |
| 1290 | Ga0496114_0674913 | 3300048917 | Bacteria | 907 |
| 1291 | Ga0496115_0109707 | 3300048918 | Bacteria | 2266 |
| 1292 | Ga0496115_0114134 | 3300048918 | Bacteria | 2220 |
| 1293 | Ga0496115_0194781 | 3300048918 | Bacteria | 1674 |
| 1294 | Ga0496117_0130060 | 3300048920 | Bacteria | 1528 |
| 1295 | Ga0496119_0039030 | 3300048922 | Bacteria | 3057 |
| 1296 | Ga0496124_0075900 | 3300048927 | Bacteria | 2776 |
| 1297 | Ga0496124_0195148 | 3300048927 | Bacteria | 1545 |
| 1298 | Ga0496125_0140995 | 3300048928 | Bacteria | 1676 |
| 1299 | Ga0496126_0007772 | 3300048929 | Bacteria | 11685 |
| 1300 | Ga0496126_0124145 | 3300048929 | Bacteria | 2236 |
| 1301 | Ga0496126_0319714 | 3300048929 | Bacteria | 1276 |
| 1302 | Ga0501031_0053545 | 3300049568 | Bacteria | 2630 |
| 1303 | Ga0501034_0028563 | 3300049571 | Bacteria | 5677 |
| 1304 | Ga0501034_0388411 | 3300049571 | Bacteria | 1320 |
| 1305 | Ga0501036_0006249 | 3300049572 | Bacteria | 9662 |
| 1306 | Ga0501037_0035170 | 3300049573 | Bacteria | 3695 |
| 1307 | Ga0501037_0046940 | 3300049573 | Bacteria | 3166 |
| 1308 | Ga0501038_0001144 | 3300049574 | Bacteria | 24032 |
| 1309 | Ga0501038_0101197 | 3300049574 | Bacteria | 2399 |
| 1310 | Ga0501039_0073454 | 3300049575 | Bacteria | 2657 |
| 1311 | Ga0501039_0093563 | 3300049575 | Bacteria | 2343 |
| 1312 | Ga0501040_0005550 | 3300049576 | Bacteria | 8167 |
| 1313 | Ga0501040_0129168 | 3300049576 | Bacteria | 1776 |
| 1314 | Ga0501041_0000946 | 3300049577 | Bacteria | 15751 |
| 1315 | Ga0501042_0006519 | 3300049578 | Bacteria | 7582 |
| 1316 | Ga0501042_0007655 | 3300049578 | Bacteria | 7089 |
| 1317 | Ga0501043_0012741 | 3300049579 | Bacteria | 6572 |
| 1318 | Ga0501043_0068779 | 3300049579 | Bacteria | 2781 |
| 1319 | Ga0501046_0011693 | 3300049580 | Bacteria | 7497 |
| 1320 | Ga0501047_0000142 | 3300049581 | Bacteria | 87761 |
| 1321 | Ga0501047_0034147 | 3300049581 | Bacteria | 4911 |
| 1322 | Ga0501047_0320376 | 3300049581 | Bacteria | 1390 |
| 1323 | Ga0501047_0368362 | 3300049581 | Bacteria | 1272 |
| 1324 | Ga0501048_0040438 | 3300049582 | Bacteria | 3341 |
| 1325 | Ga0501048_0056247 | 3300049582 | Bacteria | 2791 |
| 1326 | Ga0501067_0025344 | 3300049583 | Bacteria | 3287 |
| 1327 | Ga0501067_0049319 | 3300049583 | Bacteria | 2333 |
| 1328 | Ga0501069_0020370 | 3300049585 | Bacteria | 3593 |
| 1329 | Ga0501070_0114313 | 3300049586 | Bacteria | 2230 |
| 1330 | Ga0501071_0000522 | 3300049587 | Bacteria | 19649 |
| 1331 | Ga0501072_0007902 | 3300049588 | Bacteria | 8076 |
| 1332 | Ga0501073_0007656 | 3300049589 | Bacteria | 8017 |
| 1333 | Ga0501073_0180435 | 3300049589 | Bacteria | 1461 |
| 1334 | Ga0501074_0001769 | 3300049590 | Bacteria | 14759 |
| 1335 | Ga0501074_0012148 | 3300049590 | Bacteria | 6261 |
| 1336 | Ga0501075_0052999 | 3300049591 | Bacteria | 3050 |
| 1337 | Ga0501075_0309393 | 3300049591 | Bacteria | 1204 |
| 1338 | Ga0501076_0001397 | 3300049592 | Bacteria | 16176 |
| 1339 | Ga0501079_0007061 | 3300049741 | Bacteria | 8474 |
| 1340 | Ga0501080_0036643 | 3300049742 | Bacteria | 4579 |
| 1341 | Ga0501081_0033385 | 3300049743 | Bacteria | 3496 |
| 1342 | Ga0501035_0073011 | 3300049822 | Bacteria | 3036 |
| 1343 | Ga0501044_0057615 | 3300049823 | Bacteria | 3987 |
| 1344 | Ga0501045_0001418 | 3300049824 | Bacteria | 15977 |
| 1345 | Ga0501045_0128299 | 3300049824 | Bacteria | 1885 |
| 1346 | Ga0501045_0143278 | 3300049824 | Bacteria | 1777 |
| 1347 | nmdc:mga0yw44_327743_c1 | 3300050492 | Bacteria | 1029 |
| 1348 | nmdc:mga0yw44_41168_c1 | 3300050492 | Bacteria | 2749 |
| 1349 | nmdc:mga06z11_15499_c1 | 3300050494 | Bacteria | 3403 |
| 1350 | nmdc:mga06z11_362014_c1 | 3300050494 | Bacteria | 869 |
| 1351 | nmdc:mga05p37_1011693_c1 | 3300050507 | Bacteria | 881 |
| 1352 | nmdc:mga05p37_11636_c1 | 3300050507 | Bacteria | 10487 |
| 1353 | nmdc:mga05p37_203002_c1 | 3300050507 | Bacteria | 2399 |
| 1354 | nmdc:mga05p37_493541_c1 | 3300050507 | Bacteria | 1407 |
| 1355 | nmdc:mga05p37_64391_c1 | 3300050507 | Bacteria | 2615 |
| 1356 | nmdc:mga05p37_815_c1 | 3300050507 | Bacteria | 34870 |
| 1357 | nmdc:mga05p37_9788_c1 | 3300050507 | Bacteria | 11374 |
| 1358 | nmdc:mga09592_108713_c1 | 3300050508 | Bacteria | 2379 |
| 1359 | nmdc:mga09592_349381_c1 | 3300050508 | Bacteria | 1280 |
| 1360 | nmdc:mga09592_96632_c1 | 3300050508 | Bacteria | 2527 |
| 1361 | nmdc:mga0qj67_148242_c1 | 3300050509 | Bacteria | 1903 |
| 1362 | nmdc:mga0qj67_341211_c1 | 3300050509 | Bacteria | 1212 |
| 1363 | nmdc:mga06r32_120339_c1 | 3300050510 | Bacteria | 2589 |
| 1364 | nmdc:mga06r32_269928_c1 | 3300050510 | Bacteria | 1689 |
| 1365 | nmdc:mga06r32_484819_c1 | 3300050510 | Bacteria | 1214 |
| 1366 | nmdc:mga06r32_555_c1 | 3300050510 | Bacteria | 32486 |
| 1367 | nmdc:mga08y16_13789_c1 | 3300050511 | Bacteria | 8506 |
| 1368 | nmdc:mga08y16_25766_c1 | 3300050511 | Bacteria | 6206 |
| 1369 | nmdc:mga08y16_2869_c1 | 3300050511 | Bacteria | 17731 |
| 1370 | nmdc:mga0n895_18318_c1 | 3300050512 | Bacteria | 6476 |
| 1371 | nmdc:mga0n895_2559_c1 | 3300050512 | Bacteria | 14261 |
| 1372 | nmdc:mga0n895_25683_c1 | 3300050512 | Bacteria | 5570 |
| 1373 | nmdc:mga0n895_9919_c1 | 3300050512 | Bacteria | 8377 |
| 1374 | nmdc:mga0rr50_218038_c1 | 3300050513 | Bacteria | 1575 |
| 1375 | nmdc:mga08x19_2217_c1 | 3300050514 | Bacteria | 11868 |
| 1376 | nmdc:mga08x19_24349_c1 | 3300050514 | Bacteria | 3761 |
| 1377 | nmdc:mga08x19_282208_c1 | 3300050514 | Bacteria | 1151 |
| 1378 | nmdc:mga08x19_461869_c1 | 3300050514 | Bacteria | 894 |
| 1379 | nmdc:mga0a205_22726_c1 | 3300050515 | Bacteria | 5945 |
| 1380 | nmdc:mga0a205_42649_c1 | 3300050515 | Bacteria | 4372 |
| 1381 | nmdc:mga0a205_51921_c1 | 3300050515 | Bacteria | 3958 |
| 1382 | nmdc:mga0a205_6990_c1 | 3300050515 | Bacteria | 10200 |
| 1383 | Ga0495601_0026743 | 3300053077 | Bacteria | 3564 |
| 1384 | Ga0495601_0064932 | 3300053077 | Bacteria | 2322 |
| 1385 | Ga0495601_0082067 | 3300053077 | Bacteria | 2069 |
| 1386 | Ga0495601_0086935 | 3300053077 | Bacteria | 2009 |
| 1387 | Ga0495601_0192021 | 3300053077 | Bacteria | 1334 |
| 1388 | Ga0495612_0000871 | 3300053078 | Bacteria | 12306 |
| 1389 | Ga0495612_0017277 | 3300053078 | Bacteria | 2890 |
| 1390 | Ga0495612_0026922 | 3300053078 | Bacteria | 2311 |
| 1391 | Ga0495612_0039608 | 3300053078 | Bacteria | 1917 |
| 1392 | Ga0495612_0049375 | 3300053078 | Bacteria | 1726 |
| 1393 | Ga0495595_0001179 | 3300053084 | Bacteria | 10154 |
| 1394 | Ga0495595_0006228 | 3300053084 | Bacteria | 4856 |
| 1395 | Ga0495595_0025853 | 3300053084 | Bacteria | 2604 |
| 1396 | Ga0495595_0051393 | 3300053084 | Bacteria | 1910 |
| 1397 | Ga0495595_0190837 | 3300053084 | Bacteria | 1018 |
| 1398 | Ga0495619_0039553 | 3300053085 | Bacteria | 3079 |
| 1399 | Ga0495619_0084061 | 3300053085 | Bacteria | 2147 |
| 1400 | Ga0495619_0231472 | 3300053085 | Bacteria | 1280 |
| 1401 | Ga0501084_0003958 | 3300054114 | Bacteria | 12064 |
| 1402 | Ga0590075_021409 | 3300059424 | Bacteria | 1613 |
| 1403 | Ga0501082_0003209 | 3300060353 | Bacteria | 14258 |
| 1404 | Ga0501082_0057334 | 3300060353 | Bacteria | 3356 |
| 1405 | Ga0466962_0022908 | 3300061719 | Bacteria | 3001 |
| 1406 | Ga0466962_0025908 | 3300061719 | Bacteria | 2815 |
| 1407 | Ga0466962_0063119 | 3300061719 | Bacteria | 1769 |
| 1408 | Ga0466962_0153770 | 3300061719 | Bacteria | 1116 |
| 1409 | Ga0530510_0018420 | 3300061734 | Bacteria | 4950 |
| 1410 | Ga0530510_0069360 | 3300061734 | Bacteria | 2558 |
| 1411 | Ga0530510_0256115 | 3300061734 | Bacteria | 1304 |
| 1412 | 2537897869 | 2537561592 | Bacteria | 4348607 |
| 1413 | 2644526702 | 2643221694 | Bacteria | 4392972 |
| 1414 | 2644611205 | 2643221711 | Bacteria | 4865335 |
| 1415 | 2644670556 | 2643221722 | Bacteria | 4247614 |
| 1416 | 2676495084 | 2675903060 | Bacteria | 10051191 |
| 1417 | 2768646664 | 2767802112 | Bacteria | 6465194 |
| 1418 | 2775656908 | 2775506735 | Bacteria | 4556596 |
| 1419 | 2784472230 | 2784132109 | Bacteria | 3141763 |
| 1420 | 2808831129 | 2808606357 | Bacteria | 4466944 |
| 1421 | 2808852393 | 2808606360 | Bacteria | 4404006 |
| 1422 | 2808879315 | 2808606366 | Bacteria | 4415912 |
| 1423 | 2808896439 | 2808606371 | Bacteria | 4251511 |
| 1424 | 2810363754 | 2808606700 | Bacteria | 3482157 |
| 1425 | 2812321175 | 2811994871 | Bacteria | 4497550 |
| 1426 | 2812375004 | 2811994882 | Bacteria | 4688362 |
| 1427 | 2819427746 | 2818991318 | Bacteria | 5266538 |
| 1428 | 2819691759 | 2818991462 | Bacteria | 4320267 |
| 1429 | 2819729467 | 2818991469 | Bacteria | 4644110 |
| 1430 | 2856743494 | 2856741275 | Bacteria | 8096094 |
| 1431 | 2862706621 | 2862705112 | Bacteria | 6563286 |
| 1432 | 2873314945 | 2873314349 | Bacteria | 8512634 |
| 1433 | 2884694273 | 2884693830 | Bacteria | 11273186 |
| 1434 | 2891402564 | 2891395885 | Bacteria | 9251614 |
| 1435 | 2891554893 | 2891554331 | Bacteria | 8812224 |
| 1436 | 2891562797 | 2891562705 | Bacteria | 8039471 |
| 1437 | 2895435668 | 2895427314 | Bacteria | 13147766 |
| 1438 | 2895444713 | 2895442618 | Bacteria | 11027144 |
| 1439 | 2905930886 | 2905926851 | Bacteria | 4423176 |
| 1440 | 2932434693 | 2932431166 | Bacteria | 4215299 |
| 1441 | 2945918934 | 2945916053 | Bacteria | 4555517 |
| 1442 | 2946062785 | 2946059875 | Bacteria | 4386623 |
| 1443 | 2954000409 | 2953998280 | Bacteria | 4812144 |
| 1444 | 2974306914 | 2974302888 | Bacteria | 4369871 |
| 1445 | 2990044591 | 2990044586 | Bacteria | 6603797 |
| 1446 | 3001891493 | 3001889506 | Bacteria | 2975194 |
| 1447 | 3003002262 | 3002998708 | Bacteria | 11715108 |
| 1448 | 8004022743 | 8004021418 | Bacteria | 4313954 |
| 1449 | 8004029419 | 8004025490 | Bacteria | 4327753 |
| 1450 | 8008489218 | 8008485437 | Bacteria | 7198341 |
| 1451 | 8025527549 | 8025524527 | Bacteria | 7197316 |
| 1452 | 8053951764 | 8053945823 | Bacteria | 8962862 |
| 1453 | 8054612961 | 8054609563 | Bacteria | 5170090 |
| 1454 | 8055072627 | 8055066027 | Bacteria | 9479577 |
| 1455 | 8055175737 | 8055172936 | Bacteria | 9305943 |
| 1456 | 8056582024 | 8056579771 | Bacteria | 5840325 |
| 1457 | Ga0213875_10000279 | |||
| 1458 | JGI25152J39213_1000140 | |||
| 1459 | JGI25404J52841_10005090 | |||
| 1460 | JGI25404J52841_10026453 | |||
| 1461 | Ga0065714_10006475 | |||
| 1462 | Ga0070658_10037640 | |||
| 1463 | Ga0070658_10041079 | |||
| 1464 | Ga0070658_10365269 | |||
| 1465 | Ga0070676_10034801 | |||
| 1466 | Ga0070676_10066430 | |||
| 1467 | Ga0070676_10142671 | |||
| 1468 | Ga0070683_100001232 | |||
| 1469 | Ga0070683_100023183 | |||
| 1470 | Ga0070683_100038676 | |||
| 1471 | Ga0070683_100126071 | |||
| 1472 | Ga0070683_100399913 | |||
| 1473 | Ga0070690_100078081 | |||
| 1474 | Ga0070690_100094011 | |||
| 1475 | Ga0070670_100152472 | |||
| 1476 | Ga0068869_100048676 | |||
| 1477 | Ga0070666_10015201 | |||
| 1478 | Ga0070680_100020946 | |||
| 1479 | Ga0070680_100096329 | |||
| 1480 | Ga0070680_100261212 | |||
| 1481 | Ga0070680_100511273 | |||
| 1482 | Ga0070680_100560137 | |||
| 1483 | Ga0070682_100007568 | |||
| 1484 | Ga0070682_100010252 | |||
| 1485 | Ga0070682_100041585 | |||
| 1486 | Ga0070682_100054771 | |||
| 1487 | Ga0070682_100177740 | |||
| 1488 | Ga0068868_100072693 | |||
| 1489 | Ga0068868_100088079 | |||
| 1490 | Ga0070660_100045964 | |||
| 1491 | Ga0070689_100122383 | |||
| 1492 | Ga0070691_10010867 | |||
| 1493 | Ga0070691_10030466 | |||
| 1494 | Ga0070687_100217974 | |||
| 1495 | Ga0070661_100065930 | |||
| 1496 | Ga0070661_100119649 | |||
| 1497 | Ga0070692_10049130 | |||
| 1498 | Ga0070692_10063335 | |||
| 1499 | Ga0070668_100150927 | |||
| 1500 | Ga0070668_100394332 | |||
| 1501 | Ga0070669_100129893 | |||
| 1502 | Ga0070675_100018324 | |||
| 1503 | Ga0070675_100039053 | |||
| 1504 | Ga0070671_100049585 | |||
| 1505 | Ga0070671_100142149 | |||
| 1506 | Ga0070673_100128824 | |||
| 1507 | Ga0070673_100521723 | |||
| 1508 | Ga0070673_100571776 | |||
| 1509 | Ga0070659_100048728 | |||
| 1510 | Ga0070659_100255916 | |||
| 1511 | Ga0070703_10006990 | |||
| 1512 | Ga0070709_10119243 | |||
| 1513 | Ga0070709_10132298 | |||
| 1514 | Ga0070714_100000106 | |||
| 1515 | Ga0070714_100003050 | |||
| 1516 | Ga0070714_100011007 | |||
| 1517 | Ga0070714_100068535 | |||
| 1518 | Ga0070714_100086279 | |||
| 1519 | Ga0070714_100089153 | |||
| 1520 | Ga0070714_100116118 | |||
| 1521 | Ga0070714_100215886 | |||
| 1522 | Ga0070714_100294787 | |||
| 1523 | Ga0070714_100368581 | |||
| 1524 | Ga0070714_100549624 | |||
| 1525 | Ga0070713_100002552 | |||
| 1526 | Ga0070713_100008841 | |||
| 1527 | Ga0070713_100010745 | |||
| 1528 | Ga0070713_100026673 | |||
| 1529 | Ga0070713_100041218 | |||
| 1530 | Ga0070713_100050651 | |||
| 1531 | Ga0070713_100070574 | |||
| 1532 | Ga0070713_100083862 | |||
| 1533 | Ga0070713_100251386 | |||
| 1534 | Ga0070713_100651521 | |||
| 1535 | Ga0070710_10007646 | |||
| 1536 | Ga0070710_10015638 | |||
| 1537 | Ga0070710_10024332 | |||
| 1538 | Ga0070710_10028942 | |||
| 1539 | Ga0070710_10065028 | |||
| 1540 | Ga0070710_10072542 | |||
| 1541 | Ga0070710_10074785 | |||
| 1542 | Ga0070701_10040585 | |||
| 1543 | Ga0070701_10060258 | |||
| 1544 | Ga0070711_100003698 | |||
| 1545 | Ga0070711_100159984 | |||
| 1546 | Ga0070705_100016297 | |||
| 1547 | Ga0070705_100021518 | |||
| 1548 | Ga0070705_100379451 | |||
| 1549 | Ga0070700_100000032 | |||
| 1550 | Ga0070700_100016501 | |||
| 1551 | Ga0070700_100088159 | |||
| 1552 | Ga0070694_100008433 | |||
| 1553 | Ga0070708_100004613 | |||
| 1554 | Ga0070708_100014087 | |||
| 1555 | Ga0070708_100030992 | |||
| 1556 | Ga0070708_100041624 | |||
| 1557 | Ga0070708_100063836 | |||
| 1558 | Ga0070708_100131996 | |||
| 1559 | Ga0070663_100002903 | |||
| 1560 | Ga0070663_100016265 | |||
| 1561 | Ga0070678_100003362 | |||
| 1562 | Ga0070678_100023732 | |||
| 1563 | Ga0070681_10265389 | |||
| 1564 | Ga0070681_10327749 | |||
| 1565 | Ga0070685_10097188 | |||
| 1566 | Ga0070706_100001339 | |||
| 1567 | Ga0070706_100002385 | |||
| 1568 | Ga0070706_100009601 | |||
| 1569 | Ga0070706_100012481 | |||
| 1570 | Ga0070706_100016812 | |||
| 1571 | Ga0070706_100022152 | |||
| 1572 | Ga0070706_100063501 | |||
| 1573 | Ga0070706_100066956 | |||
| 1574 | Ga0070706_100074265 | |||
| 1575 | Ga0070706_100160898 | |||
| 1576 | Ga0070706_100233845 | |||
| 1577 | Ga0070706_100251843 | |||
| 1578 | Ga0070707_100002030 | |||
| 1579 | Ga0070707_100002309 | |||
| 1580 | Ga0070707_100008144 | |||
| 1581 | Ga0070707_100033800 | |||
| 1582 | Ga0070707_100067555 | |||
| 1583 | Ga0070707_100075099 | |||
| 1584 | Ga0070707_100077254 | |||
| 1585 | Ga0070707_100100904 | |||
| 1586 | Ga0070707_100189752 | |||
| 1587 | Ga0070707_100231986 | |||
| 1588 | Ga0070698_100000546 | |||
| 1589 | Ga0070698_100000603 | |||
| 1590 | Ga0070698_100005898 | |||
| 1591 | Ga0070698_100007558 | |||
| 1592 | Ga0070698_100008876 | |||
| 1593 | Ga0070698_100029873 | |||
| 1594 | Ga0070698_100035273 | |||
| 1595 | Ga0070698_100039145 | |||
| 1596 | Ga0070698_100057134 | |||
| 1597 | Ga0070698_100064438 | |||
| 1598 | Ga0070698_100130505 | |||
| 1599 | Ga0070698_100152667 | |||
| 1600 | Ga0070698_100180223 | |||
| 1601 | Ga0070698_100226293 | |||
| 1602 | Ga0070699_100001575 | |||
| 1603 | Ga0070679_100023566 | |||
| 1604 | Ga0070679_100024087 | |||
| 1605 | Ga0070679_100097856 | |||
| 1606 | Ga0070679_100135810 | |||
| 1607 | Ga0070679_100259317 | |||
| 1608 | Ga0070684_100001567 | |||
| 1609 | Ga0070684_100025965 | |||
| 1610 | Ga0070684_100109092 | |||
| 1611 | Ga0070684_100183094 | |||
| 1612 | Ga0070684_100241134 | |||
| 1613 | Ga0070684_100431690 | |||
| 1614 | Ga0070697_100012968 | |||
| 1615 | Ga0070697_100056754 | |||
| 1616 | Ga0070697_100081358 | |||
| 1617 | Ga0070697_100124388 | |||
| 1618 | Ga0068853_100127427 | |||
| 1619 | Ga0070686_100023146 | |||
| 1620 | Ga0070686_100040954 | |||
| 1621 | Ga0070695_100007032 | |||
| 1622 | Ga0070695_100117539 | |||
| 1623 | Ga0070696_100000771 | |||
| 1624 | Ga0070696_100007537 | |||
| 1625 | Ga0070696_100033355 | |||
| 1626 | Ga0070693_100000790 | |||
| 1627 | Ga0070693_100038449 | |||
| 1628 | Ga0070665_100062161 | |||
| 1629 | Ga0070665_100128101 | |||
| 1630 | Ga0070665_100208501 | |||
| 1631 | Ga0070704_100103523 | |||
| 1632 | Ga0068855_100153052 | |||
| 1633 | Ga0068857_100455458 | |||
| 1634 | Ga0068854_100013646 | |||
| 1635 | Ga0068856_100058004 | |||
| 1636 | Ga0068856_100133415 | |||
| 1637 | Ga0068856_100279141 | |||
| 1638 | Ga0068856_100406768 | |||
| 1639 | Ga0070702_100004694 | |||
| 1640 | Ga0070702_100055450 | |||
| 1641 | Ga0068852_100083196 | |||
| 1642 | Ga0068852_100146623 | |||
| 1643 | Ga0068864_100009054 | |||
| 1644 | Ga0068864_100439866 | |||
| 1645 | Ga0068861_100298242 | |||
| 1646 | Ga0068870_10184942 | |||
| 1647 | Ga0068863_100031657 | |||
| 1648 | Ga0068863_100216938 | |||
| 1649 | Ga0068860_100095557 | |||
| 1650 | Ga0081455_10009965 | |||
| 1651 | Ga0081455_10122766 | |||
| 1652 | Ga0081455_10139456 | |||
| 1653 | Ga0081538_10001393 | |||
| 1654 | Ga0081540_1000345 | |||
| 1655 | Ga0081540_1002862 | |||
| 1656 | Ga0081540_1056961 | |||
| 1657 | Ga0070717_10004502 | |||
| 1658 | Ga0070717_10019476 | |||
| 1659 | Ga0070717_10027018 | |||
| 1660 | Ga0070717_10029071 | |||
| 1661 | Ga0070717_10223296 | |||
| 1662 | Ga0070717_10233681 | |||
| 1663 | Ga0070717_10235691 | |||
| 1664 | Ga0070717_10238522 | |||
| 1665 | Ga0075432_10001623 | |||
| 1666 | Ga0075432_10004430 | |||
| 1667 | Ga0075432_10103550 | |||
| 1668 | Ga0070715_10139307 | |||
| 1669 | Ga0070715_10154831 | |||
| 1670 | Ga0070716_100004563 | |||
| 1671 | Ga0070716_100074442 | |||
| 1672 | Ga0070716_100130020 | |||
| 1673 | Ga0070716_100348339 | |||
| 1674 | Ga0070712_100000686 | |||
| 1675 | Ga0070712_100012108 | |||
| 1676 | Ga0070712_100063385 | |||
| 1677 | Ga0070712_100346651 | |||
| 1678 | Ga0070712_100689965 | |||
| 1679 | Ga0075367_10079522 | |||
| 1680 | Ga0075367_10297830 | |||
| 1681 | Ga0097621_100104682 | |||
| 1682 | Ga0068871_100098374 | |||
| 1683 | Ga0068871_100107880 | |||
| 1684 | Ga0075428_100000550 | |||
| 1685 | Ga0075428_100000883 | |||
| 1686 | Ga0075428_100090930 | |||
| 1687 | Ga0075428_100171638 | |||
| 1688 | Ga0075430_100137972 | |||
| 1689 | Ga0075431_100022433 | |||
| 1690 | Ga0075431_100066828 | |||
| 1691 | Ga0075431_100077379 | |||
| 1692 | Ga0075433_10019092 | |||
| 1693 | Ga0075433_10022654 | |||
| 1694 | Ga0075433_10042941 | |||
| 1695 | Ga0075433_10062467 | |||
| 1696 | Ga0075434_100024868 | |||
| 1697 | Ga0075434_100040248 | |||
| 1698 | Ga0075434_100171584 | |||
| 1699 | Ga0075434_100488771 | |||
| 1700 | Ga0075429_100260772 | |||
| 1701 | Ga0075429_100318478 | |||
| 1702 | Ga0075436_100000929 | |||
| 1703 | Ga0075436_100019491 | |||
| 1704 | Ga0075436_100058056 | |||
| 1705 | Ga0075436_100069714 | |||
| 1706 | Ga0075436_100103298 | |||
| 1707 | Ga0075435_100013427 | |||
| 1708 | Ga0075435_100085039 | |||
| 1709 | Ga0075435_100729832 | |||
| 1710 | Ga0099794_10066788 | |||
| 1711 | Ga0111539_10000342 | |||
| 1712 | Ga0111539_10055497 | |||
| 1713 | Ga0105245_10023219 | |||
| 1714 | Ga0105245_10031225 | |||
| 1715 | Ga0105245_10068388 | |||
| 1716 | Ga0105245_10108505 | |||
| 1717 | Ga0105245_10123453 | |||
| 1718 | Ga0105245_10148480 | |||
| 1719 | Ga0105245_10296017 | |||
| 1720 | Ga0105245_10330414 | |||
| 1721 | Ga0105247_10035569 | |||
| 1722 | Ga0114129_10002267 | |||
| 1723 | Ga0114129_10143862 | |||
| 1724 | Ga0114129_10208890 | |||
| 1725 | Ga0114129_10291473 | |||
| 1726 | Ga0114129_10700278 | |||
| 1727 | Ga0114129_10971568 | |||
| 1728 | Ga0105243_10023631 | |||
| 1729 | Ga0105243_10097396 | |||
| 1730 | Ga0105243_10138265 | |||
| 1731 | Ga0105243_10274200 | |||
| 1732 | Ga0105241_10002632 | |||
| 1733 | Ga0105241_10171665 | |||
| 1734 | Ga0105241_10217135 | |||
| 1735 | Ga0105248_10035978 | |||
| 1736 | Ga0105248_10039070 | |||
| 1737 | Ga0105248_10111205 | |||
| 1738 | Ga0105248_10148860 | |||
| 1739 | Ga0105237_10092314 | |||
| 1740 | Ga0105237_10462450 | |||
| 1741 | Ga0105238_10089595 | |||
| 1742 | Ga0105238_10165729 | |||
| 1743 | Ga0105238_10166610 | |||
| 1744 | Ga0105239_10001401 | |||
| 1745 | Ga0105239_10183026 | |||
| 1746 | Ga0105246_10001050 | |||
| 1747 | Ga0105246_10002276 | |||
| 1748 | Ga0105246_10002387 | |||
| 1749 | Ga0105246_10178396 | |||
| 1750 | Ga0105246_10538941 | |||
| 1751 | Ga0157340_1000795 | |||
| 1752 | Ga0157328_1003268 | |||
| 1753 | Ga0157320_1001769 | |||
| 1754 | Ga0157326_1005455 | |||
| 1755 | Ga0157371_10005477 | |||
| 1756 | Ga0157370_10114716 | |||
| 1757 | Ga0157369_10041463 | |||
| 1758 | Ga0157369_10090991 | |||
| 1759 | Ga0157369_10131475 | |||
| 1760 | Ga0157369_10139130 | |||
| 1761 | Ga0157369_10196332 | |||
| 1762 | Ga0163162_10034522 | |||
| 1763 | Ga0163162_10583852 | |||
| 1764 | Ga0157372_10006117 | |||
| 1765 | Ga0157372_10253696 | |||
| 1766 | Ga0157372_10274844 | |||
| 1767 | Ga0157372_10656946 | |||
| 1768 | Ga0157375_10059104 | |||
| 1769 | Ga0157375_10154505 | |||
| 1770 | Ga0157375_10283563 | |||
| 1771 | Ga0157375_10473301 | |||
| 1772 | Ga0163163_10052099 | |||
| 1773 | Ga0163163_10187587 | |||
| 1774 | Ga0163163_10698475 | |||
| 1775 | Ga0157380_10159808 | |||
| 1776 | Ga0157377_10044266 | |||
| 1777 | Ga0157377_10053273 | |||
| 1778 | Ga0157379_10021747 | |||
| 1779 | Ga0157379_10398995 | |||
| 1780 | Ga0157376_10273075 | |||
| 1781 | Ga0163161_10020401 | |||
| 1782 | Ga0206356_10432907 | |||
| 1783 | Ga0206351_10135569 | |||
| 1784 | Ga0206350_10042881 | |||
| 1785 | Ga0206354_10464791 | |||
| 1786 | Ga0206353_10077479 | |||
| 1787 | Ga0206353_11124480 | |||
| 1788 | Ga0206353_11987931 | |||
| 1789 | Ga0154015_1296164 | |||
| 1790 | Ga0213874_10036320 | |||
| 1791 | Ga0213875_10000363 | |||
| 1792 | Ga0213875_10007999 | |||
| 1793 | Ga0213875_10027678 | |||
| 1794 | Ga0213875_10032344 | |||
| 1795 | Ga0213875_10044511 | |||
| 1796 | Ga0213875_10137709 | |||
| 1797 | Ga0224712_10021924 | |||
| 1798 | Ga0224712_10147916 | |||
| 1799 | Ga0209148_1002761 | |||
| 1800 | Ga0209129_1000067 | |||
| 1801 | Ga0209025_1001395 | |||
| 1802 | Ga0209051_1012946 | |||
| 1803 | Ga0207656_10056187 | |||
| 1804 | Ga0207653_10002967 | |||
| 1805 | Ga0207692_10003787 | |||
| 1806 | Ga0207692_10004622 | |||
| 1807 | Ga0207692_10020352 | |||
| 1808 | Ga0207692_10042308 | |||
| 1809 | Ga0207692_10129041 | |||
| 1810 | Ga0207692_10174450 | |||
| 1811 | Ga0207692_10237494 | |||
| 1812 | Ga0207710_10060560 | |||
| 1813 | Ga0207688_10003738 | |||
| 1814 | Ga0207688_10004765 | |||
| 1815 | Ga0207688_10064737 | |||
| 1816 | Ga0207688_10358762 | |||
| 1817 | Ga0207647_10052049 | |||
| 1818 | Ga0207685_10000503 | |||
| 1819 | Ga0207685_10016331 | |||
| 1820 | Ga0207685_10123546 | |||
| 1821 | Ga0207699_10000988 | |||
| 1822 | Ga0207699_10003997 | |||
| 1823 | Ga0207699_10004908 | |||
| 1824 | Ga0207699_10011620 | |||
| 1825 | Ga0207645_10008076 | |||
| 1826 | Ga0207645_10075430 | |||
| 1827 | Ga0207645_10097895 | |||
| 1828 | Ga0207643_10000047 | |||
| 1829 | Ga0207643_10030020 | |||
| 1830 | Ga0207705_10035401 | |||
| 1831 | Ga0207705_10098161 | |||
| 1832 | Ga0207684_10000323 | |||
| 1833 | Ga0207684_10003999 | |||
| 1834 | Ga0207684_10010100 | |||
| 1835 | Ga0207684_10022827 | |||
| 1836 | Ga0207684_10029169 | |||
| 1837 | Ga0207684_10040467 | |||
| 1838 | Ga0207684_10045316 | |||
| 1839 | Ga0207684_10064461 | |||
| 1840 | Ga0207684_10067070 | |||
| 1841 | Ga0207684_10103170 | |||
| 1842 | Ga0207684_10127839 | |||
| 1843 | Ga0207684_10128721 | |||
| 1844 | Ga0207684_10251776 | |||
| 1845 | Ga0207707_10001352 | |||
| 1846 | Ga0207671_10109947 | |||
| 1847 | Ga0207693_10025677 | |||
| 1848 | Ga0207693_10044196 | |||
| 1849 | Ga0207693_10061577 | |||
| 1850 | Ga0207693_10159272 | |||
| 1851 | Ga0207693_10187925 | |||
| 1852 | Ga0207693_10199085 | |||
| 1853 | Ga0207693_10325018 | |||
| 1854 | Ga0207663_10001870 | |||
| 1855 | Ga0207663_10008539 | |||
| 1856 | Ga0207663_10031503 | |||
| 1857 | Ga0207663_10056765 | |||
| 1858 | Ga0207663_10109241 | |||
| 1859 | Ga0207663_10109409 | |||
| 1860 | Ga0207663_10189829 | |||
| 1861 | Ga0207660_10022130 | |||
| 1862 | Ga0207660_10048898 | |||
| 1863 | Ga0207660_10409184 | |||
| 1864 | Ga0207662_10068286 | |||
| 1865 | Ga0207657_10013739 | |||
| 1866 | Ga0207657_10041725 | |||
| 1867 | Ga0207657_10084590 | |||
| 1868 | Ga0207657_10089978 | |||
| 1869 | Ga0207649_10100127 | |||
| 1870 | Ga0207652_10102635 | |||
| 1871 | Ga0207652_10194305 | |||
| 1872 | Ga0207646_10000050 | |||
| 1873 | Ga0207646_10011796 | |||
| 1874 | Ga0207646_10014424 | |||
| 1875 | Ga0207646_10023656 | |||
| 1876 | Ga0207646_10027007 | |||
| 1877 | Ga0207646_10041129 | |||
| 1878 | Ga0207646_10453030 | |||
| 1879 | Ga0207646_10473784 | |||
| 1880 | Ga0207681_10015247 | |||
| 1881 | Ga0207694_10035588 | |||
| 1882 | Ga0207694_10082701 | |||
| 1883 | Ga0207650_10010952 | |||
| 1884 | Ga0207659_10066653 | |||
| 1885 | Ga0207659_10293346 | |||
| 1886 | Ga0207687_10030995 | |||
| 1887 | Ga0207700_10000216 | |||
| 1888 | Ga0207700_10000619 | |||
| 1889 | Ga0207700_10006986 | |||
| 1890 | Ga0207700_10014371 | |||
| 1891 | Ga0207700_10020739 | |||
| 1892 | Ga0207700_10039278 | |||
| 1893 | Ga0207700_10056216 | |||
| 1894 | Ga0207700_10089091 | |||
| 1895 | Ga0207700_10099220 | |||
| 1896 | Ga0207700_10101928 | |||
| 1897 | Ga0207700_10194885 | |||
| 1898 | Ga0207700_10230897 | |||
| 1899 | Ga0207700_10468992 | |||
| 1900 | Ga0207664_10000047 | |||
| 1901 | Ga0207664_10000379 | |||
| 1902 | Ga0207664_10000543 | |||
| 1903 | Ga0207664_10000594 | |||
| 1904 | Ga0207664_10002311 | |||
| 1905 | Ga0207664_10010461 | |||
| 1906 | Ga0207664_10024932 | |||
| 1907 | Ga0207664_10033956 | |||
| 1908 | Ga0207664_10060263 | |||
| 1909 | Ga0207664_10061428 | |||
| 1910 | Ga0207664_10074863 | |||
| 1911 | Ga0207664_10110371 | |||
| 1912 | Ga0207664_10176661 | |||
| 1913 | Ga0207664_10255494 | |||
| 1914 | Ga0207664_10332582 | |||
| 1915 | Ga0207664_10338737 | |||
| 1916 | Ga0207664_10425908 | |||
| 1917 | Ga0207664_10699689 | |||
| 1918 | Ga0207644_10027196 | |||
| 1919 | Ga0207690_10053190 | |||
| 1920 | Ga0207690_10214901 | |||
| 1921 | Ga0207690_10430363 | |||
| 1922 | Ga0207686_10151336 | |||
| 1923 | Ga0207709_10011152 | |||
| 1924 | Ga0207709_10144620 | |||
| 1925 | Ga0207709_10330032 | |||
| 1926 | Ga0207670_10324473 | |||
| 1927 | Ga0207665_10001106 | |||
| 1928 | Ga0207665_10001519 | |||
| 1929 | Ga0207665_10001843 | |||
| 1930 | Ga0207665_10020336 | |||
| 1931 | Ga0207665_10022999 | |||
| 1932 | Ga0207665_10033589 | |||
| 1933 | Ga0207665_10171255 | |||
| 1934 | Ga0207691_10011415 | |||
| 1935 | Ga0207691_10035120 | |||
| 1936 | Ga0207689_10009034 | |||
| 1937 | Ga0207689_10026742 | |||
| 1938 | Ga0207661_10012478 | |||
| 1939 | Ga0207661_10038004 | |||
| 1940 | Ga0207661_10070137 | |||
| 1941 | Ga0207661_10182722 | |||
| 1942 | Ga0207661_10209366 | |||
| 1943 | Ga0207661_10366378 | |||
| 1944 | Ga0207661_10380131 | |||
| 1945 | Ga0207679_10003830 | |||
| 1946 | Ga0207679_10056484 | |||
| 1947 | Ga0207667_10108095 | |||
| 1948 | Ga0207667_10818001 | |||
| 1949 | Ga0207651_10150573 | |||
| 1950 | Ga0207668_10148664 | |||
| 1951 | Ga0207640_10062340 | |||
| 1952 | Ga0207658_10048223 | |||
| 1953 | Ga0207658_10101344 | |||
| 1954 | Ga0207677_10047770 | |||
| 1955 | Ga0207677_10263260 | |||
| 1956 | Ga0207677_10539415 | |||
| 1957 | Ga0207703_10036637 | |||
| 1958 | Ga0207703_10175221 | |||
| 1959 | Ga0207639_10070751 | |||
| 1960 | Ga0207639_10101308 | |||
| 1961 | Ga0207678_10001956 | |||
| 1962 | Ga0207678_10007294 | |||
| 1963 | Ga0207678_10022190 | |||
| 1964 | Ga0207678_10439890 | |||
| 1965 | Ga0207708_10027364 | |||
| 1966 | Ga0207708_10074694 | |||
| 1967 | Ga0207702_10101267 | |||
| 1968 | Ga0207702_10205652 | |||
| 1969 | Ga0207702_10286343 | |||
| 1970 | Ga0207702_10418616 | |||
| 1971 | Ga0207641_10037314 | |||
| 1972 | Ga0207641_10089939 | |||
| 1973 | Ga0207676_10063866 | |||
| 1974 | Ga0207676_10077200 | |||
| 1975 | Ga0207674_10027421 | |||
| 1976 | Ga0207674_10028680 | |||
| 1977 | Ga0207674_10065923 | |||
| 1978 | Ga0207674_10192671 | |||
| 1979 | Ga0207675_100010057 | |||
| 1980 | Ga0207683_10001336 | |||
| 1981 | Ga0207683_10006321 | |||
| 1982 | Ga0207683_10007910 | |||
| 1983 | Ga0207683_10317592 | |||
| 1984 | Ga0207698_10203673 | |||
| 1985 | Ga0207698_10662167 | |||
| 1986 | Ga0207428_10000436 | |||
| 1987 | Ga0207428_10006188 | |||
| 1988 | Ga0207428_10243194 | |||
| 1989 | Ga0268266_10027769 | |||
| 1990 | Ga0268266_10191818 | |||
| 1991 | Ga0268264_10227381 | |||
| 1992 | Ga0265337_1002783 | |||
| 1993 | Ga0265319_1040619 | |||
| 1994 | Ga0265334_10028035 | |||
| 1995 | Ga0265318_10052844 | |||
| 1996 | Ga0265323_10032217 | |||
| 1997 | Ga0265322_10004808 | |||
| 1998 | Ga0265336_10006997 | |||
| 1999 | Ga0265336_10007124 | |||
| 2000 | Ga0307515_10228167 | |||
| 2001 | Ga0265338_10001346 | |||
| 2002 | Ga0265338_10006911 | |||
| 2003 | Ga0265338_10010558 | |||
| 2004 | Ga0265338_10025455 | |||
| 2005 | Ga0265324_10009688 | |||
| 2006 | Ga0316181_1287760 | |||
| 2007 | Ga0265760_10084872 | |||
| 2008 | Ga0265332_10002184 | |||
| 2009 | Ga0265320_10042505 | |||
| 2010 | Ga0265340_10025062 | |||
| 2011 | Ga0265339_10015113 | |||
| 2012 | Ga0265316_10068929 | |||
| 2013 | Ga0307513_10001072 | |||
| 2014 | Ga0307509_10405746 | |||
| 2015 | Ga0307408_100002302 | |||
| 2016 | Ga0307408_100009943 | |||
| 2017 | Ga0307408_100023860 | |||
| 2018 | Ga0307408_100030294 | |||
| 2019 | Ga0307408_100042486 | |||
| 2020 | Ga0307408_100083312 | |||
| 2021 | Ga0307408_100111110 | |||
| 2022 | Ga0307408_100182329 | |||
| 2023 | Ga0265313_10006305 | |||
| 2024 | Ga0265313_10030774 | |||
| 2025 | Ga0316579_10004478 | |||
| 2026 | Ga0316579_10042337 | |||
| 2027 | Ga0265314_10017800 | |||
| 2028 | Ga0265314_10046623 | |||
| 2029 | Ga0265342_10012657 | |||
| 2030 | Ga0316576_10055510 | |||
| 2031 | Ga0316576_10074597 | |||
| 2032 | Ga0316576_10089022 | |||
| 2033 | Ga0316578_10106373 | |||
| 2034 | Ga0316578_10130603 | |||
| 2035 | Ga0307516_10360182 | |||
| 2036 | Ga0307405_10001740 | |||
| 2037 | Ga0307405_10080869 | |||
| 2038 | Ga0307405_10143594 | |||
| 2039 | Ga0307405_10492008 | |||
| 2040 | Ga0316577_10004394 | |||
| 2041 | Ga0316577_10066283 | |||
| 2042 | Ga0307413_10009968 | |||
| 2043 | Ga0307413_10050142 | |||
| 2044 | Ga0307413_10073826 | |||
| 2045 | Ga0307413_10109312 | |||
| 2046 | Ga0307413_10128990 | |||
| 2047 | Ga0307410_10001200 | |||
| 2048 | Ga0307410_10010483 | |||
| 2049 | Ga0307410_10017746 | |||
| 2050 | Ga0307410_10063996 | |||
| 2051 | Ga0307410_10082752 | |||
| 2052 | Ga0307410_10240531 | |||
| 2053 | Ga0307406_10000241 | |||
| 2054 | Ga0307406_10018790 | |||
| 2055 | Ga0307406_10019670 | |||
| 2056 | Ga0307406_10040560 | |||
| 2057 | Ga0307406_10240116 | |||
| 2058 | Ga0307407_10002677 | |||
| 2059 | Ga0307407_10004684 | |||
| 2060 | Ga0307407_10045925 | |||
| 2061 | Ga0307407_10067460 | |||
| 2062 | Ga0307407_10337237 | |||
| 2063 | Ga0307412_10033871 | |||
| 2064 | Ga0307412_10156909 | |||
| 2065 | Ga0307409_100000403 | |||
| 2066 | Ga0307409_100007374 | |||
| 2067 | Ga0307409_100022171 | |||
| 2068 | Ga0307409_100027710 | |||
| 2069 | Ga0307409_100035514 | |||
| 2070 | Ga0307409_100036313 | |||
| 2071 | Ga0307409_100049765 | |||
| 2072 | Ga0307409_100056382 | |||
| 2073 | Ga0307409_100081847 | |||
| 2074 | Ga0307409_100111676 | |||
| 2075 | Ga0307409_100225590 | |||
| 2076 | Ga0307409_100231143 | |||
| 2077 | Ga0307409_100258484 | |||
| 2078 | Ga0307409_100507870 | |||
| 2079 | Ga0307416_100000079 | |||
| 2080 | Ga0307416_100003433 | |||
| 2081 | Ga0307416_100020205 | |||
| 2082 | Ga0307416_100054577 | |||
| 2083 | Ga0307416_100055863 | |||
| 2084 | Ga0307416_100056940 | |||
| 2085 | Ga0307416_100065826 | |||
| 2086 | Ga0307416_100092062 | |||
| 2087 | Ga0307416_100125879 | |||
| 2088 | Ga0307416_100181798 | |||
| 2089 | Ga0307416_100212282 | |||
| 2090 | Ga0307416_100575738 | |||
| 2091 | Ga0307416_100720352 | |||
| 2092 | Ga0307414_10001328 | |||
| 2093 | Ga0307414_10086137 | |||
| 2094 | Ga0307414_10095165 | |||
| 2095 | Ga0307414_10147376 | |||
| 2096 | Ga0307414_10192540 | |||
| 2097 | Ga0307414_10375124 | |||
| 2098 | Ga0307411_10001879 | |||
| 2099 | Ga0307411_10016592 | |||
| 2100 | Ga0307411_10035516 | |||
| 2101 | Ga0307411_10062628 | |||
| 2102 | Ga0307415_100026311 | |||
| 2103 | Ga0307415_100055891 | |||
| 2104 | Ga0307415_100061389 | |||
| 2105 | Ga0307415_100172409 | |||
| 2106 | Ga0307415_100183569 | |||
| 2107 | Ga0307415_100270370 | |||
| 2108 | Ga0307415_100363536 | |||
| 2109 | Ga0316583_10012370 | |||
| 2110 | Ga0316585_10019142 | |||
| 2111 | Ga0316580_10006211 | |||
| 2112 | Ga0316580_10055174 | |||
| 2113 | Ga0316212_1002393 | |||
| 2114 | Ga0373926_0006434 | |||
| 2115 | Ga0373926_0070539 | |||
| 2116 | Ga0373929_0027598 | |||
| 2117 | Ga0373934_0000032 | |||
| 2118 | Ga0373934_0004815 | |||
| 2119 | Ga0373934_0015706 | |||
| 2120 | Ga0373934_0045351 | |||
| 2121 | Ga0373934_0049421 | |||
| 2122 | Ga0373940_0089207 | |||
| 2123 | Ga0373944_0000245 | |||
| 2124 | Ga0373944_0009505 | |||
| 2125 | Ga0373944_0018985 | |||
| 2126 | Ga0373923_0000558 | |||
| 2127 | Ga0373923_0022773 | |||
| 2128 | Ga0373923_0040387 | |||
| 2129 | Ga0373923_0052739 | |||
| 2130 | Ga0373923_0168404 | |||
| 2131 | Ga0373936_0000908 | |||
| 2132 | Ga0373936_0009917 | |||
| 2133 | Ga0373936_0010386 | |||
| 2134 | Ga0373936_0071039 | |||
| 2135 | Ga0373941_0019241 | |||
| 2136 | Ga0373945_0000949 | |||
| 2137 | Ga0373945_0001238 | |||
| 2138 | Ga0373945_0037134 | |||
| 2139 | Ga0373953_0000145 | |||
| 2140 | Ga0373953_0008206 | |||
| 2141 | Ga0373953_0010007 | |||
| 2142 | Ga0373953_0068792 | |||
| 2143 | Ga0373953_0069406 | |||
| 2144 | Ga0373954_0023062 | |||
| 2145 | Ga0373954_0050839 | |||
| 2146 | Ga0373954_0059263 | |||
| 2147 | Ga0373954_0091376 | |||
| 2148 | Ga0373954_0228590 | |||
| 2149 | Ga0373956_0000096 | |||
| 2150 | Ga0373956_0009546 | |||
| 2151 | Ga0373956_0015945 | |||
| 2152 | Ga0373956_0017507 | |||
| 2153 | Ga0373956_0024516 | |||
| 2154 | Ga0373956_0065067 | |||
| 2155 | Ga0373957_0017156 | |||
| 2156 | Ga0373957_0104642 | |||
| 2157 | Ga0373960_0011769 | |||
| 2158 | Ga0373943_0000554 | |||
| 2159 | Ga0373943_0095187 | |||
| 2160 | Ga0373946_0000088 | |||
| 2161 | Ga0373946_0037577 | |||
| 2162 | Ga0373946_0080395 | |||
| 2163 | Ga0373955_0000015 | |||
| 2164 | Ga0373955_0021499 | |||
| 2165 | Ga0373955_0031472 | |||
| 2166 | Ga0373955_0053296 | |||
| 2167 | Ga0373955_0086690 | |||
| 2168 | Ga0373955_0102681 | |||
| 2169 | Ga0373955_0185831 | |||
| 2170 | Ga0373942_0003854 | |||
| 2171 | Ga0373961_0009430 | |||
| 2172 | Ga0373961_0066805 | |||
| 2173 | Ga0373962_0011474 | |||
| 2174 | Ga0373962_0016970 | |||
| 2175 | Ga0316574_0002969 | |||
| 2176 | Ga0316574_0027597 | |||
| 2177 | Ga0316574_0048143 | |||
| 2178 | Ga0373924_0003592 | |||
| 2179 | Ga0373924_0006043 | |||
| 2180 | Ga0373924_0006676 | |||
| 2181 | Ga0373924_0057313 | |||
| 2182 | Ga0373924_0063716 | |||
| 2183 | Ga0373924_0175103 | |||
| 2184 | Ga0373931_0016392 | |||
| 2185 | Ga0373931_0039540 | |||
| 2186 | Ga0373931_0253756 | |||
| 2187 | Ga0373931_0344708 | |||
| 2188 | Ga0373931_0385249 | |||
| 2189 | Ga0373935_0005038 | |||
| 2190 | Ga0373935_0007971 | |||
| 2191 | Ga0373935_0032118 | |||
| 2192 | Ga0373935_0095527 | |||
| 2193 | Ga0373927_0002273 | |||
| 2194 | Ga0373927_0013177 | |||
| 2195 | Ga0373927_0183227 | |||
| 2196 | Ga0373933_0000004 | |||
| 2197 | Ga0373933_0001154 | |||
| 2198 | Ga0373933_0009139 | |||
| 2199 | Ga0373933_0026217 | |||
| 2200 | Ga0373933_0032220 | |||
| 2201 | Ga0373933_0087911 | |||
| 2202 | Ga0373933_0101986 | |||
| 2203 | Ga0373933_0138807 | |||
| 2204 | Ga0373933_0211310 | |||
| 2205 | Ga0373933_0242773 | |||
| 2206 | Ga0373947_0000116 | |||
| 2207 | Ga0373947_0000815 | |||
| 2208 | Ga0373947_0025713 | |||
| 2209 | Ga0373947_0100704 | |||
| 2210 | Ga0373947_0121269 | |||
| 2211 | Ga0373947_0284467 | |||
| 2212 | Ga0373937_0000012 | |||
| 2213 | Ga0373937_0063728 | |||
| 2214 | Ga0373937_0067438 | |||
| 2215 | Ga0373937_0068625 | |||
| 2216 | Ga0373937_0119951 | |||
| 2217 | Ga0373937_0168985 | |||
| 2218 | Ga0373937_0172163 | |||
| 2219 | Ga0373937_0402129 | |||
| 2220 | Ga0373937_0751607 | |||
| 2221 | Ga0373937_0835469 | |||
| 2222 | Ga0372808_006891 | |||
| 2223 | Ga0316582_0004867 | |||
| 2224 | Ga0316584_0009116 | |||
| 2225 | Ga0316584_0018850 | |||
| 2226 | Ga0316584_0051715 | |||
| 2227 | Ga0373925_0000021 | |||
| 2228 | Ga0373925_0003050 | |||
| 2229 | Ga0373925_0005539 | |||
| 2230 | Ga0373925_0073881 | |||
| 2231 | Ga0373925_0094353 | |||
| 2232 | Ga0373925_0112859 | |||
| 2233 | Ga0373925_0168389 | |||
| 2234 | Ga0395899_0016113 | |||
| 2235 | Ga0395899_0055732 | |||
| 2236 | Ga0395900_0007662 | |||
| 2237 | Ga0395900_0018014 | |||
| 2238 | Ga0395900_0018741 | |||
| 2239 | Ga0395900_0049923 | |||
| 2240 | Ga0395900_0057687 | |||
| 2241 | Ga0395900_0085090 | |||
| 2242 | Ga0395900_0113139 | |||
| 2243 | Ga0395898_0017683 | |||
| 2244 | Ga0395898_0032533 | |||
| 2245 | Ga0395898_0050546 | |||
| 2246 | Ga0395898_0073181 | |||
| 2247 | Ga0395898_0081435 | |||
| 2248 | Ga0395898_0083833 | |||
| 2249 | Ga0395898_0090890 | |||
| 2250 | Ga0395898_0133313 | |||
| 2251 | Ga0395905_0042768 | |||
| 2252 | Ga0395905_0088621 | |||
| 2253 | Ga0395905_0117457 | |||
| 2254 | Ga0316581_0016916 | |||
| 2255 | Ga0436364_0426348 | |||
| 2256 | Ga0436364_0549328 | |||
| 2257 | Ga0436364_0563172 | |||
| 2258 | Ga0436364_0896453 | |||
| 2259 | Ga0436364_0990552 | |||
| 2260 | Ga0436364_1292226 | |||
| 2261 | Ga0436364_1406831 | |||
| 2262 | Ga0436364_1419792 | |||
| 2263 | Ga0436364_1427311 | |||
| 2264 | Ga0436364_1475022 | |||
| 2265 | Ga0395901_0003285 | |||
| 2266 | Ga0395901_0004509 | |||
| 2267 | Ga0395901_0008590 | |||
| 2268 | Ga0395901_0018051 | |||
| 2269 | Ga0395901_0020548 | |||
| 2270 | Ga0395901_0032466 | |||
| 2271 | Ga0395901_0048337 | |||
| 2272 | Ga0395901_0112405 | |||
| 2273 | Ga0395901_0167743 | |||
| 2274 | Ga0395901_0203548 | |||
| 2275 | Ga0395901_0224113 | |||
| 2276 | Ga0395901_0229433 | |||
| 2277 | Ga0436365_0471577 | |||
| 2278 | Ga0436365_0510277 | |||
| 2279 | Ga0436363_1571899 | |||
| 2280 | Ga0439436_0030917 | |||
| 2281 | Ga0439438_032040 | |||
| 2282 | Ga0439439_0007684 | |||
| 2283 | Ga0439466_0011359 | |||
| 2284 | Ga0439466_0015797 | |||
| 2285 | Ga0439465_0027389 | |||
| 2286 | Ga0451807_1174564 | |||
| 2287 | Ga0451833_0564772 | |||
| 2288 | Ga0451833_0913143 | |||
| 2289 | Ga0451837_0729638 | |||
| 2290 | Ga0451839_1288255 | |||
| 2291 | Ga0451843_0773603 | |||
| 2292 | Ga0451853_2585626 | |||
| 2293 | Ga0439431_0053821 | |||
| 2294 | Ga0439433_0000441 | |||
| 2295 | Ga0439433_0000451 | |||
| 2296 | Ga0439442_017474 | |||
| 2297 | Ga0439432_065575 | |||
| 2298 | Ga0439449_0008093 | |||
| 2299 | Ga0439449_0009742 | |||
| 2300 | Ga0439452_012151 | |||
| 2301 | Ga0439457_000675 | |||
| 2302 | Ga0439457_008987 | |||
| 2303 | Ga0439457_041047 | |||
| 2304 | Ga0439462_0000144 | |||
| 2305 | Ga0439462_0048724 | |||
| 2306 | Ga0450919_001721 | |||
| 2307 | Ga0450919_003706 | |||
| 2308 | Ga0450907_002582 | |||
| 2309 | Ga0439446_0002486 | |||
| 2310 | Ga0439458_0007512 | |||
| 2311 | Ga0450908_006499 | |||
| 2312 | Ga0439434_0003918 | |||
| 2313 | Ga0439460_0055304 | |||
| 2314 | Ga0466969_0116744 | |||
| 2315 | Ga0466965_0035061 | |||
| 2316 | Ga0466965_0039545 | |||
| 2317 | Ga0466965_0058778 | |||
| 2318 | Ga0466965_0068583 | |||
| 2319 | Ga0466965_0130882 | |||
| 2320 | Ga0466965_0172072 | |||
| 2321 | Ga0466966_0008166 | |||
| 2322 | Ga0466961_0040238 | |||
| 2323 | Ga0466961_0054074 | |||
| 2324 | Ga0466961_0198937 | |||
| 2325 | Ga0466963_0065730 | |||
| 2326 | Ga0466963_0066124 | |||
| 2327 | Ga0466963_0066850 | |||
| 2328 | Ga0466963_0091945 | |||
| 2329 | Ga0466963_0179436 | |||
| 2330 | Ga0466963_0385456 | |||
| 2331 | Ga0466971_0020900 | |||
| 2332 | Ga0466971_0031798 | |||
| 2333 | Ga0466971_0120680 | |||
| 2334 | Ga0466970_0039673 | |||
| 2335 | Ga0466957_0006284 | |||
| 2336 | Ga0466957_0018448 | |||
| 2337 | Ga0466957_0053167 | |||
| 2338 | Ga0466957_0066043 | |||
| 2339 | Ga0466957_0070616 | |||
| 2340 | Ga0466957_0102187 | |||
| 2341 | Ga0466960_0009185 | |||
| 2342 | Ga0466960_0010549 | |||
| 2343 | Ga0466960_0118972 | |||
| 2344 | Ga0466960_0183016 | |||
| 2345 | Ga0466960_0188089 | |||
| 2346 | Ga0466960_0243029 | |||
| 2347 | Ga0466959_0019251 | |||
| 2348 | Ga0466959_0124803 | |||
| 2349 | Ga0466959_0189639 | |||
| 2350 | Ga0451576_0002230 | |||
| 2351 | Ga0451576_0119161 | |||
| 2352 | Ga0466958_0025582 | |||
| 2353 | Ga0466958_0050689 | |||
| 2354 | Ga0466958_0055151 | |||
| 2355 | Ga0466958_0058272 | |||
| 2356 | Ga0466958_0129204 | |||
| 2357 | Ga0466967_0000342 | |||
| 2358 | Ga0466967_0004421 | |||
| 2359 | Ga0466967_0015132 | |||
| 2360 | Ga0466967_0032623 | |||
| 2361 | Ga0466967_0035022 | |||
| 2362 | Ga0466967_0041283 | |||
| 2363 | Ga0466967_0125829 | |||
| 2364 | Ga0466967_0142555 | |||
| 2365 | Ga0466967_0189077 | |||
| 2366 | Ga0466967_0258272 | |||
| 2367 | Ga0466967_0829156 | |||
| 2368 | Ga0466967_1047879 | |||
| 2369 | Ga0495592_0001038 | |||
| 2370 | Ga0495592_0031728 | |||
| 2371 | Ga0495592_0050439 | |||
| 2372 | Ga0495592_0078980 | |||
| 2373 | Ga0495592_0107092 | |||
| 2374 | Ga0495592_0239903 | |||
| 2375 | Ga0495592_0326828 | |||
| 2376 | Ga0495603_0167973 | |||
| 2377 | Ga0495629_0007551 | |||
| 2378 | Ga0495629_0010631 | |||
| 2379 | Ga0495629_0013423 | |||
| 2380 | Ga0495629_0048167 | |||
| 2381 | Ga0495629_0062962 | |||
| 2382 | Ga0495629_0152261 | |||
| 2383 | Ga0495629_0163137 | |||
| 2384 | Ga0495641_0001864 | |||
| 2385 | Ga0495641_0013724 | |||
| 2386 | Ga0495641_0061386 | |||
| 2387 | Ga0495641_0106769 | |||
| 2388 | Ga0495651_0000007 | |||
| 2389 | Ga0495651_0004624 | |||
| 2390 | Ga0495651_0007200 | |||
| 2391 | Ga0495651_0017643 | |||
| 2392 | Ga0495651_0028199 | |||
| 2393 | Ga0495651_0035062 | |||
| 2394 | Ga0495651_0055772 | |||
| 2395 | Ga0495651_0100495 | |||
| 2396 | Ga0495651_0130321 | |||
| 2397 | Ga0495653_0002903 | |||
| 2398 | Ga0495653_0005400 | |||
| 2399 | Ga0495653_0044104 | |||
| 2400 | Ga0495653_0058305 | |||
| 2401 | Ga0495653_0071329 | |||
| 2402 | Ga0495653_0099008 | |||
| 2403 | Ga0495653_0107923 | |||
| 2404 | Ga0495653_0126719 | |||
| 2405 | Ga0495653_0182106 | |||
| 2406 | Ga0495653_0199359 | |||
| 2407 | Ga0495580_0004371 | |||
| 2408 | Ga0495580_0016668 | |||
| 2409 | Ga0495580_0036169 | |||
| 2410 | Ga0495580_0112747 | |||
| 2411 | Ga0495580_0171263 | |||
| 2412 | Ga0495582_0001211 | |||
| 2413 | Ga0495582_0008405 | |||
| 2414 | Ga0495582_0035034 | |||
| 2415 | Ga0495582_0089844 | |||
| 2416 | Ga0495639_0001832 | |||
| 2417 | Ga0495639_0021230 | |||
| 2418 | Ga0495639_0021980 | |||
| 2419 | Ga0495639_0093254 | |||
| 2420 | Ga0495662_0001706 | |||
| 2421 | Ga0495662_0005333 | |||
| 2422 | Ga0495662_0019268 | |||
| 2423 | Ga0495662_0056962 | |||
| 2424 | Ga0495662_0071230 | |||
| 2425 | Ga0495662_0190035 | |||
| 2426 | Ga0495664_0015997 | |||
| 2427 | Ga0495664_0017591 | |||
| 2428 | Ga0495664_0023104 | |||
| 2429 | Ga0495664_0023548 | |||
| 2430 | Ga0495664_0085245 | |||
| 2431 | Ga0495664_0088493 | |||
| 2432 | Ga0495664_0182922 | |||
| 2433 | Ga0495594_0055096 | |||
| 2434 | Ga0495594_0131569 | |||
| 2435 | Ga0495594_0176015 | |||
| 2436 | Ga0495608_0000015 | |||
| 2437 | Ga0495608_0003113 | |||
| 2438 | Ga0495608_0023384 | |||
| 2439 | Ga0495608_0035583 | |||
| 2440 | Ga0495608_0042228 | |||
| 2441 | Ga0495608_0173290 | |||
| 2442 | Ga0495610_0046672 | |||
| 2443 | Ga0495618_0010247 | |||
| 2444 | Ga0495618_0018166 | |||
| 2445 | Ga0495618_0032650 | |||
| 2446 | Ga0495618_0033505 | |||
| 2447 | Ga0495618_0046890 | |||
| 2448 | Ga0495618_0226819 | |||
| 2449 | Ga0495618_0259084 | |||
| 2450 | Ga0495620_0033763 | |||
| 2451 | Ga0495628_0000737 | |||
| 2452 | Ga0495628_0020395 | |||
| 2453 | Ga0495628_0093629 | |||
| 2454 | Ga0495628_0108065 | |||
| 2455 | Ga0495628_0109645 | |||
| 2456 | Ga0495628_0225522 | |||
| 2457 | Ga0495630_0014740 | |||
| 2458 | Ga0495630_0016397 | |||
| 2459 | Ga0495630_0055377 | |||
| 2460 | Ga0495630_0073436 | |||
| 2461 | Ga0495630_0101875 | |||
| 2462 | Ga0495630_0143227 | |||
| 2463 | Ga0495630_0186032 | |||
| 2464 | Ga0495631_0025563 | |||
| 2465 | Ga0495643_0049805 | |||
| 2466 | Ga0495666_0047449 | |||
| 2467 | Ga0495642_0050632 | |||
| 2468 | Ga0495652_0000074 | |||
| 2469 | Ga0495652_0040395 | |||
| 2470 | Ga0495652_0059276 | |||
| 2471 | Ga0495665_0000709 | |||
| 2472 | Ga0495665_0012143 | |||
| 2473 | Ga0495665_0013704 | |||
| 2474 | Ga0495665_0028260 | |||
| 2475 | Ga0495665_0063921 | |||
| 2476 | Ga0495665_0074025 | |||
| 2477 | Ga0495665_0272085 | |||
| 2478 | Ga0495640_0017253 | |||
| 2479 | Ga0495640_0036412 | |||
| 2480 | Ga0495640_0040539 | |||
| 2481 | Ga0495640_0051504 | |||
| 2482 | Ga0495640_0208143 | |||
| 2483 | Ga0495640_0230679 | |||
| 2484 | Ga0495586_0015922 | |||
| 2485 | Ga0495586_0019276 | |||
| 2486 | Ga0495586_0025942 | |||
| 2487 | Ga0495586_0043843 | |||
| 2488 | Ga0495586_0051127 | |||
| 2489 | Ga0495586_0095013 | |||
| 2490 | Ga0495586_0153479 | |||
| 2491 | Ga0495586_0156678 | |||
| 2492 | Ga0495587_0001582 | |||
| 2493 | Ga0495587_0002197 | |||
| 2494 | Ga0495587_0006439 | |||
| 2495 | Ga0495587_0025644 | |||
| 2496 | Ga0495587_0027425 | |||
| 2497 | Ga0495587_0086010 | |||
| 2498 | Ga0495587_0097585 | |||
| 2499 | Ga0495645_0014511 | |||
| 2500 | Ga0495645_0028722 | |||
| 2501 | Ga0495645_0035518 | |||
| 2502 | Ga0495645_0053202 | |||
| 2503 | Ga0495645_0055341 | |||
| 2504 | Ga0495645_0331087 | |||
| 2505 | Ga0495667_0000033 | |||
| 2506 | Ga0495667_0003838 | |||
| 2507 | Ga0495667_0006453 | |||
| 2508 | Ga0495667_0015200 | |||
| 2509 | Ga0495667_0026409 | |||
| 2510 | Ga0495667_0050559 | |||
| 2511 | Ga0495667_0054161 | |||
| 2512 | Ga0495667_0063129 | |||
| 2513 | Ga0495667_0173149 | |||
| 2514 | Ga0495667_0202688 | |||
| 2515 | Ga0495667_0233168 | |||
| 2516 | Ga0495667_0371471 | |||
| 2517 | Ga0495656_0043226 | |||
| 2518 | Ga0495634_0004914 | |||
| 2519 | Ga0495634_0006863 | |||
| 2520 | Ga0495634_0052289 | |||
| 2521 | Ga0495634_0057233 | |||
| 2522 | Ga0495634_0062630 | |||
| 2523 | Ga0495635_0001151 | |||
| 2524 | Ga0495635_0003052 | |||
| 2525 | Ga0495635_0010933 | |||
| 2526 | Ga0495635_0025589 | |||
| 2527 | Ga0495635_0043517 | |||
| 2528 | Ga0495635_0153485 | |||
| 2529 | Ga0495635_0229102 | |||
| 2530 | Ga0495659_0009118 | |||
| 2531 | Ga0495588_0009692 | |||
| 2532 | Ga0495588_0036359 | |||
| 2533 | Ga0495588_0049669 | |||
| 2534 | Ga0495657_0001345 | |||
| 2535 | Ga0495657_0013216 | |||
| 2536 | Ga0495657_0015858 | |||
| 2537 | Ga0495657_0020960 | |||
| 2538 | Ga0495657_0022556 | |||
| 2539 | Ga0495657_0032716 | |||
| 2540 | Ga0495657_0047774 | |||
| 2541 | Ga0495657_0109004 | |||
| 2542 | Ga0495599_0000018 | |||
| 2543 | Ga0495599_0008300 | |||
| 2544 | Ga0495599_0030869 | |||
| 2545 | Ga0495599_0058667 | |||
| 2546 | Ga0495599_0069816 | |||
| 2547 | Ga0495599_0110027 | |||
| 2548 | Ga0495599_0190784 | |||
| 2549 | Ga0495623_0000075 | |||
| 2550 | Ga0495623_0012733 | |||
| 2551 | Ga0495623_0040315 | |||
| 2552 | Ga0495623_0050129 | |||
| 2553 | Ga0495623_0099298 | |||
| 2554 | Ga0495623_0171860 | |||
| 2555 | Ga0495646_0005199 | |||
| 2556 | Ga0495646_0058945 | |||
| 2557 | Ga0495646_0090788 | |||
| 2558 | Ga0495646_0114864 | |||
| 2559 | Ga0495646_0142086 | |||
| 2560 | Ga0495658_0007844 | |||
| 2561 | Ga0495658_0031150 | |||
| 2562 | Ga0495613_0006775 | |||
| 2563 | Ga0495613_0033390 | |||
| 2564 | Ga0495613_0054248 | |||
| 2565 | Ga0495613_0132890 | |||
| 2566 | Ga0495613_0179312 | |||
| 2567 | Ga0495613_0239717 | |||
| 2568 | Ga0495624_0009190 | |||
| 2569 | Ga0495624_0095250 | |||
| 2570 | Ga0495624_0109554 | |||
| 2571 | Ga0495624_0122669 | |||
| 2572 | Ga0495624_0185385 | |||
| 2573 | Ga0495600_0007035 | |||
| 2574 | Ga0495600_0008415 | |||
| 2575 | Ga0495600_0010982 | |||
| 2576 | Ga0495600_0015979 | |||
| 2577 | Ga0495600_0101597 | |||
| 2578 | Ga0495600_0131703 | |||
| 2579 | Ga0495600_0148859 | |||
| 2580 | Ga0495600_0180257 | |||
| 2581 | Ga0495581_0006935 | |||
| 2582 | Ga0495581_0008284 | |||
| 2583 | Ga0495581_0010908 | |||
| 2584 | Ga0495581_0016572 | |||
| 2585 | Ga0495581_0021236 | |||
| 2586 | Ga0495581_0042980 | |||
| 2587 | Ga0495581_0059559 | |||
| 2588 | Ga0495604_0000025 | |||
| 2589 | Ga0495604_0017705 | |||
| 2590 | Ga0495604_0024002 | |||
| 2591 | Ga0495604_0032506 | |||
| 2592 | Ga0495604_0042546 | |||
| 2593 | Ga0495604_0057467 | |||
| 2594 | Ga0495604_0211629 | |||
| 2595 | Ga0495636_0033001 | |||
| 2596 | Ga0495674_0005960 | |||
| 2597 | Ga0495674_0013242 | |||
| 2598 | Ga0495674_0023719 | |||
| 2599 | Ga0495674_0034845 | |||
| 2600 | Ga0495674_0054121 | |||
| 2601 | Ga0495674_0064350 | |||
| 2602 | Ga0495672_0100302 | |||
| 2603 | Ga0495676_0006692 | |||
| 2604 | Ga0495676_0045371 | |||
| 2605 | Ga0495676_0051299 | |||
| 2606 | Ga0495680_0000015 | |||
| 2607 | Ga0495680_0003725 | |||
| 2608 | Ga0495680_0020712 | |||
| 2609 | Ga0495680_0028691 | |||
| 2610 | Ga0495680_0035526 | |||
| 2611 | Ga0495680_0053573 | |||
| 2612 | Ga0495680_0055477 | |||
| 2613 | Ga0495680_0061328 | |||
| 2614 | Ga0495680_0091614 | |||
| 2615 | Ga0495680_0116839 | |||
| 2616 | Ga0495680_0121746 | |||
| 2617 | Ga0495680_0142002 | |||
| 2618 | Ga0495675_0006002 | |||
| 2619 | Ga0495675_0014139 | |||
| 2620 | Ga0495675_0064853 | |||
| 2621 | Ga0495675_0090742 | |||
| 2622 | Ga0495675_0142855 | |||
| 2623 | Ga0495675_0166250 | |||
| 2624 | Ga0495685_074299 | |||
| 2625 | Ga0495681_0054340 | |||
| 2626 | Ga0495684_0004360 | |||
| 2627 | Ga0495684_0012033 | |||
| 2628 | Ga0495684_0023488 | |||
| 2629 | Ga0495684_0027914 | |||
| 2630 | Ga0495684_0116879 | |||
| 2631 | Ga0495684_0125141 | |||
| 2632 | Ga0495684_0156418 | |||
| 2633 | Ga0495684_0217165 | |||
| 2634 | Ga0495593_0002727 | |||
| 2635 | Ga0495593_0005255 | |||
| 2636 | Ga0495593_0018131 | |||
| 2637 | Ga0495593_0020226 | |||
| 2638 | Ga0495593_0073721 | |||
| 2639 | Ga0495593_0081178 | |||
| 2640 | Ga0495602_0000065 | |||
| 2641 | Ga0495602_0015962 | |||
| 2642 | Ga0495602_0028880 | |||
| 2643 | Ga0495602_0035415 | |||
| 2644 | Ga0495602_0046172 | |||
| 2645 | Ga0495602_0054069 | |||
| 2646 | Ga0495602_0071309 | |||
| 2647 | Ga0495602_0433737 | |||
| 2648 | Ga0495614_0028717 | |||
| 2649 | Ga0495614_0028970 | |||
| 2650 | Ga0495614_0137722 | |||
| 2651 | Ga0496100_0102894 | |||
| 2652 | Ga0496100_0165139 | |||
| 2653 | Ga0496100_0205013 | |||
| 2654 | Ga0496101_0022411 | |||
| 2655 | Ga0496101_0224310 | |||
| 2656 | Ga0496102_0001147 | |||
| 2657 | Ga0496102_0007743 | |||
| 2658 | Ga0496102_0008038 | |||
| 2659 | Ga0496102_0016570 | |||
| 2660 | Ga0496102_0050376 | |||
| 2661 | Ga0496102_0088675 | |||
| 2662 | Ga0496102_0115613 | |||
| 2663 | Ga0496102_0117750 | |||
| 2664 | Ga0496102_0135005 | |||
| 2665 | Ga0496102_0166647 | |||
| 2666 | Ga0496102_0175818 | |||
| 2667 | Ga0496102_0183895 | |||
| 2668 | Ga0496102_0799468 | |||
| 2669 | Ga0496103_0004543 | |||
| 2670 | Ga0496103_0009868 | |||
| 2671 | Ga0496103_0015951 | |||
| 2672 | Ga0496103_0047618 | |||
| 2673 | Ga0496103_0070346 | |||
| 2674 | Ga0496103_0079015 | |||
| 2675 | Ga0496103_0093138 | |||
| 2676 | Ga0496103_0138626 | |||
| 2677 | Ga0496103_0343089 | |||
| 2678 | Ga0496104_0011195 | |||
| 2679 | Ga0496104_0012344 | |||
| 2680 | Ga0496104_0013954 | |||
| 2681 | Ga0496104_0021920 | |||
| 2682 | Ga0496104_0036361 | |||
| 2683 | Ga0496104_0037130 | |||
| 2684 | Ga0496104_0139773 | |||
| 2685 | Ga0496104_0188275 | |||
| 2686 | Ga0496104_0540981 | |||
| 2687 | Ga0496104_0685495 | |||
| 2688 | Ga0496104_0704538 | |||
| 2689 | Ga0496105_0007335 | |||
| 2690 | Ga0496105_0027946 | |||
| 2691 | Ga0496105_0031980 | |||
| 2692 | Ga0496105_0136872 | |||
| 2693 | Ga0496105_0180562 | |||
| 2694 | Ga0496105_0275585 | |||
| 2695 | Ga0496105_0319177 | |||
| 2696 | Ga0496105_0340263 | |||
| 2697 | Ga0496105_0367523 | |||
| 2698 | Ga0496105_0465627 | |||
| 2699 | Ga0496106_0030607 | |||
| 2700 | Ga0496106_0081020 | |||
| 2701 | Ga0496106_0082451 | |||
| 2702 | Ga0496106_0134664 | |||
| 2703 | Ga0496106_0213648 | |||
| 2704 | Ga0496107_0031342 | |||
| 2705 | Ga0496107_0072462 | |||
| 2706 | Ga0496107_0092545 | |||
| 2707 | Ga0496108_0003156 | |||
| 2708 | Ga0496108_0014407 | |||
| 2709 | Ga0496108_0018270 | |||
| 2710 | Ga0496108_0025779 | |||
| 2711 | Ga0496108_0214097 | |||
| 2712 | Ga0496108_0668302 | |||
| 2713 | Ga0496109_0005308 | |||
| 2714 | Ga0496109_0038020 | |||
| 2715 | Ga0496109_0165228 | |||
| 2716 | Ga0496109_0193317 | |||
| 2717 | Ga0496109_0367757 | |||
| 2718 | Ga0496109_0465062 | |||
| 2719 | Ga0496110_0005523 | |||
| 2720 | Ga0496110_0010037 | |||
| 2721 | Ga0496110_0011132 | |||
| 2722 | Ga0496110_0057940 | |||
| 2723 | Ga0496110_0123817 | |||
| 2724 | Ga0496110_0181973 | |||
| 2725 | Ga0496110_0274224 | |||
| 2726 | Ga0496110_0371266 | |||
| 2727 | Ga0496111_0003277 | |||
| 2728 | Ga0496111_0046277 | |||
| 2729 | Ga0496111_0059149 | |||
| 2730 | Ga0496111_0073915 | |||
| 2731 | Ga0496112_0004018 | |||
| 2732 | Ga0496112_0072079 | |||
| 2733 | Ga0496112_0082862 | |||
| 2734 | Ga0496112_0278771 | |||
| 2735 | Ga0496112_0405126 | |||
| 2736 | Ga0496113_0125781 | |||
| 2737 | Ga0496113_0175342 | |||
| 2738 | Ga0496113_0181358 | |||
| 2739 | Ga0496113_0274747 | |||
| 2740 | Ga0496114_0006337 | |||
| 2741 | Ga0496114_0009161 | |||
| 2742 | Ga0496114_0010117 | |||
| 2743 | Ga0496114_0296046 | |||
| 2744 | Ga0496114_0353241 | |||
| 2745 | Ga0496114_0476973 | |||
| 2746 | Ga0496114_0674913 | |||
| 2747 | Ga0496115_0109707 | |||
| 2748 | Ga0496115_0114134 | |||
| 2749 | Ga0496115_0194781 | |||
| 2750 | Ga0496117_0130060 | |||
| 2751 | Ga0496119_0039030 | |||
| 2752 | Ga0496124_0075900 | |||
| 2753 | Ga0496124_0195148 | |||
| 2754 | Ga0496125_0140995 | |||
| 2755 | Ga0496126_0007772 | |||
| 2756 | Ga0496126_0124145 | |||
| 2757 | Ga0496126_0319714 | |||
| 2758 | Ga0501031_0053545 | |||
| 2759 | Ga0501034_0028563 | |||
| 2760 | Ga0501034_0388411 | |||
| 2761 | Ga0501036_0006249 | |||
| 2762 | Ga0501037_0035170 | |||
| 2763 | Ga0501037_0046940 | |||
| 2764 | Ga0501038_0001144 | |||
| 2765 | Ga0501038_0101197 | |||
| 2766 | Ga0501039_0073454 | |||
| 2767 | Ga0501039_0093563 | |||
| 2768 | Ga0501040_0005550 | |||
| 2769 | Ga0501040_0129168 | |||
| 2770 | Ga0501041_0000946 | |||
| 2771 | Ga0501042_0006519 | |||
| 2772 | Ga0501042_0007655 | |||
| 2773 | Ga0501043_0012741 | |||
| 2774 | Ga0501043_0068779 | |||
| 2775 | Ga0501046_0011693 | |||
| 2776 | Ga0501047_0000142 | |||
| 2777 | Ga0501047_0034147 | |||
| 2778 | Ga0501047_0320376 | |||
| 2779 | Ga0501047_0368362 | |||
| 2780 | Ga0501048_0040438 | |||
| 2781 | Ga0501048_0056247 | |||
| 2782 | Ga0501067_0025344 | |||
| 2783 | Ga0501067_0049319 | |||
| 2784 | Ga0501069_0020370 | |||
| 2785 | Ga0501070_0114313 | |||
| 2786 | Ga0501071_0000522 | |||
| 2787 | Ga0501072_0007902 | |||
| 2788 | Ga0501073_0007656 | |||
| 2789 | Ga0501073_0180435 | |||
| 2790 | Ga0501074_0001769 | |||
| 2791 | Ga0501074_0012148 | |||
| 2792 | Ga0501075_0052999 | |||
| 2793 | Ga0501075_0309393 | |||
| 2794 | Ga0501076_0001397 | |||
| 2795 | Ga0501079_0007061 | |||
| 2796 | Ga0501080_0036643 | |||
| 2797 | Ga0501081_0033385 | |||
| 2798 | Ga0501035_0073011 | |||
| 2799 | Ga0501044_0057615 | |||
| 2800 | Ga0501045_0001418 | |||
| 2801 | Ga0501045_0128299 | |||
| 2802 | Ga0501045_0143278 | |||
| 2803 | nmdc:mga0yw44_327743_c1 | |||
| 2804 | nmdc:mga0yw44_41168_c1 | |||
| 2805 | nmdc:mga06z11_15499_c1 | |||
| 2806 | nmdc:mga06z11_362014_c1 | |||
| 2807 | nmdc:mga05p37_1011693_c1 | |||
| 2808 | nmdc:mga05p37_11636_c1 | |||
| 2809 | nmdc:mga05p37_203002_c1 | |||
| 2810 | nmdc:mga05p37_493541_c1 | |||
| 2811 | nmdc:mga05p37_64391_c1 | |||
| 2812 | nmdc:mga05p37_815_c1 | |||
| 2813 | nmdc:mga05p37_9788_c1 | |||
| 2814 | nmdc:mga09592_108713_c1 | |||
| 2815 | nmdc:mga09592_349381_c1 | |||
| 2816 | nmdc:mga09592_96632_c1 | |||
| 2817 | nmdc:mga0qj67_148242_c1 | |||
| 2818 | nmdc:mga0qj67_341211_c1 | |||
| 2819 | nmdc:mga06r32_120339_c1 | |||
| 2820 | nmdc:mga06r32_269928_c1 | |||
| 2821 | nmdc:mga06r32_484819_c1 | |||
| 2822 | nmdc:mga06r32_555_c1 | |||
| 2823 | nmdc:mga08y16_13789_c1 | |||
| 2824 | nmdc:mga08y16_25766_c1 | |||
| 2825 | nmdc:mga08y16_2869_c1 | |||
| 2826 | nmdc:mga0n895_18318_c1 | |||
| 2827 | nmdc:mga0n895_2559_c1 | |||
| 2828 | nmdc:mga0n895_25683_c1 | |||
| 2829 | nmdc:mga0n895_9919_c1 | |||
| 2830 | nmdc:mga0rr50_218038_c1 | |||
| 2831 | nmdc:mga08x19_2217_c1 | |||
| 2832 | nmdc:mga08x19_24349_c1 | |||
| 2833 | nmdc:mga08x19_282208_c1 | |||
| 2834 | nmdc:mga08x19_461869_c1 | |||
| 2835 | nmdc:mga0a205_22726_c1 | |||
| 2836 | nmdc:mga0a205_42649_c1 | |||
| 2837 | nmdc:mga0a205_51921_c1 | |||
| 2838 | nmdc:mga0a205_6990_c1 | |||
| 2839 | Ga0495601_0026743 | |||
| 2840 | Ga0495601_0064932 | |||
| 2841 | Ga0495601_0082067 | |||
| 2842 | Ga0495601_0086935 | |||
| 2843 | Ga0495601_0192021 | |||
| 2844 | Ga0495612_0000871 | |||
| 2845 | Ga0495612_0017277 | |||
| 2846 | Ga0495612_0026922 | |||
| 2847 | Ga0495612_0039608 | |||
| 2848 | Ga0495612_0049375 | |||
| 2849 | Ga0495595_0001179 | |||
| 2850 | Ga0495595_0006228 | |||
| 2851 | Ga0495595_0025853 | |||
| 2852 | Ga0495595_0051393 | |||
| 2853 | Ga0495595_0190837 | |||
| 2854 | Ga0495619_0039553 | |||
| 2855 | Ga0495619_0084061 | |||
| 2856 | Ga0495619_0231472 | |||
| 2857 | Ga0501084_0003958 | |||
| 2858 | Ga0590075_021409 | |||
| 2859 | Ga0501082_0003209 | |||
| 2860 | Ga0501082_0057334 | |||
| 2861 | Ga0466962_0022908 | |||
| 2862 | Ga0466962_0025908 | |||
| 2863 | Ga0466962_0063119 | |||
| 2864 | Ga0466962_0153770 | |||
| 2865 | Ga0530510_0018420 | |||
| 2866 | Ga0530510_0069360 | |||
| 2867 | Ga0530510_0256115 | |||
| 2868 | 2537897869 | |||
| 2869 | 2644526702 | |||
| 2870 | 2644611205 | |||
| 2871 | 2644670556 | |||
| 2872 | 2676495084 | |||
| 2873 | 2768646664 | |||
| 2874 | 2775656908 | |||
| 2875 | 2784472230 | |||
| 2876 | 2808831129 | |||
| 2877 | 2808852393 | |||
| 2878 | 2808879315 | |||
| 2879 | 2808896439 | |||
| 2880 | 2810363754 | |||
| 2881 | 2812321175 | |||
| 2882 | 2812375004 | |||
| 2883 | 2819427746 | |||
| 2884 | 2819691759 | |||
| 2885 | 2819729467 | |||
| 2886 | 2856743494 | |||
| 2887 | 2862706621 | |||
| 2888 | 2873314945 | |||
| 2889 | 2884694273 | |||
| 2890 | 2891402564 | |||
| 2891 | 2891554893 | |||
| 2892 | 2891562797 | |||
| 2893 | 2895435668 | |||
| 2894 | 2895444713 | |||
| 2895 | 2905930886 | |||
| 2896 | 2932434693 | |||
| 2897 | 2945918934 | |||
| 2898 | 2946062785 | |||
| 2899 | 2954000409 | |||
| 2900 | 2974306914 | |||
| 2901 | 2990044591 | |||
| 2902 | 3001891493 | |||
| 2903 | 3003002262 | |||
| 2904 | 8004022743 | |||
| 2905 | 8004029419 | |||
| 2906 | 8008489218 | |||
| 2907 | 8025527549 | |||
| 2908 | 8053951764 | |||
| 2909 | 8054612961 | |||
| 2910 | 8055072627 | |||
| 2911 | 8055175737 | |||
| 2912 | 8056582024 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ihy-assembly1.cif.gz_A | structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter | 0.943 | 2 | 260 |
| 2ihy-assembly1.cif.gz_A | structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter | 0.9393 | 2 | 260 |
| 2ihy-assembly1.cif.gz_B | structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter | 0.9315 | 1 | 260 |
| 4yer-assembly1.cif.gz_B | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9293 | 1 | 232 |
| 4hzi-assembly1.cif.gz_A | crystal structure of the leptospira interrogans atpase subunit of an orphan abc transporter | 0.9065 | 2 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YF11_12_276_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9704 | 3 | 261 | 3.40.50.300 |
| af_Q2FWA1_1_260_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9603 | 4 | 261 | 3.40.50.300 |
| af_I6YF11_12_276_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9521 | 3 | 261 | 3.40.50.300 |
| af_Q2FWA1_1_260_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9496 | 4 | 261 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9214 | 5 | 227 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7Y3Q6-F1-model_v4 | ABC-2 type transport system ATP-binding protein | 0.9239 | 5 | 232 |
GO:0005524
GO:0016887 |
| AF-A0A2N6SMT4-F1-model_v4 | ABC transporter | 0.9206 | 4 | 260 |
GO:0005524
GO:0016887 |
| AF-A0A352RIQ6-F1-model_v4 | ABC transporter ATP-binding protein | 0.916 | 5 | 227 |
GO:0005524
GO:0016887 |
| AF-A0A7C4NAX2-F1-model_v4 | Nitrous oxide reductase family maturation protein NosD | 0.9142 | 5 | 238 |
GO:0005524
GO:0016887 |
| AF-A0A7X7G2J4-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9123 | 5 | 233 |
GO:0005524
GO:0005886 GO:0016887 |