F494091

General Info

Members Datasets Scaffolds Average Seq Length
1456 493 2913 124

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0371742|Ga0495647_0371742_171_623
Length 150
Sequence MCSRRWVSASASGCEGDAMNHPEDPVIPAEAGDGEPPPNRVMLPTLETPTLTKAELAELLFERLGLNKRESKDMVEAFFDLIHATLVSGDDVKMSGFGNFNIRRKAPRPGRNPRTGEAIPIKARNVVTFHASHKLKGVVQGDIPPEEEFE

Samples

Sample ID Description Type Environment
1 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
112 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
113 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
114 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
115 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
208 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
218 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
238 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
239 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
240 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
241 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
242 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
243 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
244 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
247 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
249 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
257 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
258 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
259 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
260 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
261 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
273 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
274 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
275 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
276 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
277 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
278 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
279 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
280 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
281 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
282 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
283 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
286 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
287 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
288 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
289 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
290 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
291 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
292 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
293 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
294 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
295 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
296 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
297 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
298 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
299 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
300 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
301 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
302 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
303 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
304 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
305 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
306 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
307 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
308 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
309 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
310 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
311 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
312 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
313 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
314 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
315 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
316 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
317 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
318 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
319 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
320 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
321 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
322 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
323 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
324 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
327 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
328 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
329 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
330 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
331 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
334 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
338 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
339 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
340 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
341 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
342 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
343 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
344 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
345 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
346 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
347 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
348 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
349 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
350 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
351 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
352 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
353 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
354 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
355 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
356 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
359 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
360 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
361 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
362 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
365 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
366 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
369 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
370 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
371 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
372 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
373 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
374 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
375 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
376 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
379 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
380 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
381 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
382 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
383 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
398 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
399 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
400 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
401 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
405 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
406 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
407 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
408 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
409 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
410 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
411 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
419 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
420 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
421 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
422 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
423 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
424 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
425 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
426 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
427 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
428 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
429 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
430 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
431 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
432 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
433 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
434 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
435 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
436 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
437 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
438 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
439 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
440 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
441 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
445 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
446 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
447 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
448 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
449 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
450 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
451 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
452 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
453 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
454 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
455 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
456 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
457 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
458 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
459 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
460 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
461 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
462 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
463 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
464 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
465 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
466 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
467 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
468 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
469 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
470 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
471 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
472 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
473 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
474 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
475 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
476 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
477 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
478 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
479 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
480 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
481 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
482 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
483 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
484 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
485 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
486 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
487 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
488 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
489 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
490 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
491 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
492 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
493 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.55
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.53
Nodule 0.14
Rhizoplane 3.98
Rhizosphere 76.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495647_0371742 3300046681 Bacteria 653
2 JGI24033J26618_1036228 3300002155 Bacteria 677
3 JGI25150J39212_1006308 3300002774 Bacteria 2457
4 JGI25153J46596_10009043 3300003215 Bacteria 4682
5 JGI25153J46596_10030106 3300003215 Bacteria 1853
6 rootH1_10062755 3300003316 Bacteria 1416
7 rootH2_10019535 3300003320 Bacteria 3072
8 rootL2_10003847 3300003322 Bacteria 35009
9 rootL2_10005851 3300003322 Bacteria 11114
10 rootH1_10023641 3300003316 Bacteria 1142
11 rootH1_10023641 3300003323 Bacteria 1358
12 rootH1_10108114 3300003323 Bacteria 1001
13 JGI26145J50221_1002180 3300003371 Bacteria 1539
14 Ga0055526_1001112 3300003771 Bacteria 19553
15 Ga0055530_10058995 3300003791 Bacteria 862
16 Ga0055540_1022368 3300003792 Bacteria 1618
17 Ga0055540_1112627 3300003792 Bacteria 501
18 Ga0055531_10001930 3300003794 Bacteria 14509
19 Ga0055531_10046861 3300003794 Bacteria 1183
20 Ga0055543_1002155 3300004625 Bacteria 6796
21 Ga0065165_1000184 3300005262 Bacteria 109539
22 Ga0065165_1006209 3300005262 Bacteria 6370
23 Ga0065715_10121665 3300005293 Bacteria 2223
24 Ga0065715_10195151 3300005293 Bacteria 1392
25 Ga0065715_10493371 3300005293 Bacteria 786
26 Ga0065707_10082794 3300005295 Bacteria 12061
27 Ga0065707_10327756 3300005295 Bacteria 939
28 Ga0065707_10422887 3300005295 Bacteria 829
29 Ga0065707_10568002 3300005295 Bacteria 706
30 Ga0070658_10085385 3300005327 Bacteria 2596
31 Ga0070658_10255739 3300005327 Bacteria 1486
32 Ga0070658_10560847 3300005327 Bacteria 989
33 Ga0070676_10002035 3300005328 Bacteria 10267
34 Ga0070676_10088789 3300005328 Bacteria 1889
35 Ga0070676_10151549 3300005328 Bacteria 1485
36 Ga0070676_10167278 3300005328 Bacteria 1420
37 Ga0070676_10443337 3300005328 Bacteria 911
38 Ga0070676_11619813 3300005328 Bacteria 500
39 Ga0070683_100049615 3300005329 Bacteria 3883
40 Ga0070683_101356018 3300005329 Bacteria 683
41 Ga0070690_100016127 3300005330 Bacteria 4469
42 Ga0070690_100020915 3300005330 Bacteria 3991
43 Ga0070670_100001136 3300005331 Bacteria 21141
44 Ga0070670_100020708 3300005331 Bacteria 5656
45 Ga0070670_100034250 3300005331 Bacteria 4371
46 Ga0070670_100065307 3300005331 Bacteria 3123
47 Ga0070670_100379370 3300005331 Bacteria 1245
48 Ga0070670_100417662 3300005331 Bacteria 1186
49 Ga0070670_100842064 3300005331 Bacteria 830
50 Ga0070670_101220447 3300005331 Bacteria 687
51 Ga0070670_101945992 3300005331 Bacteria 541
52 Ga0070670_102100816 3300005331 Bacteria 520
53 Ga0070677_10046190 3300005333 Bacteria 1740
54 Ga0070677_10051350 3300005333 Bacteria 1668
55 Ga0070677_10140396 3300005333 Bacteria 1113
56 Ga0070677_10558075 3300005333 Bacteria 629
57 Ga0068869_100003616 3300005334 Bacteria 9485
58 Ga0068869_100013951 3300005334 Bacteria 5359
59 Ga0068869_100084261 3300005334 Bacteria 2379
60 Ga0068869_100138200 3300005334 Bacteria 1879
61 Ga0068869_100230986 3300005334 Bacteria 1470
62 Ga0070666_10051060 3300005335 Bacteria 2783
63 Ga0070666_10058891 3300005335 Bacteria 2598
64 Ga0070666_10402295 3300005335 Bacteria 984
65 Ga0070666_10542382 3300005335 Bacteria 845
66 Ga0070666_10799652 3300005335 Bacteria 694
67 Ga0070680_100656390 3300005336 Bacteria 902
68 Ga0070682_100040490 3300005337 Bacteria 2868
69 Ga0070682_101024262 3300005337 Bacteria 687
70 Ga0068868_100000818 3300005338 Bacteria 21090
71 Ga0068868_100014677 3300005338 Bacteria 5777
72 Ga0068868_100019252 3300005338 Bacteria 5113
73 Ga0068868_100035823 3300005338 Bacteria 3838
74 Ga0068868_100132399 3300005338 Bacteria 2041
75 Ga0068868_100193168 3300005338 Bacteria 1694
76 Ga0068868_100327318 3300005338 Bacteria 1307
77 Ga0068868_100542579 3300005338 Bacteria 1024
78 Ga0068868_101203844 3300005338 Bacteria 700
79 Ga0070660_100046927 3300005339 Bacteria 3312
80 Ga0070660_100168309 3300005339 Bacteria 1769
81 Ga0070660_100822386 3300005339 Bacteria 782
82 Ga0070689_100147818 3300005340 Bacteria 1894
83 Ga0070689_100391053 3300005340 Bacteria 1174
84 Ga0070689_102135811 3300005340 Bacteria 513
85 Ga0070691_10912387 3300005341 Bacteria 543
86 Ga0070687_101180020 3300005343 Bacteria 563
87 Ga0070661_100000791 3300005344 Bacteria 22707
88 Ga0070661_100020436 3300005344 Bacteria 4721
89 Ga0070661_100061356 3300005344 Bacteria 2759
90 Ga0070661_100084411 3300005344 Bacteria 2346
91 Ga0070661_100309400 3300005344 Bacteria 1231
92 Ga0070661_101008793 3300005344 Bacteria 691
93 Ga0070668_100050350 3300005347 Bacteria 3207
94 Ga0070668_100367400 3300005347 Bacteria 1221
95 Ga0070668_101635463 3300005347 Bacteria 590
96 Ga0070669_100119297 3300005353 Bacteria 2010
97 Ga0070669_100124487 3300005353 Bacteria 1971
98 Ga0070669_100391317 3300005353 Bacteria 1135
99 Ga0070669_100527011 3300005353 Bacteria 983
100 Ga0070669_100579569 3300005353 Bacteria 938
101 Ga0070669_100636036 3300005353 Bacteria 896
102 Ga0070675_100000269 3300005354 Bacteria 34213
103 Ga0070675_100001006 3300005354 Bacteria 20229
104 Ga0070675_100001473 3300005354 Bacteria 17347
105 Ga0070675_100004442 3300005354 Bacteria 10691
106 Ga0070675_100034940 3300005354 Bacteria 4082
107 Ga0070675_100067143 3300005354 Bacteria 2967
108 Ga0070675_100130871 3300005354 Bacteria 2138
109 Ga0070675_100149834 3300005354 Bacteria 1999
110 Ga0070675_100851828 3300005354 Bacteria 834
111 Ga0070675_101266567 3300005354 Bacteria 679
112 Ga0070671_100021062 3300005355 Bacteria 5322
113 Ga0070671_100025141 3300005355 Bacteria 4883
114 Ga0070671_100054032 3300005355 Bacteria 3338
115 Ga0070671_100056765 3300005355 Bacteria 3258
116 Ga0070671_100109545 3300005355 Bacteria 2319
117 Ga0070671_100232448 3300005355 Bacteria 1564
118 Ga0070671_100350208 3300005355 Bacteria 1260
119 Ga0070671_100496619 3300005355 Bacteria 1049
120 Ga0070671_100697473 3300005355 Bacteria 880
121 Ga0070671_101263473 3300005355 Bacteria 651
122 Ga0070674_100011798 3300005356 Bacteria 5334
123 Ga0070674_100013715 3300005356 Bacteria 5016
124 Ga0070674_100026145 3300005356 Bacteria 3808
125 Ga0070674_100155833 3300005356 Bacteria 1728
126 Ga0070674_100224261 3300005356 Bacteria 1464
127 Ga0070674_100232817 3300005356 Bacteria 1438
128 Ga0070674_100235016 3300005356 Bacteria 1432
129 Ga0070674_100255810 3300005356 Bacteria 1377
130 Ga0070674_100486718 3300005356 Bacteria 1025
131 Ga0070674_102072756 3300005356 Bacteria 518
132 Ga0070673_100008559 3300005364 Bacteria 6809
133 Ga0070673_100071365 3300005364 Bacteria 2790
134 Ga0070673_100075952 3300005364 Bacteria 2711
135 Ga0070673_100240978 3300005364 Bacteria 1572
136 Ga0070673_100274092 3300005364 Bacteria 1478
137 Ga0070673_100481228 3300005364 Bacteria 1120
138 Ga0070673_100796000 3300005364 Bacteria 873
139 Ga0070688_100284908 3300005365 Bacteria 1189
140 Ga0070688_100445952 3300005365 Bacteria 967
141 Ga0070659_100000451 3300005366 Bacteria 30634
142 Ga0070659_100010741 3300005366 Bacteria 6748
143 Ga0070659_100010749 3300005366 Bacteria 6746
144 Ga0070659_100076710 3300005366 Bacteria 2664
145 Ga0070659_101845862 3300005366 Bacteria 542
146 Ga0070667_100003333 3300005367 Bacteria 13717
147 Ga0070667_100023446 3300005367 Bacteria 5120
148 Ga0070667_100069129 3300005367 Bacteria 3005
149 Ga0070667_100087470 3300005367 Bacteria 2674
150 Ga0070667_100107798 3300005367 Bacteria 2412
151 Ga0070667_100109237 3300005367 Bacteria 2397
152 Ga0070667_100576390 3300005367 Bacteria 1036
153 Ga0070667_100751731 3300005367 Bacteria 904
154 Ga0070667_100763566 3300005367 Bacteria 897
155 Ga0070667_100893616 3300005367 Bacteria 827
156 Ga0070667_102045404 3300005367 Bacteria 539
157 Ga0070701_10883299 3300005438 Bacteria 616
158 Ga0070701_11166487 3300005438 Bacteria 545
159 Ga0070700_100131463 3300005441 Bacteria 1690
160 Ga0070663_100009632 3300005455 Bacteria 5990
161 Ga0070663_100019349 3300005455 Bacteria 4485
162 Ga0070663_100096616 3300005455 Bacteria 2198
163 Ga0070663_100436341 3300005455 Bacteria 1077
164 Ga0070663_100464499 3300005455 Bacteria 1045
165 Ga0070663_100627191 3300005455 Bacteria 907
166 Ga0070663_101685724 3300005455 Bacteria 566
167 Ga0070678_100011667 3300005456 Bacteria 5431
168 Ga0070678_100018712 3300005456 Bacteria 4496
169 Ga0070678_100039403 3300005456 Bacteria 3333
170 Ga0070678_100089762 3300005456 Bacteria 2353
171 Ga0070678_100159972 3300005456 Bacteria 1823
172 Ga0070678_100325158 3300005456 Bacteria 1314
173 Ga0070678_100341685 3300005456 Bacteria 1284
174 Ga0070678_100477001 3300005456 Bacteria 1097
175 Ga0070678_100581749 3300005456 Bacteria 997
176 Ga0070678_100809159 3300005456 Bacteria 851
177 Ga0070678_101606426 3300005456 Bacteria 610
178 Ga0070662_100001019 3300005457 Bacteria 17139
179 Ga0070662_100011240 3300005457 Bacteria 5901
180 Ga0070662_100023675 3300005457 Bacteria 4221
181 Ga0070662_100127956 3300005457 Bacteria 1954
182 Ga0070662_100170413 3300005457 Bacteria 1709
183 Ga0070662_100199797 3300005457 Bacteria 1586
184 Ga0070662_100444044 3300005457 Bacteria 1076
185 Ga0070662_100533932 3300005457 Bacteria 981
186 Ga0070662_101081723 3300005457 Bacteria 688
187 Ga0070681_10197965 3300005458 Bacteria 1928
188 Ga0070681_10278698 3300005458 Bacteria 1583
189 Ga0068867_100000102 3300005459 Bacteria 54275
190 Ga0068867_100016344 3300005459 Bacteria 5268
191 Ga0068867_100019254 3300005459 Bacteria 4864
192 Ga0068867_100021121 3300005459 Bacteria 4644
193 Ga0068867_100024764 3300005459 Bacteria 4301
194 Ga0068867_100034247 3300005459 Bacteria 3680
195 Ga0068867_100048865 3300005459 Bacteria 3113
196 Ga0068867_100256542 3300005459 Bacteria 1424
197 Ga0068867_100743637 3300005459 Bacteria 869
198 Ga0068867_100851984 3300005459 Bacteria 817
199 Ga0068867_101856265 3300005459 Bacteria 567
200 Ga0070685_10204044 3300005466 Bacteria 1287
201 Ga0070685_10319507 3300005466 Bacteria 1052
202 Ga0070685_10725257 3300005466 Bacteria 727
203 Ga0070706_100222505 3300005467 Bacteria 1762
204 Ga0070706_100894898 3300005467 Bacteria 820
205 Ga0070706_101269687 3300005467 Bacteria 676
206 Ga0070706_101283998 3300005467 Bacteria 672
207 Ga0070707_100068338 3300005468 Bacteria 3419
208 Ga0070707_101793977 3300005468 Bacteria 581
209 Ga0070699_100333141 3300005518 Bacteria 1365
210 Ga0070679_100008517 3300005530 Bacteria 9663
211 Ga0070684_100080735 3300005535 Bacteria 2877
212 Ga0070684_100357163 3300005535 Bacteria 1344
213 Ga0068853_100039549 3300005539 Bacteria 4023
214 Ga0068853_100082693 3300005539 Bacteria 2812
215 Ga0068853_100289610 3300005539 Bacteria 1511
216 Ga0068853_100585456 3300005539 Bacteria 1059
217 Ga0068853_100672118 3300005539 Bacteria 987
218 Ga0068853_102216775 3300005539 Bacteria 532
219 Ga0070672_100000367 3300005543 Bacteria 25974
220 Ga0070672_100005175 3300005543 Bacteria 8622
221 Ga0070672_100029306 3300005543 Bacteria 4127
222 Ga0070672_100053519 3300005543 Bacteria 3156
223 Ga0070672_100070307 3300005543 Bacteria 2781
224 Ga0070672_100076494 3300005543 Bacteria 2674
225 Ga0070672_100091204 3300005543 Bacteria 2458
226 Ga0070672_100126183 3300005543 Bacteria 2099
227 Ga0070672_100143469 3300005543 Bacteria 1971
228 Ga0070672_100286296 3300005543 Bacteria 1394
229 Ga0070672_100631445 3300005543 Bacteria 935
230 Ga0070672_101237673 3300005543 Bacteria 665
231 Ga0070672_101527324 3300005543 Bacteria 598
232 Ga0070686_100584919 3300005544 Bacteria 878
233 Ga0070686_101249616 3300005544 Bacteria 618
234 Ga0070686_101904375 3300005544 Bacteria 507
235 Ga0070695_100895853 3300005545 Bacteria 716
236 Ga0070693_100021069 3300005547 Bacteria 3448
237 Ga0070693_100127276 3300005547 Bacteria 1587
238 Ga0070665_100197332 3300005548 Bacteria 2013
239 Ga0070665_101042928 3300005548 Bacteria 830
240 Ga0070665_101238790 3300005548 Bacteria 756
241 Ga0070665_101321897 3300005548 Bacteria 731
242 Ga0070665_101550683 3300005548 Bacteria 671
243 Ga0068855_100063871 3300005563 Bacteria 4295
244 Ga0068855_100124744 3300005563 Bacteria 2945
245 Ga0070664_100000524 3300005564 Bacteria 29185
246 Ga0070664_100003061 3300005564 Bacteria 13518
247 Ga0070664_100163926 3300005564 Bacteria 1968
248 Ga0070664_100212193 3300005564 Bacteria 1730
249 Ga0070664_100344962 3300005564 Bacteria 1353
250 Ga0070664_100601512 3300005564 Bacteria 1020
251 Ga0070664_100879653 3300005564 Bacteria 839
252 Ga0070664_100976988 3300005564 Bacteria 795
253 Ga0068857_100008620 3300005577 Bacteria 8823
254 Ga0068857_100230301 3300005577 Bacteria 1694
255 Ga0068857_100300894 3300005577 Bacteria 1478
256 Ga0068857_100430985 3300005577 Bacteria 1231
257 Ga0068857_101833039 3300005577 Bacteria 594
258 Ga0068854_100020602 3300005578 Bacteria 4465
259 Ga0068854_100139888 3300005578 Bacteria 1856
260 Ga0068854_100542159 3300005578 Bacteria 985
261 Ga0068854_101163122 3300005578 Bacteria 690
262 Ga0068856_100006422 3300005614 Bacteria 11535
263 Ga0068856_100015458 3300005614 Bacteria 7374
264 Ga0068856_100057763 3300005614 Bacteria 3831
265 Ga0068856_101078255 3300005614 Bacteria 821
266 Ga0068856_102086819 3300005614 Bacteria 577
267 Ga0070702_100164921 3300005615 Bacteria 1436
268 Ga0070702_101036618 3300005615 Bacteria 652
269 Ga0068852_100003787 3300005616 Bacteria 10603
270 Ga0068852_100018700 3300005616 Bacteria 5463
271 Ga0068852_100025312 3300005616 Bacteria 4807
272 Ga0068852_100214846 3300005616 Bacteria 1826
273 Ga0068852_100217237 3300005616 Bacteria 1817
274 Ga0068852_100221503 3300005616 Bacteria 1799
275 Ga0068852_100260265 3300005616 Bacteria 1666
276 Ga0068852_100947732 3300005616 Bacteria 879
277 Ga0068852_101078970 3300005616 Bacteria 823
278 Ga0068852_101547430 3300005616 Bacteria 685
279 Ga0068852_102020113 3300005616 Bacteria 599
280 Ga0068859_100166319 3300005617 Bacteria 2285
281 Ga0068859_100617641 3300005617 Bacteria 1177
282 Ga0068859_101094095 3300005617 Bacteria 877
283 Ga0068859_102786939 3300005617 Bacteria 537
284 Ga0068864_100020683 3300005618 Bacteria 5507
285 Ga0068864_100028571 3300005618 Bacteria 4716
286 Ga0068864_100045025 3300005618 Bacteria 3785
287 Ga0068864_100066554 3300005618 Bacteria 3128
288 Ga0068864_100113586 3300005618 Bacteria 2414
289 Ga0068864_100188680 3300005618 Bacteria 1888
290 Ga0068864_100351616 3300005618 Bacteria 1390
291 Ga0068864_100378150 3300005618 Bacteria 1341
292 Ga0068864_100679397 3300005618 Bacteria 1004
293 Ga0068864_101506658 3300005618 Bacteria 676
294 Ga0068866_10029696 3300005718 Bacteria 2617
295 Ga0068866_10060240 3300005718 Bacteria 1967
296 Ga0068866_10083662 3300005718 Bacteria 1720
297 Ga0068866_10134098 3300005718 Bacteria 1412
298 Ga0068861_100002334 3300005719 Bacteria 12330
299 Ga0068861_100007942 3300005719 Bacteria 7301
300 Ga0068861_100042320 3300005719 Bacteria 3413
301 Ga0068861_100273857 3300005719 Bacteria 1451
302 Ga0068861_101213756 3300005719 Bacteria 730
303 Ga0068861_101679098 3300005719 Bacteria 628
304 Ga0068861_102670825 3300005719 Bacteria 504
305 Ga0068851_10010578 3300005834 Bacteria 4308
306 Ga0068851_10053755 3300005834 Bacteria 2051
307 Ga0068851_10126112 3300005834 Bacteria 1380
308 Ga0068851_10221816 3300005834 Bacteria 1062
309 Ga0068851_10379856 3300005834 Bacteria 827
310 Ga0068851_10508047 3300005834 Bacteria 723
311 Ga0068851_11080222 3300005834 Bacteria 508
312 Ga0068870_10349316 3300005840 Bacteria 949
313 Ga0068870_10691859 3300005840 Bacteria 702
314 Ga0068870_10979031 3300005840 Bacteria 602
315 Ga0068870_11021070 3300005840 Bacteria 591
316 Ga0068863_100029644 3300005841 Bacteria 5223
317 Ga0068863_100052427 3300005841 Bacteria 3866
318 Ga0068863_100056820 3300005841 Bacteria 3704
319 Ga0068863_100097913 3300005841 Bacteria 2786
320 Ga0068863_100128349 3300005841 Bacteria 2420
321 Ga0068863_100209124 3300005841 Bacteria 1878
322 Ga0068863_100297393 3300005841 Bacteria 1565
323 Ga0068863_100305432 3300005841 Bacteria 1544
324 Ga0068863_100326831 3300005841 Bacteria 1490
325 Ga0068858_100001369 3300005842 Bacteria 25137
326 Ga0068858_100012867 3300005842 Bacteria 7890
327 Ga0068858_100014492 3300005842 Bacteria 7428
328 Ga0068858_100019550 3300005842 Bacteria 6333
329 Ga0068858_100586552 3300005842 Bacteria 1081
330 Ga0068858_100593919 3300005842 Bacteria 1074
331 Ga0068858_100681293 3300005842 Bacteria 1000
332 Ga0068860_100002243 3300005843 Bacteria 20349
333 Ga0068860_100011668 3300005843 Bacteria 8662
334 Ga0068860_100058883 3300005843 Bacteria 3652
335 Ga0068860_100065639 3300005843 Bacteria 3446
336 Ga0068860_101082211 3300005843 Bacteria 821
337 Ga0068860_102398962 3300005843 Bacteria 548
338 Ga0068862_100003264 3300005844 Bacteria 14033
339 Ga0068862_100006660 3300005844 Bacteria 9581
340 Ga0068862_100201826 3300005844 Bacteria 1793
341 Ga0068862_100289662 3300005844 Bacteria 1503
342 Ga0068862_100642219 3300005844 Bacteria 1023
343 Ga0068862_102653626 3300005844 Bacteria 513
344 Ga0075365_10071131 3300006038 Bacteria 2341
345 Ga0075368_10027258 3300006042 Bacteria 2202
346 Ga0075368_10044569 3300006042 Bacteria 1750
347 Ga0075368_10132483 3300006042 Bacteria 1036
348 Ga0075368_10469290 3300006042 Bacteria 559
349 Ga0075363_100017431 3300006048 Bacteria 3562
350 Ga0075363_100691326 3300006048 Bacteria 615
351 Ga0070716_100377044 3300006173 Bacteria 1013
352 Ga0075362_10015137 3300006177 Bacteria 3132
353 Ga0075362_10024416 3300006177 Bacteria 2564
354 Ga0075362_10118069 3300006177 Bacteria 1254
355 Ga0075362_10120485 3300006177 Bacteria 1242
356 Ga0075362_10262805 3300006177 Bacteria 851
357 Ga0075367_10002153 3300006178 Bacteria 8863
358 Ga0075367_10106569 3300006178 Bacteria 1717
359 Ga0075367_10540917 3300006178 Bacteria 739
360 Ga0075369_10158584 3300006186 Bacteria 1036
361 Ga0075369_10237193 3300006186 Bacteria 846
362 Ga0075369_10541228 3300006186 Bacteria 555
363 Ga0075366_10000953 3300006195 Bacteria 14096
364 Ga0075366_10011821 3300006195 Bacteria 4938
365 Ga0075366_10012199 3300006195 Bacteria 4871
366 Ga0075366_10016893 3300006195 Bacteria 4194
367 Ga0075366_10032816 3300006195 Bacteria 3057
368 Ga0075366_10035903 3300006195 Bacteria 2922
369 Ga0075366_10036799 3300006195 Bacteria 2886
370 Ga0075366_10038857 3300006195 Bacteria 2811
371 Ga0075366_10053567 3300006195 Bacteria 2397
372 Ga0075366_10057998 3300006195 Bacteria 2300
373 Ga0075366_10084998 3300006195 Bacteria 1892
374 Ga0075366_10109724 3300006195 Bacteria 1659
375 Ga0075366_10130981 3300006195 Bacteria 1513
376 Ga0075366_10140401 3300006195 Bacteria 1460
377 Ga0075366_10177719 3300006195 Bacteria 1292
378 Ga0075366_10216436 3300006195 Bacteria 1167
379 Ga0075366_10218687 3300006195 Bacteria 1160
380 Ga0075366_10240109 3300006195 Bacteria 1104
381 Ga0075366_10343606 3300006195 Bacteria 915
382 Ga0075366_10718359 3300006195 Bacteria 621
383 Ga0075366_10733945 3300006195 Bacteria 614
384 Ga0097621_100025627 3300006237 Bacteria 4615
385 Ga0097621_100035295 3300006237 Bacteria 3995
386 Ga0097621_100215455 3300006237 Bacteria 1671
387 Ga0097621_100474969 3300006237 Bacteria 1129
388 Ga0097621_100513842 3300006237 Bacteria 1086
389 Ga0097621_100852260 3300006237 Bacteria 847
390 Ga0097621_101454911 3300006237 Bacteria 649
391 Ga0075370_10000895 3300006353 Bacteria 12211
392 Ga0075370_10010826 3300006353 Bacteria 4780
393 Ga0075370_10011595 3300006353 Bacteria 4636
394 Ga0075370_10026609 3300006353 Bacteria 3205
395 Ga0075370_10038797 3300006353 Bacteria 2681
396 Ga0075370_10049848 3300006353 Bacteria 2374
397 Ga0075370_10072515 3300006353 Bacteria 1971
398 Ga0075370_10094627 3300006353 Bacteria 1725
399 Ga0075370_10096140 3300006353 Bacteria 1711
400 Ga0075370_10218808 3300006353 Bacteria 1125
401 Ga0075370_10409958 3300006353 Bacteria 813
402 Ga0075370_10433789 3300006353 Bacteria 790
403 Ga0075370_10527534 3300006353 Bacteria 713
404 Ga0075370_10643318 3300006353 Bacteria 643
405 Ga0075370_10654221 3300006353 Bacteria 638
406 Ga0068871_100004241 3300006358 Bacteria 9937
407 Ga0068871_100094517 3300006358 Bacteria 2495
408 Ga0068871_100195365 3300006358 Bacteria 1745
409 Ga0068871_100614112 3300006358 Bacteria 990
410 Ga0068871_101606850 3300006358 Bacteria 615
411 Ga0068871_101863082 3300006358 Bacteria 571
412 Ga0068871_102233905 3300006358 Bacteria 521
413 Ga0075430_100025745 3300006846 Bacteria 5006
414 Ga0075433_10658183 3300006852 Bacteria 918
415 Ga0075429_100034324 3300006880 Bacteria 4408
416 Ga0075429_101789318 3300006880 Bacteria 533
417 Ga0068865_100036691 3300006881 Bacteria 3306
418 Ga0068865_100125124 3300006881 Bacteria 1918
419 Ga0068865_100139010 3300006881 Bacteria 1829
420 Ga0068865_100188351 3300006881 Bacteria 1594
421 Ga0068865_100532660 3300006881 Bacteria 984
422 Ga0068865_100625864 3300006881 Bacteria 912
423 Ga0068865_100714478 3300006881 Bacteria 857
424 Ga0068865_101013388 3300006881 Bacteria 728
425 Ga0097620_100166332 3300006931 Bacteria 2285
426 Ga0097620_100617651 3300006931 Bacteria 1177
427 Ga0097620_100709335 3300006931 Bacteria 1096
428 Ga0097620_101094136 3300006931 Bacteria 877
429 Ga0097620_102786881 3300006931 Bacteria 537
430 Ga0099823_1000164 3300006944 Bacteria 35666
431 Ga0075435_100757518 3300007076 Bacteria 845
432 Ga0105251_10594277 3300009011 Bacteria 525
433 Ga0105240_10020928 3300009093 Bacteria 8710
434 Ga0105240_10091540 3300009093 Bacteria 3715
435 Ga0105240_10192337 3300009093 Bacteria 2398
436 Ga0105240_10514691 3300009093 Bacteria 1329
437 Ga0105240_11916636 3300009093 Bacteria 616
438 Ga0105240_11999306 3300009093 Bacteria 602
439 Ga0111539_11587541 3300009094 Bacteria 759
440 Ga0105245_10004781 3300009098 Bacteria 11952
441 Ga0105245_10447177 3300009098 Bacteria 1300
442 Ga0105245_10848886 3300009098 Bacteria 953
443 Ga0114129_10457333 3300009147 Bacteria 1673
444 Ga0114129_10582865 3300009147 Bacteria 1451
445 Ga0105243_10001238 3300009148 Bacteria 22984
446 Ga0105243_10070292 3300009148 Bacteria 2826
447 Ga0105243_10185578 3300009148 Bacteria 1812
448 Ga0105243_10282955 3300009148 Bacteria 1495
449 Ga0105243_10448998 3300009148 Bacteria 1209
450 Ga0105243_10691013 3300009148 Bacteria 993
451 Ga0105241_10619696 3300009174 Bacteria 979
452 Ga0105241_10740028 3300009174 Bacteria 901
453 Ga0105241_10920631 3300009174 Bacteria 813
454 Ga0105242_10078680 3300009176 Bacteria 2753
455 Ga0105242_10261291 3300009176 Bacteria 1564
456 Ga0105242_13280570 3300009176 Bacteria 503
457 Ga0105248_10025146 3300009177 Bacteria 6619
458 Ga0105248_10115604 3300009177 Bacteria 3026
459 Ga0105248_10126227 3300009177 Bacteria 2886
460 Ga0105248_10560532 3300009177 Bacteria 1289
461 Ga0105237_10010119 3300009545 Bacteria 10053
462 Ga0105238_10020844 3300009551 Bacteria 6677
463 Ga0105238_10261763 3300009551 Bacteria 1709
464 Ga0105238_10609897 3300009551 Bacteria 1100
465 Ga0105238_10711555 3300009551 Bacteria 1017
466 Ga0105238_10960111 3300009551 Bacteria 875
467 Ga0105249_10015679 3300009553 Bacteria 6710
468 Ga0105249_10022012 3300009553 Bacteria 5708
469 Ga0105249_10027380 3300009553 Bacteria 5142
470 Ga0105239_10000914 3300010375 Bacteria 41919
471 Ga0105239_10253069 3300010375 Bacteria 1978
472 Ga0105239_11107013 3300010375 Bacteria 912
473 Ga0105239_11416417 3300010375 Bacteria 802
474 Ga0105239_13094518 3300010375 Bacteria 542
475 Ga0105246_11304357 3300011119 Bacteria 673
476 Ga0105246_11406569 3300011119 Bacteria 651
477 Ga0157340_1013755 3300012473 Bacteria 611
478 Ga0157325_1018032 3300012485 Bacteria 603
479 Ga0157319_1000009 3300012497 Bacteria 227971
480 Ga0157315_1006689 3300012508 Bacteria 910
481 Ga0157327_1050875 3300012512 Bacteria 589
482 Ga0157373_10178978 3300013100 Bacteria 1493
483 Ga0157373_10547074 3300013100 Bacteria 839
484 Ga0157373_11048390 3300013100 Bacteria 610
485 Ga0157371_10273729 3300013102 Bacteria 1219
486 Ga0157371_10393527 3300013102 Bacteria 1013
487 Ga0157370_10300284 3300013104 Bacteria 1482
488 Ga0157370_10603805 3300013104 Bacteria 1005
489 Ga0157370_10896628 3300013104 Bacteria 805
490 Ga0157369_10038041 3300013105 Bacteria 5263
491 Ga0157369_10720988 3300013105 Bacteria 1026
492 Ga0157369_11860210 3300013105 Bacteria 611
493 Ga0157374_10031516 3300013296 Bacteria 4819
494 Ga0157374_10071656 3300013296 Bacteria 3268
495 Ga0157374_10091743 3300013296 Bacteria 2897
496 Ga0157374_10109095 3300013296 Bacteria 2661
497 Ga0157374_10347798 3300013296 Bacteria 1473
498 Ga0157378_10013493 3300013297 Bacteria 7145
499 Ga0157378_10024860 3300013297 Bacteria 5275
500 Ga0157378_10083591 3300013297 Bacteria 2889
501 Ga0157378_10206658 3300013297 Bacteria 1860
502 Ga0157378_10234741 3300013297 Bacteria 1749
503 Ga0157378_10565633 3300013297 Bacteria 1144
504 Ga0157378_12004026 3300013297 Bacteria 629
505 Ga0163162_10036220 3300013306 Bacteria 4916
506 Ga0163162_10050457 3300013306 Bacteria 4172
507 Ga0163162_10133273 3300013306 Bacteria 2595
508 Ga0163162_10531748 3300013306 Bacteria 1305
509 Ga0163162_10603819 3300013306 Bacteria 1223
510 Ga0163162_10628255 3300013306 Bacteria 1199
511 Ga0163162_10632997 3300013306 Bacteria 1194
512 Ga0163162_10941602 3300013306 Bacteria 975
513 Ga0163162_11862038 3300013306 Bacteria 688
514 Ga0157372_10219116 3300013307 Bacteria 2206
515 Ga0157372_10424816 3300013307 Bacteria 1549
516 Ga0157372_10822618 3300013307 Bacteria 1079
517 Ga0157372_12403121 3300013307 Bacteria 605
518 Ga0157375_10006998 3300013308 Bacteria 9848
519 Ga0157375_10012615 3300013308 Bacteria 7499
520 Ga0157375_10014610 3300013308 Bacteria 7012
521 Ga0157375_10017183 3300013308 Bacteria 6522
522 Ga0157375_10097705 3300013308 Bacteria 3012
523 Ga0157375_10132410 3300013308 Bacteria 2614
524 Ga0157375_10204193 3300013308 Bacteria 2132
525 Ga0157375_10751085 3300013308 Bacteria 1127
526 Ga0157375_11566463 3300013308 Bacteria 779
527 Ga0157375_11827134 3300013308 Bacteria 721
528 Ga0157375_12140135 3300013308 Bacteria 666
529 Ga0163163_10000864 3300014325 Bacteria 25838
530 Ga0163163_11053786 3300014325 Bacteria 876
531 Ga0157380_10057760 3300014326 Bacteria 3091
532 Ga0157380_10172521 3300014326 Bacteria 1891
533 Ga0157380_10202828 3300014326 Bacteria 1761
534 Ga0157380_10696184 3300014326 Bacteria 1020
535 Ga0157380_11033392 3300014326 Bacteria 857
536 Ga0157380_11358176 3300014326 Bacteria 760
537 Ga0157377_10000014 3300014745 Bacteria 213961
538 Ga0157377_10002696 3300014745 Bacteria 7892
539 Ga0157377_10709345 3300014745 Bacteria 731
540 Ga0157377_10808312 3300014745 Bacteria 692
541 Ga0157379_10004431 3300014968 Bacteria 12036
542 Ga0157379_10028700 3300014968 Bacteria 4948
543 Ga0157379_10031149 3300014968 Bacteria 4751
544 Ga0157379_10053888 3300014968 Bacteria 3593
545 Ga0157379_10077404 3300014968 Bacteria 2978
546 Ga0157379_10212028 3300014968 Bacteria 1753
547 Ga0157379_10341460 3300014968 Bacteria 1370
548 Ga0157379_10412328 3300014968 Bacteria 1243
549 Ga0157379_10562367 3300014968 Bacteria 1062
550 Ga0157376_10024497 3300014969 Bacteria 4739
551 Ga0157376_10135295 3300014969 Bacteria 2205
552 Ga0157376_10144432 3300014969 Bacteria 2139
553 Ga0157376_10238764 3300014969 Bacteria 1692
554 Ga0157376_10246313 3300014969 Bacteria 1667
555 Ga0157376_10541042 3300014969 Bacteria 1151
556 Ga0157376_10555117 3300014969 Bacteria 1137
557 Ga0157376_10589480 3300014969 Bacteria 1105
558 Ga0157376_12906528 3300014969 Bacteria 518
559 Ga0182006_1211916 3300015261 Bacteria 640
560 Ga0182007_10266367 3300015262 Bacteria 619
561 Ga0182005_1091227 3300015265 Bacteria 847
562 Ga0163161_10012297 3300017792 Bacteria 5941
563 Ga0163161_10019156 3300017792 Bacteria 4798
564 Ga0163161_10040590 3300017792 Bacteria 3343
565 Ga0163161_10123509 3300017792 Bacteria 1947
566 Ga0163161_10181451 3300017792 Bacteria 1614
567 Ga0163161_10268707 3300017792 Bacteria 1334
568 Ga0206353_10514887 3300020082 Bacteria 583
569 Ga0213872_10002349 3300021361 Bacteria 11240
570 Ga0213872_10043062 3300021361 Bacteria 2058
571 Ga0213872_10251285 3300021361 Bacteria 745
572 Ga0209258_120493 3300025242 Bacteria 692
573 Ga0207425_1000511 3300025245 Bacteria 23911
574 Ga0209129_1002180 3300025258 Bacteria 9862
575 Ga0209129_1026616 3300025258 Bacteria 997
576 Ga0207666_1048305 3300025271 Bacteria 672
577 Ga0209673_1009744 3300025273 Bacteria 4123
578 Ga0209673_1012171 3300025273 Bacteria 3486
579 Ga0209673_1029638 3300025273 Bacteria 1739
580 Ga0209564_1000003 3300025295 Bacteria 1585848
581 Ga0209564_1000196 3300025295 Bacteria 141368
582 Ga0209758_1000181 3300025297 Bacteria 140847
583 Ga0209758_1000207 3300025297 Bacteria 129217
584 Ga0209050_1000858 3300025298 Bacteria 41211
585 Ga0209050_1001266 3300025298 Bacteria 29109
586 Ga0209050_1006370 3300025298 Bacteria 7004
587 Ga0209256_1031332 3300025299 Bacteria 1455
588 Ga0209256_1074696 3300025299 Bacteria 753
589 Ga0209051_1002697 3300025303 Bacteria 12355
590 Ga0209051_1012833 3300025303 Bacteria 4029
591 Ga0209051_1043460 3300025303 Bacteria 1577
592 Ga0209257_1000021 3300025304 Bacteria 771986
593 Ga0209257_1005175 3300025304 Bacteria 9399
594 Ga0209257_1015510 3300025304 Bacteria 3165
595 Ga0209257_1042771 3300025304 Bacteria 1334
596 Ga0209257_1153677 3300025304 Bacteria 504
597 Ga0207697_10110727 3300025315 Bacteria 1176
598 Ga0207656_10014661 3300025321 Bacteria 3024
599 Ga0207656_10082290 3300025321 Bacteria 1449
600 Ga0207656_10127880 3300025321 Bacteria 1188
601 Ga0207656_10147672 3300025321 Bacteria 1111
602 Ga0207656_10245505 3300025321 Bacteria 876
603 Ga0207656_10311423 3300025321 Bacteria 781
604 Ga0207682_10027282 3300025893 Bacteria 2273
605 Ga0207682_10043554 3300025893 Bacteria 1837
606 Ga0207642_10002666 3300025899 Bacteria 5560
607 Ga0207642_10012484 3300025899 Bacteria 3068
608 Ga0207642_10052446 3300025899 Bacteria 1850
609 Ga0207710_10156056 3300025900 Bacteria 1109
610 Ga0207688_10034955 3300025901 Bacteria 2784
611 Ga0207680_10005278 3300025903 Bacteria 6166
612 Ga0207680_10041270 3300025903 Bacteria 2691
613 Ga0207680_10185664 3300025903 Bacteria 1409
614 Ga0207680_10586460 3300025903 Bacteria 797
615 Ga0207685_10302143 3300025905 Bacteria 792
616 Ga0207645_10001190 3300025907 Bacteria 21497
617 Ga0207645_10029270 3300025907 Bacteria 3551
618 Ga0207645_10079243 3300025907 Bacteria 2105
619 Ga0207645_10140960 3300025907 Bacteria 1571
620 Ga0207645_10182418 3300025907 Bacteria 1377
621 Ga0207645_10192193 3300025907 Bacteria 1342
622 Ga0207643_10318077 3300025908 Bacteria 971
623 Ga0207643_10832915 3300025908 Bacteria 598
624 Ga0207643_10996285 3300025908 Bacteria 542
625 Ga0207705_10024072 3300025909 Bacteria 4345
626 Ga0207705_10039570 3300025909 Bacteria 3380
627 Ga0207705_10431687 3300025909 Bacteria 1021
628 Ga0207705_10956916 3300025909 Bacteria 662
629 Ga0207684_10015609 3300025910 Bacteria 6537
630 Ga0207684_10544836 3300025910 Bacteria 993
631 Ga0207654_10451245 3300025911 Bacteria 902
632 Ga0207654_10717037 3300025911 Bacteria 719
633 Ga0207654_10764005 3300025911 Bacteria 697
634 Ga0207707_10292186 3300025912 Bacteria 1410
635 Ga0207707_10324237 3300025912 Bacteria 1329
636 Ga0207695_10016280 3300025913 Bacteria 8710
637 Ga0207695_10519502 3300025913 Bacteria 1072
638 Ga0207695_10637486 3300025913 Bacteria 947
639 Ga0207671_10006390 3300025914 Bacteria 10506
640 Ga0207660_10101515 3300025917 Bacteria 2149
641 Ga0207662_10061901 3300025918 Bacteria 2248
642 Ga0207657_10024402 3300025919 Bacteria 5599
643 Ga0207657_10145653 3300025919 Bacteria 1932
644 Ga0207657_10675112 3300025919 Bacteria 803
645 Ga0207649_10001484 3300025920 Bacteria 13768
646 Ga0207649_10009940 3300025920 Bacteria 5214
647 Ga0207649_10409486 3300025920 Bacteria 1016
648 Ga0207649_10737510 3300025920 Bacteria 766
649 Ga0207649_11134876 3300025920 Bacteria 617
650 Ga0207652_10077074 3300025921 Bacteria 2908
651 Ga0207646_10307947 3300025922 Bacteria 1431
652 Ga0207681_10000214 3300025923 Bacteria 45816
653 Ga0207681_10099546 3300025923 Bacteria 2094
654 Ga0207681_10161918 3300025923 Bacteria 1688
655 Ga0207681_10192341 3300025923 Bacteria 1562
656 Ga0207681_10279077 3300025923 Bacteria 1315
657 Ga0207681_10439878 3300025923 Bacteria 1059
658 Ga0207681_10466410 3300025923 Bacteria 1029
659 Ga0207681_10691665 3300025923 Bacteria 847
660 Ga0207694_10009034 3300025924 Bacteria 7522
661 Ga0207694_10207529 3300025924 Bacteria 1595
662 Ga0207694_10478137 3300025924 Bacteria 1042
663 Ga0207694_11061595 3300025924 Bacteria 685
664 Ga0207650_10000937 3300025925 Bacteria 21987
665 Ga0207650_10002494 3300025925 Bacteria 12790
666 Ga0207650_10103958 3300025925 Bacteria 2191
667 Ga0207650_10143131 3300025925 Bacteria 1881
668 Ga0207650_10195655 3300025925 Bacteria 1617
669 Ga0207650_10273263 3300025925 Bacteria 1374
670 Ga0207650_10426023 3300025925 Bacteria 1102
671 Ga0207650_10777543 3300025925 Bacteria 811
672 Ga0207650_11545158 3300025925 Bacteria 564
673 Ga0207659_10004306 3300025926 Bacteria 8603
674 Ga0207659_10004991 3300025926 Bacteria 8039
675 Ga0207659_10017778 3300025926 Bacteria 4649
676 Ga0207659_10017801 3300025926 Bacteria 4648
677 Ga0207659_10055052 3300025926 Bacteria 2843
678 Ga0207659_10092294 3300025926 Bacteria 2263
679 Ga0207659_10482749 3300025926 Bacteria 1047
680 Ga0207659_10985527 3300025926 Bacteria 725
681 Ga0207687_10280279 3300025927 Bacteria 1336
682 Ga0207687_10506091 3300025927 Bacteria 1008
683 Ga0207687_10949392 3300025927 Bacteria 737
684 Ga0207687_11141610 3300025927 Bacteria 669
685 Ga0207644_10010554 3300025931 Bacteria 6089
686 Ga0207644_10014021 3300025931 Bacteria 5357
687 Ga0207644_10024213 3300025931 Bacteria 4165
688 Ga0207644_10044789 3300025931 Bacteria 3145
689 Ga0207644_10057347 3300025931 Bacteria 2812
690 Ga0207644_10196979 3300025931 Bacteria 1587
691 Ga0207644_11520441 3300025931 Bacteria 562
692 Ga0207644_11806127 3300025931 Bacteria 511
693 Ga0207690_10002792 3300025932 Bacteria 10532
694 Ga0207690_10017607 3300025932 Bacteria 4367
695 Ga0207690_10035310 3300025932 Bacteria 3229
696 Ga0207690_10084537 3300025932 Bacteria 2224
697 Ga0207690_10240615 3300025932 Bacteria 1394
698 Ga0207706_10000449 3300025933 Bacteria 43973
699 Ga0207706_10003147 3300025933 Bacteria 15850
700 Ga0207706_10018191 3300025933 Bacteria 6322
701 Ga0207706_10033988 3300025933 Bacteria 4538
702 Ga0207706_10322887 3300025933 Bacteria 1343
703 Ga0207706_10356451 3300025933 Bacteria 1271
704 Ga0207706_10506314 3300025933 Bacteria 1042
705 Ga0207706_10507711 3300025933 Bacteria 1040
706 Ga0207706_11135284 3300025933 Bacteria 652
707 Ga0207686_10008428 3300025934 Bacteria 5564
708 Ga0207686_10076296 3300025934 Bacteria 2173
709 Ga0207686_11064645 3300025934 Bacteria 658
710 Ga0207709_10000804 3300025935 Bacteria 24412
711 Ga0207709_10022408 3300025935 Bacteria 3583
712 Ga0207709_10264068 3300025935 Bacteria 1264
713 Ga0207709_10300940 3300025935 Bacteria 1192
714 Ga0207709_10937051 3300025935 Bacteria 705
715 Ga0207670_10120453 3300025936 Bacteria 1906
716 Ga0207670_10711682 3300025936 Bacteria 832
717 Ga0207670_11767725 3300025936 Bacteria 526
718 Ga0207669_10020710 3300025937 Bacteria 3455
719 Ga0207669_10031788 3300025937 Bacteria 2954
720 Ga0207669_10147654 3300025937 Bacteria 1642
721 Ga0207669_10158936 3300025937 Bacteria 1593
722 Ga0207669_10183787 3300025937 Bacteria 1501
723 Ga0207669_10301815 3300025937 Bacteria 1217
724 Ga0207669_10363569 3300025937 Bacteria 1122
725 Ga0207669_10458253 3300025937 Bacteria 1012
726 Ga0207669_10919911 3300025937 Bacteria 731
727 Ga0207704_10003076 3300025938 Bacteria 7541
728 Ga0207704_10026016 3300025938 Bacteria 3203
729 Ga0207704_10133576 3300025938 Bacteria 1723
730 Ga0207704_10184203 3300025938 Bacteria 1512
731 Ga0207704_10455008 3300025938 Bacteria 1022
732 Ga0207704_10471995 3300025938 Bacteria 1005
733 Ga0207704_10504016 3300025938 Bacteria 976
734 Ga0207704_10879031 3300025938 Bacteria 753
735 Ga0207665_10358200 3300025939 Bacteria 1102
736 Ga0207665_11537807 3300025939 Bacteria 528
737 Ga0207691_10001841 3300025940 Bacteria 20724
738 Ga0207691_10024826 3300025940 Bacteria 5634
739 Ga0207691_10045546 3300025940 Bacteria 4031
740 Ga0207691_10120992 3300025940 Bacteria 2320
741 Ga0207691_10202067 3300025940 Bacteria 1729
742 Ga0207691_10214760 3300025940 Bacteria 1670
743 Ga0207691_10230990 3300025940 Bacteria 1602
744 Ga0207691_10545743 3300025940 Bacteria 983
745 Ga0207691_10593261 3300025940 Bacteria 938
746 Ga0207691_10617357 3300025940 Bacteria 917
747 Ga0207691_11111503 3300025940 Bacteria 657
748 Ga0207711_10036125 3300025941 Bacteria 4191
749 Ga0207711_10040995 3300025941 Bacteria 3941
750 Ga0207711_10043521 3300025941 Bacteria 3831
751 Ga0207711_10056982 3300025941 Bacteria 3359
752 Ga0207711_10069942 3300025941 Bacteria 3043
753 Ga0207711_10077629 3300025941 Bacteria 2895
754 Ga0207711_10401642 3300025941 Bacteria 1273
755 Ga0207689_10001542 3300025942 Bacteria 21888
756 Ga0207689_10016843 3300025942 Bacteria 6185
757 Ga0207689_10099988 3300025942 Bacteria 2383
758 Ga0207689_10126213 3300025942 Bacteria 2105
759 Ga0207689_10154252 3300025942 Bacteria 1893
760 Ga0207689_10187388 3300025942 Bacteria 1706
761 Ga0207689_10276067 3300025942 Bacteria 1391
762 Ga0207661_10061440 3300025944 Bacteria 3035
763 Ga0207661_10179565 3300025944 Bacteria 1848
764 Ga0207661_10771878 3300025944 Bacteria 885
765 Ga0207679_10000220 3300025945 Bacteria 45059
766 Ga0207679_10017939 3300025945 Bacteria 4730
767 Ga0207679_11027953 3300025945 Bacteria 755
768 Ga0207667_10187364 3300025949 Bacteria 2124
769 Ga0207667_11371211 3300025949 Bacteria 681
770 Ga0207651_10007714 3300025960 Bacteria 5751
771 Ga0207651_10017944 3300025960 Bacteria 4196
772 Ga0207651_10023971 3300025960 Bacteria 3765
773 Ga0207651_10026542 3300025960 Bacteria 3621
774 Ga0207651_10179679 3300025960 Bacteria 1677
775 Ga0207651_10318084 3300025960 Bacteria 1300
776 Ga0207651_10420766 3300025960 Bacteria 1140
777 Ga0207651_10616424 3300025960 Bacteria 950
778 Ga0207651_11566746 3300025960 Bacteria 593
779 Ga0207712_10003685 3300025961 Bacteria 9663
780 Ga0207712_10037266 3300025961 Bacteria 3316
781 Ga0207712_10485526 3300025961 Bacteria 1054
782 Ga0207668_10007597 3300025972 Bacteria 6454
783 Ga0207668_10081814 3300025972 Bacteria 2344
784 Ga0207668_10083356 3300025972 Bacteria 2326
785 Ga0207668_10130917 3300025972 Bacteria 1915
786 Ga0207668_10589541 3300025972 Bacteria 967
787 Ga0207668_11135661 3300025972 Bacteria 701
788 Ga0207640_10480671 3300025981 Bacteria 1030
789 Ga0207640_10570827 3300025981 Bacteria 953
790 Ga0207658_10002329 3300025986 Bacteria 13956
791 Ga0207658_10003279 3300025986 Bacteria 11495
792 Ga0207658_10092681 3300025986 Bacteria 2347
793 Ga0207658_10297802 3300025986 Bacteria 1388
794 Ga0207658_10525847 3300025986 Bacteria 1056
795 Ga0207658_10751053 3300025986 Bacteria 883
796 Ga0207658_10786591 3300025986 Bacteria 863
797 Ga0207658_10902915 3300025986 Bacteria 804
798 Ga0207677_10004256 3300026023 Bacteria 7657
799 Ga0207677_10010920 3300026023 Bacteria 5158
800 Ga0207677_10064331 3300026023 Bacteria 2554
801 Ga0207677_10305442 3300026023 Bacteria 1316
802 Ga0207677_10324344 3300026023 Bacteria 1281
803 Ga0207677_10611657 3300026023 Bacteria 957
804 Ga0207677_10670329 3300026023 Bacteria 917
805 Ga0207677_11399452 3300026023 Bacteria 644
806 Ga0207703_10003713 3300026035 Bacteria 12704
807 Ga0207703_10013980 3300026035 Bacteria 6258
808 Ga0207703_11136695 3300026035 Bacteria 750
809 Ga0207639_10023473 3300026041 Bacteria 4454
810 Ga0207639_10038242 3300026041 Bacteria 3569
811 Ga0207639_10062937 3300026041 Bacteria 2871
812 Ga0207639_10108330 3300026041 Bacteria 2259
813 Ga0207639_11079247 3300026041 Bacteria 753
814 Ga0207639_11219935 3300026041 Bacteria 706
815 Ga0207639_11794840 3300026041 Bacteria 574
816 Ga0207678_10006005 3300026067 Bacteria 10804
817 Ga0207678_10268879 3300026067 Bacteria 1461
818 Ga0207678_10295515 3300026067 Bacteria 1391
819 Ga0207678_10528083 3300026067 Bacteria 1030
820 Ga0207708_10127265 3300026075 Bacteria 1989
821 Ga0207702_10012956 3300026078 Bacteria 6937
822 Ga0207702_10023008 3300026078 Bacteria 5169
823 Ga0207702_10336198 3300026078 Bacteria 1442
824 Ga0207702_10488907 3300026078 Bacteria 1198
825 Ga0207702_10880880 3300026078 Bacteria 887
826 Ga0207641_10015342 3300026088 Bacteria 6278
827 Ga0207641_10022787 3300026088 Bacteria 5156
828 Ga0207641_10040936 3300026088 Bacteria 3882
829 Ga0207641_10050442 3300026088 Bacteria 3520
830 Ga0207641_10053534 3300026088 Bacteria 3421
831 Ga0207641_10091665 3300026088 Bacteria 2660
832 Ga0207641_10109554 3300026088 Bacteria 2446
833 Ga0207641_10275304 3300026088 Bacteria 1581
834 Ga0207641_10410947 3300026088 Bacteria 1301
835 Ga0207648_10000062 3300026089 Bacteria 99889
836 Ga0207648_10005680 3300026089 Bacteria 12515
837 Ga0207648_10016056 3300026089 Bacteria 6860
838 Ga0207648_10022315 3300026089 Bacteria 5687
839 Ga0207648_10027768 3300026089 Bacteria 5022
840 Ga0207648_10039524 3300026089 Bacteria 4148
841 Ga0207648_10046362 3300026089 Bacteria 3811
842 Ga0207648_10155583 3300026089 Bacteria 2018
843 Ga0207648_10222240 3300026089 Bacteria 1679
844 Ga0207648_10299880 3300026089 Bacteria 1441
845 Ga0207648_10376683 3300026089 Bacteria 1283
846 Ga0207648_10538976 3300026089 Bacteria 1071
847 Ga0207648_10627432 3300026089 Bacteria 992
848 Ga0207676_10027995 3300026095 Bacteria 4204
849 Ga0207676_10040197 3300026095 Bacteria 3583
850 Ga0207676_10042173 3300026095 Bacteria 3508
851 Ga0207676_10148970 3300026095 Bacteria 2013
852 Ga0207676_10154293 3300026095 Bacteria 1981
853 Ga0207676_10174215 3300026095 Bacteria 1877
854 Ga0207676_10451756 3300026095 Bacteria 1211
855 Ga0207676_10579893 3300026095 Bacteria 1075
856 Ga0207676_10621491 3300026095 Bacteria 1040
857 Ga0207674_10008358 3300026116 Bacteria 11971
858 Ga0207674_10016738 3300026116 Bacteria 8012
859 Ga0207674_10117874 3300026116 Bacteria 2625
860 Ga0207674_10251500 3300026116 Bacteria 1714
861 Ga0207674_10579628 3300026116 Bacteria 1084
862 Ga0207674_10625124 3300026116 Bacteria 1040
863 Ga0207674_10685603 3300026116 Bacteria 989
864 Ga0207675_100000214 3300026118 Bacteria 54263
865 Ga0207675_100014189 3300026118 Bacteria 7430
866 Ga0207675_100115029 3300026118 Bacteria 2541
867 Ga0207675_100157793 3300026118 Bacteria 2163
868 Ga0207675_100358683 3300026118 Bacteria 1430
869 Ga0207675_101058402 3300026118 Bacteria 830
870 Ga0207683_10012322 3300026121 Bacteria 7298
871 Ga0207683_10041309 3300026121 Bacteria 4027
872 Ga0207683_10052458 3300026121 Bacteria 3574
873 Ga0207683_10111911 3300026121 Bacteria 2445
874 Ga0207683_10133661 3300026121 Bacteria 2232
875 Ga0207683_10196025 3300026121 Bacteria 1835
876 Ga0207683_10316180 3300026121 Bacteria 1430
877 Ga0207683_10465761 3300026121 Bacteria 1166
878 Ga0207683_10594593 3300026121 Bacteria 1024
879 Ga0207683_10848548 3300026121 Bacteria 848
880 Ga0207698_10003539 3300026142 Bacteria 9418
881 Ga0207698_10005500 3300026142 Bacteria 7837
882 Ga0207698_10006533 3300026142 Bacteria 7284
883 Ga0207698_10055990 3300026142 Bacteria 3043
884 Ga0207698_10064769 3300026142 Bacteria 2866
885 Ga0207698_10265655 3300026142 Bacteria 1579
886 Ga0207698_10292521 3300026142 Bacteria 1512
887 Ga0207698_10684324 3300026142 Bacteria 1019
888 Ga0207698_10742882 3300026142 Bacteria 979
889 Ga0207698_10743730 3300026142 Bacteria 979
890 Ga0207698_10991956 3300026142 Bacteria 850
891 Ga0207698_11079274 3300026142 Bacteria 815
892 Ga0209389_1037396 3300027296 Bacteria 3861
893 Ga0209371_1023370 3300027312 Bacteria 1456
894 Ga0209971_1044781 3300027682 Bacteria 1066
895 Ga0209813_10009766 3300027866 Bacteria 2465
896 Ga0209974_10000044 3300027876 Bacteria 31037
897 Ga0268266_10129746 3300028379 Bacteria 2253
898 Ga0268266_10242316 3300028379 Bacteria 1665
899 Ga0268266_11030168 3300028379 Bacteria 796
900 Ga0268266_11263554 3300028379 Bacteria 713
901 Ga0268265_10009334 3300028380 Bacteria 6630
902 Ga0268265_10039299 3300028380 Bacteria 3487
903 Ga0268265_10308172 3300028380 Bacteria 1429
904 Ga0268265_10624783 3300028380 Bacteria 1032
905 Ga0268265_11008029 3300028380 Bacteria 823
906 Ga0268264_10001033 3300028381 Bacteria 27952
907 Ga0268264_10072983 3300028381 Bacteria 2911
908 Ga0268264_10241607 3300028381 Bacteria 1673
909 Ga0268264_10263534 3300028381 Bacteria 1607
910 Ga0268264_10624264 3300028381 Bacteria 1064
911 Ga0268264_11109104 3300028381 Bacteria 800
912 Ga0268264_11375056 3300028381 Bacteria 716
913 Ga0307517_10000708 3300028786 Bacteria 57419
914 Ga0307517_10118579 3300028786 Bacteria 1969
915 Ga0307517_10273449 3300028786 Bacteria 969
916 Ga0307517_10410674 3300028786 Bacteria 713
917 Ga0307515_10000150 3300028794 Bacteria 169644
918 Ga0307515_10000187 3300028794 Bacteria 151904
919 Ga0307515_10005172 3300028794 Bacteria 26524
920 Ga0307515_10015579 3300028794 Bacteria 13992
921 Ga0307515_10032801 3300028794 Bacteria 8581
922 Ga0307515_10064599 3300028794 Bacteria 5115
923 Ga0307515_10096842 3300028794 Bacteria 3613
924 Ga0307515_10216175 3300028794 Bacteria 1747
925 Ga0307515_10259736 3300028794 Bacteria 1475
926 Ga0307515_10327804 3300028794 Bacteria 1192
927 Ga0307515_10343198 3300028794 Bacteria 1144
928 Ga0268256_1025964 3300030500 Bacteria 1480
929 Ga0307512_10109325 3300030522 Bacteria 1830
930 Ga0307512_10145132 3300030522 Bacteria 1438
931 Ga0307512_10231385 3300030522 Bacteria 949
932 Ga0307513_10017100 3300031456 Bacteria 8714
933 Ga0307513_10115414 3300031456 Bacteria 2667
934 Ga0307513_10122795 3300031456 Bacteria 2560
935 Ga0307513_10124857 3300031456 Bacteria 2532
936 Ga0307509_10034015 3300031507 Bacteria 5603
937 Ga0307509_10039232 3300031507 Bacteria 5160
938 Ga0307509_10185497 3300031507 Bacteria 1939
939 Ga0307509_10212909 3300031507 Bacteria 1755
940 Ga0307408_100000010 3300031548 Bacteria 420048
941 Ga0307408_100018381 3300031548 Bacteria 4692
942 Ga0307408_100113110 3300031548 Bacteria 2089
943 Ga0307408_100400521 3300031548 Bacteria 1178
944 Ga0307408_101204470 3300031548 Bacteria 706
945 Ga0307408_101441961 3300031548 Bacteria 649
946 Ga0307508_10001596 3300031616 Bacteria 25282
947 Ga0307508_10003456 3300031616 Bacteria 15989
948 Ga0307508_10110633 3300031616 Bacteria 2346
949 Ga0307508_10294188 3300031616 Bacteria 1217
950 Ga0307514_10002176 3300031649 Bacteria 21074
951 Ga0307514_10120644 3300031649 Bacteria 1829
952 Ga0307514_10282290 3300031649 Bacteria 949
953 Ga0307514_10286116 3300031649 Bacteria 938
954 Ga0307516_10000268 3300031730 Bacteria 66758
955 Ga0307516_10003906 3300031730 Bacteria 18801
956 Ga0307516_10213559 3300031730 Bacteria 1642
957 Ga0307516_10294015 3300031730 Bacteria 1302
958 Ga0307516_10647278 3300031730 Bacteria 712
959 Ga0307516_10753397 3300031730 Bacteria 633
960 Ga0307405_10005746 3300031731 Bacteria 6028
961 Ga0307405_10274690 3300031731 Bacteria 1265
962 Ga0307405_10628796 3300031731 Bacteria 880
963 Ga0307405_11960169 3300031731 Bacteria 523
964 Ga0307413_10019225 3300031824 Bacteria 3604
965 Ga0307518_10370619 3300031838 Bacteria 820
966 Ga0307410_10003356 3300031852 Bacteria 8023
967 Ga0307406_10354766 3300031901 Bacteria 1147
968 Ga0307407_10008822 3300031903 Bacteria 4655
969 Ga0307407_10153575 3300031903 Bacteria 1499
970 Ga0307407_11439400 3300031903 Bacteria 544
971 Ga0307412_10134374 3300031911 Bacteria 1802
972 Ga0307412_10172020 3300031911 Bacteria 1620
973 Ga0307412_10415390 3300031911 Bacteria 1099
974 Ga0307412_10866769 3300031911 Bacteria 789
975 Ga0307412_10981464 3300031911 Bacteria 745
976 Ga0307409_100382829 3300031995 Bacteria 1338
977 Ga0307409_100529484 3300031995 Bacteria 1153
978 Ga0307416_100013304 3300032002 Bacteria 5588
979 Ga0307416_100274638 3300032002 Bacteria 1657
980 Ga0307416_100475036 3300032002 Bacteria 1309
981 Ga0307416_101647897 3300032002 Bacteria 746
982 Ga0307416_101921852 3300032002 Bacteria 695
983 Ga0307414_10223977 3300032004 Bacteria 1546
984 Ga0307414_10334425 3300032004 Bacteria 1294
985 Ga0307414_12201286 3300032004 Bacteria 515
986 Ga0307411_10001686 3300032005 Bacteria 9255
987 Ga0307411_10001815 3300032005 Bacteria 9045
988 Ga0307411_10460262 3300032005 Bacteria 1066
989 Ga0307411_10743021 3300032005 Bacteria 859
990 Ga0307411_11027769 3300032005 Bacteria 739
991 Ga0307415_100007903 3300032126 Bacteria 5854
992 Ga0307415_100205875 3300032126 Bacteria 1565
993 Ga0307507_10023516 3300033179 Bacteria 6761
994 Ga0307507_10094001 3300033179 Bacteria 2551
995 Ga0307510_10025175 3300033180 Bacteria 6868
996 Ga0307510_10045192 3300033180 Bacteria 4758
997 Ga0307510_10051426 3300033180 Bacteria 4357
998 Ga0307510_10498148 3300033180 Bacteria 661
999 Ga0373958_0058867 3300034819 Bacteria 828
1000 Ga0373959_0046453 3300034820 Bacteria 926
1001 Ga0373938_0031692 3300034957 Bacteria 1135
1002 Ga0373940_0047582 3300035088 Bacteria 1196
1003 Ga0373940_0237584 3300035088 Bacteria 610
1004 Ga0373944_0272924 3300035089 Bacteria 629
1005 Ga0373949_0028332 3300035090 Bacteria 1321
1006 Ga0373951_0090239 3300035091 Bacteria 803
1007 Ga0373952_0104597 3300035092 Bacteria 751
1008 Ga0373923_0303749 3300035111 Bacteria 755
1009 Ga0373923_0516054 3300035111 Bacteria 584
1010 Ga0373932_0034081 3300035112 Bacteria 1433
1011 Ga0373939_0000272 3300035114 Bacteria 13809
1012 Ga0373954_0173704 3300035118 Bacteria 1056
1013 Ga0373943_0070104 3300035170 Bacteria 1773
1014 Ga0373943_0105381 3300035170 Bacteria 1480
1015 Ga0373943_0798885 3300035170 Bacteria 561
1016 Ga0373946_0320684 3300035171 Bacteria 770
1017 Ga0373946_0599319 3300035171 Bacteria 571
1018 Ga0373955_0177348 3300035172 Bacteria 1263
1019 Ga0373962_0006206 3300035242 Bacteria 2891
1020 Ga0373962_0011842 3300035242 Bacteria 2191
1021 Ga0373924_0106397 3300035410 Bacteria 1209
1022 Ga0373924_0503637 3300035410 Bacteria 544
1023 Ga0373931_0000665 3300035691 Bacteria 14209
1024 Ga0373931_0001429 3300035691 Bacteria 10246
1025 Ga0373931_0370700 3300035691 Bacteria 900
1026 Ga0373935_0795653 3300035692 Bacteria 698
1027 Ga0373927_0352780 3300035695 Bacteria 969
1028 Ga0373927_0448564 3300035695 Bacteria 852
1029 Ga0373933_0182375 3300035724 Bacteria 1339
1030 Ga0373933_0276253 3300035724 Bacteria 1085
1031 Ga0373947_0050825 3300035725 Bacteria 2493
1032 Ga0373947_0831150 3300035725 Bacteria 631
1033 Ga0373937_0065617 3300036401 Bacteria 3342
1034 Ga0373937_0129239 3300036401 Bacteria 2359
1035 Ga0373937_0162313 3300036401 Bacteria 2095
1036 Ga0373925_0070801 3300037068 Bacteria 2637
1037 Ga0373925_0080994 3300037068 Bacteria 2468
1038 Ga0373925_0193368 3300037068 Bacteria 1615
1039 Ga0373925_0405428 3300037068 Bacteria 1112
1040 Ga0373925_0673822 3300037068 Bacteria 852
1041 Ga0395900_0000535 3300037418 Bacteria 53622
1042 Ga0395898_0002836 3300037466 Bacteria 19833
1043 Ga0395905_0007293 3300037471 Bacteria 11021
1044 Ga0395905_0012706 3300037471 Bacteria 8098
1045 Ga0395905_0053650 3300037471 Bacteria 3772
1046 Ga0395905_0124032 3300037471 Bacteria 2429
1047 Ga0395905_0811662 3300037471 Bacteria 838
1048 Ga0436364_1495413 3300037853 Bacteria 958
1049 Ga0436365_1267282 3300039437 Bacteria 895
1050 Ga0436360_0381654 3300039438 Bacteria 606
1051 Ga0436361_0233952 3300039447 Bacteria 547
1052 Ga0436361_0240417 3300039447 Bacteria 3149
1053 Ga0436361_0996052 3300039447 Bacteria 5986
1054 Ga0439461_0059791 3300041410 Bacteria 863
1055 Ga0439461_0127329 3300041410 Bacteria 641
1056 Ga0439465_0338149 3300041413 Bacteria 567
1057 Ga0451789_1178356 3300041443 Bacteria 1226
1058 Ga0451793_0358311 3300041452 Bacteria 1139
1059 Ga0451793_1172903 3300041452 Bacteria 599
1060 Ga0451793_1673427 3300041452 Bacteria 1144
1061 Ga0451797_0278276 3300041453 Bacteria 597
1062 Ga0451797_1036550 3300041453 Bacteria 637
1063 Ga0451797_1315304 3300041453 Bacteria 961
1064 Ga0451795_0059148 3300041456 Bacteria 640
1065 Ga0451795_0139934 3300041456 Bacteria 533
1066 Ga0451795_0394184 3300041456 Bacteria 1321
1067 Ga0451798_0566853 3300041458 Bacteria 827
1068 Ga0451798_0791769 3300041458 Bacteria 739
1069 Ga0451798_1166708 3300041458 Bacteria 1199
1070 Ga0451800_0500868 3300041459 Bacteria 866
1071 Ga0451800_1533257 3300041459 Bacteria 680
1072 Ga0451802_0175899 3300041460 Bacteria 1688
1073 Ga0451805_098782 3300041461 Bacteria 600
1074 Ga0451804_0031720 3300041463 Bacteria 1149
1075 Ga0451804_0695359 3300041463 Bacteria 511
1076 Ga0451807_0270528 3300041486 Bacteria 771
1077 Ga0451807_0589163 3300041486 Bacteria 786
1078 Ga0451807_0592901 3300041486 Bacteria 925
1079 Ga0451833_1494138 3300041491 Bacteria 666
1080 Ga0451835_0060653 3300041492 Bacteria 580
1081 Ga0451839_0134199 3300041496 Bacteria 537
1082 Ga0451839_0843576 3300041496 Bacteria 649
1083 Ga0451841_0137167 3300041498 Bacteria 541
1084 Ga0451841_0202568 3300041498 Bacteria 1086
1085 Ga0451845_0177849 3300041501 Bacteria 788
1086 Ga0451849_0038608 3300041505 Bacteria 830
1087 Ga0451851_0007129 3300041507 Bacteria 799
1088 Ga0451851_0476484 3300041507 Bacteria 665
1089 Ga0451843_0724857 3300041509 Bacteria 752
1090 Ga0451843_1037426 3300041509 Bacteria 572
1091 Ga0451843_1577317 3300041509 Bacteria 516
1092 Ga0451855_0366185 3300041511 Bacteria 614
1093 Ga0451853_2795309 3300041512 Bacteria 921
1094 Ga0451853_3145576 3300041512 Bacteria 1007
1095 Ga0451853_3325265 3300041512 Bacteria 654
1096 Ga0451853_3908419 3300041512 Bacteria 1988
1097 Ga0439433_0025071 3300041999 Bacteria 1346
1098 Ga0439437_022894 3300042000 Bacteria 762
1099 Ga0439445_0030673 3300042004 Bacteria 1394
1100 Ga0439449_0117024 3300042007 Bacteria 989
1101 Ga0439450_001164 3300042008 Bacteria 3762
1102 Ga0439450_073815 3300042008 Bacteria 840
1103 Ga0439454_110360 3300042011 Bacteria 524
1104 Ga0439455_0049240 3300042012 Bacteria 1097
1105 Ga0450912_031564 3300042116 Bacteria 551
1106 Ga0450917_000284 3300042120 Bacteria 3743
1107 Ga0450919_000285 3300042121 Bacteria 5938
1108 Ga0450920_055118 3300042122 Bacteria 800
1109 Ga0450888_005886 3300042126 Bacteria 1320
1110 Ga0450888_010596 3300042126 Bacteria 1070
1111 Ga0450890_001614 3300042127 Bacteria 3233
1112 Ga0450890_001839 3300042127 Bacteria 3005
1113 Ga0450891_001574 3300042129 Bacteria 2346
1114 Ga0450892_001645 3300042130 Bacteria 2091
1115 Ga0450898_019707 3300042134 Bacteria 1177
1116 Ga0450898_028272 3300042134 Bacteria 1018
1117 Ga0450898_042079 3300042134 Bacteria 867
1118 Ga0450904_014100 3300042139 Bacteria 796
1119 Ga0450889_001274 3300042144 Bacteria 2617
1120 Ga0439446_0069153 3300042156 Bacteria 1078
1121 Ga0439458_0046384 3300042157 Bacteria 1064
1122 Ga0439458_0105508 3300042157 Bacteria 734
1123 Ga0439435_0169373 3300042436 Bacteria 709
1124 Ga0439444_0022531 3300042437 Bacteria 1124
1125 Ga0439464_0004537 3300042439 Bacteria 3557
1126 Ga0439460_0071551 3300042461 Bacteria 1075
1127 Ga0450918_000434 3300042531 Bacteria 9012
1128 Ga0450893_0006947 3300042532 Bacteria 1834
1129 Ga0450893_0030477 3300042532 Bacteria 960
1130 Ga0450893_0077745 3300042532 Bacteria 652
1131 Ga0451577_0001608 3300042876 Bacteria 29360
1132 Ga0451577_0008143 3300042876 Bacteria 10223
1133 Ga0451577_0009084 3300042876 Bacteria 9593
1134 Ga0451577_0292353 3300042876 Bacteria 1476
1135 Ga0451577_0379735 3300042876 Bacteria 1282
1136 Ga0451577_1509607 3300042876 Bacteria 594
1137 Ga0466969_0023536 3300044656 Bacteria 3174
1138 Ga0466969_0057161 3300044656 Bacteria 1902
1139 Ga0466972_0004153 3300044658 Bacteria 7225
1140 Ga0466972_0013057 3300044658 Bacteria 4174
1141 Ga0466972_0039081 3300044658 Bacteria 2317
1142 Ga0453683_0844060 3300044673 Bacteria 604
1143 Ga0466965_0036600 3300044683 Bacteria 2408
1144 Ga0466965_0057540 3300044683 Bacteria 1938
1145 Ga0466965_0153621 3300044683 Bacteria 1204
1146 Ga0466965_0212190 3300044683 Bacteria 1029
1147 Ga0466965_0220200 3300044683 Bacteria 1011
1148 Ga0466966_0004224 3300044684 Bacteria 9483
1149 Ga0466966_0041477 3300044684 Bacteria 2957
1150 Ga0466966_0050824 3300044684 Bacteria 2636
1151 Ga0466961_0032915 3300044693 Bacteria 3330
1152 Ga0466961_0045694 3300044693 Bacteria 2801
1153 Ga0466961_0240990 3300044693 Bacteria 1111
1154 Ga0466963_0037909 3300044694 Bacteria 3151
1155 Ga0466964_0012532 3300044706 Bacteria 3209
1156 Ga0466964_0060667 3300044706 Bacteria 1573
1157 Ga0453684_0007620 3300044712 Bacteria 19830
1158 Ga0453684_0041964 3300044712 Bacteria 6175
1159 Ga0453684_0118560 3300044712 Bacteria 3201
1160 Ga0453684_0242660 3300044712 Bacteria 2073
1161 Ga0453684_0296619 3300044712 Bacteria 1839
1162 Ga0453684_2447925 3300044712 Bacteria 516
1163 Ga0466968_0086394 3300044735 Bacteria 1384
1164 Ga0466970_0026135 3300044765 Bacteria 3060
1165 Ga0466970_0301278 3300044765 Bacteria 904
1166 Ga0466957_0096817 3300044842 Bacteria 1855
1167 Ga0466960_0005145 3300044901 Bacteria 5172
1168 Ga0466960_0205627 3300044901 Bacteria 1077
1169 Ga0466959_0000793 3300045049 Bacteria 18583
1170 Ga0466959_0058453 3300045049 Bacteria 2808
1171 Ga0451576_0004508 3300045051 Bacteria 18022
1172 Ga0451576_0014073 3300045051 Bacteria 8915
1173 Ga0451576_0040276 3300045051 Bacteria 4947
1174 Ga0451576_0067461 3300045051 Bacteria 3724
1175 Ga0451576_0094271 3300045051 Bacteria 3113
1176 Ga0451576_0179084 3300045051 Bacteria 2213
1177 Ga0451576_0226207 3300045051 Bacteria 1953
1178 Ga0451576_0357938 3300045051 Bacteria 1528
1179 Ga0466958_0138502 3300045836 Bacteria 1531
1180 Ga0495592_0000295 3300046454 Bacteria 42617
1181 Ga0495592_0570222 3300046454 Bacteria 694
1182 Ga0495603_0294798 3300046455 Bacteria 932
1183 Ga0495590_0088566 3300046457 Bacteria 1094
1184 Ga0495591_101977 3300046458 Bacteria 711
1185 Ga0495629_0183779 3300046459 Bacteria 1448
1186 Ga0495629_0913725 3300046459 Bacteria 575
1187 Ga0495638_0463109 3300046460 Bacteria 645
1188 Ga0495582_0516988 3300046473 Bacteria 690
1189 Ga0495639_0317507 3300046475 Bacteria 779
1190 Ga0495664_0351137 3300046477 Bacteria 888
1191 Ga0495583_0089971 3300046506 Bacteria 1323
1192 Ga0495606_0308558 3300046507 Bacteria 855
1193 Ga0495608_0220549 3300046511 Bacteria 1190
1194 Ga0495610_0005844 3300046512 Bacteria 8642
1195 Ga0495620_0083960 3300046515 Bacteria 1285
1196 Ga0495628_0935336 3300046516 Bacteria 600
1197 Ga0495630_1026686 3300046517 Bacteria 626
1198 Ga0495631_0066241 3300046518 Bacteria 1563
1199 Ga0495632_0010763 3300046519 Bacteria 5390
1200 Ga0495632_0020823 3300046519 Bacteria 3544
1201 Ga0495632_0284097 3300046519 Bacteria 736
1202 Ga0495643_0158986 3300046522 Bacteria 1113
1203 Ga0495648_0163679 3300046524 Bacteria 1147
1204 Ga0495648_0195975 3300046524 Bacteria 1015
1205 Ga0495648_0455521 3300046524 Bacteria 558
1206 Ga0495666_0091251 3300046526 Bacteria 1437
1207 Ga0495666_0482124 3300046526 Bacteria 555
1208 Ga0495586_0159847 3300046535 Bacteria 1270
1209 Ga0495586_0182997 3300046535 Bacteria 1186
1210 Ga0495609_0149509 3300046538 Bacteria 994
1211 Ga0495621_0292428 3300046539 Bacteria 673
1212 Ga0495597_0008922 3300046542 Bacteria 5001
1213 Ga0495645_0150423 3300046543 Bacteria 1618
1214 Ga0495667_0168248 3300046559 Bacteria 1409
1215 Ga0495668_0148343 3300046616 Bacteria 1284
1216 Ga0495668_0813534 3300046616 Bacteria 517
1217 Ga0495611_0062211 3300046648 Bacteria 1698
1218 Ga0495625_0002174 3300046660 Bacteria 21783
1219 Ga0495625_0004670 3300046660 Bacteria 12862
1220 Ga0495625_0289950 3300046660 Bacteria 1050
1221 Ga0495625_0608088 3300046660 Bacteria 655
1222 Ga0495635_0210694 3300046663 Bacteria 1316
1223 Ga0495647_0113929 3300046681 Bacteria 1131
1224 Ga0495647_0214694 3300046681 Bacteria 847
1225 Ga0495658_0067119 3300046683 Bacteria 2074
1226 Ga0495658_0107084 3300046683 Bacteria 1676
1227 Ga0495658_0109706 3300046683 Bacteria 1658
1228 Ga0495658_0166449 3300046683 Bacteria 1362
1229 Ga0495613_0402751 3300046689 Bacteria 933
1230 Ga0495613_0475467 3300046689 Bacteria 844
1231 Ga0495624_0025731 3300046690 Bacteria 3862
1232 Ga0495670_0081267 3300046691 Bacteria 1651
1233 Ga0495670_0195654 3300046691 Bacteria 1070
1234 Ga0495671_0142081 3300046692 Bacteria 1170
1235 Ga0495671_0248083 3300046692 Bacteria 859
1236 Ga0495649_0006798 3300046694 Bacteria 7084
1237 Ga0495660_0020654 3300046810 Bacteria 3775
1238 Ga0495581_0418620 3300047315 Bacteria 781
1239 Ga0495636_0280313 3300047318 Bacteria 776
1240 Ga0495674_0667548 3300047319 Bacteria 818
1241 Ga0495687_000636 3300047443 Bacteria 40190
1242 Ga0495673_0076118 3300047469 Bacteria 1400
1243 Ga0495684_0179919 3300047471 Bacteria 1568
1244 Ga0495684_0941954 3300047471 Bacteria 553
1245 Ga0495686_0002900 3300047472 Bacteria 15394
1246 Ga0495686_0069329 3300047472 Bacteria 2174
1247 Ga0495602_0403157 3300048088 Bacteria 975
1248 Ga0495626_0133152 3300048091 Bacteria 1060
1249 Ga0496101_0221248 3300048904 Bacteria 1469
1250 Ga0496101_0573894 3300048904 Bacteria 892
1251 Ga0496101_0997218 3300048904 Bacteria 659
1252 Ga0496101_1062950 3300048904 Bacteria 636
1253 Ga0496102_0027533 3300048905 Bacteria 5076
1254 Ga0496102_0652466 3300048905 Bacteria 975
1255 Ga0496104_0214747 3300048907 Bacteria 1835
1256 Ga0496104_0308141 3300048907 Bacteria 1496
1257 Ga0496105_0026211 3300048908 Bacteria 4753
1258 Ga0496105_0231209 3300048908 Bacteria 1503
1259 Ga0496105_0302639 3300048908 Bacteria 1285
1260 Ga0496105_1066228 3300048908 Bacteria 601
1261 Ga0496106_0010515 3300048909 Bacteria 6836
1262 Ga0496106_0125219 3300048909 Bacteria 2011
1263 Ga0496107_0007401 3300048910 Bacteria 7569
1264 Ga0496107_0373843 3300048910 Bacteria 1060
1265 Ga0496108_0028747 3300048911 Bacteria 4600
1266 Ga0496108_0216381 3300048911 Bacteria 1664
1267 Ga0496108_0332358 3300048911 Bacteria 1325
1268 Ga0496108_0378982 3300048911 Bacteria 1235
1269 Ga0496108_1201518 3300048911 Bacteria 641
1270 Ga0496109_0304524 3300048912 Bacteria 1503
1271 Ga0496109_1588787 3300048912 Bacteria 588
1272 Ga0496110_0031571 3300048913 Bacteria 4571
1273 Ga0496110_0297248 3300048913 Bacteria 1471
1274 Ga0496110_0938505 3300048913 Bacteria 772
1275 Ga0496111_0640031 3300048914 Bacteria 776
1276 Ga0496111_0913893 3300048914 Bacteria 632
1277 Ga0496112_0263917 3300048915 Bacteria 1671
1278 Ga0496113_0272336 3300048916 Bacteria 1353
1279 Ga0496113_0350661 3300048916 Bacteria 1184
1280 Ga0496114_0263997 3300048917 Bacteria 1516
1281 Ga0496114_0272685 3300048917 Bacteria 1491
1282 Ga0496114_0957620 3300048917 Bacteria 738
1283 Ga0496114_1025311 3300048917 Bacteria 709
1284 Ga0496115_0200731 3300048918 Bacteria 1647
1285 Ga0496121_0018192 3300048924 Bacteria 7102
1286 Ga0496123_0302375 3300048926 Bacteria 763
1287 Ga0496124_0071074 3300048927 Bacteria 2886
1288 Ga0496125_0006880 3300048928 Bacteria 12182
1289 Ga0496125_0137600 3300048928 Bacteria 1705
1290 Ga0496125_0361294 3300048928 Bacteria 863
1291 Ga0496126_0100589 3300048929 Bacteria 2530
1292 Ga0496126_0200834 3300048929 Bacteria 1684
1293 Ga0501309_016098 3300049129 Bacteria 1016
1294 Ga0501310_002487 3300049130 Bacteria 1754
1295 Ga0501305_009668 3300049161 Bacteria 1272
1296 Ga0501292_009653 3300049515 Bacteria 1435
1297 Ga0501293_015501 3300049516 Bacteria 702
1298 Ga0501294_005995 3300049517 Bacteria 1158
1299 Ga0501295_102340 3300049518 Bacteria 673
1300 Ga0501298_016579 3300049521 Bacteria 1337
1301 Ga0501301_011540 3300049524 Bacteria 739
1302 Ga0501303_007065 3300049526 Bacteria 993
1303 Ga0501312_032643 3300049528 Bacteria 823
1304 Ga0501312_078798 3300049528 Bacteria 594
1305 Ga0501313_011837 3300049529 Bacteria 1010
1306 Ga0501043_0000075 3300049579 Bacteria 86156
1307 Ga0501046_0000195 3300049580 Bacteria 62300
1308 Ga0501047_0000145 3300049581 Bacteria 86319
1309 Ga0501048_0000999 3300049582 Bacteria 21090
1310 Ga0501070_1001267 3300049586 Bacteria 648
1311 Ga0501198_000015 3300049649 Bacteria 102945
1312 Ga0501206_010361 3300049653 Bacteria 1248
1313 Ga0501207_019830 3300049654 Bacteria 1069
1314 Ga0501211_005166 3300049658 Bacteria 1313
1315 Ga0501217_146762 3300049661 Bacteria 702
1316 Ga0501222_000040 3300049662 Bacteria 49987
1317 Ga0501222_004797 3300049662 Bacteria 1838
1318 Ga0501222_059558 3300049662 Bacteria 575
1319 Ga0501223_018194 3300049663 Bacteria 1383
1320 Ga0501233_123583 3300049668 Bacteria 701
1321 Ga0501235_018965 3300049669 Bacteria 1525
1322 Ga0501249_009208 3300049679 Bacteria 2054
1323 Ga0501257_190349 3300049686 Bacteria 585
1324 Ga0501261_048038 3300049690 Bacteria 692
1325 Ga0501229_000012 3300049706 Bacteria 25765
1326 Ga0501245_035141 3300049708 Bacteria 843
1327 Ga0501079_0520663 3300049741 Bacteria 935
1328 Ga0501232_059792 3300049757 Bacteria 607
1329 Ga0501262_019485 3300049759 Bacteria 919
1330 Ga0501262_091132 3300049759 Bacteria 518
1331 Ga0501263_091079 3300049760 Bacteria 515
1332 Ga0501265_004388 3300049762 Bacteria 1605
1333 Ga0501269_048975 3300049766 Bacteria 578
1334 Ga0501272_001140 3300049769 Bacteria 2457
1335 Ga0501274_027674 3300049771 Bacteria 624
1336 Ga0501276_031686 3300049773 Bacteria 555
1337 Ga0501280_042545 3300049776 Bacteria 741
1338 Ga0501035_0067274 3300049822 Bacteria 3180
1339 Ga0501045_0010507 3300049824 Bacteria 6485
1340 Ga0501226_017971 3300049853 Bacteria 778
1341 nmdc:mga03683_118420_c1 3300050489 Bacteria 1176
1342 nmdc:mga03683_12560_c1 3300050489 Bacteria 3097
1343 nmdc:mga03683_18823_c1 3300050489 Bacteria 2631
1344 nmdc:mga03683_49338_c1 3300050489 Bacteria 1752
1345 nmdc:mga00v17_102345_c1 3300050491 Bacteria 1809
1346 nmdc:mga0k408_112983_c1 3300050493 Bacteria 1606
1347 nmdc:mga0k408_115773_c1 3300050493 Bacteria 1586
1348 nmdc:mga0k408_148_c1 3300050493 Bacteria 35989
1349 nmdc:mga0k408_157915_c1 3300050493 Bacteria 1351
1350 nmdc:mga0k408_187083_c1 3300050493 Bacteria 1235
1351 nmdc:mga0k408_199009_c1 3300050493 Bacteria 1196
1352 nmdc:mga0k408_204526_c1 3300050493 Bacteria 1179
1353 nmdc:mga0k408_20746_c1 3300050493 Bacteria 3686
1354 nmdc:mga0k408_209336_c1 3300050493 Bacteria 1164
1355 nmdc:mga0k408_228472_c1 3300050493 Bacteria 1111
1356 nmdc:mga0k408_2372_c1 3300050493 Bacteria 8674
1357 nmdc:mga0k408_2509_c1 3300050493 Bacteria 9764
1358 nmdc:mga0k408_26933_c1 3300050493 Bacteria 3262
1359 nmdc:mga0k408_283907_c1 3300050493 Bacteria 988
1360 nmdc:mga0k408_29340_c1 3300050493 Bacteria 3131
1361 nmdc:mga0k408_37851_c1 3300050493 Bacteria 2770
1362 nmdc:mga0k408_39980_c1 3300050493 Bacteria 2697
1363 nmdc:mga0k408_422366_c1 3300050493 Bacteria 793
1364 nmdc:mga0k408_48557_c1 3300050493 Bacteria 2456
1365 nmdc:mga0k408_565085_c1 3300050493 Bacteria 672
1366 nmdc:mga0k408_631204_c1 3300050493 Bacteria 631
1367 nmdc:mga0k408_69397_c1 3300050493 Bacteria 2057
1368 nmdc:mga0k408_7192_c1 3300050493 Bacteria 5951
1369 nmdc:mga0k408_816325_c1 3300050493 Bacteria 543
1370 nmdc:mga0k408_9250_c1 3300050493 Bacteria 5309
1371 nmdc:mga06z11_250734_c1 3300050494 Bacteria 1042
1372 nmdc:mga06z11_27747_c1 3300050494 Bacteria 2709
1373 nmdc:mga06z11_36995_c1 3300050494 Bacteria 2414
1374 nmdc:mga04h51_11416_c1 3300050495 Bacteria 2465
1375 nmdc:mga04h51_143940_c1 3300050495 Bacteria 906
1376 nmdc:mga07m45_141279_c1 3300050496 Bacteria 1395
1377 nmdc:mga07m45_1748_c1 3300050496 Bacteria 10008
1378 nmdc:mga07m45_17681_c1 3300050496 Bacteria 3835
1379 nmdc:mga07m45_195687_c1 3300050496 Bacteria 1176
1380 nmdc:mga07m45_207593_c1 3300050496 Bacteria 1140
1381 nmdc:mga07m45_219380_c1 3300050496 Bacteria 1106
1382 nmdc:mga07m45_26285_c1 3300050496 Bacteria 3199
1383 nmdc:mga07m45_454377_c1 3300050496 Bacteria 743
1384 nmdc:mga07m45_507282_c1 3300050496 Bacteria 698
1385 nmdc:mga07m45_5236_c1 3300050496 Bacteria 6439
1386 nmdc:mga07m45_569_c1 3300050496 Bacteria 5463
1387 nmdc:mga07m45_587096_c1 3300050496 Bacteria 644
1388 nmdc:mga07m45_637902_c1 3300050496 Bacteria 614
1389 nmdc:mga07m45_651412_c1 3300050496 Bacteria 607
1390 nmdc:mga07m45_9266_c1 3300050496 Bacteria 5097
1391 nmdc:mga05p37_1042262_c1 3300050507 Bacteria 864
1392 nmdc:mga09592_2500_c1 3300050508 Bacteria 14862
1393 nmdc:mga0qj67_687499_c1 3300050509 Bacteria 814
1394 nmdc:mga0rr50_598170_c1 3300050513 Bacteria 940
1395 nmdc:mga0sz30_223290_c1 3300050516 Bacteria 838
1396 nmdc:mga0sz30_485404_c1 3300050516 Bacteria 555
1397 nmdc:mga0sz30_93180_c1 3300050516 Bacteria 1312
1398 Ga0495601_0239039 3300053077 Bacteria 1186
1399 Ga0495612_0109920 3300053078 Bacteria 1179
1400 Ga0495612_0111159 3300053078 Bacteria 1173
1401 Ga0500635_0089445 3300053080 Bacteria 1118
1402 Ga0495595_0045883 3300053084 Bacteria 2011
1403 Ga0495619_0263687 3300053085 Bacteria 1194
1404 Ga0495619_1013021 3300053085 Bacteria 555
1405 Ga0500578_0000224 3300053086 Bacteria 70358
1406 Ga0500578_0050616 3300053086 Bacteria 2664
1407 Ga0500578_0299536 3300053086 Bacteria 954
1408 Ga0500643_034161 3300053087 Bacteria 1533
1409 Ga0500644_0010134 3300053088 Bacteria 2543
1410 Ga0500644_0120932 3300053088 Bacteria 1020
1411 Ga0500646_0004682 3300053090 Bacteria 3457
1412 Ga0500646_0164139 3300053090 Bacteria 743
1413 Ga0500583_0036759 3300053092 Bacteria 2195
1414 Ga0500583_0149970 3300053092 Bacteria 1160
1415 Ga0500651_0017559 3300053093 Bacteria 4417
1416 Ga0500651_0135489 3300053093 Bacteria 1487
1417 Ga0500651_0269812 3300053093 Bacteria 984
1418 Ga0500650_0082359 3300053098 Bacteria 1505
1419 Ga0500650_0114126 3300053098 Bacteria 1260
1420 Ga0500562_126507 3300053108 Bacteria 696
1421 Ga0500569_053929 3300053109 Bacteria 1221
1422 Ga0500593_000250 3300053117 Bacteria 22072
1423 Ga0500594_0016209 3300053118 Bacteria 1808
1424 Ga0500614_013639 3300053123 Bacteria 1789
1425 Ga0500628_002390 3300053129 Bacteria 3113
1426 Ga0500642_0007522 3300053130 Bacteria 3668
1427 Ga0500652_001099 3300053131 Bacteria 8722
1428 Ga0500652_033825 3300053131 Bacteria 2022
1429 Ga0500655_002874 3300053133 Bacteria 3128
1430 Ga0500655_042869 3300053133 Bacteria 890
1431 Ga0500658_0007909 3300053134 Bacteria 3929
1432 Ga0500658_0187077 3300053134 Bacteria 944
1433 Ga0500559_0000011 3300053136 Bacteria 164751
1434 Ga0500559_0126453 3300053136 Bacteria 1192
1435 Ga0500564_106111 3300053138 Bacteria 1237
1436 Ga0500568_0050224 3300053139 Bacteria 1644
1437 Ga0500577_0015015 3300053142 Bacteria 2409
1438 Ga0500577_0365620 3300053142 Bacteria 631
1439 Ga0500577_0397043 3300053142 Bacteria 603
1440 Ga0500579_189477 3300053143 Bacteria 788
1441 Ga0500589_123070 3300053147 Bacteria 1095
1442 Ga0500619_000143 3300053154 Bacteria 17415
1443 Ga0500619_012224 3300053154 Bacteria 2236
1444 Ga0500622_0001541 3300053156 Bacteria 18260
1445 Ga0500622_0001880 3300053156 Bacteria 15853
1446 Ga0500622_0009235 3300053156 Bacteria 5469
1447 Ga0500627_0322206 3300053158 Bacteria 671
1448 Ga0500636_0083939 3300053177 Bacteria 1832
1449 Ga0500637_0462678 3300053178 Bacteria 640
1450 Ga0500570_080325 3300053724 Bacteria 1473
1451 Ga0500570_083568 3300053724 Bacteria 1425
1452 Ga0500645_014572 3300053730 Bacteria 2502
1453 Ga0500645_096771 3300053730 Bacteria 834
1454 Ga0500587_000945 3300053739 Bacteria 3908
1455 Ga0500587_005067 3300053739 Bacteria 1786
1456 Ga0500661_106554 3300055283 Bacteria 535
1457 2644305083 2643221654 Bacteria 5273570
1458 Ga0495647_0371742
1459 JGI24033J26618_1036228
1460 JGI25150J39212_1006308
1461 JGI25153J46596_10009043
1462 JGI25153J46596_10030106
1463 rootH1_10062755
1464 rootH2_10019535
1465 rootL2_10003847
1466 rootL2_10005851
1467 rootH1_10023641
1468 rootH1_10108114
1469 JGI26145J50221_1002180
1470 Ga0055526_1001112
1471 Ga0055530_10058995
1472 Ga0055540_1022368
1473 Ga0055540_1112627
1474 Ga0055531_10001930
1475 Ga0055531_10046861
1476 Ga0055543_1002155
1477 Ga0065165_1000184
1478 Ga0065165_1006209
1479 Ga0065715_10121665
1480 Ga0065715_10195151
1481 Ga0065715_10493371
1482 Ga0065707_10082794
1483 Ga0065707_10327756
1484 Ga0065707_10422887
1485 Ga0065707_10568002
1486 Ga0070658_10085385
1487 Ga0070658_10255739
1488 Ga0070658_10560847
1489 Ga0070676_10002035
1490 Ga0070676_10088789
1491 Ga0070676_10151549
1492 Ga0070676_10167278
1493 Ga0070676_10443337
1494 Ga0070676_11619813
1495 Ga0070683_100049615
1496 Ga0070683_101356018
1497 Ga0070690_100016127
1498 Ga0070690_100020915
1499 Ga0070670_100001136
1500 Ga0070670_100020708
1501 Ga0070670_100034250
1502 Ga0070670_100065307
1503 Ga0070670_100379370
1504 Ga0070670_100417662
1505 Ga0070670_100842064
1506 Ga0070670_101220447
1507 Ga0070670_101945992
1508 Ga0070670_102100816
1509 Ga0070677_10046190
1510 Ga0070677_10051350
1511 Ga0070677_10140396
1512 Ga0070677_10558075
1513 Ga0068869_100003616
1514 Ga0068869_100013951
1515 Ga0068869_100084261
1516 Ga0068869_100138200
1517 Ga0068869_100230986
1518 Ga0070666_10051060
1519 Ga0070666_10058891
1520 Ga0070666_10402295
1521 Ga0070666_10542382
1522 Ga0070666_10799652
1523 Ga0070680_100656390
1524 Ga0070682_100040490
1525 Ga0070682_101024262
1526 Ga0068868_100000818
1527 Ga0068868_100014677
1528 Ga0068868_100019252
1529 Ga0068868_100035823
1530 Ga0068868_100132399
1531 Ga0068868_100193168
1532 Ga0068868_100327318
1533 Ga0068868_100542579
1534 Ga0068868_101203844
1535 Ga0070660_100046927
1536 Ga0070660_100168309
1537 Ga0070660_100822386
1538 Ga0070689_100147818
1539 Ga0070689_100391053
1540 Ga0070689_102135811
1541 Ga0070691_10912387
1542 Ga0070687_101180020
1543 Ga0070661_100000791
1544 Ga0070661_100020436
1545 Ga0070661_100061356
1546 Ga0070661_100084411
1547 Ga0070661_100309400
1548 Ga0070661_101008793
1549 Ga0070668_100050350
1550 Ga0070668_100367400
1551 Ga0070668_101635463
1552 Ga0070669_100119297
1553 Ga0070669_100124487
1554 Ga0070669_100391317
1555 Ga0070669_100527011
1556 Ga0070669_100579569
1557 Ga0070669_100636036
1558 Ga0070675_100000269
1559 Ga0070675_100001006
1560 Ga0070675_100001473
1561 Ga0070675_100004442
1562 Ga0070675_100034940
1563 Ga0070675_100067143
1564 Ga0070675_100130871
1565 Ga0070675_100149834
1566 Ga0070675_100851828
1567 Ga0070675_101266567
1568 Ga0070671_100021062
1569 Ga0070671_100025141
1570 Ga0070671_100054032
1571 Ga0070671_100056765
1572 Ga0070671_100109545
1573 Ga0070671_100232448
1574 Ga0070671_100350208
1575 Ga0070671_100496619
1576 Ga0070671_100697473
1577 Ga0070671_101263473
1578 Ga0070674_100011798
1579 Ga0070674_100013715
1580 Ga0070674_100026145
1581 Ga0070674_100155833
1582 Ga0070674_100224261
1583 Ga0070674_100232817
1584 Ga0070674_100235016
1585 Ga0070674_100255810
1586 Ga0070674_100486718
1587 Ga0070674_102072756
1588 Ga0070673_100008559
1589 Ga0070673_100071365
1590 Ga0070673_100075952
1591 Ga0070673_100240978
1592 Ga0070673_100274092
1593 Ga0070673_100481228
1594 Ga0070673_100796000
1595 Ga0070688_100284908
1596 Ga0070688_100445952
1597 Ga0070659_100000451
1598 Ga0070659_100010741
1599 Ga0070659_100010749
1600 Ga0070659_100076710
1601 Ga0070659_101845862
1602 Ga0070667_100003333
1603 Ga0070667_100023446
1604 Ga0070667_100069129
1605 Ga0070667_100087470
1606 Ga0070667_100107798
1607 Ga0070667_100109237
1608 Ga0070667_100576390
1609 Ga0070667_100751731
1610 Ga0070667_100763566
1611 Ga0070667_100893616
1612 Ga0070667_102045404
1613 Ga0070701_10883299
1614 Ga0070701_11166487
1615 Ga0070700_100131463
1616 Ga0070663_100009632
1617 Ga0070663_100019349
1618 Ga0070663_100096616
1619 Ga0070663_100436341
1620 Ga0070663_100464499
1621 Ga0070663_100627191
1622 Ga0070663_101685724
1623 Ga0070678_100011667
1624 Ga0070678_100018712
1625 Ga0070678_100039403
1626 Ga0070678_100089762
1627 Ga0070678_100159972
1628 Ga0070678_100325158
1629 Ga0070678_100341685
1630 Ga0070678_100477001
1631 Ga0070678_100581749
1632 Ga0070678_100809159
1633 Ga0070678_101606426
1634 Ga0070662_100001019
1635 Ga0070662_100011240
1636 Ga0070662_100023675
1637 Ga0070662_100127956
1638 Ga0070662_100170413
1639 Ga0070662_100199797
1640 Ga0070662_100444044
1641 Ga0070662_100533932
1642 Ga0070662_101081723
1643 Ga0070681_10197965
1644 Ga0070681_10278698
1645 Ga0068867_100000102
1646 Ga0068867_100016344
1647 Ga0068867_100019254
1648 Ga0068867_100021121
1649 Ga0068867_100024764
1650 Ga0068867_100034247
1651 Ga0068867_100048865
1652 Ga0068867_100256542
1653 Ga0068867_100743637
1654 Ga0068867_100851984
1655 Ga0068867_101856265
1656 Ga0070685_10204044
1657 Ga0070685_10319507
1658 Ga0070685_10725257
1659 Ga0070706_100222505
1660 Ga0070706_100894898
1661 Ga0070706_101269687
1662 Ga0070706_101283998
1663 Ga0070707_100068338
1664 Ga0070707_101793977
1665 Ga0070699_100333141
1666 Ga0070679_100008517
1667 Ga0070684_100080735
1668 Ga0070684_100357163
1669 Ga0068853_100039549
1670 Ga0068853_100082693
1671 Ga0068853_100289610
1672 Ga0068853_100585456
1673 Ga0068853_100672118
1674 Ga0068853_102216775
1675 Ga0070672_100000367
1676 Ga0070672_100005175
1677 Ga0070672_100029306
1678 Ga0070672_100053519
1679 Ga0070672_100070307
1680 Ga0070672_100076494
1681 Ga0070672_100091204
1682 Ga0070672_100126183
1683 Ga0070672_100143469
1684 Ga0070672_100286296
1685 Ga0070672_100631445
1686 Ga0070672_101237673
1687 Ga0070672_101527324
1688 Ga0070686_100584919
1689 Ga0070686_101249616
1690 Ga0070686_101904375
1691 Ga0070695_100895853
1692 Ga0070693_100021069
1693 Ga0070693_100127276
1694 Ga0070665_100197332
1695 Ga0070665_101042928
1696 Ga0070665_101238790
1697 Ga0070665_101321897
1698 Ga0070665_101550683
1699 Ga0068855_100063871
1700 Ga0068855_100124744
1701 Ga0070664_100000524
1702 Ga0070664_100003061
1703 Ga0070664_100163926
1704 Ga0070664_100212193
1705 Ga0070664_100344962
1706 Ga0070664_100601512
1707 Ga0070664_100879653
1708 Ga0070664_100976988
1709 Ga0068857_100008620
1710 Ga0068857_100230301
1711 Ga0068857_100300894
1712 Ga0068857_100430985
1713 Ga0068857_101833039
1714 Ga0068854_100020602
1715 Ga0068854_100139888
1716 Ga0068854_100542159
1717 Ga0068854_101163122
1718 Ga0068856_100006422
1719 Ga0068856_100015458
1720 Ga0068856_100057763
1721 Ga0068856_101078255
1722 Ga0068856_102086819
1723 Ga0070702_100164921
1724 Ga0070702_101036618
1725 Ga0068852_100003787
1726 Ga0068852_100018700
1727 Ga0068852_100025312
1728 Ga0068852_100214846
1729 Ga0068852_100217237
1730 Ga0068852_100221503
1731 Ga0068852_100260265
1732 Ga0068852_100947732
1733 Ga0068852_101078970
1734 Ga0068852_101547430
1735 Ga0068852_102020113
1736 Ga0068859_100166319
1737 Ga0068859_100617641
1738 Ga0068859_101094095
1739 Ga0068859_102786939
1740 Ga0068864_100020683
1741 Ga0068864_100028571
1742 Ga0068864_100045025
1743 Ga0068864_100066554
1744 Ga0068864_100113586
1745 Ga0068864_100188680
1746 Ga0068864_100351616
1747 Ga0068864_100378150
1748 Ga0068864_100679397
1749 Ga0068864_101506658
1750 Ga0068866_10029696
1751 Ga0068866_10060240
1752 Ga0068866_10083662
1753 Ga0068866_10134098
1754 Ga0068861_100002334
1755 Ga0068861_100007942
1756 Ga0068861_100042320
1757 Ga0068861_100273857
1758 Ga0068861_101213756
1759 Ga0068861_101679098
1760 Ga0068861_102670825
1761 Ga0068851_10010578
1762 Ga0068851_10053755
1763 Ga0068851_10126112
1764 Ga0068851_10221816
1765 Ga0068851_10379856
1766 Ga0068851_10508047
1767 Ga0068851_11080222
1768 Ga0068870_10349316
1769 Ga0068870_10691859
1770 Ga0068870_10979031
1771 Ga0068870_11021070
1772 Ga0068863_100029644
1773 Ga0068863_100052427
1774 Ga0068863_100056820
1775 Ga0068863_100097913
1776 Ga0068863_100128349
1777 Ga0068863_100209124
1778 Ga0068863_100297393
1779 Ga0068863_100305432
1780 Ga0068863_100326831
1781 Ga0068858_100001369
1782 Ga0068858_100012867
1783 Ga0068858_100014492
1784 Ga0068858_100019550
1785 Ga0068858_100586552
1786 Ga0068858_100593919
1787 Ga0068858_100681293
1788 Ga0068860_100002243
1789 Ga0068860_100011668
1790 Ga0068860_100058883
1791 Ga0068860_100065639
1792 Ga0068860_101082211
1793 Ga0068860_102398962
1794 Ga0068862_100003264
1795 Ga0068862_100006660
1796 Ga0068862_100201826
1797 Ga0068862_100289662
1798 Ga0068862_100642219
1799 Ga0068862_102653626
1800 Ga0075365_10071131
1801 Ga0075368_10027258
1802 Ga0075368_10044569
1803 Ga0075368_10132483
1804 Ga0075368_10469290
1805 Ga0075363_100017431
1806 Ga0075363_100691326
1807 Ga0070716_100377044
1808 Ga0075362_10015137
1809 Ga0075362_10024416
1810 Ga0075362_10118069
1811 Ga0075362_10120485
1812 Ga0075362_10262805
1813 Ga0075367_10002153
1814 Ga0075367_10106569
1815 Ga0075367_10540917
1816 Ga0075369_10158584
1817 Ga0075369_10237193
1818 Ga0075369_10541228
1819 Ga0075366_10000953
1820 Ga0075366_10011821
1821 Ga0075366_10012199
1822 Ga0075366_10016893
1823 Ga0075366_10032816
1824 Ga0075366_10035903
1825 Ga0075366_10036799
1826 Ga0075366_10038857
1827 Ga0075366_10053567
1828 Ga0075366_10057998
1829 Ga0075366_10084998
1830 Ga0075366_10109724
1831 Ga0075366_10130981
1832 Ga0075366_10140401
1833 Ga0075366_10177719
1834 Ga0075366_10216436
1835 Ga0075366_10218687
1836 Ga0075366_10240109
1837 Ga0075366_10343606
1838 Ga0075366_10718359
1839 Ga0075366_10733945
1840 Ga0097621_100025627
1841 Ga0097621_100035295
1842 Ga0097621_100215455
1843 Ga0097621_100474969
1844 Ga0097621_100513842
1845 Ga0097621_100852260
1846 Ga0097621_101454911
1847 Ga0075370_10000895
1848 Ga0075370_10010826
1849 Ga0075370_10011595
1850 Ga0075370_10026609
1851 Ga0075370_10038797
1852 Ga0075370_10049848
1853 Ga0075370_10072515
1854 Ga0075370_10094627
1855 Ga0075370_10096140
1856 Ga0075370_10218808
1857 Ga0075370_10409958
1858 Ga0075370_10433789
1859 Ga0075370_10527534
1860 Ga0075370_10643318
1861 Ga0075370_10654221
1862 Ga0068871_100004241
1863 Ga0068871_100094517
1864 Ga0068871_100195365
1865 Ga0068871_100614112
1866 Ga0068871_101606850
1867 Ga0068871_101863082
1868 Ga0068871_102233905
1869 Ga0075430_100025745
1870 Ga0075433_10658183
1871 Ga0075429_100034324
1872 Ga0075429_101789318
1873 Ga0068865_100036691
1874 Ga0068865_100125124
1875 Ga0068865_100139010
1876 Ga0068865_100188351
1877 Ga0068865_100532660
1878 Ga0068865_100625864
1879 Ga0068865_100714478
1880 Ga0068865_101013388
1881 Ga0097620_100166332
1882 Ga0097620_100617651
1883 Ga0097620_100709335
1884 Ga0097620_101094136
1885 Ga0097620_102786881
1886 Ga0099823_1000164
1887 Ga0075435_100757518
1888 Ga0105251_10594277
1889 Ga0105240_10020928
1890 Ga0105240_10091540
1891 Ga0105240_10192337
1892 Ga0105240_10514691
1893 Ga0105240_11916636
1894 Ga0105240_11999306
1895 Ga0111539_11587541
1896 Ga0105245_10004781
1897 Ga0105245_10447177
1898 Ga0105245_10848886
1899 Ga0114129_10457333
1900 Ga0114129_10582865
1901 Ga0105243_10001238
1902 Ga0105243_10070292
1903 Ga0105243_10185578
1904 Ga0105243_10282955
1905 Ga0105243_10448998
1906 Ga0105243_10691013
1907 Ga0105241_10619696
1908 Ga0105241_10740028
1909 Ga0105241_10920631
1910 Ga0105242_10078680
1911 Ga0105242_10261291
1912 Ga0105242_13280570
1913 Ga0105248_10025146
1914 Ga0105248_10115604
1915 Ga0105248_10126227
1916 Ga0105248_10560532
1917 Ga0105237_10010119
1918 Ga0105238_10020844
1919 Ga0105238_10261763
1920 Ga0105238_10609897
1921 Ga0105238_10711555
1922 Ga0105238_10960111
1923 Ga0105249_10015679
1924 Ga0105249_10022012
1925 Ga0105249_10027380
1926 Ga0105239_10000914
1927 Ga0105239_10253069
1928 Ga0105239_11107013
1929 Ga0105239_11416417
1930 Ga0105239_13094518
1931 Ga0105246_11304357
1932 Ga0105246_11406569
1933 Ga0157340_1013755
1934 Ga0157325_1018032
1935 Ga0157319_1000009
1936 Ga0157315_1006689
1937 Ga0157327_1050875
1938 Ga0157373_10178978
1939 Ga0157373_10547074
1940 Ga0157373_11048390
1941 Ga0157371_10273729
1942 Ga0157371_10393527
1943 Ga0157370_10300284
1944 Ga0157370_10603805
1945 Ga0157370_10896628
1946 Ga0157369_10038041
1947 Ga0157369_10720988
1948 Ga0157369_11860210
1949 Ga0157374_10031516
1950 Ga0157374_10071656
1951 Ga0157374_10091743
1952 Ga0157374_10109095
1953 Ga0157374_10347798
1954 Ga0157378_10013493
1955 Ga0157378_10024860
1956 Ga0157378_10083591
1957 Ga0157378_10206658
1958 Ga0157378_10234741
1959 Ga0157378_10565633
1960 Ga0157378_12004026
1961 Ga0163162_10036220
1962 Ga0163162_10050457
1963 Ga0163162_10133273
1964 Ga0163162_10531748
1965 Ga0163162_10603819
1966 Ga0163162_10628255
1967 Ga0163162_10632997
1968 Ga0163162_10941602
1969 Ga0163162_11862038
1970 Ga0157372_10219116
1971 Ga0157372_10424816
1972 Ga0157372_10822618
1973 Ga0157372_12403121
1974 Ga0157375_10006998
1975 Ga0157375_10012615
1976 Ga0157375_10014610
1977 Ga0157375_10017183
1978 Ga0157375_10097705
1979 Ga0157375_10132410
1980 Ga0157375_10204193
1981 Ga0157375_10751085
1982 Ga0157375_11566463
1983 Ga0157375_11827134
1984 Ga0157375_12140135
1985 Ga0163163_10000864
1986 Ga0163163_11053786
1987 Ga0157380_10057760
1988 Ga0157380_10172521
1989 Ga0157380_10202828
1990 Ga0157380_10696184
1991 Ga0157380_11033392
1992 Ga0157380_11358176
1993 Ga0157377_10000014
1994 Ga0157377_10002696
1995 Ga0157377_10709345
1996 Ga0157377_10808312
1997 Ga0157379_10004431
1998 Ga0157379_10028700
1999 Ga0157379_10031149
2000 Ga0157379_10053888
2001 Ga0157379_10077404
2002 Ga0157379_10212028
2003 Ga0157379_10341460
2004 Ga0157379_10412328
2005 Ga0157379_10562367
2006 Ga0157376_10024497
2007 Ga0157376_10135295
2008 Ga0157376_10144432
2009 Ga0157376_10238764
2010 Ga0157376_10246313
2011 Ga0157376_10541042
2012 Ga0157376_10555117
2013 Ga0157376_10589480
2014 Ga0157376_12906528
2015 Ga0182006_1211916
2016 Ga0182007_10266367
2017 Ga0182005_1091227
2018 Ga0163161_10012297
2019 Ga0163161_10019156
2020 Ga0163161_10040590
2021 Ga0163161_10123509
2022 Ga0163161_10181451
2023 Ga0163161_10268707
2024 Ga0206353_10514887
2025 Ga0213872_10002349
2026 Ga0213872_10043062
2027 Ga0213872_10251285
2028 Ga0209258_120493
2029 Ga0207425_1000511
2030 Ga0209129_1002180
2031 Ga0209129_1026616
2032 Ga0207666_1048305
2033 Ga0209673_1009744
2034 Ga0209673_1012171
2035 Ga0209673_1029638
2036 Ga0209564_1000003
2037 Ga0209564_1000196
2038 Ga0209758_1000181
2039 Ga0209758_1000207
2040 Ga0209050_1000858
2041 Ga0209050_1001266
2042 Ga0209050_1006370
2043 Ga0209256_1031332
2044 Ga0209256_1074696
2045 Ga0209051_1002697
2046 Ga0209051_1012833
2047 Ga0209051_1043460
2048 Ga0209257_1000021
2049 Ga0209257_1005175
2050 Ga0209257_1015510
2051 Ga0209257_1042771
2052 Ga0209257_1153677
2053 Ga0207697_10110727
2054 Ga0207656_10014661
2055 Ga0207656_10082290
2056 Ga0207656_10127880
2057 Ga0207656_10147672
2058 Ga0207656_10245505
2059 Ga0207656_10311423
2060 Ga0207682_10027282
2061 Ga0207682_10043554
2062 Ga0207642_10002666
2063 Ga0207642_10012484
2064 Ga0207642_10052446
2065 Ga0207710_10156056
2066 Ga0207688_10034955
2067 Ga0207680_10005278
2068 Ga0207680_10041270
2069 Ga0207680_10185664
2070 Ga0207680_10586460
2071 Ga0207685_10302143
2072 Ga0207645_10001190
2073 Ga0207645_10029270
2074 Ga0207645_10079243
2075 Ga0207645_10140960
2076 Ga0207645_10182418
2077 Ga0207645_10192193
2078 Ga0207643_10318077
2079 Ga0207643_10832915
2080 Ga0207643_10996285
2081 Ga0207705_10024072
2082 Ga0207705_10039570
2083 Ga0207705_10431687
2084 Ga0207705_10956916
2085 Ga0207684_10015609
2086 Ga0207684_10544836
2087 Ga0207654_10451245
2088 Ga0207654_10717037
2089 Ga0207654_10764005
2090 Ga0207707_10292186
2091 Ga0207707_10324237
2092 Ga0207695_10016280
2093 Ga0207695_10519502
2094 Ga0207695_10637486
2095 Ga0207671_10006390
2096 Ga0207660_10101515
2097 Ga0207662_10061901
2098 Ga0207657_10024402
2099 Ga0207657_10145653
2100 Ga0207657_10675112
2101 Ga0207649_10001484
2102 Ga0207649_10009940
2103 Ga0207649_10409486
2104 Ga0207649_10737510
2105 Ga0207649_11134876
2106 Ga0207652_10077074
2107 Ga0207646_10307947
2108 Ga0207681_10000214
2109 Ga0207681_10099546
2110 Ga0207681_10161918
2111 Ga0207681_10192341
2112 Ga0207681_10279077
2113 Ga0207681_10439878
2114 Ga0207681_10466410
2115 Ga0207681_10691665
2116 Ga0207694_10009034
2117 Ga0207694_10207529
2118 Ga0207694_10478137
2119 Ga0207694_11061595
2120 Ga0207650_10000937
2121 Ga0207650_10002494
2122 Ga0207650_10103958
2123 Ga0207650_10143131
2124 Ga0207650_10195655
2125 Ga0207650_10273263
2126 Ga0207650_10426023
2127 Ga0207650_10777543
2128 Ga0207650_11545158
2129 Ga0207659_10004306
2130 Ga0207659_10004991
2131 Ga0207659_10017778
2132 Ga0207659_10017801
2133 Ga0207659_10055052
2134 Ga0207659_10092294
2135 Ga0207659_10482749
2136 Ga0207659_10985527
2137 Ga0207687_10280279
2138 Ga0207687_10506091
2139 Ga0207687_10949392
2140 Ga0207687_11141610
2141 Ga0207644_10010554
2142 Ga0207644_10014021
2143 Ga0207644_10024213
2144 Ga0207644_10044789
2145 Ga0207644_10057347
2146 Ga0207644_10196979
2147 Ga0207644_11520441
2148 Ga0207644_11806127
2149 Ga0207690_10002792
2150 Ga0207690_10017607
2151 Ga0207690_10035310
2152 Ga0207690_10084537
2153 Ga0207690_10240615
2154 Ga0207706_10000449
2155 Ga0207706_10003147
2156 Ga0207706_10018191
2157 Ga0207706_10033988
2158 Ga0207706_10322887
2159 Ga0207706_10356451
2160 Ga0207706_10506314
2161 Ga0207706_10507711
2162 Ga0207706_11135284
2163 Ga0207686_10008428
2164 Ga0207686_10076296
2165 Ga0207686_11064645
2166 Ga0207709_10000804
2167 Ga0207709_10022408
2168 Ga0207709_10264068
2169 Ga0207709_10300940
2170 Ga0207709_10937051
2171 Ga0207670_10120453
2172 Ga0207670_10711682
2173 Ga0207670_11767725
2174 Ga0207669_10020710
2175 Ga0207669_10031788
2176 Ga0207669_10147654
2177 Ga0207669_10158936
2178 Ga0207669_10183787
2179 Ga0207669_10301815
2180 Ga0207669_10363569
2181 Ga0207669_10458253
2182 Ga0207669_10919911
2183 Ga0207704_10003076
2184 Ga0207704_10026016
2185 Ga0207704_10133576
2186 Ga0207704_10184203
2187 Ga0207704_10455008
2188 Ga0207704_10471995
2189 Ga0207704_10504016
2190 Ga0207704_10879031
2191 Ga0207665_10358200
2192 Ga0207665_11537807
2193 Ga0207691_10001841
2194 Ga0207691_10024826
2195 Ga0207691_10045546
2196 Ga0207691_10120992
2197 Ga0207691_10202067
2198 Ga0207691_10214760
2199 Ga0207691_10230990
2200 Ga0207691_10545743
2201 Ga0207691_10593261
2202 Ga0207691_10617357
2203 Ga0207691_11111503
2204 Ga0207711_10036125
2205 Ga0207711_10040995
2206 Ga0207711_10043521
2207 Ga0207711_10056982
2208 Ga0207711_10069942
2209 Ga0207711_10077629
2210 Ga0207711_10401642
2211 Ga0207689_10001542
2212 Ga0207689_10016843
2213 Ga0207689_10099988
2214 Ga0207689_10126213
2215 Ga0207689_10154252
2216 Ga0207689_10187388
2217 Ga0207689_10276067
2218 Ga0207661_10061440
2219 Ga0207661_10179565
2220 Ga0207661_10771878
2221 Ga0207679_10000220
2222 Ga0207679_10017939
2223 Ga0207679_11027953
2224 Ga0207667_10187364
2225 Ga0207667_11371211
2226 Ga0207651_10007714
2227 Ga0207651_10017944
2228 Ga0207651_10023971
2229 Ga0207651_10026542
2230 Ga0207651_10179679
2231 Ga0207651_10318084
2232 Ga0207651_10420766
2233 Ga0207651_10616424
2234 Ga0207651_11566746
2235 Ga0207712_10003685
2236 Ga0207712_10037266
2237 Ga0207712_10485526
2238 Ga0207668_10007597
2239 Ga0207668_10081814
2240 Ga0207668_10083356
2241 Ga0207668_10130917
2242 Ga0207668_10589541
2243 Ga0207668_11135661
2244 Ga0207640_10480671
2245 Ga0207640_10570827
2246 Ga0207658_10002329
2247 Ga0207658_10003279
2248 Ga0207658_10092681
2249 Ga0207658_10297802
2250 Ga0207658_10525847
2251 Ga0207658_10751053
2252 Ga0207658_10786591
2253 Ga0207658_10902915
2254 Ga0207677_10004256
2255 Ga0207677_10010920
2256 Ga0207677_10064331
2257 Ga0207677_10305442
2258 Ga0207677_10324344
2259 Ga0207677_10611657
2260 Ga0207677_10670329
2261 Ga0207677_11399452
2262 Ga0207703_10003713
2263 Ga0207703_10013980
2264 Ga0207703_11136695
2265 Ga0207639_10023473
2266 Ga0207639_10038242
2267 Ga0207639_10062937
2268 Ga0207639_10108330
2269 Ga0207639_11079247
2270 Ga0207639_11219935
2271 Ga0207639_11794840
2272 Ga0207678_10006005
2273 Ga0207678_10268879
2274 Ga0207678_10295515
2275 Ga0207678_10528083
2276 Ga0207708_10127265
2277 Ga0207702_10012956
2278 Ga0207702_10023008
2279 Ga0207702_10336198
2280 Ga0207702_10488907
2281 Ga0207702_10880880
2282 Ga0207641_10015342
2283 Ga0207641_10022787
2284 Ga0207641_10040936
2285 Ga0207641_10050442
2286 Ga0207641_10053534
2287 Ga0207641_10091665
2288 Ga0207641_10109554
2289 Ga0207641_10275304
2290 Ga0207641_10410947
2291 Ga0207648_10000062
2292 Ga0207648_10005680
2293 Ga0207648_10016056
2294 Ga0207648_10022315
2295 Ga0207648_10027768
2296 Ga0207648_10039524
2297 Ga0207648_10046362
2298 Ga0207648_10155583
2299 Ga0207648_10222240
2300 Ga0207648_10299880
2301 Ga0207648_10376683
2302 Ga0207648_10538976
2303 Ga0207648_10627432
2304 Ga0207676_10027995
2305 Ga0207676_10040197
2306 Ga0207676_10042173
2307 Ga0207676_10148970
2308 Ga0207676_10154293
2309 Ga0207676_10174215
2310 Ga0207676_10451756
2311 Ga0207676_10579893
2312 Ga0207676_10621491
2313 Ga0207674_10008358
2314 Ga0207674_10016738
2315 Ga0207674_10117874
2316 Ga0207674_10251500
2317 Ga0207674_10579628
2318 Ga0207674_10625124
2319 Ga0207674_10685603
2320 Ga0207675_100000214
2321 Ga0207675_100014189
2322 Ga0207675_100115029
2323 Ga0207675_100157793
2324 Ga0207675_100358683
2325 Ga0207675_101058402
2326 Ga0207683_10012322
2327 Ga0207683_10041309
2328 Ga0207683_10052458
2329 Ga0207683_10111911
2330 Ga0207683_10133661
2331 Ga0207683_10196025
2332 Ga0207683_10316180
2333 Ga0207683_10465761
2334 Ga0207683_10594593
2335 Ga0207683_10848548
2336 Ga0207698_10003539
2337 Ga0207698_10005500
2338 Ga0207698_10006533
2339 Ga0207698_10055990
2340 Ga0207698_10064769
2341 Ga0207698_10265655
2342 Ga0207698_10292521
2343 Ga0207698_10684324
2344 Ga0207698_10742882
2345 Ga0207698_10743730
2346 Ga0207698_10991956
2347 Ga0207698_11079274
2348 Ga0209389_1037396
2349 Ga0209371_1023370
2350 Ga0209971_1044781
2351 Ga0209813_10009766
2352 Ga0209974_10000044
2353 Ga0268266_10129746
2354 Ga0268266_10242316
2355 Ga0268266_11030168
2356 Ga0268266_11263554
2357 Ga0268265_10009334
2358 Ga0268265_10039299
2359 Ga0268265_10308172
2360 Ga0268265_10624783
2361 Ga0268265_11008029
2362 Ga0268264_10001033
2363 Ga0268264_10072983
2364 Ga0268264_10241607
2365 Ga0268264_10263534
2366 Ga0268264_10624264
2367 Ga0268264_11109104
2368 Ga0268264_11375056
2369 Ga0307517_10000708
2370 Ga0307517_10118579
2371 Ga0307517_10273449
2372 Ga0307517_10410674
2373 Ga0307515_10000150
2374 Ga0307515_10000187
2375 Ga0307515_10005172
2376 Ga0307515_10015579
2377 Ga0307515_10032801
2378 Ga0307515_10064599
2379 Ga0307515_10096842
2380 Ga0307515_10216175
2381 Ga0307515_10259736
2382 Ga0307515_10327804
2383 Ga0307515_10343198
2384 Ga0268256_1025964
2385 Ga0307512_10109325
2386 Ga0307512_10145132
2387 Ga0307512_10231385
2388 Ga0307513_10017100
2389 Ga0307513_10115414
2390 Ga0307513_10122795
2391 Ga0307513_10124857
2392 Ga0307509_10034015
2393 Ga0307509_10039232
2394 Ga0307509_10185497
2395 Ga0307509_10212909
2396 Ga0307408_100000010
2397 Ga0307408_100018381
2398 Ga0307408_100113110
2399 Ga0307408_100400521
2400 Ga0307408_101204470
2401 Ga0307408_101441961
2402 Ga0307508_10001596
2403 Ga0307508_10003456
2404 Ga0307508_10110633
2405 Ga0307508_10294188
2406 Ga0307514_10002176
2407 Ga0307514_10120644
2408 Ga0307514_10282290
2409 Ga0307514_10286116
2410 Ga0307516_10000268
2411 Ga0307516_10003906
2412 Ga0307516_10213559
2413 Ga0307516_10294015
2414 Ga0307516_10647278
2415 Ga0307516_10753397
2416 Ga0307405_10005746
2417 Ga0307405_10274690
2418 Ga0307405_10628796
2419 Ga0307405_11960169
2420 Ga0307413_10019225
2421 Ga0307518_10370619
2422 Ga0307410_10003356
2423 Ga0307406_10354766
2424 Ga0307407_10008822
2425 Ga0307407_10153575
2426 Ga0307407_11439400
2427 Ga0307412_10134374
2428 Ga0307412_10172020
2429 Ga0307412_10415390
2430 Ga0307412_10866769
2431 Ga0307412_10981464
2432 Ga0307409_100382829
2433 Ga0307409_100529484
2434 Ga0307416_100013304
2435 Ga0307416_100274638
2436 Ga0307416_100475036
2437 Ga0307416_101647897
2438 Ga0307416_101921852
2439 Ga0307414_10223977
2440 Ga0307414_10334425
2441 Ga0307414_12201286
2442 Ga0307411_10001686
2443 Ga0307411_10001815
2444 Ga0307411_10460262
2445 Ga0307411_10743021
2446 Ga0307411_11027769
2447 Ga0307415_100007903
2448 Ga0307415_100205875
2449 Ga0307507_10023516
2450 Ga0307507_10094001
2451 Ga0307510_10025175
2452 Ga0307510_10045192
2453 Ga0307510_10051426
2454 Ga0307510_10498148
2455 Ga0373958_0058867
2456 Ga0373959_0046453
2457 Ga0373938_0031692
2458 Ga0373940_0047582
2459 Ga0373940_0237584
2460 Ga0373944_0272924
2461 Ga0373949_0028332
2462 Ga0373951_0090239
2463 Ga0373952_0104597
2464 Ga0373923_0303749
2465 Ga0373923_0516054
2466 Ga0373932_0034081
2467 Ga0373939_0000272
2468 Ga0373954_0173704
2469 Ga0373943_0070104
2470 Ga0373943_0105381
2471 Ga0373943_0798885
2472 Ga0373946_0320684
2473 Ga0373946_0599319
2474 Ga0373955_0177348
2475 Ga0373962_0006206
2476 Ga0373962_0011842
2477 Ga0373924_0106397
2478 Ga0373924_0503637
2479 Ga0373931_0000665
2480 Ga0373931_0001429
2481 Ga0373931_0370700
2482 Ga0373935_0795653
2483 Ga0373927_0352780
2484 Ga0373927_0448564
2485 Ga0373933_0182375
2486 Ga0373933_0276253
2487 Ga0373947_0050825
2488 Ga0373947_0831150
2489 Ga0373937_0065617
2490 Ga0373937_0129239
2491 Ga0373937_0162313
2492 Ga0373925_0070801
2493 Ga0373925_0080994
2494 Ga0373925_0193368
2495 Ga0373925_0405428
2496 Ga0373925_0673822
2497 Ga0395900_0000535
2498 Ga0395898_0002836
2499 Ga0395905_0007293
2500 Ga0395905_0012706
2501 Ga0395905_0053650
2502 Ga0395905_0124032
2503 Ga0395905_0811662
2504 Ga0436364_1495413
2505 Ga0436365_1267282
2506 Ga0436360_0381654
2507 Ga0436361_0233952
2508 Ga0436361_0240417
2509 Ga0436361_0996052
2510 Ga0439461_0059791
2511 Ga0439461_0127329
2512 Ga0439465_0338149
2513 Ga0451789_1178356
2514 Ga0451793_0358311
2515 Ga0451793_1172903
2516 Ga0451793_1673427
2517 Ga0451797_0278276
2518 Ga0451797_1036550
2519 Ga0451797_1315304
2520 Ga0451795_0059148
2521 Ga0451795_0139934
2522 Ga0451795_0394184
2523 Ga0451798_0566853
2524 Ga0451798_0791769
2525 Ga0451798_1166708
2526 Ga0451800_0500868
2527 Ga0451800_1533257
2528 Ga0451802_0175899
2529 Ga0451805_098782
2530 Ga0451804_0031720
2531 Ga0451804_0695359
2532 Ga0451807_0270528
2533 Ga0451807_0589163
2534 Ga0451807_0592901
2535 Ga0451833_1494138
2536 Ga0451835_0060653
2537 Ga0451839_0134199
2538 Ga0451839_0843576
2539 Ga0451841_0137167
2540 Ga0451841_0202568
2541 Ga0451845_0177849
2542 Ga0451849_0038608
2543 Ga0451851_0007129
2544 Ga0451851_0476484
2545 Ga0451843_0724857
2546 Ga0451843_1037426
2547 Ga0451843_1577317
2548 Ga0451855_0366185
2549 Ga0451853_2795309
2550 Ga0451853_3145576
2551 Ga0451853_3325265
2552 Ga0451853_3908419
2553 Ga0439433_0025071
2554 Ga0439437_022894
2555 Ga0439445_0030673
2556 Ga0439449_0117024
2557 Ga0439450_001164
2558 Ga0439450_073815
2559 Ga0439454_110360
2560 Ga0439455_0049240
2561 Ga0450912_031564
2562 Ga0450917_000284
2563 Ga0450919_000285
2564 Ga0450920_055118
2565 Ga0450888_005886
2566 Ga0450888_010596
2567 Ga0450890_001614
2568 Ga0450890_001839
2569 Ga0450891_001574
2570 Ga0450892_001645
2571 Ga0450898_019707
2572 Ga0450898_028272
2573 Ga0450898_042079
2574 Ga0450904_014100
2575 Ga0450889_001274
2576 Ga0439446_0069153
2577 Ga0439458_0046384
2578 Ga0439458_0105508
2579 Ga0439435_0169373
2580 Ga0439444_0022531
2581 Ga0439464_0004537
2582 Ga0439460_0071551
2583 Ga0450918_000434
2584 Ga0450893_0006947
2585 Ga0450893_0030477
2586 Ga0450893_0077745
2587 Ga0451577_0001608
2588 Ga0451577_0008143
2589 Ga0451577_0009084
2590 Ga0451577_0292353
2591 Ga0451577_0379735
2592 Ga0451577_1509607
2593 Ga0466969_0023536
2594 Ga0466969_0057161
2595 Ga0466972_0004153
2596 Ga0466972_0013057
2597 Ga0466972_0039081
2598 Ga0453683_0844060
2599 Ga0466965_0036600
2600 Ga0466965_0057540
2601 Ga0466965_0153621
2602 Ga0466965_0212190
2603 Ga0466965_0220200
2604 Ga0466966_0004224
2605 Ga0466966_0041477
2606 Ga0466966_0050824
2607 Ga0466961_0032915
2608 Ga0466961_0045694
2609 Ga0466961_0240990
2610 Ga0466963_0037909
2611 Ga0466964_0012532
2612 Ga0466964_0060667
2613 Ga0453684_0007620
2614 Ga0453684_0041964
2615 Ga0453684_0118560
2616 Ga0453684_0242660
2617 Ga0453684_0296619
2618 Ga0453684_2447925
2619 Ga0466968_0086394
2620 Ga0466970_0026135
2621 Ga0466970_0301278
2622 Ga0466957_0096817
2623 Ga0466960_0005145
2624 Ga0466960_0205627
2625 Ga0466959_0000793
2626 Ga0466959_0058453
2627 Ga0451576_0004508
2628 Ga0451576_0014073
2629 Ga0451576_0040276
2630 Ga0451576_0067461
2631 Ga0451576_0094271
2632 Ga0451576_0179084
2633 Ga0451576_0226207
2634 Ga0451576_0357938
2635 Ga0466958_0138502
2636 Ga0495592_0000295
2637 Ga0495592_0570222
2638 Ga0495603_0294798
2639 Ga0495590_0088566
2640 Ga0495591_101977
2641 Ga0495629_0183779
2642 Ga0495629_0913725
2643 Ga0495638_0463109
2644 Ga0495582_0516988
2645 Ga0495639_0317507
2646 Ga0495664_0351137
2647 Ga0495583_0089971
2648 Ga0495606_0308558
2649 Ga0495608_0220549
2650 Ga0495610_0005844
2651 Ga0495620_0083960
2652 Ga0495628_0935336
2653 Ga0495630_1026686
2654 Ga0495631_0066241
2655 Ga0495632_0010763
2656 Ga0495632_0020823
2657 Ga0495632_0284097
2658 Ga0495643_0158986
2659 Ga0495648_0163679
2660 Ga0495648_0195975
2661 Ga0495648_0455521
2662 Ga0495666_0091251
2663 Ga0495666_0482124
2664 Ga0495586_0159847
2665 Ga0495586_0182997
2666 Ga0495609_0149509
2667 Ga0495621_0292428
2668 Ga0495597_0008922
2669 Ga0495645_0150423
2670 Ga0495667_0168248
2671 Ga0495668_0148343
2672 Ga0495668_0813534
2673 Ga0495611_0062211
2674 Ga0495625_0002174
2675 Ga0495625_0004670
2676 Ga0495625_0289950
2677 Ga0495625_0608088
2678 Ga0495635_0210694
2679 Ga0495647_0113929
2680 Ga0495647_0214694
2681 Ga0495658_0067119
2682 Ga0495658_0107084
2683 Ga0495658_0109706
2684 Ga0495658_0166449
2685 Ga0495613_0402751
2686 Ga0495613_0475467
2687 Ga0495624_0025731
2688 Ga0495670_0081267
2689 Ga0495670_0195654
2690 Ga0495671_0142081
2691 Ga0495671_0248083
2692 Ga0495649_0006798
2693 Ga0495660_0020654
2694 Ga0495581_0418620
2695 Ga0495636_0280313
2696 Ga0495674_0667548
2697 Ga0495687_000636
2698 Ga0495673_0076118
2699 Ga0495684_0179919
2700 Ga0495684_0941954
2701 Ga0495686_0002900
2702 Ga0495686_0069329
2703 Ga0495602_0403157
2704 Ga0495626_0133152
2705 Ga0496101_0221248
2706 Ga0496101_0573894
2707 Ga0496101_0997218
2708 Ga0496101_1062950
2709 Ga0496102_0027533
2710 Ga0496102_0652466
2711 Ga0496104_0214747
2712 Ga0496104_0308141
2713 Ga0496105_0026211
2714 Ga0496105_0231209
2715 Ga0496105_0302639
2716 Ga0496105_1066228
2717 Ga0496106_0010515
2718 Ga0496106_0125219
2719 Ga0496107_0007401
2720 Ga0496107_0373843
2721 Ga0496108_0028747
2722 Ga0496108_0216381
2723 Ga0496108_0332358
2724 Ga0496108_0378982
2725 Ga0496108_1201518
2726 Ga0496109_0304524
2727 Ga0496109_1588787
2728 Ga0496110_0031571
2729 Ga0496110_0297248
2730 Ga0496110_0938505
2731 Ga0496111_0640031
2732 Ga0496111_0913893
2733 Ga0496112_0263917
2734 Ga0496113_0272336
2735 Ga0496113_0350661
2736 Ga0496114_0263997
2737 Ga0496114_0272685
2738 Ga0496114_0957620
2739 Ga0496114_1025311
2740 Ga0496115_0200731
2741 Ga0496121_0018192
2742 Ga0496123_0302375
2743 Ga0496124_0071074
2744 Ga0496125_0006880
2745 Ga0496125_0137600
2746 Ga0496125_0361294
2747 Ga0496126_0100589
2748 Ga0496126_0200834
2749 Ga0501309_016098
2750 Ga0501310_002487
2751 Ga0501305_009668
2752 Ga0501292_009653
2753 Ga0501293_015501
2754 Ga0501294_005995
2755 Ga0501295_102340
2756 Ga0501298_016579
2757 Ga0501301_011540
2758 Ga0501303_007065
2759 Ga0501312_032643
2760 Ga0501312_078798
2761 Ga0501313_011837
2762 Ga0501043_0000075
2763 Ga0501046_0000195
2764 Ga0501047_0000145
2765 Ga0501048_0000999
2766 Ga0501070_1001267
2767 Ga0501198_000015
2768 Ga0501206_010361
2769 Ga0501207_019830
2770 Ga0501211_005166
2771 Ga0501217_146762
2772 Ga0501222_000040
2773 Ga0501222_004797
2774 Ga0501222_059558
2775 Ga0501223_018194
2776 Ga0501233_123583
2777 Ga0501235_018965
2778 Ga0501249_009208
2779 Ga0501257_190349
2780 Ga0501261_048038
2781 Ga0501229_000012
2782 Ga0501245_035141
2783 Ga0501079_0520663
2784 Ga0501232_059792
2785 Ga0501262_019485
2786 Ga0501262_091132
2787 Ga0501263_091079
2788 Ga0501265_004388
2789 Ga0501269_048975
2790 Ga0501272_001140
2791 Ga0501274_027674
2792 Ga0501276_031686
2793 Ga0501280_042545
2794 Ga0501035_0067274
2795 Ga0501045_0010507
2796 Ga0501226_017971
2797 nmdc:mga03683_118420_c1
2798 nmdc:mga03683_12560_c1
2799 nmdc:mga03683_18823_c1
2800 nmdc:mga03683_49338_c1
2801 nmdc:mga00v17_102345_c1
2802 nmdc:mga0k408_112983_c1
2803 nmdc:mga0k408_115773_c1
2804 nmdc:mga0k408_148_c1
2805 nmdc:mga0k408_157915_c1
2806 nmdc:mga0k408_187083_c1
2807 nmdc:mga0k408_199009_c1
2808 nmdc:mga0k408_204526_c1
2809 nmdc:mga0k408_20746_c1
2810 nmdc:mga0k408_209336_c1
2811 nmdc:mga0k408_228472_c1
2812 nmdc:mga0k408_2372_c1
2813 nmdc:mga0k408_2509_c1
2814 nmdc:mga0k408_26933_c1
2815 nmdc:mga0k408_283907_c1
2816 nmdc:mga0k408_29340_c1
2817 nmdc:mga0k408_37851_c1
2818 nmdc:mga0k408_39980_c1
2819 nmdc:mga0k408_422366_c1
2820 nmdc:mga0k408_48557_c1
2821 nmdc:mga0k408_565085_c1
2822 nmdc:mga0k408_631204_c1
2823 nmdc:mga0k408_69397_c1
2824 nmdc:mga0k408_7192_c1
2825 nmdc:mga0k408_816325_c1
2826 nmdc:mga0k408_9250_c1
2827 nmdc:mga06z11_250734_c1
2828 nmdc:mga06z11_27747_c1
2829 nmdc:mga06z11_36995_c1
2830 nmdc:mga04h51_11416_c1
2831 nmdc:mga04h51_143940_c1
2832 nmdc:mga07m45_141279_c1
2833 nmdc:mga07m45_1748_c1
2834 nmdc:mga07m45_17681_c1
2835 nmdc:mga07m45_195687_c1
2836 nmdc:mga07m45_207593_c1
2837 nmdc:mga07m45_219380_c1
2838 nmdc:mga07m45_26285_c1
2839 nmdc:mga07m45_454377_c1
2840 nmdc:mga07m45_507282_c1
2841 nmdc:mga07m45_5236_c1
2842 nmdc:mga07m45_569_c1
2843 nmdc:mga07m45_587096_c1
2844 nmdc:mga07m45_637902_c1
2845 nmdc:mga07m45_651412_c1
2846 nmdc:mga07m45_9266_c1
2847 nmdc:mga05p37_1042262_c1
2848 nmdc:mga09592_2500_c1
2849 nmdc:mga0qj67_687499_c1
2850 nmdc:mga0rr50_598170_c1
2851 nmdc:mga0sz30_223290_c1
2852 nmdc:mga0sz30_485404_c1
2853 nmdc:mga0sz30_93180_c1
2854 Ga0495601_0239039
2855 Ga0495612_0109920
2856 Ga0495612_0111159
2857 Ga0500635_0089445
2858 Ga0495595_0045883
2859 Ga0495619_0263687
2860 Ga0495619_1013021
2861 Ga0500578_0000224
2862 Ga0500578_0050616
2863 Ga0500578_0299536
2864 Ga0500643_034161
2865 Ga0500644_0010134
2866 Ga0500644_0120932
2867 Ga0500646_0004682
2868 Ga0500646_0164139
2869 Ga0500583_0036759
2870 Ga0500583_0149970
2871 Ga0500651_0017559
2872 Ga0500651_0135489
2873 Ga0500651_0269812
2874 Ga0500650_0082359
2875 Ga0500650_0114126
2876 Ga0500562_126507
2877 Ga0500569_053929
2878 Ga0500593_000250
2879 Ga0500594_0016209
2880 Ga0500614_013639
2881 Ga0500628_002390
2882 Ga0500642_0007522
2883 Ga0500652_001099
2884 Ga0500652_033825
2885 Ga0500655_002874
2886 Ga0500655_042869
2887 Ga0500658_0007909
2888 Ga0500658_0187077
2889 Ga0500559_0000011
2890 Ga0500559_0126453
2891 Ga0500564_106111
2892 Ga0500568_0050224
2893 Ga0500577_0015015
2894 Ga0500577_0365620
2895 Ga0500577_0397043
2896 Ga0500579_189477
2897 Ga0500589_123070
2898 Ga0500619_000143
2899 Ga0500619_012224
2900 Ga0500622_0001541
2901 Ga0500622_0001880
2902 Ga0500622_0009235
2903 Ga0500627_0322206
2904 Ga0500636_0083939
2905 Ga0500637_0462678
2906 Ga0500570_080325
2907 Ga0500570_083568
2908 Ga0500645_014572
2909 Ga0500645_096771
2910 Ga0500587_000945
2911 Ga0500587_005067
2912 Ga0500661_106554
2913 2644305083

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00216

Bac_DNA_binding

Bacterial DNA-binding protein

51

140

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b8z-assembly1.cif.gz_B hu from thermotoga maritima 0.9392 38 126
1riy-assembly1.cif.gz_A-2 hu mutant v42i from thermotoga maritima 0.9177 38 126
1b8z-assembly1.cif.gz_B hu from thermotoga maritima 0.9132 38 126
4p3v-assembly1.cif.gz_A-2 crystal structure of the e. coli hu beta2 protein 0.9115 38 126
1huu-assembly2.cif.gz_B dna-binding protein hu from bacillus stearothermophilus 0.9047 38 126
ID Description Score Start End Superfamily
af_Q4D6K7_133_320_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9276 40 62 3.30.420.10
af_A0A1D8PLR7_520_680_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8951 40 68 3.40.50.80
4dkyA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8843 38 133 4.10.520.10
5fbmA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8736 38 127 4.10.520.10
4yexA00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.8694 38 126 4.10.520.10
ID Description Score Start End GO Terms
AF-A0A5D9CQ11-F1-model_v4 HU family DNA-binding protein 0.952 64 128 GO:0003677
GO:0030261
GO:0030527
AF-A0A3M1RL10-F1-model_v4 Integration host factor subunit alpha 0.9456 38 127 GO:0003677
GO:0005829
GO:0006310
GO:0006355
GO:0006417
GO:0030527
AF-A0A6L8C2B3-F1-model_v4 HU family DNA-binding protein 0.9444 45 128 GO:0003677
GO:0005829
GO:0030527
AF-A0A316LPA8-F1-model_v4 deleted 0.9289 37 126
AF-A0A416MW47-F1-model_v4 deleted 0.9277 38 127

Map