F494091
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1456 | 493 | 2913 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300046681|Ga0495647_0371742|Ga0495647_0371742_171_623 |
| Length | 150 |
| Sequence | MCSRRWVSASASGCEGDAMNHPEDPVIPAEAGDGEPPPNRVMLPTLETPTLTKAELAELLFERLGLNKRESKDMVEAFFDLIHATLVSGDDVKMSGFGNFNIRRKAPRPGRNPRTGEAIPIKARNVVTFHASHKLKGVVQGDIPPEEEFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 112 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 113 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 114 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 115 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 238 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 239 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 240 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 241 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 252 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 261 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 271 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 272 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 280 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 283 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 284 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 285 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 286 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 287 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 288 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 289 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 290 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 291 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 292 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 293 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 294 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 295 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 296 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 297 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 298 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 299 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 300 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 301 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 302 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 303 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 304 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 305 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 306 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 307 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 308 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 309 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 310 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 311 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 312 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 313 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 314 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 315 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 316 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 317 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 318 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 319 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 320 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 321 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 322 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 323 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 324 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 325 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 326 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 327 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 328 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 329 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 330 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 331 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 332 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 333 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 334 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 335 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 384 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 385 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 388 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 391 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 392 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 393 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 394 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 395 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 396 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 397 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 398 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 399 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 400 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 401 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 405 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 406 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 407 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 408 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 409 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 410 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 411 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 419 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 420 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 421 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 422 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 423 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 424 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 425 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 426 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 427 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 428 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 429 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 430 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 431 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 432 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 434 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 435 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 436 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 437 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 438 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 439 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 440 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 441 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 442 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 445 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 446 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 448 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 449 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 450 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 451 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 456 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 459 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 462 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 463 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 464 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 465 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 466 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 467 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 468 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 469 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 470 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 471 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 472 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 473 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 474 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 475 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 476 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 477 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 478 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 479 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 481 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 482 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 483 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 484 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 485 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 486 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 487 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 489 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 490 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 491 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 492 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 493 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0.55 |
| Isolates | 0.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.53 |
| Nodule | 0.14 |
| Rhizoplane | 3.98 |
| Rhizosphere | 76.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495647_0371742 | 3300046681 | Bacteria | 653 |
| 2 | JGI24033J26618_1036228 | 3300002155 | Bacteria | 677 |
| 3 | JGI25150J39212_1006308 | 3300002774 | Bacteria | 2457 |
| 4 | JGI25153J46596_10009043 | 3300003215 | Bacteria | 4682 |
| 5 | JGI25153J46596_10030106 | 3300003215 | Bacteria | 1853 |
| 6 | rootH1_10062755 | 3300003316 | Bacteria | 1416 |
| 7 | rootH2_10019535 | 3300003320 | Bacteria | 3072 |
| 8 | rootL2_10003847 | 3300003322 | Bacteria | 35009 |
| 9 | rootL2_10005851 | 3300003322 | Bacteria | 11114 |
| 10 | rootH1_10023641 | 3300003316 | Bacteria | 1142 |
| 11 | rootH1_10023641 | 3300003323 | Bacteria | 1358 |
| 12 | rootH1_10108114 | 3300003323 | Bacteria | 1001 |
| 13 | JGI26145J50221_1002180 | 3300003371 | Bacteria | 1539 |
| 14 | Ga0055526_1001112 | 3300003771 | Bacteria | 19553 |
| 15 | Ga0055530_10058995 | 3300003791 | Bacteria | 862 |
| 16 | Ga0055540_1022368 | 3300003792 | Bacteria | 1618 |
| 17 | Ga0055540_1112627 | 3300003792 | Bacteria | 501 |
| 18 | Ga0055531_10001930 | 3300003794 | Bacteria | 14509 |
| 19 | Ga0055531_10046861 | 3300003794 | Bacteria | 1183 |
| 20 | Ga0055543_1002155 | 3300004625 | Bacteria | 6796 |
| 21 | Ga0065165_1000184 | 3300005262 | Bacteria | 109539 |
| 22 | Ga0065165_1006209 | 3300005262 | Bacteria | 6370 |
| 23 | Ga0065715_10121665 | 3300005293 | Bacteria | 2223 |
| 24 | Ga0065715_10195151 | 3300005293 | Bacteria | 1392 |
| 25 | Ga0065715_10493371 | 3300005293 | Bacteria | 786 |
| 26 | Ga0065707_10082794 | 3300005295 | Bacteria | 12061 |
| 27 | Ga0065707_10327756 | 3300005295 | Bacteria | 939 |
| 28 | Ga0065707_10422887 | 3300005295 | Bacteria | 829 |
| 29 | Ga0065707_10568002 | 3300005295 | Bacteria | 706 |
| 30 | Ga0070658_10085385 | 3300005327 | Bacteria | 2596 |
| 31 | Ga0070658_10255739 | 3300005327 | Bacteria | 1486 |
| 32 | Ga0070658_10560847 | 3300005327 | Bacteria | 989 |
| 33 | Ga0070676_10002035 | 3300005328 | Bacteria | 10267 |
| 34 | Ga0070676_10088789 | 3300005328 | Bacteria | 1889 |
| 35 | Ga0070676_10151549 | 3300005328 | Bacteria | 1485 |
| 36 | Ga0070676_10167278 | 3300005328 | Bacteria | 1420 |
| 37 | Ga0070676_10443337 | 3300005328 | Bacteria | 911 |
| 38 | Ga0070676_11619813 | 3300005328 | Bacteria | 500 |
| 39 | Ga0070683_100049615 | 3300005329 | Bacteria | 3883 |
| 40 | Ga0070683_101356018 | 3300005329 | Bacteria | 683 |
| 41 | Ga0070690_100016127 | 3300005330 | Bacteria | 4469 |
| 42 | Ga0070690_100020915 | 3300005330 | Bacteria | 3991 |
| 43 | Ga0070670_100001136 | 3300005331 | Bacteria | 21141 |
| 44 | Ga0070670_100020708 | 3300005331 | Bacteria | 5656 |
| 45 | Ga0070670_100034250 | 3300005331 | Bacteria | 4371 |
| 46 | Ga0070670_100065307 | 3300005331 | Bacteria | 3123 |
| 47 | Ga0070670_100379370 | 3300005331 | Bacteria | 1245 |
| 48 | Ga0070670_100417662 | 3300005331 | Bacteria | 1186 |
| 49 | Ga0070670_100842064 | 3300005331 | Bacteria | 830 |
| 50 | Ga0070670_101220447 | 3300005331 | Bacteria | 687 |
| 51 | Ga0070670_101945992 | 3300005331 | Bacteria | 541 |
| 52 | Ga0070670_102100816 | 3300005331 | Bacteria | 520 |
| 53 | Ga0070677_10046190 | 3300005333 | Bacteria | 1740 |
| 54 | Ga0070677_10051350 | 3300005333 | Bacteria | 1668 |
| 55 | Ga0070677_10140396 | 3300005333 | Bacteria | 1113 |
| 56 | Ga0070677_10558075 | 3300005333 | Bacteria | 629 |
| 57 | Ga0068869_100003616 | 3300005334 | Bacteria | 9485 |
| 58 | Ga0068869_100013951 | 3300005334 | Bacteria | 5359 |
| 59 | Ga0068869_100084261 | 3300005334 | Bacteria | 2379 |
| 60 | Ga0068869_100138200 | 3300005334 | Bacteria | 1879 |
| 61 | Ga0068869_100230986 | 3300005334 | Bacteria | 1470 |
| 62 | Ga0070666_10051060 | 3300005335 | Bacteria | 2783 |
| 63 | Ga0070666_10058891 | 3300005335 | Bacteria | 2598 |
| 64 | Ga0070666_10402295 | 3300005335 | Bacteria | 984 |
| 65 | Ga0070666_10542382 | 3300005335 | Bacteria | 845 |
| 66 | Ga0070666_10799652 | 3300005335 | Bacteria | 694 |
| 67 | Ga0070680_100656390 | 3300005336 | Bacteria | 902 |
| 68 | Ga0070682_100040490 | 3300005337 | Bacteria | 2868 |
| 69 | Ga0070682_101024262 | 3300005337 | Bacteria | 687 |
| 70 | Ga0068868_100000818 | 3300005338 | Bacteria | 21090 |
| 71 | Ga0068868_100014677 | 3300005338 | Bacteria | 5777 |
| 72 | Ga0068868_100019252 | 3300005338 | Bacteria | 5113 |
| 73 | Ga0068868_100035823 | 3300005338 | Bacteria | 3838 |
| 74 | Ga0068868_100132399 | 3300005338 | Bacteria | 2041 |
| 75 | Ga0068868_100193168 | 3300005338 | Bacteria | 1694 |
| 76 | Ga0068868_100327318 | 3300005338 | Bacteria | 1307 |
| 77 | Ga0068868_100542579 | 3300005338 | Bacteria | 1024 |
| 78 | Ga0068868_101203844 | 3300005338 | Bacteria | 700 |
| 79 | Ga0070660_100046927 | 3300005339 | Bacteria | 3312 |
| 80 | Ga0070660_100168309 | 3300005339 | Bacteria | 1769 |
| 81 | Ga0070660_100822386 | 3300005339 | Bacteria | 782 |
| 82 | Ga0070689_100147818 | 3300005340 | Bacteria | 1894 |
| 83 | Ga0070689_100391053 | 3300005340 | Bacteria | 1174 |
| 84 | Ga0070689_102135811 | 3300005340 | Bacteria | 513 |
| 85 | Ga0070691_10912387 | 3300005341 | Bacteria | 543 |
| 86 | Ga0070687_101180020 | 3300005343 | Bacteria | 563 |
| 87 | Ga0070661_100000791 | 3300005344 | Bacteria | 22707 |
| 88 | Ga0070661_100020436 | 3300005344 | Bacteria | 4721 |
| 89 | Ga0070661_100061356 | 3300005344 | Bacteria | 2759 |
| 90 | Ga0070661_100084411 | 3300005344 | Bacteria | 2346 |
| 91 | Ga0070661_100309400 | 3300005344 | Bacteria | 1231 |
| 92 | Ga0070661_101008793 | 3300005344 | Bacteria | 691 |
| 93 | Ga0070668_100050350 | 3300005347 | Bacteria | 3207 |
| 94 | Ga0070668_100367400 | 3300005347 | Bacteria | 1221 |
| 95 | Ga0070668_101635463 | 3300005347 | Bacteria | 590 |
| 96 | Ga0070669_100119297 | 3300005353 | Bacteria | 2010 |
| 97 | Ga0070669_100124487 | 3300005353 | Bacteria | 1971 |
| 98 | Ga0070669_100391317 | 3300005353 | Bacteria | 1135 |
| 99 | Ga0070669_100527011 | 3300005353 | Bacteria | 983 |
| 100 | Ga0070669_100579569 | 3300005353 | Bacteria | 938 |
| 101 | Ga0070669_100636036 | 3300005353 | Bacteria | 896 |
| 102 | Ga0070675_100000269 | 3300005354 | Bacteria | 34213 |
| 103 | Ga0070675_100001006 | 3300005354 | Bacteria | 20229 |
| 104 | Ga0070675_100001473 | 3300005354 | Bacteria | 17347 |
| 105 | Ga0070675_100004442 | 3300005354 | Bacteria | 10691 |
| 106 | Ga0070675_100034940 | 3300005354 | Bacteria | 4082 |
| 107 | Ga0070675_100067143 | 3300005354 | Bacteria | 2967 |
| 108 | Ga0070675_100130871 | 3300005354 | Bacteria | 2138 |
| 109 | Ga0070675_100149834 | 3300005354 | Bacteria | 1999 |
| 110 | Ga0070675_100851828 | 3300005354 | Bacteria | 834 |
| 111 | Ga0070675_101266567 | 3300005354 | Bacteria | 679 |
| 112 | Ga0070671_100021062 | 3300005355 | Bacteria | 5322 |
| 113 | Ga0070671_100025141 | 3300005355 | Bacteria | 4883 |
| 114 | Ga0070671_100054032 | 3300005355 | Bacteria | 3338 |
| 115 | Ga0070671_100056765 | 3300005355 | Bacteria | 3258 |
| 116 | Ga0070671_100109545 | 3300005355 | Bacteria | 2319 |
| 117 | Ga0070671_100232448 | 3300005355 | Bacteria | 1564 |
| 118 | Ga0070671_100350208 | 3300005355 | Bacteria | 1260 |
| 119 | Ga0070671_100496619 | 3300005355 | Bacteria | 1049 |
| 120 | Ga0070671_100697473 | 3300005355 | Bacteria | 880 |
| 121 | Ga0070671_101263473 | 3300005355 | Bacteria | 651 |
| 122 | Ga0070674_100011798 | 3300005356 | Bacteria | 5334 |
| 123 | Ga0070674_100013715 | 3300005356 | Bacteria | 5016 |
| 124 | Ga0070674_100026145 | 3300005356 | Bacteria | 3808 |
| 125 | Ga0070674_100155833 | 3300005356 | Bacteria | 1728 |
| 126 | Ga0070674_100224261 | 3300005356 | Bacteria | 1464 |
| 127 | Ga0070674_100232817 | 3300005356 | Bacteria | 1438 |
| 128 | Ga0070674_100235016 | 3300005356 | Bacteria | 1432 |
| 129 | Ga0070674_100255810 | 3300005356 | Bacteria | 1377 |
| 130 | Ga0070674_100486718 | 3300005356 | Bacteria | 1025 |
| 131 | Ga0070674_102072756 | 3300005356 | Bacteria | 518 |
| 132 | Ga0070673_100008559 | 3300005364 | Bacteria | 6809 |
| 133 | Ga0070673_100071365 | 3300005364 | Bacteria | 2790 |
| 134 | Ga0070673_100075952 | 3300005364 | Bacteria | 2711 |
| 135 | Ga0070673_100240978 | 3300005364 | Bacteria | 1572 |
| 136 | Ga0070673_100274092 | 3300005364 | Bacteria | 1478 |
| 137 | Ga0070673_100481228 | 3300005364 | Bacteria | 1120 |
| 138 | Ga0070673_100796000 | 3300005364 | Bacteria | 873 |
| 139 | Ga0070688_100284908 | 3300005365 | Bacteria | 1189 |
| 140 | Ga0070688_100445952 | 3300005365 | Bacteria | 967 |
| 141 | Ga0070659_100000451 | 3300005366 | Bacteria | 30634 |
| 142 | Ga0070659_100010741 | 3300005366 | Bacteria | 6748 |
| 143 | Ga0070659_100010749 | 3300005366 | Bacteria | 6746 |
| 144 | Ga0070659_100076710 | 3300005366 | Bacteria | 2664 |
| 145 | Ga0070659_101845862 | 3300005366 | Bacteria | 542 |
| 146 | Ga0070667_100003333 | 3300005367 | Bacteria | 13717 |
| 147 | Ga0070667_100023446 | 3300005367 | Bacteria | 5120 |
| 148 | Ga0070667_100069129 | 3300005367 | Bacteria | 3005 |
| 149 | Ga0070667_100087470 | 3300005367 | Bacteria | 2674 |
| 150 | Ga0070667_100107798 | 3300005367 | Bacteria | 2412 |
| 151 | Ga0070667_100109237 | 3300005367 | Bacteria | 2397 |
| 152 | Ga0070667_100576390 | 3300005367 | Bacteria | 1036 |
| 153 | Ga0070667_100751731 | 3300005367 | Bacteria | 904 |
| 154 | Ga0070667_100763566 | 3300005367 | Bacteria | 897 |
| 155 | Ga0070667_100893616 | 3300005367 | Bacteria | 827 |
| 156 | Ga0070667_102045404 | 3300005367 | Bacteria | 539 |
| 157 | Ga0070701_10883299 | 3300005438 | Bacteria | 616 |
| 158 | Ga0070701_11166487 | 3300005438 | Bacteria | 545 |
| 159 | Ga0070700_100131463 | 3300005441 | Bacteria | 1690 |
| 160 | Ga0070663_100009632 | 3300005455 | Bacteria | 5990 |
| 161 | Ga0070663_100019349 | 3300005455 | Bacteria | 4485 |
| 162 | Ga0070663_100096616 | 3300005455 | Bacteria | 2198 |
| 163 | Ga0070663_100436341 | 3300005455 | Bacteria | 1077 |
| 164 | Ga0070663_100464499 | 3300005455 | Bacteria | 1045 |
| 165 | Ga0070663_100627191 | 3300005455 | Bacteria | 907 |
| 166 | Ga0070663_101685724 | 3300005455 | Bacteria | 566 |
| 167 | Ga0070678_100011667 | 3300005456 | Bacteria | 5431 |
| 168 | Ga0070678_100018712 | 3300005456 | Bacteria | 4496 |
| 169 | Ga0070678_100039403 | 3300005456 | Bacteria | 3333 |
| 170 | Ga0070678_100089762 | 3300005456 | Bacteria | 2353 |
| 171 | Ga0070678_100159972 | 3300005456 | Bacteria | 1823 |
| 172 | Ga0070678_100325158 | 3300005456 | Bacteria | 1314 |
| 173 | Ga0070678_100341685 | 3300005456 | Bacteria | 1284 |
| 174 | Ga0070678_100477001 | 3300005456 | Bacteria | 1097 |
| 175 | Ga0070678_100581749 | 3300005456 | Bacteria | 997 |
| 176 | Ga0070678_100809159 | 3300005456 | Bacteria | 851 |
| 177 | Ga0070678_101606426 | 3300005456 | Bacteria | 610 |
| 178 | Ga0070662_100001019 | 3300005457 | Bacteria | 17139 |
| 179 | Ga0070662_100011240 | 3300005457 | Bacteria | 5901 |
| 180 | Ga0070662_100023675 | 3300005457 | Bacteria | 4221 |
| 181 | Ga0070662_100127956 | 3300005457 | Bacteria | 1954 |
| 182 | Ga0070662_100170413 | 3300005457 | Bacteria | 1709 |
| 183 | Ga0070662_100199797 | 3300005457 | Bacteria | 1586 |
| 184 | Ga0070662_100444044 | 3300005457 | Bacteria | 1076 |
| 185 | Ga0070662_100533932 | 3300005457 | Bacteria | 981 |
| 186 | Ga0070662_101081723 | 3300005457 | Bacteria | 688 |
| 187 | Ga0070681_10197965 | 3300005458 | Bacteria | 1928 |
| 188 | Ga0070681_10278698 | 3300005458 | Bacteria | 1583 |
| 189 | Ga0068867_100000102 | 3300005459 | Bacteria | 54275 |
| 190 | Ga0068867_100016344 | 3300005459 | Bacteria | 5268 |
| 191 | Ga0068867_100019254 | 3300005459 | Bacteria | 4864 |
| 192 | Ga0068867_100021121 | 3300005459 | Bacteria | 4644 |
| 193 | Ga0068867_100024764 | 3300005459 | Bacteria | 4301 |
| 194 | Ga0068867_100034247 | 3300005459 | Bacteria | 3680 |
| 195 | Ga0068867_100048865 | 3300005459 | Bacteria | 3113 |
| 196 | Ga0068867_100256542 | 3300005459 | Bacteria | 1424 |
| 197 | Ga0068867_100743637 | 3300005459 | Bacteria | 869 |
| 198 | Ga0068867_100851984 | 3300005459 | Bacteria | 817 |
| 199 | Ga0068867_101856265 | 3300005459 | Bacteria | 567 |
| 200 | Ga0070685_10204044 | 3300005466 | Bacteria | 1287 |
| 201 | Ga0070685_10319507 | 3300005466 | Bacteria | 1052 |
| 202 | Ga0070685_10725257 | 3300005466 | Bacteria | 727 |
| 203 | Ga0070706_100222505 | 3300005467 | Bacteria | 1762 |
| 204 | Ga0070706_100894898 | 3300005467 | Bacteria | 820 |
| 205 | Ga0070706_101269687 | 3300005467 | Bacteria | 676 |
| 206 | Ga0070706_101283998 | 3300005467 | Bacteria | 672 |
| 207 | Ga0070707_100068338 | 3300005468 | Bacteria | 3419 |
| 208 | Ga0070707_101793977 | 3300005468 | Bacteria | 581 |
| 209 | Ga0070699_100333141 | 3300005518 | Bacteria | 1365 |
| 210 | Ga0070679_100008517 | 3300005530 | Bacteria | 9663 |
| 211 | Ga0070684_100080735 | 3300005535 | Bacteria | 2877 |
| 212 | Ga0070684_100357163 | 3300005535 | Bacteria | 1344 |
| 213 | Ga0068853_100039549 | 3300005539 | Bacteria | 4023 |
| 214 | Ga0068853_100082693 | 3300005539 | Bacteria | 2812 |
| 215 | Ga0068853_100289610 | 3300005539 | Bacteria | 1511 |
| 216 | Ga0068853_100585456 | 3300005539 | Bacteria | 1059 |
| 217 | Ga0068853_100672118 | 3300005539 | Bacteria | 987 |
| 218 | Ga0068853_102216775 | 3300005539 | Bacteria | 532 |
| 219 | Ga0070672_100000367 | 3300005543 | Bacteria | 25974 |
| 220 | Ga0070672_100005175 | 3300005543 | Bacteria | 8622 |
| 221 | Ga0070672_100029306 | 3300005543 | Bacteria | 4127 |
| 222 | Ga0070672_100053519 | 3300005543 | Bacteria | 3156 |
| 223 | Ga0070672_100070307 | 3300005543 | Bacteria | 2781 |
| 224 | Ga0070672_100076494 | 3300005543 | Bacteria | 2674 |
| 225 | Ga0070672_100091204 | 3300005543 | Bacteria | 2458 |
| 226 | Ga0070672_100126183 | 3300005543 | Bacteria | 2099 |
| 227 | Ga0070672_100143469 | 3300005543 | Bacteria | 1971 |
| 228 | Ga0070672_100286296 | 3300005543 | Bacteria | 1394 |
| 229 | Ga0070672_100631445 | 3300005543 | Bacteria | 935 |
| 230 | Ga0070672_101237673 | 3300005543 | Bacteria | 665 |
| 231 | Ga0070672_101527324 | 3300005543 | Bacteria | 598 |
| 232 | Ga0070686_100584919 | 3300005544 | Bacteria | 878 |
| 233 | Ga0070686_101249616 | 3300005544 | Bacteria | 618 |
| 234 | Ga0070686_101904375 | 3300005544 | Bacteria | 507 |
| 235 | Ga0070695_100895853 | 3300005545 | Bacteria | 716 |
| 236 | Ga0070693_100021069 | 3300005547 | Bacteria | 3448 |
| 237 | Ga0070693_100127276 | 3300005547 | Bacteria | 1587 |
| 238 | Ga0070665_100197332 | 3300005548 | Bacteria | 2013 |
| 239 | Ga0070665_101042928 | 3300005548 | Bacteria | 830 |
| 240 | Ga0070665_101238790 | 3300005548 | Bacteria | 756 |
| 241 | Ga0070665_101321897 | 3300005548 | Bacteria | 731 |
| 242 | Ga0070665_101550683 | 3300005548 | Bacteria | 671 |
| 243 | Ga0068855_100063871 | 3300005563 | Bacteria | 4295 |
| 244 | Ga0068855_100124744 | 3300005563 | Bacteria | 2945 |
| 245 | Ga0070664_100000524 | 3300005564 | Bacteria | 29185 |
| 246 | Ga0070664_100003061 | 3300005564 | Bacteria | 13518 |
| 247 | Ga0070664_100163926 | 3300005564 | Bacteria | 1968 |
| 248 | Ga0070664_100212193 | 3300005564 | Bacteria | 1730 |
| 249 | Ga0070664_100344962 | 3300005564 | Bacteria | 1353 |
| 250 | Ga0070664_100601512 | 3300005564 | Bacteria | 1020 |
| 251 | Ga0070664_100879653 | 3300005564 | Bacteria | 839 |
| 252 | Ga0070664_100976988 | 3300005564 | Bacteria | 795 |
| 253 | Ga0068857_100008620 | 3300005577 | Bacteria | 8823 |
| 254 | Ga0068857_100230301 | 3300005577 | Bacteria | 1694 |
| 255 | Ga0068857_100300894 | 3300005577 | Bacteria | 1478 |
| 256 | Ga0068857_100430985 | 3300005577 | Bacteria | 1231 |
| 257 | Ga0068857_101833039 | 3300005577 | Bacteria | 594 |
| 258 | Ga0068854_100020602 | 3300005578 | Bacteria | 4465 |
| 259 | Ga0068854_100139888 | 3300005578 | Bacteria | 1856 |
| 260 | Ga0068854_100542159 | 3300005578 | Bacteria | 985 |
| 261 | Ga0068854_101163122 | 3300005578 | Bacteria | 690 |
| 262 | Ga0068856_100006422 | 3300005614 | Bacteria | 11535 |
| 263 | Ga0068856_100015458 | 3300005614 | Bacteria | 7374 |
| 264 | Ga0068856_100057763 | 3300005614 | Bacteria | 3831 |
| 265 | Ga0068856_101078255 | 3300005614 | Bacteria | 821 |
| 266 | Ga0068856_102086819 | 3300005614 | Bacteria | 577 |
| 267 | Ga0070702_100164921 | 3300005615 | Bacteria | 1436 |
| 268 | Ga0070702_101036618 | 3300005615 | Bacteria | 652 |
| 269 | Ga0068852_100003787 | 3300005616 | Bacteria | 10603 |
| 270 | Ga0068852_100018700 | 3300005616 | Bacteria | 5463 |
| 271 | Ga0068852_100025312 | 3300005616 | Bacteria | 4807 |
| 272 | Ga0068852_100214846 | 3300005616 | Bacteria | 1826 |
| 273 | Ga0068852_100217237 | 3300005616 | Bacteria | 1817 |
| 274 | Ga0068852_100221503 | 3300005616 | Bacteria | 1799 |
| 275 | Ga0068852_100260265 | 3300005616 | Bacteria | 1666 |
| 276 | Ga0068852_100947732 | 3300005616 | Bacteria | 879 |
| 277 | Ga0068852_101078970 | 3300005616 | Bacteria | 823 |
| 278 | Ga0068852_101547430 | 3300005616 | Bacteria | 685 |
| 279 | Ga0068852_102020113 | 3300005616 | Bacteria | 599 |
| 280 | Ga0068859_100166319 | 3300005617 | Bacteria | 2285 |
| 281 | Ga0068859_100617641 | 3300005617 | Bacteria | 1177 |
| 282 | Ga0068859_101094095 | 3300005617 | Bacteria | 877 |
| 283 | Ga0068859_102786939 | 3300005617 | Bacteria | 537 |
| 284 | Ga0068864_100020683 | 3300005618 | Bacteria | 5507 |
| 285 | Ga0068864_100028571 | 3300005618 | Bacteria | 4716 |
| 286 | Ga0068864_100045025 | 3300005618 | Bacteria | 3785 |
| 287 | Ga0068864_100066554 | 3300005618 | Bacteria | 3128 |
| 288 | Ga0068864_100113586 | 3300005618 | Bacteria | 2414 |
| 289 | Ga0068864_100188680 | 3300005618 | Bacteria | 1888 |
| 290 | Ga0068864_100351616 | 3300005618 | Bacteria | 1390 |
| 291 | Ga0068864_100378150 | 3300005618 | Bacteria | 1341 |
| 292 | Ga0068864_100679397 | 3300005618 | Bacteria | 1004 |
| 293 | Ga0068864_101506658 | 3300005618 | Bacteria | 676 |
| 294 | Ga0068866_10029696 | 3300005718 | Bacteria | 2617 |
| 295 | Ga0068866_10060240 | 3300005718 | Bacteria | 1967 |
| 296 | Ga0068866_10083662 | 3300005718 | Bacteria | 1720 |
| 297 | Ga0068866_10134098 | 3300005718 | Bacteria | 1412 |
| 298 | Ga0068861_100002334 | 3300005719 | Bacteria | 12330 |
| 299 | Ga0068861_100007942 | 3300005719 | Bacteria | 7301 |
| 300 | Ga0068861_100042320 | 3300005719 | Bacteria | 3413 |
| 301 | Ga0068861_100273857 | 3300005719 | Bacteria | 1451 |
| 302 | Ga0068861_101213756 | 3300005719 | Bacteria | 730 |
| 303 | Ga0068861_101679098 | 3300005719 | Bacteria | 628 |
| 304 | Ga0068861_102670825 | 3300005719 | Bacteria | 504 |
| 305 | Ga0068851_10010578 | 3300005834 | Bacteria | 4308 |
| 306 | Ga0068851_10053755 | 3300005834 | Bacteria | 2051 |
| 307 | Ga0068851_10126112 | 3300005834 | Bacteria | 1380 |
| 308 | Ga0068851_10221816 | 3300005834 | Bacteria | 1062 |
| 309 | Ga0068851_10379856 | 3300005834 | Bacteria | 827 |
| 310 | Ga0068851_10508047 | 3300005834 | Bacteria | 723 |
| 311 | Ga0068851_11080222 | 3300005834 | Bacteria | 508 |
| 312 | Ga0068870_10349316 | 3300005840 | Bacteria | 949 |
| 313 | Ga0068870_10691859 | 3300005840 | Bacteria | 702 |
| 314 | Ga0068870_10979031 | 3300005840 | Bacteria | 602 |
| 315 | Ga0068870_11021070 | 3300005840 | Bacteria | 591 |
| 316 | Ga0068863_100029644 | 3300005841 | Bacteria | 5223 |
| 317 | Ga0068863_100052427 | 3300005841 | Bacteria | 3866 |
| 318 | Ga0068863_100056820 | 3300005841 | Bacteria | 3704 |
| 319 | Ga0068863_100097913 | 3300005841 | Bacteria | 2786 |
| 320 | Ga0068863_100128349 | 3300005841 | Bacteria | 2420 |
| 321 | Ga0068863_100209124 | 3300005841 | Bacteria | 1878 |
| 322 | Ga0068863_100297393 | 3300005841 | Bacteria | 1565 |
| 323 | Ga0068863_100305432 | 3300005841 | Bacteria | 1544 |
| 324 | Ga0068863_100326831 | 3300005841 | Bacteria | 1490 |
| 325 | Ga0068858_100001369 | 3300005842 | Bacteria | 25137 |
| 326 | Ga0068858_100012867 | 3300005842 | Bacteria | 7890 |
| 327 | Ga0068858_100014492 | 3300005842 | Bacteria | 7428 |
| 328 | Ga0068858_100019550 | 3300005842 | Bacteria | 6333 |
| 329 | Ga0068858_100586552 | 3300005842 | Bacteria | 1081 |
| 330 | Ga0068858_100593919 | 3300005842 | Bacteria | 1074 |
| 331 | Ga0068858_100681293 | 3300005842 | Bacteria | 1000 |
| 332 | Ga0068860_100002243 | 3300005843 | Bacteria | 20349 |
| 333 | Ga0068860_100011668 | 3300005843 | Bacteria | 8662 |
| 334 | Ga0068860_100058883 | 3300005843 | Bacteria | 3652 |
| 335 | Ga0068860_100065639 | 3300005843 | Bacteria | 3446 |
| 336 | Ga0068860_101082211 | 3300005843 | Bacteria | 821 |
| 337 | Ga0068860_102398962 | 3300005843 | Bacteria | 548 |
| 338 | Ga0068862_100003264 | 3300005844 | Bacteria | 14033 |
| 339 | Ga0068862_100006660 | 3300005844 | Bacteria | 9581 |
| 340 | Ga0068862_100201826 | 3300005844 | Bacteria | 1793 |
| 341 | Ga0068862_100289662 | 3300005844 | Bacteria | 1503 |
| 342 | Ga0068862_100642219 | 3300005844 | Bacteria | 1023 |
| 343 | Ga0068862_102653626 | 3300005844 | Bacteria | 513 |
| 344 | Ga0075365_10071131 | 3300006038 | Bacteria | 2341 |
| 345 | Ga0075368_10027258 | 3300006042 | Bacteria | 2202 |
| 346 | Ga0075368_10044569 | 3300006042 | Bacteria | 1750 |
| 347 | Ga0075368_10132483 | 3300006042 | Bacteria | 1036 |
| 348 | Ga0075368_10469290 | 3300006042 | Bacteria | 559 |
| 349 | Ga0075363_100017431 | 3300006048 | Bacteria | 3562 |
| 350 | Ga0075363_100691326 | 3300006048 | Bacteria | 615 |
| 351 | Ga0070716_100377044 | 3300006173 | Bacteria | 1013 |
| 352 | Ga0075362_10015137 | 3300006177 | Bacteria | 3132 |
| 353 | Ga0075362_10024416 | 3300006177 | Bacteria | 2564 |
| 354 | Ga0075362_10118069 | 3300006177 | Bacteria | 1254 |
| 355 | Ga0075362_10120485 | 3300006177 | Bacteria | 1242 |
| 356 | Ga0075362_10262805 | 3300006177 | Bacteria | 851 |
| 357 | Ga0075367_10002153 | 3300006178 | Bacteria | 8863 |
| 358 | Ga0075367_10106569 | 3300006178 | Bacteria | 1717 |
| 359 | Ga0075367_10540917 | 3300006178 | Bacteria | 739 |
| 360 | Ga0075369_10158584 | 3300006186 | Bacteria | 1036 |
| 361 | Ga0075369_10237193 | 3300006186 | Bacteria | 846 |
| 362 | Ga0075369_10541228 | 3300006186 | Bacteria | 555 |
| 363 | Ga0075366_10000953 | 3300006195 | Bacteria | 14096 |
| 364 | Ga0075366_10011821 | 3300006195 | Bacteria | 4938 |
| 365 | Ga0075366_10012199 | 3300006195 | Bacteria | 4871 |
| 366 | Ga0075366_10016893 | 3300006195 | Bacteria | 4194 |
| 367 | Ga0075366_10032816 | 3300006195 | Bacteria | 3057 |
| 368 | Ga0075366_10035903 | 3300006195 | Bacteria | 2922 |
| 369 | Ga0075366_10036799 | 3300006195 | Bacteria | 2886 |
| 370 | Ga0075366_10038857 | 3300006195 | Bacteria | 2811 |
| 371 | Ga0075366_10053567 | 3300006195 | Bacteria | 2397 |
| 372 | Ga0075366_10057998 | 3300006195 | Bacteria | 2300 |
| 373 | Ga0075366_10084998 | 3300006195 | Bacteria | 1892 |
| 374 | Ga0075366_10109724 | 3300006195 | Bacteria | 1659 |
| 375 | Ga0075366_10130981 | 3300006195 | Bacteria | 1513 |
| 376 | Ga0075366_10140401 | 3300006195 | Bacteria | 1460 |
| 377 | Ga0075366_10177719 | 3300006195 | Bacteria | 1292 |
| 378 | Ga0075366_10216436 | 3300006195 | Bacteria | 1167 |
| 379 | Ga0075366_10218687 | 3300006195 | Bacteria | 1160 |
| 380 | Ga0075366_10240109 | 3300006195 | Bacteria | 1104 |
| 381 | Ga0075366_10343606 | 3300006195 | Bacteria | 915 |
| 382 | Ga0075366_10718359 | 3300006195 | Bacteria | 621 |
| 383 | Ga0075366_10733945 | 3300006195 | Bacteria | 614 |
| 384 | Ga0097621_100025627 | 3300006237 | Bacteria | 4615 |
| 385 | Ga0097621_100035295 | 3300006237 | Bacteria | 3995 |
| 386 | Ga0097621_100215455 | 3300006237 | Bacteria | 1671 |
| 387 | Ga0097621_100474969 | 3300006237 | Bacteria | 1129 |
| 388 | Ga0097621_100513842 | 3300006237 | Bacteria | 1086 |
| 389 | Ga0097621_100852260 | 3300006237 | Bacteria | 847 |
| 390 | Ga0097621_101454911 | 3300006237 | Bacteria | 649 |
| 391 | Ga0075370_10000895 | 3300006353 | Bacteria | 12211 |
| 392 | Ga0075370_10010826 | 3300006353 | Bacteria | 4780 |
| 393 | Ga0075370_10011595 | 3300006353 | Bacteria | 4636 |
| 394 | Ga0075370_10026609 | 3300006353 | Bacteria | 3205 |
| 395 | Ga0075370_10038797 | 3300006353 | Bacteria | 2681 |
| 396 | Ga0075370_10049848 | 3300006353 | Bacteria | 2374 |
| 397 | Ga0075370_10072515 | 3300006353 | Bacteria | 1971 |
| 398 | Ga0075370_10094627 | 3300006353 | Bacteria | 1725 |
| 399 | Ga0075370_10096140 | 3300006353 | Bacteria | 1711 |
| 400 | Ga0075370_10218808 | 3300006353 | Bacteria | 1125 |
| 401 | Ga0075370_10409958 | 3300006353 | Bacteria | 813 |
| 402 | Ga0075370_10433789 | 3300006353 | Bacteria | 790 |
| 403 | Ga0075370_10527534 | 3300006353 | Bacteria | 713 |
| 404 | Ga0075370_10643318 | 3300006353 | Bacteria | 643 |
| 405 | Ga0075370_10654221 | 3300006353 | Bacteria | 638 |
| 406 | Ga0068871_100004241 | 3300006358 | Bacteria | 9937 |
| 407 | Ga0068871_100094517 | 3300006358 | Bacteria | 2495 |
| 408 | Ga0068871_100195365 | 3300006358 | Bacteria | 1745 |
| 409 | Ga0068871_100614112 | 3300006358 | Bacteria | 990 |
| 410 | Ga0068871_101606850 | 3300006358 | Bacteria | 615 |
| 411 | Ga0068871_101863082 | 3300006358 | Bacteria | 571 |
| 412 | Ga0068871_102233905 | 3300006358 | Bacteria | 521 |
| 413 | Ga0075430_100025745 | 3300006846 | Bacteria | 5006 |
| 414 | Ga0075433_10658183 | 3300006852 | Bacteria | 918 |
| 415 | Ga0075429_100034324 | 3300006880 | Bacteria | 4408 |
| 416 | Ga0075429_101789318 | 3300006880 | Bacteria | 533 |
| 417 | Ga0068865_100036691 | 3300006881 | Bacteria | 3306 |
| 418 | Ga0068865_100125124 | 3300006881 | Bacteria | 1918 |
| 419 | Ga0068865_100139010 | 3300006881 | Bacteria | 1829 |
| 420 | Ga0068865_100188351 | 3300006881 | Bacteria | 1594 |
| 421 | Ga0068865_100532660 | 3300006881 | Bacteria | 984 |
| 422 | Ga0068865_100625864 | 3300006881 | Bacteria | 912 |
| 423 | Ga0068865_100714478 | 3300006881 | Bacteria | 857 |
| 424 | Ga0068865_101013388 | 3300006881 | Bacteria | 728 |
| 425 | Ga0097620_100166332 | 3300006931 | Bacteria | 2285 |
| 426 | Ga0097620_100617651 | 3300006931 | Bacteria | 1177 |
| 427 | Ga0097620_100709335 | 3300006931 | Bacteria | 1096 |
| 428 | Ga0097620_101094136 | 3300006931 | Bacteria | 877 |
| 429 | Ga0097620_102786881 | 3300006931 | Bacteria | 537 |
| 430 | Ga0099823_1000164 | 3300006944 | Bacteria | 35666 |
| 431 | Ga0075435_100757518 | 3300007076 | Bacteria | 845 |
| 432 | Ga0105251_10594277 | 3300009011 | Bacteria | 525 |
| 433 | Ga0105240_10020928 | 3300009093 | Bacteria | 8710 |
| 434 | Ga0105240_10091540 | 3300009093 | Bacteria | 3715 |
| 435 | Ga0105240_10192337 | 3300009093 | Bacteria | 2398 |
| 436 | Ga0105240_10514691 | 3300009093 | Bacteria | 1329 |
| 437 | Ga0105240_11916636 | 3300009093 | Bacteria | 616 |
| 438 | Ga0105240_11999306 | 3300009093 | Bacteria | 602 |
| 439 | Ga0111539_11587541 | 3300009094 | Bacteria | 759 |
| 440 | Ga0105245_10004781 | 3300009098 | Bacteria | 11952 |
| 441 | Ga0105245_10447177 | 3300009098 | Bacteria | 1300 |
| 442 | Ga0105245_10848886 | 3300009098 | Bacteria | 953 |
| 443 | Ga0114129_10457333 | 3300009147 | Bacteria | 1673 |
| 444 | Ga0114129_10582865 | 3300009147 | Bacteria | 1451 |
| 445 | Ga0105243_10001238 | 3300009148 | Bacteria | 22984 |
| 446 | Ga0105243_10070292 | 3300009148 | Bacteria | 2826 |
| 447 | Ga0105243_10185578 | 3300009148 | Bacteria | 1812 |
| 448 | Ga0105243_10282955 | 3300009148 | Bacteria | 1495 |
| 449 | Ga0105243_10448998 | 3300009148 | Bacteria | 1209 |
| 450 | Ga0105243_10691013 | 3300009148 | Bacteria | 993 |
| 451 | Ga0105241_10619696 | 3300009174 | Bacteria | 979 |
| 452 | Ga0105241_10740028 | 3300009174 | Bacteria | 901 |
| 453 | Ga0105241_10920631 | 3300009174 | Bacteria | 813 |
| 454 | Ga0105242_10078680 | 3300009176 | Bacteria | 2753 |
| 455 | Ga0105242_10261291 | 3300009176 | Bacteria | 1564 |
| 456 | Ga0105242_13280570 | 3300009176 | Bacteria | 503 |
| 457 | Ga0105248_10025146 | 3300009177 | Bacteria | 6619 |
| 458 | Ga0105248_10115604 | 3300009177 | Bacteria | 3026 |
| 459 | Ga0105248_10126227 | 3300009177 | Bacteria | 2886 |
| 460 | Ga0105248_10560532 | 3300009177 | Bacteria | 1289 |
| 461 | Ga0105237_10010119 | 3300009545 | Bacteria | 10053 |
| 462 | Ga0105238_10020844 | 3300009551 | Bacteria | 6677 |
| 463 | Ga0105238_10261763 | 3300009551 | Bacteria | 1709 |
| 464 | Ga0105238_10609897 | 3300009551 | Bacteria | 1100 |
| 465 | Ga0105238_10711555 | 3300009551 | Bacteria | 1017 |
| 466 | Ga0105238_10960111 | 3300009551 | Bacteria | 875 |
| 467 | Ga0105249_10015679 | 3300009553 | Bacteria | 6710 |
| 468 | Ga0105249_10022012 | 3300009553 | Bacteria | 5708 |
| 469 | Ga0105249_10027380 | 3300009553 | Bacteria | 5142 |
| 470 | Ga0105239_10000914 | 3300010375 | Bacteria | 41919 |
| 471 | Ga0105239_10253069 | 3300010375 | Bacteria | 1978 |
| 472 | Ga0105239_11107013 | 3300010375 | Bacteria | 912 |
| 473 | Ga0105239_11416417 | 3300010375 | Bacteria | 802 |
| 474 | Ga0105239_13094518 | 3300010375 | Bacteria | 542 |
| 475 | Ga0105246_11304357 | 3300011119 | Bacteria | 673 |
| 476 | Ga0105246_11406569 | 3300011119 | Bacteria | 651 |
| 477 | Ga0157340_1013755 | 3300012473 | Bacteria | 611 |
| 478 | Ga0157325_1018032 | 3300012485 | Bacteria | 603 |
| 479 | Ga0157319_1000009 | 3300012497 | Bacteria | 227971 |
| 480 | Ga0157315_1006689 | 3300012508 | Bacteria | 910 |
| 481 | Ga0157327_1050875 | 3300012512 | Bacteria | 589 |
| 482 | Ga0157373_10178978 | 3300013100 | Bacteria | 1493 |
| 483 | Ga0157373_10547074 | 3300013100 | Bacteria | 839 |
| 484 | Ga0157373_11048390 | 3300013100 | Bacteria | 610 |
| 485 | Ga0157371_10273729 | 3300013102 | Bacteria | 1219 |
| 486 | Ga0157371_10393527 | 3300013102 | Bacteria | 1013 |
| 487 | Ga0157370_10300284 | 3300013104 | Bacteria | 1482 |
| 488 | Ga0157370_10603805 | 3300013104 | Bacteria | 1005 |
| 489 | Ga0157370_10896628 | 3300013104 | Bacteria | 805 |
| 490 | Ga0157369_10038041 | 3300013105 | Bacteria | 5263 |
| 491 | Ga0157369_10720988 | 3300013105 | Bacteria | 1026 |
| 492 | Ga0157369_11860210 | 3300013105 | Bacteria | 611 |
| 493 | Ga0157374_10031516 | 3300013296 | Bacteria | 4819 |
| 494 | Ga0157374_10071656 | 3300013296 | Bacteria | 3268 |
| 495 | Ga0157374_10091743 | 3300013296 | Bacteria | 2897 |
| 496 | Ga0157374_10109095 | 3300013296 | Bacteria | 2661 |
| 497 | Ga0157374_10347798 | 3300013296 | Bacteria | 1473 |
| 498 | Ga0157378_10013493 | 3300013297 | Bacteria | 7145 |
| 499 | Ga0157378_10024860 | 3300013297 | Bacteria | 5275 |
| 500 | Ga0157378_10083591 | 3300013297 | Bacteria | 2889 |
| 501 | Ga0157378_10206658 | 3300013297 | Bacteria | 1860 |
| 502 | Ga0157378_10234741 | 3300013297 | Bacteria | 1749 |
| 503 | Ga0157378_10565633 | 3300013297 | Bacteria | 1144 |
| 504 | Ga0157378_12004026 | 3300013297 | Bacteria | 629 |
| 505 | Ga0163162_10036220 | 3300013306 | Bacteria | 4916 |
| 506 | Ga0163162_10050457 | 3300013306 | Bacteria | 4172 |
| 507 | Ga0163162_10133273 | 3300013306 | Bacteria | 2595 |
| 508 | Ga0163162_10531748 | 3300013306 | Bacteria | 1305 |
| 509 | Ga0163162_10603819 | 3300013306 | Bacteria | 1223 |
| 510 | Ga0163162_10628255 | 3300013306 | Bacteria | 1199 |
| 511 | Ga0163162_10632997 | 3300013306 | Bacteria | 1194 |
| 512 | Ga0163162_10941602 | 3300013306 | Bacteria | 975 |
| 513 | Ga0163162_11862038 | 3300013306 | Bacteria | 688 |
| 514 | Ga0157372_10219116 | 3300013307 | Bacteria | 2206 |
| 515 | Ga0157372_10424816 | 3300013307 | Bacteria | 1549 |
| 516 | Ga0157372_10822618 | 3300013307 | Bacteria | 1079 |
| 517 | Ga0157372_12403121 | 3300013307 | Bacteria | 605 |
| 518 | Ga0157375_10006998 | 3300013308 | Bacteria | 9848 |
| 519 | Ga0157375_10012615 | 3300013308 | Bacteria | 7499 |
| 520 | Ga0157375_10014610 | 3300013308 | Bacteria | 7012 |
| 521 | Ga0157375_10017183 | 3300013308 | Bacteria | 6522 |
| 522 | Ga0157375_10097705 | 3300013308 | Bacteria | 3012 |
| 523 | Ga0157375_10132410 | 3300013308 | Bacteria | 2614 |
| 524 | Ga0157375_10204193 | 3300013308 | Bacteria | 2132 |
| 525 | Ga0157375_10751085 | 3300013308 | Bacteria | 1127 |
| 526 | Ga0157375_11566463 | 3300013308 | Bacteria | 779 |
| 527 | Ga0157375_11827134 | 3300013308 | Bacteria | 721 |
| 528 | Ga0157375_12140135 | 3300013308 | Bacteria | 666 |
| 529 | Ga0163163_10000864 | 3300014325 | Bacteria | 25838 |
| 530 | Ga0163163_11053786 | 3300014325 | Bacteria | 876 |
| 531 | Ga0157380_10057760 | 3300014326 | Bacteria | 3091 |
| 532 | Ga0157380_10172521 | 3300014326 | Bacteria | 1891 |
| 533 | Ga0157380_10202828 | 3300014326 | Bacteria | 1761 |
| 534 | Ga0157380_10696184 | 3300014326 | Bacteria | 1020 |
| 535 | Ga0157380_11033392 | 3300014326 | Bacteria | 857 |
| 536 | Ga0157380_11358176 | 3300014326 | Bacteria | 760 |
| 537 | Ga0157377_10000014 | 3300014745 | Bacteria | 213961 |
| 538 | Ga0157377_10002696 | 3300014745 | Bacteria | 7892 |
| 539 | Ga0157377_10709345 | 3300014745 | Bacteria | 731 |
| 540 | Ga0157377_10808312 | 3300014745 | Bacteria | 692 |
| 541 | Ga0157379_10004431 | 3300014968 | Bacteria | 12036 |
| 542 | Ga0157379_10028700 | 3300014968 | Bacteria | 4948 |
| 543 | Ga0157379_10031149 | 3300014968 | Bacteria | 4751 |
| 544 | Ga0157379_10053888 | 3300014968 | Bacteria | 3593 |
| 545 | Ga0157379_10077404 | 3300014968 | Bacteria | 2978 |
| 546 | Ga0157379_10212028 | 3300014968 | Bacteria | 1753 |
| 547 | Ga0157379_10341460 | 3300014968 | Bacteria | 1370 |
| 548 | Ga0157379_10412328 | 3300014968 | Bacteria | 1243 |
| 549 | Ga0157379_10562367 | 3300014968 | Bacteria | 1062 |
| 550 | Ga0157376_10024497 | 3300014969 | Bacteria | 4739 |
| 551 | Ga0157376_10135295 | 3300014969 | Bacteria | 2205 |
| 552 | Ga0157376_10144432 | 3300014969 | Bacteria | 2139 |
| 553 | Ga0157376_10238764 | 3300014969 | Bacteria | 1692 |
| 554 | Ga0157376_10246313 | 3300014969 | Bacteria | 1667 |
| 555 | Ga0157376_10541042 | 3300014969 | Bacteria | 1151 |
| 556 | Ga0157376_10555117 | 3300014969 | Bacteria | 1137 |
| 557 | Ga0157376_10589480 | 3300014969 | Bacteria | 1105 |
| 558 | Ga0157376_12906528 | 3300014969 | Bacteria | 518 |
| 559 | Ga0182006_1211916 | 3300015261 | Bacteria | 640 |
| 560 | Ga0182007_10266367 | 3300015262 | Bacteria | 619 |
| 561 | Ga0182005_1091227 | 3300015265 | Bacteria | 847 |
| 562 | Ga0163161_10012297 | 3300017792 | Bacteria | 5941 |
| 563 | Ga0163161_10019156 | 3300017792 | Bacteria | 4798 |
| 564 | Ga0163161_10040590 | 3300017792 | Bacteria | 3343 |
| 565 | Ga0163161_10123509 | 3300017792 | Bacteria | 1947 |
| 566 | Ga0163161_10181451 | 3300017792 | Bacteria | 1614 |
| 567 | Ga0163161_10268707 | 3300017792 | Bacteria | 1334 |
| 568 | Ga0206353_10514887 | 3300020082 | Bacteria | 583 |
| 569 | Ga0213872_10002349 | 3300021361 | Bacteria | 11240 |
| 570 | Ga0213872_10043062 | 3300021361 | Bacteria | 2058 |
| 571 | Ga0213872_10251285 | 3300021361 | Bacteria | 745 |
| 572 | Ga0209258_120493 | 3300025242 | Bacteria | 692 |
| 573 | Ga0207425_1000511 | 3300025245 | Bacteria | 23911 |
| 574 | Ga0209129_1002180 | 3300025258 | Bacteria | 9862 |
| 575 | Ga0209129_1026616 | 3300025258 | Bacteria | 997 |
| 576 | Ga0207666_1048305 | 3300025271 | Bacteria | 672 |
| 577 | Ga0209673_1009744 | 3300025273 | Bacteria | 4123 |
| 578 | Ga0209673_1012171 | 3300025273 | Bacteria | 3486 |
| 579 | Ga0209673_1029638 | 3300025273 | Bacteria | 1739 |
| 580 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 581 | Ga0209564_1000196 | 3300025295 | Bacteria | 141368 |
| 582 | Ga0209758_1000181 | 3300025297 | Bacteria | 140847 |
| 583 | Ga0209758_1000207 | 3300025297 | Bacteria | 129217 |
| 584 | Ga0209050_1000858 | 3300025298 | Bacteria | 41211 |
| 585 | Ga0209050_1001266 | 3300025298 | Bacteria | 29109 |
| 586 | Ga0209050_1006370 | 3300025298 | Bacteria | 7004 |
| 587 | Ga0209256_1031332 | 3300025299 | Bacteria | 1455 |
| 588 | Ga0209256_1074696 | 3300025299 | Bacteria | 753 |
| 589 | Ga0209051_1002697 | 3300025303 | Bacteria | 12355 |
| 590 | Ga0209051_1012833 | 3300025303 | Bacteria | 4029 |
| 591 | Ga0209051_1043460 | 3300025303 | Bacteria | 1577 |
| 592 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 593 | Ga0209257_1005175 | 3300025304 | Bacteria | 9399 |
| 594 | Ga0209257_1015510 | 3300025304 | Bacteria | 3165 |
| 595 | Ga0209257_1042771 | 3300025304 | Bacteria | 1334 |
| 596 | Ga0209257_1153677 | 3300025304 | Bacteria | 504 |
| 597 | Ga0207697_10110727 | 3300025315 | Bacteria | 1176 |
| 598 | Ga0207656_10014661 | 3300025321 | Bacteria | 3024 |
| 599 | Ga0207656_10082290 | 3300025321 | Bacteria | 1449 |
| 600 | Ga0207656_10127880 | 3300025321 | Bacteria | 1188 |
| 601 | Ga0207656_10147672 | 3300025321 | Bacteria | 1111 |
| 602 | Ga0207656_10245505 | 3300025321 | Bacteria | 876 |
| 603 | Ga0207656_10311423 | 3300025321 | Bacteria | 781 |
| 604 | Ga0207682_10027282 | 3300025893 | Bacteria | 2273 |
| 605 | Ga0207682_10043554 | 3300025893 | Bacteria | 1837 |
| 606 | Ga0207642_10002666 | 3300025899 | Bacteria | 5560 |
| 607 | Ga0207642_10012484 | 3300025899 | Bacteria | 3068 |
| 608 | Ga0207642_10052446 | 3300025899 | Bacteria | 1850 |
| 609 | Ga0207710_10156056 | 3300025900 | Bacteria | 1109 |
| 610 | Ga0207688_10034955 | 3300025901 | Bacteria | 2784 |
| 611 | Ga0207680_10005278 | 3300025903 | Bacteria | 6166 |
| 612 | Ga0207680_10041270 | 3300025903 | Bacteria | 2691 |
| 613 | Ga0207680_10185664 | 3300025903 | Bacteria | 1409 |
| 614 | Ga0207680_10586460 | 3300025903 | Bacteria | 797 |
| 615 | Ga0207685_10302143 | 3300025905 | Bacteria | 792 |
| 616 | Ga0207645_10001190 | 3300025907 | Bacteria | 21497 |
| 617 | Ga0207645_10029270 | 3300025907 | Bacteria | 3551 |
| 618 | Ga0207645_10079243 | 3300025907 | Bacteria | 2105 |
| 619 | Ga0207645_10140960 | 3300025907 | Bacteria | 1571 |
| 620 | Ga0207645_10182418 | 3300025907 | Bacteria | 1377 |
| 621 | Ga0207645_10192193 | 3300025907 | Bacteria | 1342 |
| 622 | Ga0207643_10318077 | 3300025908 | Bacteria | 971 |
| 623 | Ga0207643_10832915 | 3300025908 | Bacteria | 598 |
| 624 | Ga0207643_10996285 | 3300025908 | Bacteria | 542 |
| 625 | Ga0207705_10024072 | 3300025909 | Bacteria | 4345 |
| 626 | Ga0207705_10039570 | 3300025909 | Bacteria | 3380 |
| 627 | Ga0207705_10431687 | 3300025909 | Bacteria | 1021 |
| 628 | Ga0207705_10956916 | 3300025909 | Bacteria | 662 |
| 629 | Ga0207684_10015609 | 3300025910 | Bacteria | 6537 |
| 630 | Ga0207684_10544836 | 3300025910 | Bacteria | 993 |
| 631 | Ga0207654_10451245 | 3300025911 | Bacteria | 902 |
| 632 | Ga0207654_10717037 | 3300025911 | Bacteria | 719 |
| 633 | Ga0207654_10764005 | 3300025911 | Bacteria | 697 |
| 634 | Ga0207707_10292186 | 3300025912 | Bacteria | 1410 |
| 635 | Ga0207707_10324237 | 3300025912 | Bacteria | 1329 |
| 636 | Ga0207695_10016280 | 3300025913 | Bacteria | 8710 |
| 637 | Ga0207695_10519502 | 3300025913 | Bacteria | 1072 |
| 638 | Ga0207695_10637486 | 3300025913 | Bacteria | 947 |
| 639 | Ga0207671_10006390 | 3300025914 | Bacteria | 10506 |
| 640 | Ga0207660_10101515 | 3300025917 | Bacteria | 2149 |
| 641 | Ga0207662_10061901 | 3300025918 | Bacteria | 2248 |
| 642 | Ga0207657_10024402 | 3300025919 | Bacteria | 5599 |
| 643 | Ga0207657_10145653 | 3300025919 | Bacteria | 1932 |
| 644 | Ga0207657_10675112 | 3300025919 | Bacteria | 803 |
| 645 | Ga0207649_10001484 | 3300025920 | Bacteria | 13768 |
| 646 | Ga0207649_10009940 | 3300025920 | Bacteria | 5214 |
| 647 | Ga0207649_10409486 | 3300025920 | Bacteria | 1016 |
| 648 | Ga0207649_10737510 | 3300025920 | Bacteria | 766 |
| 649 | Ga0207649_11134876 | 3300025920 | Bacteria | 617 |
| 650 | Ga0207652_10077074 | 3300025921 | Bacteria | 2908 |
| 651 | Ga0207646_10307947 | 3300025922 | Bacteria | 1431 |
| 652 | Ga0207681_10000214 | 3300025923 | Bacteria | 45816 |
| 653 | Ga0207681_10099546 | 3300025923 | Bacteria | 2094 |
| 654 | Ga0207681_10161918 | 3300025923 | Bacteria | 1688 |
| 655 | Ga0207681_10192341 | 3300025923 | Bacteria | 1562 |
| 656 | Ga0207681_10279077 | 3300025923 | Bacteria | 1315 |
| 657 | Ga0207681_10439878 | 3300025923 | Bacteria | 1059 |
| 658 | Ga0207681_10466410 | 3300025923 | Bacteria | 1029 |
| 659 | Ga0207681_10691665 | 3300025923 | Bacteria | 847 |
| 660 | Ga0207694_10009034 | 3300025924 | Bacteria | 7522 |
| 661 | Ga0207694_10207529 | 3300025924 | Bacteria | 1595 |
| 662 | Ga0207694_10478137 | 3300025924 | Bacteria | 1042 |
| 663 | Ga0207694_11061595 | 3300025924 | Bacteria | 685 |
| 664 | Ga0207650_10000937 | 3300025925 | Bacteria | 21987 |
| 665 | Ga0207650_10002494 | 3300025925 | Bacteria | 12790 |
| 666 | Ga0207650_10103958 | 3300025925 | Bacteria | 2191 |
| 667 | Ga0207650_10143131 | 3300025925 | Bacteria | 1881 |
| 668 | Ga0207650_10195655 | 3300025925 | Bacteria | 1617 |
| 669 | Ga0207650_10273263 | 3300025925 | Bacteria | 1374 |
| 670 | Ga0207650_10426023 | 3300025925 | Bacteria | 1102 |
| 671 | Ga0207650_10777543 | 3300025925 | Bacteria | 811 |
| 672 | Ga0207650_11545158 | 3300025925 | Bacteria | 564 |
| 673 | Ga0207659_10004306 | 3300025926 | Bacteria | 8603 |
| 674 | Ga0207659_10004991 | 3300025926 | Bacteria | 8039 |
| 675 | Ga0207659_10017778 | 3300025926 | Bacteria | 4649 |
| 676 | Ga0207659_10017801 | 3300025926 | Bacteria | 4648 |
| 677 | Ga0207659_10055052 | 3300025926 | Bacteria | 2843 |
| 678 | Ga0207659_10092294 | 3300025926 | Bacteria | 2263 |
| 679 | Ga0207659_10482749 | 3300025926 | Bacteria | 1047 |
| 680 | Ga0207659_10985527 | 3300025926 | Bacteria | 725 |
| 681 | Ga0207687_10280279 | 3300025927 | Bacteria | 1336 |
| 682 | Ga0207687_10506091 | 3300025927 | Bacteria | 1008 |
| 683 | Ga0207687_10949392 | 3300025927 | Bacteria | 737 |
| 684 | Ga0207687_11141610 | 3300025927 | Bacteria | 669 |
| 685 | Ga0207644_10010554 | 3300025931 | Bacteria | 6089 |
| 686 | Ga0207644_10014021 | 3300025931 | Bacteria | 5357 |
| 687 | Ga0207644_10024213 | 3300025931 | Bacteria | 4165 |
| 688 | Ga0207644_10044789 | 3300025931 | Bacteria | 3145 |
| 689 | Ga0207644_10057347 | 3300025931 | Bacteria | 2812 |
| 690 | Ga0207644_10196979 | 3300025931 | Bacteria | 1587 |
| 691 | Ga0207644_11520441 | 3300025931 | Bacteria | 562 |
| 692 | Ga0207644_11806127 | 3300025931 | Bacteria | 511 |
| 693 | Ga0207690_10002792 | 3300025932 | Bacteria | 10532 |
| 694 | Ga0207690_10017607 | 3300025932 | Bacteria | 4367 |
| 695 | Ga0207690_10035310 | 3300025932 | Bacteria | 3229 |
| 696 | Ga0207690_10084537 | 3300025932 | Bacteria | 2224 |
| 697 | Ga0207690_10240615 | 3300025932 | Bacteria | 1394 |
| 698 | Ga0207706_10000449 | 3300025933 | Bacteria | 43973 |
| 699 | Ga0207706_10003147 | 3300025933 | Bacteria | 15850 |
| 700 | Ga0207706_10018191 | 3300025933 | Bacteria | 6322 |
| 701 | Ga0207706_10033988 | 3300025933 | Bacteria | 4538 |
| 702 | Ga0207706_10322887 | 3300025933 | Bacteria | 1343 |
| 703 | Ga0207706_10356451 | 3300025933 | Bacteria | 1271 |
| 704 | Ga0207706_10506314 | 3300025933 | Bacteria | 1042 |
| 705 | Ga0207706_10507711 | 3300025933 | Bacteria | 1040 |
| 706 | Ga0207706_11135284 | 3300025933 | Bacteria | 652 |
| 707 | Ga0207686_10008428 | 3300025934 | Bacteria | 5564 |
| 708 | Ga0207686_10076296 | 3300025934 | Bacteria | 2173 |
| 709 | Ga0207686_11064645 | 3300025934 | Bacteria | 658 |
| 710 | Ga0207709_10000804 | 3300025935 | Bacteria | 24412 |
| 711 | Ga0207709_10022408 | 3300025935 | Bacteria | 3583 |
| 712 | Ga0207709_10264068 | 3300025935 | Bacteria | 1264 |
| 713 | Ga0207709_10300940 | 3300025935 | Bacteria | 1192 |
| 714 | Ga0207709_10937051 | 3300025935 | Bacteria | 705 |
| 715 | Ga0207670_10120453 | 3300025936 | Bacteria | 1906 |
| 716 | Ga0207670_10711682 | 3300025936 | Bacteria | 832 |
| 717 | Ga0207670_11767725 | 3300025936 | Bacteria | 526 |
| 718 | Ga0207669_10020710 | 3300025937 | Bacteria | 3455 |
| 719 | Ga0207669_10031788 | 3300025937 | Bacteria | 2954 |
| 720 | Ga0207669_10147654 | 3300025937 | Bacteria | 1642 |
| 721 | Ga0207669_10158936 | 3300025937 | Bacteria | 1593 |
| 722 | Ga0207669_10183787 | 3300025937 | Bacteria | 1501 |
| 723 | Ga0207669_10301815 | 3300025937 | Bacteria | 1217 |
| 724 | Ga0207669_10363569 | 3300025937 | Bacteria | 1122 |
| 725 | Ga0207669_10458253 | 3300025937 | Bacteria | 1012 |
| 726 | Ga0207669_10919911 | 3300025937 | Bacteria | 731 |
| 727 | Ga0207704_10003076 | 3300025938 | Bacteria | 7541 |
| 728 | Ga0207704_10026016 | 3300025938 | Bacteria | 3203 |
| 729 | Ga0207704_10133576 | 3300025938 | Bacteria | 1723 |
| 730 | Ga0207704_10184203 | 3300025938 | Bacteria | 1512 |
| 731 | Ga0207704_10455008 | 3300025938 | Bacteria | 1022 |
| 732 | Ga0207704_10471995 | 3300025938 | Bacteria | 1005 |
| 733 | Ga0207704_10504016 | 3300025938 | Bacteria | 976 |
| 734 | Ga0207704_10879031 | 3300025938 | Bacteria | 753 |
| 735 | Ga0207665_10358200 | 3300025939 | Bacteria | 1102 |
| 736 | Ga0207665_11537807 | 3300025939 | Bacteria | 528 |
| 737 | Ga0207691_10001841 | 3300025940 | Bacteria | 20724 |
| 738 | Ga0207691_10024826 | 3300025940 | Bacteria | 5634 |
| 739 | Ga0207691_10045546 | 3300025940 | Bacteria | 4031 |
| 740 | Ga0207691_10120992 | 3300025940 | Bacteria | 2320 |
| 741 | Ga0207691_10202067 | 3300025940 | Bacteria | 1729 |
| 742 | Ga0207691_10214760 | 3300025940 | Bacteria | 1670 |
| 743 | Ga0207691_10230990 | 3300025940 | Bacteria | 1602 |
| 744 | Ga0207691_10545743 | 3300025940 | Bacteria | 983 |
| 745 | Ga0207691_10593261 | 3300025940 | Bacteria | 938 |
| 746 | Ga0207691_10617357 | 3300025940 | Bacteria | 917 |
| 747 | Ga0207691_11111503 | 3300025940 | Bacteria | 657 |
| 748 | Ga0207711_10036125 | 3300025941 | Bacteria | 4191 |
| 749 | Ga0207711_10040995 | 3300025941 | Bacteria | 3941 |
| 750 | Ga0207711_10043521 | 3300025941 | Bacteria | 3831 |
| 751 | Ga0207711_10056982 | 3300025941 | Bacteria | 3359 |
| 752 | Ga0207711_10069942 | 3300025941 | Bacteria | 3043 |
| 753 | Ga0207711_10077629 | 3300025941 | Bacteria | 2895 |
| 754 | Ga0207711_10401642 | 3300025941 | Bacteria | 1273 |
| 755 | Ga0207689_10001542 | 3300025942 | Bacteria | 21888 |
| 756 | Ga0207689_10016843 | 3300025942 | Bacteria | 6185 |
| 757 | Ga0207689_10099988 | 3300025942 | Bacteria | 2383 |
| 758 | Ga0207689_10126213 | 3300025942 | Bacteria | 2105 |
| 759 | Ga0207689_10154252 | 3300025942 | Bacteria | 1893 |
| 760 | Ga0207689_10187388 | 3300025942 | Bacteria | 1706 |
| 761 | Ga0207689_10276067 | 3300025942 | Bacteria | 1391 |
| 762 | Ga0207661_10061440 | 3300025944 | Bacteria | 3035 |
| 763 | Ga0207661_10179565 | 3300025944 | Bacteria | 1848 |
| 764 | Ga0207661_10771878 | 3300025944 | Bacteria | 885 |
| 765 | Ga0207679_10000220 | 3300025945 | Bacteria | 45059 |
| 766 | Ga0207679_10017939 | 3300025945 | Bacteria | 4730 |
| 767 | Ga0207679_11027953 | 3300025945 | Bacteria | 755 |
| 768 | Ga0207667_10187364 | 3300025949 | Bacteria | 2124 |
| 769 | Ga0207667_11371211 | 3300025949 | Bacteria | 681 |
| 770 | Ga0207651_10007714 | 3300025960 | Bacteria | 5751 |
| 771 | Ga0207651_10017944 | 3300025960 | Bacteria | 4196 |
| 772 | Ga0207651_10023971 | 3300025960 | Bacteria | 3765 |
| 773 | Ga0207651_10026542 | 3300025960 | Bacteria | 3621 |
| 774 | Ga0207651_10179679 | 3300025960 | Bacteria | 1677 |
| 775 | Ga0207651_10318084 | 3300025960 | Bacteria | 1300 |
| 776 | Ga0207651_10420766 | 3300025960 | Bacteria | 1140 |
| 777 | Ga0207651_10616424 | 3300025960 | Bacteria | 950 |
| 778 | Ga0207651_11566746 | 3300025960 | Bacteria | 593 |
| 779 | Ga0207712_10003685 | 3300025961 | Bacteria | 9663 |
| 780 | Ga0207712_10037266 | 3300025961 | Bacteria | 3316 |
| 781 | Ga0207712_10485526 | 3300025961 | Bacteria | 1054 |
| 782 | Ga0207668_10007597 | 3300025972 | Bacteria | 6454 |
| 783 | Ga0207668_10081814 | 3300025972 | Bacteria | 2344 |
| 784 | Ga0207668_10083356 | 3300025972 | Bacteria | 2326 |
| 785 | Ga0207668_10130917 | 3300025972 | Bacteria | 1915 |
| 786 | Ga0207668_10589541 | 3300025972 | Bacteria | 967 |
| 787 | Ga0207668_11135661 | 3300025972 | Bacteria | 701 |
| 788 | Ga0207640_10480671 | 3300025981 | Bacteria | 1030 |
| 789 | Ga0207640_10570827 | 3300025981 | Bacteria | 953 |
| 790 | Ga0207658_10002329 | 3300025986 | Bacteria | 13956 |
| 791 | Ga0207658_10003279 | 3300025986 | Bacteria | 11495 |
| 792 | Ga0207658_10092681 | 3300025986 | Bacteria | 2347 |
| 793 | Ga0207658_10297802 | 3300025986 | Bacteria | 1388 |
| 794 | Ga0207658_10525847 | 3300025986 | Bacteria | 1056 |
| 795 | Ga0207658_10751053 | 3300025986 | Bacteria | 883 |
| 796 | Ga0207658_10786591 | 3300025986 | Bacteria | 863 |
| 797 | Ga0207658_10902915 | 3300025986 | Bacteria | 804 |
| 798 | Ga0207677_10004256 | 3300026023 | Bacteria | 7657 |
| 799 | Ga0207677_10010920 | 3300026023 | Bacteria | 5158 |
| 800 | Ga0207677_10064331 | 3300026023 | Bacteria | 2554 |
| 801 | Ga0207677_10305442 | 3300026023 | Bacteria | 1316 |
| 802 | Ga0207677_10324344 | 3300026023 | Bacteria | 1281 |
| 803 | Ga0207677_10611657 | 3300026023 | Bacteria | 957 |
| 804 | Ga0207677_10670329 | 3300026023 | Bacteria | 917 |
| 805 | Ga0207677_11399452 | 3300026023 | Bacteria | 644 |
| 806 | Ga0207703_10003713 | 3300026035 | Bacteria | 12704 |
| 807 | Ga0207703_10013980 | 3300026035 | Bacteria | 6258 |
| 808 | Ga0207703_11136695 | 3300026035 | Bacteria | 750 |
| 809 | Ga0207639_10023473 | 3300026041 | Bacteria | 4454 |
| 810 | Ga0207639_10038242 | 3300026041 | Bacteria | 3569 |
| 811 | Ga0207639_10062937 | 3300026041 | Bacteria | 2871 |
| 812 | Ga0207639_10108330 | 3300026041 | Bacteria | 2259 |
| 813 | Ga0207639_11079247 | 3300026041 | Bacteria | 753 |
| 814 | Ga0207639_11219935 | 3300026041 | Bacteria | 706 |
| 815 | Ga0207639_11794840 | 3300026041 | Bacteria | 574 |
| 816 | Ga0207678_10006005 | 3300026067 | Bacteria | 10804 |
| 817 | Ga0207678_10268879 | 3300026067 | Bacteria | 1461 |
| 818 | Ga0207678_10295515 | 3300026067 | Bacteria | 1391 |
| 819 | Ga0207678_10528083 | 3300026067 | Bacteria | 1030 |
| 820 | Ga0207708_10127265 | 3300026075 | Bacteria | 1989 |
| 821 | Ga0207702_10012956 | 3300026078 | Bacteria | 6937 |
| 822 | Ga0207702_10023008 | 3300026078 | Bacteria | 5169 |
| 823 | Ga0207702_10336198 | 3300026078 | Bacteria | 1442 |
| 824 | Ga0207702_10488907 | 3300026078 | Bacteria | 1198 |
| 825 | Ga0207702_10880880 | 3300026078 | Bacteria | 887 |
| 826 | Ga0207641_10015342 | 3300026088 | Bacteria | 6278 |
| 827 | Ga0207641_10022787 | 3300026088 | Bacteria | 5156 |
| 828 | Ga0207641_10040936 | 3300026088 | Bacteria | 3882 |
| 829 | Ga0207641_10050442 | 3300026088 | Bacteria | 3520 |
| 830 | Ga0207641_10053534 | 3300026088 | Bacteria | 3421 |
| 831 | Ga0207641_10091665 | 3300026088 | Bacteria | 2660 |
| 832 | Ga0207641_10109554 | 3300026088 | Bacteria | 2446 |
| 833 | Ga0207641_10275304 | 3300026088 | Bacteria | 1581 |
| 834 | Ga0207641_10410947 | 3300026088 | Bacteria | 1301 |
| 835 | Ga0207648_10000062 | 3300026089 | Bacteria | 99889 |
| 836 | Ga0207648_10005680 | 3300026089 | Bacteria | 12515 |
| 837 | Ga0207648_10016056 | 3300026089 | Bacteria | 6860 |
| 838 | Ga0207648_10022315 | 3300026089 | Bacteria | 5687 |
| 839 | Ga0207648_10027768 | 3300026089 | Bacteria | 5022 |
| 840 | Ga0207648_10039524 | 3300026089 | Bacteria | 4148 |
| 841 | Ga0207648_10046362 | 3300026089 | Bacteria | 3811 |
| 842 | Ga0207648_10155583 | 3300026089 | Bacteria | 2018 |
| 843 | Ga0207648_10222240 | 3300026089 | Bacteria | 1679 |
| 844 | Ga0207648_10299880 | 3300026089 | Bacteria | 1441 |
| 845 | Ga0207648_10376683 | 3300026089 | Bacteria | 1283 |
| 846 | Ga0207648_10538976 | 3300026089 | Bacteria | 1071 |
| 847 | Ga0207648_10627432 | 3300026089 | Bacteria | 992 |
| 848 | Ga0207676_10027995 | 3300026095 | Bacteria | 4204 |
| 849 | Ga0207676_10040197 | 3300026095 | Bacteria | 3583 |
| 850 | Ga0207676_10042173 | 3300026095 | Bacteria | 3508 |
| 851 | Ga0207676_10148970 | 3300026095 | Bacteria | 2013 |
| 852 | Ga0207676_10154293 | 3300026095 | Bacteria | 1981 |
| 853 | Ga0207676_10174215 | 3300026095 | Bacteria | 1877 |
| 854 | Ga0207676_10451756 | 3300026095 | Bacteria | 1211 |
| 855 | Ga0207676_10579893 | 3300026095 | Bacteria | 1075 |
| 856 | Ga0207676_10621491 | 3300026095 | Bacteria | 1040 |
| 857 | Ga0207674_10008358 | 3300026116 | Bacteria | 11971 |
| 858 | Ga0207674_10016738 | 3300026116 | Bacteria | 8012 |
| 859 | Ga0207674_10117874 | 3300026116 | Bacteria | 2625 |
| 860 | Ga0207674_10251500 | 3300026116 | Bacteria | 1714 |
| 861 | Ga0207674_10579628 | 3300026116 | Bacteria | 1084 |
| 862 | Ga0207674_10625124 | 3300026116 | Bacteria | 1040 |
| 863 | Ga0207674_10685603 | 3300026116 | Bacteria | 989 |
| 864 | Ga0207675_100000214 | 3300026118 | Bacteria | 54263 |
| 865 | Ga0207675_100014189 | 3300026118 | Bacteria | 7430 |
| 866 | Ga0207675_100115029 | 3300026118 | Bacteria | 2541 |
| 867 | Ga0207675_100157793 | 3300026118 | Bacteria | 2163 |
| 868 | Ga0207675_100358683 | 3300026118 | Bacteria | 1430 |
| 869 | Ga0207675_101058402 | 3300026118 | Bacteria | 830 |
| 870 | Ga0207683_10012322 | 3300026121 | Bacteria | 7298 |
| 871 | Ga0207683_10041309 | 3300026121 | Bacteria | 4027 |
| 872 | Ga0207683_10052458 | 3300026121 | Bacteria | 3574 |
| 873 | Ga0207683_10111911 | 3300026121 | Bacteria | 2445 |
| 874 | Ga0207683_10133661 | 3300026121 | Bacteria | 2232 |
| 875 | Ga0207683_10196025 | 3300026121 | Bacteria | 1835 |
| 876 | Ga0207683_10316180 | 3300026121 | Bacteria | 1430 |
| 877 | Ga0207683_10465761 | 3300026121 | Bacteria | 1166 |
| 878 | Ga0207683_10594593 | 3300026121 | Bacteria | 1024 |
| 879 | Ga0207683_10848548 | 3300026121 | Bacteria | 848 |
| 880 | Ga0207698_10003539 | 3300026142 | Bacteria | 9418 |
| 881 | Ga0207698_10005500 | 3300026142 | Bacteria | 7837 |
| 882 | Ga0207698_10006533 | 3300026142 | Bacteria | 7284 |
| 883 | Ga0207698_10055990 | 3300026142 | Bacteria | 3043 |
| 884 | Ga0207698_10064769 | 3300026142 | Bacteria | 2866 |
| 885 | Ga0207698_10265655 | 3300026142 | Bacteria | 1579 |
| 886 | Ga0207698_10292521 | 3300026142 | Bacteria | 1512 |
| 887 | Ga0207698_10684324 | 3300026142 | Bacteria | 1019 |
| 888 | Ga0207698_10742882 | 3300026142 | Bacteria | 979 |
| 889 | Ga0207698_10743730 | 3300026142 | Bacteria | 979 |
| 890 | Ga0207698_10991956 | 3300026142 | Bacteria | 850 |
| 891 | Ga0207698_11079274 | 3300026142 | Bacteria | 815 |
| 892 | Ga0209389_1037396 | 3300027296 | Bacteria | 3861 |
| 893 | Ga0209371_1023370 | 3300027312 | Bacteria | 1456 |
| 894 | Ga0209971_1044781 | 3300027682 | Bacteria | 1066 |
| 895 | Ga0209813_10009766 | 3300027866 | Bacteria | 2465 |
| 896 | Ga0209974_10000044 | 3300027876 | Bacteria | 31037 |
| 897 | Ga0268266_10129746 | 3300028379 | Bacteria | 2253 |
| 898 | Ga0268266_10242316 | 3300028379 | Bacteria | 1665 |
| 899 | Ga0268266_11030168 | 3300028379 | Bacteria | 796 |
| 900 | Ga0268266_11263554 | 3300028379 | Bacteria | 713 |
| 901 | Ga0268265_10009334 | 3300028380 | Bacteria | 6630 |
| 902 | Ga0268265_10039299 | 3300028380 | Bacteria | 3487 |
| 903 | Ga0268265_10308172 | 3300028380 | Bacteria | 1429 |
| 904 | Ga0268265_10624783 | 3300028380 | Bacteria | 1032 |
| 905 | Ga0268265_11008029 | 3300028380 | Bacteria | 823 |
| 906 | Ga0268264_10001033 | 3300028381 | Bacteria | 27952 |
| 907 | Ga0268264_10072983 | 3300028381 | Bacteria | 2911 |
| 908 | Ga0268264_10241607 | 3300028381 | Bacteria | 1673 |
| 909 | Ga0268264_10263534 | 3300028381 | Bacteria | 1607 |
| 910 | Ga0268264_10624264 | 3300028381 | Bacteria | 1064 |
| 911 | Ga0268264_11109104 | 3300028381 | Bacteria | 800 |
| 912 | Ga0268264_11375056 | 3300028381 | Bacteria | 716 |
| 913 | Ga0307517_10000708 | 3300028786 | Bacteria | 57419 |
| 914 | Ga0307517_10118579 | 3300028786 | Bacteria | 1969 |
| 915 | Ga0307517_10273449 | 3300028786 | Bacteria | 969 |
| 916 | Ga0307517_10410674 | 3300028786 | Bacteria | 713 |
| 917 | Ga0307515_10000150 | 3300028794 | Bacteria | 169644 |
| 918 | Ga0307515_10000187 | 3300028794 | Bacteria | 151904 |
| 919 | Ga0307515_10005172 | 3300028794 | Bacteria | 26524 |
| 920 | Ga0307515_10015579 | 3300028794 | Bacteria | 13992 |
| 921 | Ga0307515_10032801 | 3300028794 | Bacteria | 8581 |
| 922 | Ga0307515_10064599 | 3300028794 | Bacteria | 5115 |
| 923 | Ga0307515_10096842 | 3300028794 | Bacteria | 3613 |
| 924 | Ga0307515_10216175 | 3300028794 | Bacteria | 1747 |
| 925 | Ga0307515_10259736 | 3300028794 | Bacteria | 1475 |
| 926 | Ga0307515_10327804 | 3300028794 | Bacteria | 1192 |
| 927 | Ga0307515_10343198 | 3300028794 | Bacteria | 1144 |
| 928 | Ga0268256_1025964 | 3300030500 | Bacteria | 1480 |
| 929 | Ga0307512_10109325 | 3300030522 | Bacteria | 1830 |
| 930 | Ga0307512_10145132 | 3300030522 | Bacteria | 1438 |
| 931 | Ga0307512_10231385 | 3300030522 | Bacteria | 949 |
| 932 | Ga0307513_10017100 | 3300031456 | Bacteria | 8714 |
| 933 | Ga0307513_10115414 | 3300031456 | Bacteria | 2667 |
| 934 | Ga0307513_10122795 | 3300031456 | Bacteria | 2560 |
| 935 | Ga0307513_10124857 | 3300031456 | Bacteria | 2532 |
| 936 | Ga0307509_10034015 | 3300031507 | Bacteria | 5603 |
| 937 | Ga0307509_10039232 | 3300031507 | Bacteria | 5160 |
| 938 | Ga0307509_10185497 | 3300031507 | Bacteria | 1939 |
| 939 | Ga0307509_10212909 | 3300031507 | Bacteria | 1755 |
| 940 | Ga0307408_100000010 | 3300031548 | Bacteria | 420048 |
| 941 | Ga0307408_100018381 | 3300031548 | Bacteria | 4692 |
| 942 | Ga0307408_100113110 | 3300031548 | Bacteria | 2089 |
| 943 | Ga0307408_100400521 | 3300031548 | Bacteria | 1178 |
| 944 | Ga0307408_101204470 | 3300031548 | Bacteria | 706 |
| 945 | Ga0307408_101441961 | 3300031548 | Bacteria | 649 |
| 946 | Ga0307508_10001596 | 3300031616 | Bacteria | 25282 |
| 947 | Ga0307508_10003456 | 3300031616 | Bacteria | 15989 |
| 948 | Ga0307508_10110633 | 3300031616 | Bacteria | 2346 |
| 949 | Ga0307508_10294188 | 3300031616 | Bacteria | 1217 |
| 950 | Ga0307514_10002176 | 3300031649 | Bacteria | 21074 |
| 951 | Ga0307514_10120644 | 3300031649 | Bacteria | 1829 |
| 952 | Ga0307514_10282290 | 3300031649 | Bacteria | 949 |
| 953 | Ga0307514_10286116 | 3300031649 | Bacteria | 938 |
| 954 | Ga0307516_10000268 | 3300031730 | Bacteria | 66758 |
| 955 | Ga0307516_10003906 | 3300031730 | Bacteria | 18801 |
| 956 | Ga0307516_10213559 | 3300031730 | Bacteria | 1642 |
| 957 | Ga0307516_10294015 | 3300031730 | Bacteria | 1302 |
| 958 | Ga0307516_10647278 | 3300031730 | Bacteria | 712 |
| 959 | Ga0307516_10753397 | 3300031730 | Bacteria | 633 |
| 960 | Ga0307405_10005746 | 3300031731 | Bacteria | 6028 |
| 961 | Ga0307405_10274690 | 3300031731 | Bacteria | 1265 |
| 962 | Ga0307405_10628796 | 3300031731 | Bacteria | 880 |
| 963 | Ga0307405_11960169 | 3300031731 | Bacteria | 523 |
| 964 | Ga0307413_10019225 | 3300031824 | Bacteria | 3604 |
| 965 | Ga0307518_10370619 | 3300031838 | Bacteria | 820 |
| 966 | Ga0307410_10003356 | 3300031852 | Bacteria | 8023 |
| 967 | Ga0307406_10354766 | 3300031901 | Bacteria | 1147 |
| 968 | Ga0307407_10008822 | 3300031903 | Bacteria | 4655 |
| 969 | Ga0307407_10153575 | 3300031903 | Bacteria | 1499 |
| 970 | Ga0307407_11439400 | 3300031903 | Bacteria | 544 |
| 971 | Ga0307412_10134374 | 3300031911 | Bacteria | 1802 |
| 972 | Ga0307412_10172020 | 3300031911 | Bacteria | 1620 |
| 973 | Ga0307412_10415390 | 3300031911 | Bacteria | 1099 |
| 974 | Ga0307412_10866769 | 3300031911 | Bacteria | 789 |
| 975 | Ga0307412_10981464 | 3300031911 | Bacteria | 745 |
| 976 | Ga0307409_100382829 | 3300031995 | Bacteria | 1338 |
| 977 | Ga0307409_100529484 | 3300031995 | Bacteria | 1153 |
| 978 | Ga0307416_100013304 | 3300032002 | Bacteria | 5588 |
| 979 | Ga0307416_100274638 | 3300032002 | Bacteria | 1657 |
| 980 | Ga0307416_100475036 | 3300032002 | Bacteria | 1309 |
| 981 | Ga0307416_101647897 | 3300032002 | Bacteria | 746 |
| 982 | Ga0307416_101921852 | 3300032002 | Bacteria | 695 |
| 983 | Ga0307414_10223977 | 3300032004 | Bacteria | 1546 |
| 984 | Ga0307414_10334425 | 3300032004 | Bacteria | 1294 |
| 985 | Ga0307414_12201286 | 3300032004 | Bacteria | 515 |
| 986 | Ga0307411_10001686 | 3300032005 | Bacteria | 9255 |
| 987 | Ga0307411_10001815 | 3300032005 | Bacteria | 9045 |
| 988 | Ga0307411_10460262 | 3300032005 | Bacteria | 1066 |
| 989 | Ga0307411_10743021 | 3300032005 | Bacteria | 859 |
| 990 | Ga0307411_11027769 | 3300032005 | Bacteria | 739 |
| 991 | Ga0307415_100007903 | 3300032126 | Bacteria | 5854 |
| 992 | Ga0307415_100205875 | 3300032126 | Bacteria | 1565 |
| 993 | Ga0307507_10023516 | 3300033179 | Bacteria | 6761 |
| 994 | Ga0307507_10094001 | 3300033179 | Bacteria | 2551 |
| 995 | Ga0307510_10025175 | 3300033180 | Bacteria | 6868 |
| 996 | Ga0307510_10045192 | 3300033180 | Bacteria | 4758 |
| 997 | Ga0307510_10051426 | 3300033180 | Bacteria | 4357 |
| 998 | Ga0307510_10498148 | 3300033180 | Bacteria | 661 |
| 999 | Ga0373958_0058867 | 3300034819 | Bacteria | 828 |
| 1000 | Ga0373959_0046453 | 3300034820 | Bacteria | 926 |
| 1001 | Ga0373938_0031692 | 3300034957 | Bacteria | 1135 |
| 1002 | Ga0373940_0047582 | 3300035088 | Bacteria | 1196 |
| 1003 | Ga0373940_0237584 | 3300035088 | Bacteria | 610 |
| 1004 | Ga0373944_0272924 | 3300035089 | Bacteria | 629 |
| 1005 | Ga0373949_0028332 | 3300035090 | Bacteria | 1321 |
| 1006 | Ga0373951_0090239 | 3300035091 | Bacteria | 803 |
| 1007 | Ga0373952_0104597 | 3300035092 | Bacteria | 751 |
| 1008 | Ga0373923_0303749 | 3300035111 | Bacteria | 755 |
| 1009 | Ga0373923_0516054 | 3300035111 | Bacteria | 584 |
| 1010 | Ga0373932_0034081 | 3300035112 | Bacteria | 1433 |
| 1011 | Ga0373939_0000272 | 3300035114 | Bacteria | 13809 |
| 1012 | Ga0373954_0173704 | 3300035118 | Bacteria | 1056 |
| 1013 | Ga0373943_0070104 | 3300035170 | Bacteria | 1773 |
| 1014 | Ga0373943_0105381 | 3300035170 | Bacteria | 1480 |
| 1015 | Ga0373943_0798885 | 3300035170 | Bacteria | 561 |
| 1016 | Ga0373946_0320684 | 3300035171 | Bacteria | 770 |
| 1017 | Ga0373946_0599319 | 3300035171 | Bacteria | 571 |
| 1018 | Ga0373955_0177348 | 3300035172 | Bacteria | 1263 |
| 1019 | Ga0373962_0006206 | 3300035242 | Bacteria | 2891 |
| 1020 | Ga0373962_0011842 | 3300035242 | Bacteria | 2191 |
| 1021 | Ga0373924_0106397 | 3300035410 | Bacteria | 1209 |
| 1022 | Ga0373924_0503637 | 3300035410 | Bacteria | 544 |
| 1023 | Ga0373931_0000665 | 3300035691 | Bacteria | 14209 |
| 1024 | Ga0373931_0001429 | 3300035691 | Bacteria | 10246 |
| 1025 | Ga0373931_0370700 | 3300035691 | Bacteria | 900 |
| 1026 | Ga0373935_0795653 | 3300035692 | Bacteria | 698 |
| 1027 | Ga0373927_0352780 | 3300035695 | Bacteria | 969 |
| 1028 | Ga0373927_0448564 | 3300035695 | Bacteria | 852 |
| 1029 | Ga0373933_0182375 | 3300035724 | Bacteria | 1339 |
| 1030 | Ga0373933_0276253 | 3300035724 | Bacteria | 1085 |
| 1031 | Ga0373947_0050825 | 3300035725 | Bacteria | 2493 |
| 1032 | Ga0373947_0831150 | 3300035725 | Bacteria | 631 |
| 1033 | Ga0373937_0065617 | 3300036401 | Bacteria | 3342 |
| 1034 | Ga0373937_0129239 | 3300036401 | Bacteria | 2359 |
| 1035 | Ga0373937_0162313 | 3300036401 | Bacteria | 2095 |
| 1036 | Ga0373925_0070801 | 3300037068 | Bacteria | 2637 |
| 1037 | Ga0373925_0080994 | 3300037068 | Bacteria | 2468 |
| 1038 | Ga0373925_0193368 | 3300037068 | Bacteria | 1615 |
| 1039 | Ga0373925_0405428 | 3300037068 | Bacteria | 1112 |
| 1040 | Ga0373925_0673822 | 3300037068 | Bacteria | 852 |
| 1041 | Ga0395900_0000535 | 3300037418 | Bacteria | 53622 |
| 1042 | Ga0395898_0002836 | 3300037466 | Bacteria | 19833 |
| 1043 | Ga0395905_0007293 | 3300037471 | Bacteria | 11021 |
| 1044 | Ga0395905_0012706 | 3300037471 | Bacteria | 8098 |
| 1045 | Ga0395905_0053650 | 3300037471 | Bacteria | 3772 |
| 1046 | Ga0395905_0124032 | 3300037471 | Bacteria | 2429 |
| 1047 | Ga0395905_0811662 | 3300037471 | Bacteria | 838 |
| 1048 | Ga0436364_1495413 | 3300037853 | Bacteria | 958 |
| 1049 | Ga0436365_1267282 | 3300039437 | Bacteria | 895 |
| 1050 | Ga0436360_0381654 | 3300039438 | Bacteria | 606 |
| 1051 | Ga0436361_0233952 | 3300039447 | Bacteria | 547 |
| 1052 | Ga0436361_0240417 | 3300039447 | Bacteria | 3149 |
| 1053 | Ga0436361_0996052 | 3300039447 | Bacteria | 5986 |
| 1054 | Ga0439461_0059791 | 3300041410 | Bacteria | 863 |
| 1055 | Ga0439461_0127329 | 3300041410 | Bacteria | 641 |
| 1056 | Ga0439465_0338149 | 3300041413 | Bacteria | 567 |
| 1057 | Ga0451789_1178356 | 3300041443 | Bacteria | 1226 |
| 1058 | Ga0451793_0358311 | 3300041452 | Bacteria | 1139 |
| 1059 | Ga0451793_1172903 | 3300041452 | Bacteria | 599 |
| 1060 | Ga0451793_1673427 | 3300041452 | Bacteria | 1144 |
| 1061 | Ga0451797_0278276 | 3300041453 | Bacteria | 597 |
| 1062 | Ga0451797_1036550 | 3300041453 | Bacteria | 637 |
| 1063 | Ga0451797_1315304 | 3300041453 | Bacteria | 961 |
| 1064 | Ga0451795_0059148 | 3300041456 | Bacteria | 640 |
| 1065 | Ga0451795_0139934 | 3300041456 | Bacteria | 533 |
| 1066 | Ga0451795_0394184 | 3300041456 | Bacteria | 1321 |
| 1067 | Ga0451798_0566853 | 3300041458 | Bacteria | 827 |
| 1068 | Ga0451798_0791769 | 3300041458 | Bacteria | 739 |
| 1069 | Ga0451798_1166708 | 3300041458 | Bacteria | 1199 |
| 1070 | Ga0451800_0500868 | 3300041459 | Bacteria | 866 |
| 1071 | Ga0451800_1533257 | 3300041459 | Bacteria | 680 |
| 1072 | Ga0451802_0175899 | 3300041460 | Bacteria | 1688 |
| 1073 | Ga0451805_098782 | 3300041461 | Bacteria | 600 |
| 1074 | Ga0451804_0031720 | 3300041463 | Bacteria | 1149 |
| 1075 | Ga0451804_0695359 | 3300041463 | Bacteria | 511 |
| 1076 | Ga0451807_0270528 | 3300041486 | Bacteria | 771 |
| 1077 | Ga0451807_0589163 | 3300041486 | Bacteria | 786 |
| 1078 | Ga0451807_0592901 | 3300041486 | Bacteria | 925 |
| 1079 | Ga0451833_1494138 | 3300041491 | Bacteria | 666 |
| 1080 | Ga0451835_0060653 | 3300041492 | Bacteria | 580 |
| 1081 | Ga0451839_0134199 | 3300041496 | Bacteria | 537 |
| 1082 | Ga0451839_0843576 | 3300041496 | Bacteria | 649 |
| 1083 | Ga0451841_0137167 | 3300041498 | Bacteria | 541 |
| 1084 | Ga0451841_0202568 | 3300041498 | Bacteria | 1086 |
| 1085 | Ga0451845_0177849 | 3300041501 | Bacteria | 788 |
| 1086 | Ga0451849_0038608 | 3300041505 | Bacteria | 830 |
| 1087 | Ga0451851_0007129 | 3300041507 | Bacteria | 799 |
| 1088 | Ga0451851_0476484 | 3300041507 | Bacteria | 665 |
| 1089 | Ga0451843_0724857 | 3300041509 | Bacteria | 752 |
| 1090 | Ga0451843_1037426 | 3300041509 | Bacteria | 572 |
| 1091 | Ga0451843_1577317 | 3300041509 | Bacteria | 516 |
| 1092 | Ga0451855_0366185 | 3300041511 | Bacteria | 614 |
| 1093 | Ga0451853_2795309 | 3300041512 | Bacteria | 921 |
| 1094 | Ga0451853_3145576 | 3300041512 | Bacteria | 1007 |
| 1095 | Ga0451853_3325265 | 3300041512 | Bacteria | 654 |
| 1096 | Ga0451853_3908419 | 3300041512 | Bacteria | 1988 |
| 1097 | Ga0439433_0025071 | 3300041999 | Bacteria | 1346 |
| 1098 | Ga0439437_022894 | 3300042000 | Bacteria | 762 |
| 1099 | Ga0439445_0030673 | 3300042004 | Bacteria | 1394 |
| 1100 | Ga0439449_0117024 | 3300042007 | Bacteria | 989 |
| 1101 | Ga0439450_001164 | 3300042008 | Bacteria | 3762 |
| 1102 | Ga0439450_073815 | 3300042008 | Bacteria | 840 |
| 1103 | Ga0439454_110360 | 3300042011 | Bacteria | 524 |
| 1104 | Ga0439455_0049240 | 3300042012 | Bacteria | 1097 |
| 1105 | Ga0450912_031564 | 3300042116 | Bacteria | 551 |
| 1106 | Ga0450917_000284 | 3300042120 | Bacteria | 3743 |
| 1107 | Ga0450919_000285 | 3300042121 | Bacteria | 5938 |
| 1108 | Ga0450920_055118 | 3300042122 | Bacteria | 800 |
| 1109 | Ga0450888_005886 | 3300042126 | Bacteria | 1320 |
| 1110 | Ga0450888_010596 | 3300042126 | Bacteria | 1070 |
| 1111 | Ga0450890_001614 | 3300042127 | Bacteria | 3233 |
| 1112 | Ga0450890_001839 | 3300042127 | Bacteria | 3005 |
| 1113 | Ga0450891_001574 | 3300042129 | Bacteria | 2346 |
| 1114 | Ga0450892_001645 | 3300042130 | Bacteria | 2091 |
| 1115 | Ga0450898_019707 | 3300042134 | Bacteria | 1177 |
| 1116 | Ga0450898_028272 | 3300042134 | Bacteria | 1018 |
| 1117 | Ga0450898_042079 | 3300042134 | Bacteria | 867 |
| 1118 | Ga0450904_014100 | 3300042139 | Bacteria | 796 |
| 1119 | Ga0450889_001274 | 3300042144 | Bacteria | 2617 |
| 1120 | Ga0439446_0069153 | 3300042156 | Bacteria | 1078 |
| 1121 | Ga0439458_0046384 | 3300042157 | Bacteria | 1064 |
| 1122 | Ga0439458_0105508 | 3300042157 | Bacteria | 734 |
| 1123 | Ga0439435_0169373 | 3300042436 | Bacteria | 709 |
| 1124 | Ga0439444_0022531 | 3300042437 | Bacteria | 1124 |
| 1125 | Ga0439464_0004537 | 3300042439 | Bacteria | 3557 |
| 1126 | Ga0439460_0071551 | 3300042461 | Bacteria | 1075 |
| 1127 | Ga0450918_000434 | 3300042531 | Bacteria | 9012 |
| 1128 | Ga0450893_0006947 | 3300042532 | Bacteria | 1834 |
| 1129 | Ga0450893_0030477 | 3300042532 | Bacteria | 960 |
| 1130 | Ga0450893_0077745 | 3300042532 | Bacteria | 652 |
| 1131 | Ga0451577_0001608 | 3300042876 | Bacteria | 29360 |
| 1132 | Ga0451577_0008143 | 3300042876 | Bacteria | 10223 |
| 1133 | Ga0451577_0009084 | 3300042876 | Bacteria | 9593 |
| 1134 | Ga0451577_0292353 | 3300042876 | Bacteria | 1476 |
| 1135 | Ga0451577_0379735 | 3300042876 | Bacteria | 1282 |
| 1136 | Ga0451577_1509607 | 3300042876 | Bacteria | 594 |
| 1137 | Ga0466969_0023536 | 3300044656 | Bacteria | 3174 |
| 1138 | Ga0466969_0057161 | 3300044656 | Bacteria | 1902 |
| 1139 | Ga0466972_0004153 | 3300044658 | Bacteria | 7225 |
| 1140 | Ga0466972_0013057 | 3300044658 | Bacteria | 4174 |
| 1141 | Ga0466972_0039081 | 3300044658 | Bacteria | 2317 |
| 1142 | Ga0453683_0844060 | 3300044673 | Bacteria | 604 |
| 1143 | Ga0466965_0036600 | 3300044683 | Bacteria | 2408 |
| 1144 | Ga0466965_0057540 | 3300044683 | Bacteria | 1938 |
| 1145 | Ga0466965_0153621 | 3300044683 | Bacteria | 1204 |
| 1146 | Ga0466965_0212190 | 3300044683 | Bacteria | 1029 |
| 1147 | Ga0466965_0220200 | 3300044683 | Bacteria | 1011 |
| 1148 | Ga0466966_0004224 | 3300044684 | Bacteria | 9483 |
| 1149 | Ga0466966_0041477 | 3300044684 | Bacteria | 2957 |
| 1150 | Ga0466966_0050824 | 3300044684 | Bacteria | 2636 |
| 1151 | Ga0466961_0032915 | 3300044693 | Bacteria | 3330 |
| 1152 | Ga0466961_0045694 | 3300044693 | Bacteria | 2801 |
| 1153 | Ga0466961_0240990 | 3300044693 | Bacteria | 1111 |
| 1154 | Ga0466963_0037909 | 3300044694 | Bacteria | 3151 |
| 1155 | Ga0466964_0012532 | 3300044706 | Bacteria | 3209 |
| 1156 | Ga0466964_0060667 | 3300044706 | Bacteria | 1573 |
| 1157 | Ga0453684_0007620 | 3300044712 | Bacteria | 19830 |
| 1158 | Ga0453684_0041964 | 3300044712 | Bacteria | 6175 |
| 1159 | Ga0453684_0118560 | 3300044712 | Bacteria | 3201 |
| 1160 | Ga0453684_0242660 | 3300044712 | Bacteria | 2073 |
| 1161 | Ga0453684_0296619 | 3300044712 | Bacteria | 1839 |
| 1162 | Ga0453684_2447925 | 3300044712 | Bacteria | 516 |
| 1163 | Ga0466968_0086394 | 3300044735 | Bacteria | 1384 |
| 1164 | Ga0466970_0026135 | 3300044765 | Bacteria | 3060 |
| 1165 | Ga0466970_0301278 | 3300044765 | Bacteria | 904 |
| 1166 | Ga0466957_0096817 | 3300044842 | Bacteria | 1855 |
| 1167 | Ga0466960_0005145 | 3300044901 | Bacteria | 5172 |
| 1168 | Ga0466960_0205627 | 3300044901 | Bacteria | 1077 |
| 1169 | Ga0466959_0000793 | 3300045049 | Bacteria | 18583 |
| 1170 | Ga0466959_0058453 | 3300045049 | Bacteria | 2808 |
| 1171 | Ga0451576_0004508 | 3300045051 | Bacteria | 18022 |
| 1172 | Ga0451576_0014073 | 3300045051 | Bacteria | 8915 |
| 1173 | Ga0451576_0040276 | 3300045051 | Bacteria | 4947 |
| 1174 | Ga0451576_0067461 | 3300045051 | Bacteria | 3724 |
| 1175 | Ga0451576_0094271 | 3300045051 | Bacteria | 3113 |
| 1176 | Ga0451576_0179084 | 3300045051 | Bacteria | 2213 |
| 1177 | Ga0451576_0226207 | 3300045051 | Bacteria | 1953 |
| 1178 | Ga0451576_0357938 | 3300045051 | Bacteria | 1528 |
| 1179 | Ga0466958_0138502 | 3300045836 | Bacteria | 1531 |
| 1180 | Ga0495592_0000295 | 3300046454 | Bacteria | 42617 |
| 1181 | Ga0495592_0570222 | 3300046454 | Bacteria | 694 |
| 1182 | Ga0495603_0294798 | 3300046455 | Bacteria | 932 |
| 1183 | Ga0495590_0088566 | 3300046457 | Bacteria | 1094 |
| 1184 | Ga0495591_101977 | 3300046458 | Bacteria | 711 |
| 1185 | Ga0495629_0183779 | 3300046459 | Bacteria | 1448 |
| 1186 | Ga0495629_0913725 | 3300046459 | Bacteria | 575 |
| 1187 | Ga0495638_0463109 | 3300046460 | Bacteria | 645 |
| 1188 | Ga0495582_0516988 | 3300046473 | Bacteria | 690 |
| 1189 | Ga0495639_0317507 | 3300046475 | Bacteria | 779 |
| 1190 | Ga0495664_0351137 | 3300046477 | Bacteria | 888 |
| 1191 | Ga0495583_0089971 | 3300046506 | Bacteria | 1323 |
| 1192 | Ga0495606_0308558 | 3300046507 | Bacteria | 855 |
| 1193 | Ga0495608_0220549 | 3300046511 | Bacteria | 1190 |
| 1194 | Ga0495610_0005844 | 3300046512 | Bacteria | 8642 |
| 1195 | Ga0495620_0083960 | 3300046515 | Bacteria | 1285 |
| 1196 | Ga0495628_0935336 | 3300046516 | Bacteria | 600 |
| 1197 | Ga0495630_1026686 | 3300046517 | Bacteria | 626 |
| 1198 | Ga0495631_0066241 | 3300046518 | Bacteria | 1563 |
| 1199 | Ga0495632_0010763 | 3300046519 | Bacteria | 5390 |
| 1200 | Ga0495632_0020823 | 3300046519 | Bacteria | 3544 |
| 1201 | Ga0495632_0284097 | 3300046519 | Bacteria | 736 |
| 1202 | Ga0495643_0158986 | 3300046522 | Bacteria | 1113 |
| 1203 | Ga0495648_0163679 | 3300046524 | Bacteria | 1147 |
| 1204 | Ga0495648_0195975 | 3300046524 | Bacteria | 1015 |
| 1205 | Ga0495648_0455521 | 3300046524 | Bacteria | 558 |
| 1206 | Ga0495666_0091251 | 3300046526 | Bacteria | 1437 |
| 1207 | Ga0495666_0482124 | 3300046526 | Bacteria | 555 |
| 1208 | Ga0495586_0159847 | 3300046535 | Bacteria | 1270 |
| 1209 | Ga0495586_0182997 | 3300046535 | Bacteria | 1186 |
| 1210 | Ga0495609_0149509 | 3300046538 | Bacteria | 994 |
| 1211 | Ga0495621_0292428 | 3300046539 | Bacteria | 673 |
| 1212 | Ga0495597_0008922 | 3300046542 | Bacteria | 5001 |
| 1213 | Ga0495645_0150423 | 3300046543 | Bacteria | 1618 |
| 1214 | Ga0495667_0168248 | 3300046559 | Bacteria | 1409 |
| 1215 | Ga0495668_0148343 | 3300046616 | Bacteria | 1284 |
| 1216 | Ga0495668_0813534 | 3300046616 | Bacteria | 517 |
| 1217 | Ga0495611_0062211 | 3300046648 | Bacteria | 1698 |
| 1218 | Ga0495625_0002174 | 3300046660 | Bacteria | 21783 |
| 1219 | Ga0495625_0004670 | 3300046660 | Bacteria | 12862 |
| 1220 | Ga0495625_0289950 | 3300046660 | Bacteria | 1050 |
| 1221 | Ga0495625_0608088 | 3300046660 | Bacteria | 655 |
| 1222 | Ga0495635_0210694 | 3300046663 | Bacteria | 1316 |
| 1223 | Ga0495647_0113929 | 3300046681 | Bacteria | 1131 |
| 1224 | Ga0495647_0214694 | 3300046681 | Bacteria | 847 |
| 1225 | Ga0495658_0067119 | 3300046683 | Bacteria | 2074 |
| 1226 | Ga0495658_0107084 | 3300046683 | Bacteria | 1676 |
| 1227 | Ga0495658_0109706 | 3300046683 | Bacteria | 1658 |
| 1228 | Ga0495658_0166449 | 3300046683 | Bacteria | 1362 |
| 1229 | Ga0495613_0402751 | 3300046689 | Bacteria | 933 |
| 1230 | Ga0495613_0475467 | 3300046689 | Bacteria | 844 |
| 1231 | Ga0495624_0025731 | 3300046690 | Bacteria | 3862 |
| 1232 | Ga0495670_0081267 | 3300046691 | Bacteria | 1651 |
| 1233 | Ga0495670_0195654 | 3300046691 | Bacteria | 1070 |
| 1234 | Ga0495671_0142081 | 3300046692 | Bacteria | 1170 |
| 1235 | Ga0495671_0248083 | 3300046692 | Bacteria | 859 |
| 1236 | Ga0495649_0006798 | 3300046694 | Bacteria | 7084 |
| 1237 | Ga0495660_0020654 | 3300046810 | Bacteria | 3775 |
| 1238 | Ga0495581_0418620 | 3300047315 | Bacteria | 781 |
| 1239 | Ga0495636_0280313 | 3300047318 | Bacteria | 776 |
| 1240 | Ga0495674_0667548 | 3300047319 | Bacteria | 818 |
| 1241 | Ga0495687_000636 | 3300047443 | Bacteria | 40190 |
| 1242 | Ga0495673_0076118 | 3300047469 | Bacteria | 1400 |
| 1243 | Ga0495684_0179919 | 3300047471 | Bacteria | 1568 |
| 1244 | Ga0495684_0941954 | 3300047471 | Bacteria | 553 |
| 1245 | Ga0495686_0002900 | 3300047472 | Bacteria | 15394 |
| 1246 | Ga0495686_0069329 | 3300047472 | Bacteria | 2174 |
| 1247 | Ga0495602_0403157 | 3300048088 | Bacteria | 975 |
| 1248 | Ga0495626_0133152 | 3300048091 | Bacteria | 1060 |
| 1249 | Ga0496101_0221248 | 3300048904 | Bacteria | 1469 |
| 1250 | Ga0496101_0573894 | 3300048904 | Bacteria | 892 |
| 1251 | Ga0496101_0997218 | 3300048904 | Bacteria | 659 |
| 1252 | Ga0496101_1062950 | 3300048904 | Bacteria | 636 |
| 1253 | Ga0496102_0027533 | 3300048905 | Bacteria | 5076 |
| 1254 | Ga0496102_0652466 | 3300048905 | Bacteria | 975 |
| 1255 | Ga0496104_0214747 | 3300048907 | Bacteria | 1835 |
| 1256 | Ga0496104_0308141 | 3300048907 | Bacteria | 1496 |
| 1257 | Ga0496105_0026211 | 3300048908 | Bacteria | 4753 |
| 1258 | Ga0496105_0231209 | 3300048908 | Bacteria | 1503 |
| 1259 | Ga0496105_0302639 | 3300048908 | Bacteria | 1285 |
| 1260 | Ga0496105_1066228 | 3300048908 | Bacteria | 601 |
| 1261 | Ga0496106_0010515 | 3300048909 | Bacteria | 6836 |
| 1262 | Ga0496106_0125219 | 3300048909 | Bacteria | 2011 |
| 1263 | Ga0496107_0007401 | 3300048910 | Bacteria | 7569 |
| 1264 | Ga0496107_0373843 | 3300048910 | Bacteria | 1060 |
| 1265 | Ga0496108_0028747 | 3300048911 | Bacteria | 4600 |
| 1266 | Ga0496108_0216381 | 3300048911 | Bacteria | 1664 |
| 1267 | Ga0496108_0332358 | 3300048911 | Bacteria | 1325 |
| 1268 | Ga0496108_0378982 | 3300048911 | Bacteria | 1235 |
| 1269 | Ga0496108_1201518 | 3300048911 | Bacteria | 641 |
| 1270 | Ga0496109_0304524 | 3300048912 | Bacteria | 1503 |
| 1271 | Ga0496109_1588787 | 3300048912 | Bacteria | 588 |
| 1272 | Ga0496110_0031571 | 3300048913 | Bacteria | 4571 |
| 1273 | Ga0496110_0297248 | 3300048913 | Bacteria | 1471 |
| 1274 | Ga0496110_0938505 | 3300048913 | Bacteria | 772 |
| 1275 | Ga0496111_0640031 | 3300048914 | Bacteria | 776 |
| 1276 | Ga0496111_0913893 | 3300048914 | Bacteria | 632 |
| 1277 | Ga0496112_0263917 | 3300048915 | Bacteria | 1671 |
| 1278 | Ga0496113_0272336 | 3300048916 | Bacteria | 1353 |
| 1279 | Ga0496113_0350661 | 3300048916 | Bacteria | 1184 |
| 1280 | Ga0496114_0263997 | 3300048917 | Bacteria | 1516 |
| 1281 | Ga0496114_0272685 | 3300048917 | Bacteria | 1491 |
| 1282 | Ga0496114_0957620 | 3300048917 | Bacteria | 738 |
| 1283 | Ga0496114_1025311 | 3300048917 | Bacteria | 709 |
| 1284 | Ga0496115_0200731 | 3300048918 | Bacteria | 1647 |
| 1285 | Ga0496121_0018192 | 3300048924 | Bacteria | 7102 |
| 1286 | Ga0496123_0302375 | 3300048926 | Bacteria | 763 |
| 1287 | Ga0496124_0071074 | 3300048927 | Bacteria | 2886 |
| 1288 | Ga0496125_0006880 | 3300048928 | Bacteria | 12182 |
| 1289 | Ga0496125_0137600 | 3300048928 | Bacteria | 1705 |
| 1290 | Ga0496125_0361294 | 3300048928 | Bacteria | 863 |
| 1291 | Ga0496126_0100589 | 3300048929 | Bacteria | 2530 |
| 1292 | Ga0496126_0200834 | 3300048929 | Bacteria | 1684 |
| 1293 | Ga0501309_016098 | 3300049129 | Bacteria | 1016 |
| 1294 | Ga0501310_002487 | 3300049130 | Bacteria | 1754 |
| 1295 | Ga0501305_009668 | 3300049161 | Bacteria | 1272 |
| 1296 | Ga0501292_009653 | 3300049515 | Bacteria | 1435 |
| 1297 | Ga0501293_015501 | 3300049516 | Bacteria | 702 |
| 1298 | Ga0501294_005995 | 3300049517 | Bacteria | 1158 |
| 1299 | Ga0501295_102340 | 3300049518 | Bacteria | 673 |
| 1300 | Ga0501298_016579 | 3300049521 | Bacteria | 1337 |
| 1301 | Ga0501301_011540 | 3300049524 | Bacteria | 739 |
| 1302 | Ga0501303_007065 | 3300049526 | Bacteria | 993 |
| 1303 | Ga0501312_032643 | 3300049528 | Bacteria | 823 |
| 1304 | Ga0501312_078798 | 3300049528 | Bacteria | 594 |
| 1305 | Ga0501313_011837 | 3300049529 | Bacteria | 1010 |
| 1306 | Ga0501043_0000075 | 3300049579 | Bacteria | 86156 |
| 1307 | Ga0501046_0000195 | 3300049580 | Bacteria | 62300 |
| 1308 | Ga0501047_0000145 | 3300049581 | Bacteria | 86319 |
| 1309 | Ga0501048_0000999 | 3300049582 | Bacteria | 21090 |
| 1310 | Ga0501070_1001267 | 3300049586 | Bacteria | 648 |
| 1311 | Ga0501198_000015 | 3300049649 | Bacteria | 102945 |
| 1312 | Ga0501206_010361 | 3300049653 | Bacteria | 1248 |
| 1313 | Ga0501207_019830 | 3300049654 | Bacteria | 1069 |
| 1314 | Ga0501211_005166 | 3300049658 | Bacteria | 1313 |
| 1315 | Ga0501217_146762 | 3300049661 | Bacteria | 702 |
| 1316 | Ga0501222_000040 | 3300049662 | Bacteria | 49987 |
| 1317 | Ga0501222_004797 | 3300049662 | Bacteria | 1838 |
| 1318 | Ga0501222_059558 | 3300049662 | Bacteria | 575 |
| 1319 | Ga0501223_018194 | 3300049663 | Bacteria | 1383 |
| 1320 | Ga0501233_123583 | 3300049668 | Bacteria | 701 |
| 1321 | Ga0501235_018965 | 3300049669 | Bacteria | 1525 |
| 1322 | Ga0501249_009208 | 3300049679 | Bacteria | 2054 |
| 1323 | Ga0501257_190349 | 3300049686 | Bacteria | 585 |
| 1324 | Ga0501261_048038 | 3300049690 | Bacteria | 692 |
| 1325 | Ga0501229_000012 | 3300049706 | Bacteria | 25765 |
| 1326 | Ga0501245_035141 | 3300049708 | Bacteria | 843 |
| 1327 | Ga0501079_0520663 | 3300049741 | Bacteria | 935 |
| 1328 | Ga0501232_059792 | 3300049757 | Bacteria | 607 |
| 1329 | Ga0501262_019485 | 3300049759 | Bacteria | 919 |
| 1330 | Ga0501262_091132 | 3300049759 | Bacteria | 518 |
| 1331 | Ga0501263_091079 | 3300049760 | Bacteria | 515 |
| 1332 | Ga0501265_004388 | 3300049762 | Bacteria | 1605 |
| 1333 | Ga0501269_048975 | 3300049766 | Bacteria | 578 |
| 1334 | Ga0501272_001140 | 3300049769 | Bacteria | 2457 |
| 1335 | Ga0501274_027674 | 3300049771 | Bacteria | 624 |
| 1336 | Ga0501276_031686 | 3300049773 | Bacteria | 555 |
| 1337 | Ga0501280_042545 | 3300049776 | Bacteria | 741 |
| 1338 | Ga0501035_0067274 | 3300049822 | Bacteria | 3180 |
| 1339 | Ga0501045_0010507 | 3300049824 | Bacteria | 6485 |
| 1340 | Ga0501226_017971 | 3300049853 | Bacteria | 778 |
| 1341 | nmdc:mga03683_118420_c1 | 3300050489 | Bacteria | 1176 |
| 1342 | nmdc:mga03683_12560_c1 | 3300050489 | Bacteria | 3097 |
| 1343 | nmdc:mga03683_18823_c1 | 3300050489 | Bacteria | 2631 |
| 1344 | nmdc:mga03683_49338_c1 | 3300050489 | Bacteria | 1752 |
| 1345 | nmdc:mga00v17_102345_c1 | 3300050491 | Bacteria | 1809 |
| 1346 | nmdc:mga0k408_112983_c1 | 3300050493 | Bacteria | 1606 |
| 1347 | nmdc:mga0k408_115773_c1 | 3300050493 | Bacteria | 1586 |
| 1348 | nmdc:mga0k408_148_c1 | 3300050493 | Bacteria | 35989 |
| 1349 | nmdc:mga0k408_157915_c1 | 3300050493 | Bacteria | 1351 |
| 1350 | nmdc:mga0k408_187083_c1 | 3300050493 | Bacteria | 1235 |
| 1351 | nmdc:mga0k408_199009_c1 | 3300050493 | Bacteria | 1196 |
| 1352 | nmdc:mga0k408_204526_c1 | 3300050493 | Bacteria | 1179 |
| 1353 | nmdc:mga0k408_20746_c1 | 3300050493 | Bacteria | 3686 |
| 1354 | nmdc:mga0k408_209336_c1 | 3300050493 | Bacteria | 1164 |
| 1355 | nmdc:mga0k408_228472_c1 | 3300050493 | Bacteria | 1111 |
| 1356 | nmdc:mga0k408_2372_c1 | 3300050493 | Bacteria | 8674 |
| 1357 | nmdc:mga0k408_2509_c1 | 3300050493 | Bacteria | 9764 |
| 1358 | nmdc:mga0k408_26933_c1 | 3300050493 | Bacteria | 3262 |
| 1359 | nmdc:mga0k408_283907_c1 | 3300050493 | Bacteria | 988 |
| 1360 | nmdc:mga0k408_29340_c1 | 3300050493 | Bacteria | 3131 |
| 1361 | nmdc:mga0k408_37851_c1 | 3300050493 | Bacteria | 2770 |
| 1362 | nmdc:mga0k408_39980_c1 | 3300050493 | Bacteria | 2697 |
| 1363 | nmdc:mga0k408_422366_c1 | 3300050493 | Bacteria | 793 |
| 1364 | nmdc:mga0k408_48557_c1 | 3300050493 | Bacteria | 2456 |
| 1365 | nmdc:mga0k408_565085_c1 | 3300050493 | Bacteria | 672 |
| 1366 | nmdc:mga0k408_631204_c1 | 3300050493 | Bacteria | 631 |
| 1367 | nmdc:mga0k408_69397_c1 | 3300050493 | Bacteria | 2057 |
| 1368 | nmdc:mga0k408_7192_c1 | 3300050493 | Bacteria | 5951 |
| 1369 | nmdc:mga0k408_816325_c1 | 3300050493 | Bacteria | 543 |
| 1370 | nmdc:mga0k408_9250_c1 | 3300050493 | Bacteria | 5309 |
| 1371 | nmdc:mga06z11_250734_c1 | 3300050494 | Bacteria | 1042 |
| 1372 | nmdc:mga06z11_27747_c1 | 3300050494 | Bacteria | 2709 |
| 1373 | nmdc:mga06z11_36995_c1 | 3300050494 | Bacteria | 2414 |
| 1374 | nmdc:mga04h51_11416_c1 | 3300050495 | Bacteria | 2465 |
| 1375 | nmdc:mga04h51_143940_c1 | 3300050495 | Bacteria | 906 |
| 1376 | nmdc:mga07m45_141279_c1 | 3300050496 | Bacteria | 1395 |
| 1377 | nmdc:mga07m45_1748_c1 | 3300050496 | Bacteria | 10008 |
| 1378 | nmdc:mga07m45_17681_c1 | 3300050496 | Bacteria | 3835 |
| 1379 | nmdc:mga07m45_195687_c1 | 3300050496 | Bacteria | 1176 |
| 1380 | nmdc:mga07m45_207593_c1 | 3300050496 | Bacteria | 1140 |
| 1381 | nmdc:mga07m45_219380_c1 | 3300050496 | Bacteria | 1106 |
| 1382 | nmdc:mga07m45_26285_c1 | 3300050496 | Bacteria | 3199 |
| 1383 | nmdc:mga07m45_454377_c1 | 3300050496 | Bacteria | 743 |
| 1384 | nmdc:mga07m45_507282_c1 | 3300050496 | Bacteria | 698 |
| 1385 | nmdc:mga07m45_5236_c1 | 3300050496 | Bacteria | 6439 |
| 1386 | nmdc:mga07m45_569_c1 | 3300050496 | Bacteria | 5463 |
| 1387 | nmdc:mga07m45_587096_c1 | 3300050496 | Bacteria | 644 |
| 1388 | nmdc:mga07m45_637902_c1 | 3300050496 | Bacteria | 614 |
| 1389 | nmdc:mga07m45_651412_c1 | 3300050496 | Bacteria | 607 |
| 1390 | nmdc:mga07m45_9266_c1 | 3300050496 | Bacteria | 5097 |
| 1391 | nmdc:mga05p37_1042262_c1 | 3300050507 | Bacteria | 864 |
| 1392 | nmdc:mga09592_2500_c1 | 3300050508 | Bacteria | 14862 |
| 1393 | nmdc:mga0qj67_687499_c1 | 3300050509 | Bacteria | 814 |
| 1394 | nmdc:mga0rr50_598170_c1 | 3300050513 | Bacteria | 940 |
| 1395 | nmdc:mga0sz30_223290_c1 | 3300050516 | Bacteria | 838 |
| 1396 | nmdc:mga0sz30_485404_c1 | 3300050516 | Bacteria | 555 |
| 1397 | nmdc:mga0sz30_93180_c1 | 3300050516 | Bacteria | 1312 |
| 1398 | Ga0495601_0239039 | 3300053077 | Bacteria | 1186 |
| 1399 | Ga0495612_0109920 | 3300053078 | Bacteria | 1179 |
| 1400 | Ga0495612_0111159 | 3300053078 | Bacteria | 1173 |
| 1401 | Ga0500635_0089445 | 3300053080 | Bacteria | 1118 |
| 1402 | Ga0495595_0045883 | 3300053084 | Bacteria | 2011 |
| 1403 | Ga0495619_0263687 | 3300053085 | Bacteria | 1194 |
| 1404 | Ga0495619_1013021 | 3300053085 | Bacteria | 555 |
| 1405 | Ga0500578_0000224 | 3300053086 | Bacteria | 70358 |
| 1406 | Ga0500578_0050616 | 3300053086 | Bacteria | 2664 |
| 1407 | Ga0500578_0299536 | 3300053086 | Bacteria | 954 |
| 1408 | Ga0500643_034161 | 3300053087 | Bacteria | 1533 |
| 1409 | Ga0500644_0010134 | 3300053088 | Bacteria | 2543 |
| 1410 | Ga0500644_0120932 | 3300053088 | Bacteria | 1020 |
| 1411 | Ga0500646_0004682 | 3300053090 | Bacteria | 3457 |
| 1412 | Ga0500646_0164139 | 3300053090 | Bacteria | 743 |
| 1413 | Ga0500583_0036759 | 3300053092 | Bacteria | 2195 |
| 1414 | Ga0500583_0149970 | 3300053092 | Bacteria | 1160 |
| 1415 | Ga0500651_0017559 | 3300053093 | Bacteria | 4417 |
| 1416 | Ga0500651_0135489 | 3300053093 | Bacteria | 1487 |
| 1417 | Ga0500651_0269812 | 3300053093 | Bacteria | 984 |
| 1418 | Ga0500650_0082359 | 3300053098 | Bacteria | 1505 |
| 1419 | Ga0500650_0114126 | 3300053098 | Bacteria | 1260 |
| 1420 | Ga0500562_126507 | 3300053108 | Bacteria | 696 |
| 1421 | Ga0500569_053929 | 3300053109 | Bacteria | 1221 |
| 1422 | Ga0500593_000250 | 3300053117 | Bacteria | 22072 |
| 1423 | Ga0500594_0016209 | 3300053118 | Bacteria | 1808 |
| 1424 | Ga0500614_013639 | 3300053123 | Bacteria | 1789 |
| 1425 | Ga0500628_002390 | 3300053129 | Bacteria | 3113 |
| 1426 | Ga0500642_0007522 | 3300053130 | Bacteria | 3668 |
| 1427 | Ga0500652_001099 | 3300053131 | Bacteria | 8722 |
| 1428 | Ga0500652_033825 | 3300053131 | Bacteria | 2022 |
| 1429 | Ga0500655_002874 | 3300053133 | Bacteria | 3128 |
| 1430 | Ga0500655_042869 | 3300053133 | Bacteria | 890 |
| 1431 | Ga0500658_0007909 | 3300053134 | Bacteria | 3929 |
| 1432 | Ga0500658_0187077 | 3300053134 | Bacteria | 944 |
| 1433 | Ga0500559_0000011 | 3300053136 | Bacteria | 164751 |
| 1434 | Ga0500559_0126453 | 3300053136 | Bacteria | 1192 |
| 1435 | Ga0500564_106111 | 3300053138 | Bacteria | 1237 |
| 1436 | Ga0500568_0050224 | 3300053139 | Bacteria | 1644 |
| 1437 | Ga0500577_0015015 | 3300053142 | Bacteria | 2409 |
| 1438 | Ga0500577_0365620 | 3300053142 | Bacteria | 631 |
| 1439 | Ga0500577_0397043 | 3300053142 | Bacteria | 603 |
| 1440 | Ga0500579_189477 | 3300053143 | Bacteria | 788 |
| 1441 | Ga0500589_123070 | 3300053147 | Bacteria | 1095 |
| 1442 | Ga0500619_000143 | 3300053154 | Bacteria | 17415 |
| 1443 | Ga0500619_012224 | 3300053154 | Bacteria | 2236 |
| 1444 | Ga0500622_0001541 | 3300053156 | Bacteria | 18260 |
| 1445 | Ga0500622_0001880 | 3300053156 | Bacteria | 15853 |
| 1446 | Ga0500622_0009235 | 3300053156 | Bacteria | 5469 |
| 1447 | Ga0500627_0322206 | 3300053158 | Bacteria | 671 |
| 1448 | Ga0500636_0083939 | 3300053177 | Bacteria | 1832 |
| 1449 | Ga0500637_0462678 | 3300053178 | Bacteria | 640 |
| 1450 | Ga0500570_080325 | 3300053724 | Bacteria | 1473 |
| 1451 | Ga0500570_083568 | 3300053724 | Bacteria | 1425 |
| 1452 | Ga0500645_014572 | 3300053730 | Bacteria | 2502 |
| 1453 | Ga0500645_096771 | 3300053730 | Bacteria | 834 |
| 1454 | Ga0500587_000945 | 3300053739 | Bacteria | 3908 |
| 1455 | Ga0500587_005067 | 3300053739 | Bacteria | 1786 |
| 1456 | Ga0500661_106554 | 3300055283 | Bacteria | 535 |
| 1457 | 2644305083 | 2643221654 | Bacteria | 5273570 |
| 1458 | Ga0495647_0371742 | |||
| 1459 | JGI24033J26618_1036228 | |||
| 1460 | JGI25150J39212_1006308 | |||
| 1461 | JGI25153J46596_10009043 | |||
| 1462 | JGI25153J46596_10030106 | |||
| 1463 | rootH1_10062755 | |||
| 1464 | rootH2_10019535 | |||
| 1465 | rootL2_10003847 | |||
| 1466 | rootL2_10005851 | |||
| 1467 | rootH1_10023641 | |||
| 1468 | rootH1_10108114 | |||
| 1469 | JGI26145J50221_1002180 | |||
| 1470 | Ga0055526_1001112 | |||
| 1471 | Ga0055530_10058995 | |||
| 1472 | Ga0055540_1022368 | |||
| 1473 | Ga0055540_1112627 | |||
| 1474 | Ga0055531_10001930 | |||
| 1475 | Ga0055531_10046861 | |||
| 1476 | Ga0055543_1002155 | |||
| 1477 | Ga0065165_1000184 | |||
| 1478 | Ga0065165_1006209 | |||
| 1479 | Ga0065715_10121665 | |||
| 1480 | Ga0065715_10195151 | |||
| 1481 | Ga0065715_10493371 | |||
| 1482 | Ga0065707_10082794 | |||
| 1483 | Ga0065707_10327756 | |||
| 1484 | Ga0065707_10422887 | |||
| 1485 | Ga0065707_10568002 | |||
| 1486 | Ga0070658_10085385 | |||
| 1487 | Ga0070658_10255739 | |||
| 1488 | Ga0070658_10560847 | |||
| 1489 | Ga0070676_10002035 | |||
| 1490 | Ga0070676_10088789 | |||
| 1491 | Ga0070676_10151549 | |||
| 1492 | Ga0070676_10167278 | |||
| 1493 | Ga0070676_10443337 | |||
| 1494 | Ga0070676_11619813 | |||
| 1495 | Ga0070683_100049615 | |||
| 1496 | Ga0070683_101356018 | |||
| 1497 | Ga0070690_100016127 | |||
| 1498 | Ga0070690_100020915 | |||
| 1499 | Ga0070670_100001136 | |||
| 1500 | Ga0070670_100020708 | |||
| 1501 | Ga0070670_100034250 | |||
| 1502 | Ga0070670_100065307 | |||
| 1503 | Ga0070670_100379370 | |||
| 1504 | Ga0070670_100417662 | |||
| 1505 | Ga0070670_100842064 | |||
| 1506 | Ga0070670_101220447 | |||
| 1507 | Ga0070670_101945992 | |||
| 1508 | Ga0070670_102100816 | |||
| 1509 | Ga0070677_10046190 | |||
| 1510 | Ga0070677_10051350 | |||
| 1511 | Ga0070677_10140396 | |||
| 1512 | Ga0070677_10558075 | |||
| 1513 | Ga0068869_100003616 | |||
| 1514 | Ga0068869_100013951 | |||
| 1515 | Ga0068869_100084261 | |||
| 1516 | Ga0068869_100138200 | |||
| 1517 | Ga0068869_100230986 | |||
| 1518 | Ga0070666_10051060 | |||
| 1519 | Ga0070666_10058891 | |||
| 1520 | Ga0070666_10402295 | |||
| 1521 | Ga0070666_10542382 | |||
| 1522 | Ga0070666_10799652 | |||
| 1523 | Ga0070680_100656390 | |||
| 1524 | Ga0070682_100040490 | |||
| 1525 | Ga0070682_101024262 | |||
| 1526 | Ga0068868_100000818 | |||
| 1527 | Ga0068868_100014677 | |||
| 1528 | Ga0068868_100019252 | |||
| 1529 | Ga0068868_100035823 | |||
| 1530 | Ga0068868_100132399 | |||
| 1531 | Ga0068868_100193168 | |||
| 1532 | Ga0068868_100327318 | |||
| 1533 | Ga0068868_100542579 | |||
| 1534 | Ga0068868_101203844 | |||
| 1535 | Ga0070660_100046927 | |||
| 1536 | Ga0070660_100168309 | |||
| 1537 | Ga0070660_100822386 | |||
| 1538 | Ga0070689_100147818 | |||
| 1539 | Ga0070689_100391053 | |||
| 1540 | Ga0070689_102135811 | |||
| 1541 | Ga0070691_10912387 | |||
| 1542 | Ga0070687_101180020 | |||
| 1543 | Ga0070661_100000791 | |||
| 1544 | Ga0070661_100020436 | |||
| 1545 | Ga0070661_100061356 | |||
| 1546 | Ga0070661_100084411 | |||
| 1547 | Ga0070661_100309400 | |||
| 1548 | Ga0070661_101008793 | |||
| 1549 | Ga0070668_100050350 | |||
| 1550 | Ga0070668_100367400 | |||
| 1551 | Ga0070668_101635463 | |||
| 1552 | Ga0070669_100119297 | |||
| 1553 | Ga0070669_100124487 | |||
| 1554 | Ga0070669_100391317 | |||
| 1555 | Ga0070669_100527011 | |||
| 1556 | Ga0070669_100579569 | |||
| 1557 | Ga0070669_100636036 | |||
| 1558 | Ga0070675_100000269 | |||
| 1559 | Ga0070675_100001006 | |||
| 1560 | Ga0070675_100001473 | |||
| 1561 | Ga0070675_100004442 | |||
| 1562 | Ga0070675_100034940 | |||
| 1563 | Ga0070675_100067143 | |||
| 1564 | Ga0070675_100130871 | |||
| 1565 | Ga0070675_100149834 | |||
| 1566 | Ga0070675_100851828 | |||
| 1567 | Ga0070675_101266567 | |||
| 1568 | Ga0070671_100021062 | |||
| 1569 | Ga0070671_100025141 | |||
| 1570 | Ga0070671_100054032 | |||
| 1571 | Ga0070671_100056765 | |||
| 1572 | Ga0070671_100109545 | |||
| 1573 | Ga0070671_100232448 | |||
| 1574 | Ga0070671_100350208 | |||
| 1575 | Ga0070671_100496619 | |||
| 1576 | Ga0070671_100697473 | |||
| 1577 | Ga0070671_101263473 | |||
| 1578 | Ga0070674_100011798 | |||
| 1579 | Ga0070674_100013715 | |||
| 1580 | Ga0070674_100026145 | |||
| 1581 | Ga0070674_100155833 | |||
| 1582 | Ga0070674_100224261 | |||
| 1583 | Ga0070674_100232817 | |||
| 1584 | Ga0070674_100235016 | |||
| 1585 | Ga0070674_100255810 | |||
| 1586 | Ga0070674_100486718 | |||
| 1587 | Ga0070674_102072756 | |||
| 1588 | Ga0070673_100008559 | |||
| 1589 | Ga0070673_100071365 | |||
| 1590 | Ga0070673_100075952 | |||
| 1591 | Ga0070673_100240978 | |||
| 1592 | Ga0070673_100274092 | |||
| 1593 | Ga0070673_100481228 | |||
| 1594 | Ga0070673_100796000 | |||
| 1595 | Ga0070688_100284908 | |||
| 1596 | Ga0070688_100445952 | |||
| 1597 | Ga0070659_100000451 | |||
| 1598 | Ga0070659_100010741 | |||
| 1599 | Ga0070659_100010749 | |||
| 1600 | Ga0070659_100076710 | |||
| 1601 | Ga0070659_101845862 | |||
| 1602 | Ga0070667_100003333 | |||
| 1603 | Ga0070667_100023446 | |||
| 1604 | Ga0070667_100069129 | |||
| 1605 | Ga0070667_100087470 | |||
| 1606 | Ga0070667_100107798 | |||
| 1607 | Ga0070667_100109237 | |||
| 1608 | Ga0070667_100576390 | |||
| 1609 | Ga0070667_100751731 | |||
| 1610 | Ga0070667_100763566 | |||
| 1611 | Ga0070667_100893616 | |||
| 1612 | Ga0070667_102045404 | |||
| 1613 | Ga0070701_10883299 | |||
| 1614 | Ga0070701_11166487 | |||
| 1615 | Ga0070700_100131463 | |||
| 1616 | Ga0070663_100009632 | |||
| 1617 | Ga0070663_100019349 | |||
| 1618 | Ga0070663_100096616 | |||
| 1619 | Ga0070663_100436341 | |||
| 1620 | Ga0070663_100464499 | |||
| 1621 | Ga0070663_100627191 | |||
| 1622 | Ga0070663_101685724 | |||
| 1623 | Ga0070678_100011667 | |||
| 1624 | Ga0070678_100018712 | |||
| 1625 | Ga0070678_100039403 | |||
| 1626 | Ga0070678_100089762 | |||
| 1627 | Ga0070678_100159972 | |||
| 1628 | Ga0070678_100325158 | |||
| 1629 | Ga0070678_100341685 | |||
| 1630 | Ga0070678_100477001 | |||
| 1631 | Ga0070678_100581749 | |||
| 1632 | Ga0070678_100809159 | |||
| 1633 | Ga0070678_101606426 | |||
| 1634 | Ga0070662_100001019 | |||
| 1635 | Ga0070662_100011240 | |||
| 1636 | Ga0070662_100023675 | |||
| 1637 | Ga0070662_100127956 | |||
| 1638 | Ga0070662_100170413 | |||
| 1639 | Ga0070662_100199797 | |||
| 1640 | Ga0070662_100444044 | |||
| 1641 | Ga0070662_100533932 | |||
| 1642 | Ga0070662_101081723 | |||
| 1643 | Ga0070681_10197965 | |||
| 1644 | Ga0070681_10278698 | |||
| 1645 | Ga0068867_100000102 | |||
| 1646 | Ga0068867_100016344 | |||
| 1647 | Ga0068867_100019254 | |||
| 1648 | Ga0068867_100021121 | |||
| 1649 | Ga0068867_100024764 | |||
| 1650 | Ga0068867_100034247 | |||
| 1651 | Ga0068867_100048865 | |||
| 1652 | Ga0068867_100256542 | |||
| 1653 | Ga0068867_100743637 | |||
| 1654 | Ga0068867_100851984 | |||
| 1655 | Ga0068867_101856265 | |||
| 1656 | Ga0070685_10204044 | |||
| 1657 | Ga0070685_10319507 | |||
| 1658 | Ga0070685_10725257 | |||
| 1659 | Ga0070706_100222505 | |||
| 1660 | Ga0070706_100894898 | |||
| 1661 | Ga0070706_101269687 | |||
| 1662 | Ga0070706_101283998 | |||
| 1663 | Ga0070707_100068338 | |||
| 1664 | Ga0070707_101793977 | |||
| 1665 | Ga0070699_100333141 | |||
| 1666 | Ga0070679_100008517 | |||
| 1667 | Ga0070684_100080735 | |||
| 1668 | Ga0070684_100357163 | |||
| 1669 | Ga0068853_100039549 | |||
| 1670 | Ga0068853_100082693 | |||
| 1671 | Ga0068853_100289610 | |||
| 1672 | Ga0068853_100585456 | |||
| 1673 | Ga0068853_100672118 | |||
| 1674 | Ga0068853_102216775 | |||
| 1675 | Ga0070672_100000367 | |||
| 1676 | Ga0070672_100005175 | |||
| 1677 | Ga0070672_100029306 | |||
| 1678 | Ga0070672_100053519 | |||
| 1679 | Ga0070672_100070307 | |||
| 1680 | Ga0070672_100076494 | |||
| 1681 | Ga0070672_100091204 | |||
| 1682 | Ga0070672_100126183 | |||
| 1683 | Ga0070672_100143469 | |||
| 1684 | Ga0070672_100286296 | |||
| 1685 | Ga0070672_100631445 | |||
| 1686 | Ga0070672_101237673 | |||
| 1687 | Ga0070672_101527324 | |||
| 1688 | Ga0070686_100584919 | |||
| 1689 | Ga0070686_101249616 | |||
| 1690 | Ga0070686_101904375 | |||
| 1691 | Ga0070695_100895853 | |||
| 1692 | Ga0070693_100021069 | |||
| 1693 | Ga0070693_100127276 | |||
| 1694 | Ga0070665_100197332 | |||
| 1695 | Ga0070665_101042928 | |||
| 1696 | Ga0070665_101238790 | |||
| 1697 | Ga0070665_101321897 | |||
| 1698 | Ga0070665_101550683 | |||
| 1699 | Ga0068855_100063871 | |||
| 1700 | Ga0068855_100124744 | |||
| 1701 | Ga0070664_100000524 | |||
| 1702 | Ga0070664_100003061 | |||
| 1703 | Ga0070664_100163926 | |||
| 1704 | Ga0070664_100212193 | |||
| 1705 | Ga0070664_100344962 | |||
| 1706 | Ga0070664_100601512 | |||
| 1707 | Ga0070664_100879653 | |||
| 1708 | Ga0070664_100976988 | |||
| 1709 | Ga0068857_100008620 | |||
| 1710 | Ga0068857_100230301 | |||
| 1711 | Ga0068857_100300894 | |||
| 1712 | Ga0068857_100430985 | |||
| 1713 | Ga0068857_101833039 | |||
| 1714 | Ga0068854_100020602 | |||
| 1715 | Ga0068854_100139888 | |||
| 1716 | Ga0068854_100542159 | |||
| 1717 | Ga0068854_101163122 | |||
| 1718 | Ga0068856_100006422 | |||
| 1719 | Ga0068856_100015458 | |||
| 1720 | Ga0068856_100057763 | |||
| 1721 | Ga0068856_101078255 | |||
| 1722 | Ga0068856_102086819 | |||
| 1723 | Ga0070702_100164921 | |||
| 1724 | Ga0070702_101036618 | |||
| 1725 | Ga0068852_100003787 | |||
| 1726 | Ga0068852_100018700 | |||
| 1727 | Ga0068852_100025312 | |||
| 1728 | Ga0068852_100214846 | |||
| 1729 | Ga0068852_100217237 | |||
| 1730 | Ga0068852_100221503 | |||
| 1731 | Ga0068852_100260265 | |||
| 1732 | Ga0068852_100947732 | |||
| 1733 | Ga0068852_101078970 | |||
| 1734 | Ga0068852_101547430 | |||
| 1735 | Ga0068852_102020113 | |||
| 1736 | Ga0068859_100166319 | |||
| 1737 | Ga0068859_100617641 | |||
| 1738 | Ga0068859_101094095 | |||
| 1739 | Ga0068859_102786939 | |||
| 1740 | Ga0068864_100020683 | |||
| 1741 | Ga0068864_100028571 | |||
| 1742 | Ga0068864_100045025 | |||
| 1743 | Ga0068864_100066554 | |||
| 1744 | Ga0068864_100113586 | |||
| 1745 | Ga0068864_100188680 | |||
| 1746 | Ga0068864_100351616 | |||
| 1747 | Ga0068864_100378150 | |||
| 1748 | Ga0068864_100679397 | |||
| 1749 | Ga0068864_101506658 | |||
| 1750 | Ga0068866_10029696 | |||
| 1751 | Ga0068866_10060240 | |||
| 1752 | Ga0068866_10083662 | |||
| 1753 | Ga0068866_10134098 | |||
| 1754 | Ga0068861_100002334 | |||
| 1755 | Ga0068861_100007942 | |||
| 1756 | Ga0068861_100042320 | |||
| 1757 | Ga0068861_100273857 | |||
| 1758 | Ga0068861_101213756 | |||
| 1759 | Ga0068861_101679098 | |||
| 1760 | Ga0068861_102670825 | |||
| 1761 | Ga0068851_10010578 | |||
| 1762 | Ga0068851_10053755 | |||
| 1763 | Ga0068851_10126112 | |||
| 1764 | Ga0068851_10221816 | |||
| 1765 | Ga0068851_10379856 | |||
| 1766 | Ga0068851_10508047 | |||
| 1767 | Ga0068851_11080222 | |||
| 1768 | Ga0068870_10349316 | |||
| 1769 | Ga0068870_10691859 | |||
| 1770 | Ga0068870_10979031 | |||
| 1771 | Ga0068870_11021070 | |||
| 1772 | Ga0068863_100029644 | |||
| 1773 | Ga0068863_100052427 | |||
| 1774 | Ga0068863_100056820 | |||
| 1775 | Ga0068863_100097913 | |||
| 1776 | Ga0068863_100128349 | |||
| 1777 | Ga0068863_100209124 | |||
| 1778 | Ga0068863_100297393 | |||
| 1779 | Ga0068863_100305432 | |||
| 1780 | Ga0068863_100326831 | |||
| 1781 | Ga0068858_100001369 | |||
| 1782 | Ga0068858_100012867 | |||
| 1783 | Ga0068858_100014492 | |||
| 1784 | Ga0068858_100019550 | |||
| 1785 | Ga0068858_100586552 | |||
| 1786 | Ga0068858_100593919 | |||
| 1787 | Ga0068858_100681293 | |||
| 1788 | Ga0068860_100002243 | |||
| 1789 | Ga0068860_100011668 | |||
| 1790 | Ga0068860_100058883 | |||
| 1791 | Ga0068860_100065639 | |||
| 1792 | Ga0068860_101082211 | |||
| 1793 | Ga0068860_102398962 | |||
| 1794 | Ga0068862_100003264 | |||
| 1795 | Ga0068862_100006660 | |||
| 1796 | Ga0068862_100201826 | |||
| 1797 | Ga0068862_100289662 | |||
| 1798 | Ga0068862_100642219 | |||
| 1799 | Ga0068862_102653626 | |||
| 1800 | Ga0075365_10071131 | |||
| 1801 | Ga0075368_10027258 | |||
| 1802 | Ga0075368_10044569 | |||
| 1803 | Ga0075368_10132483 | |||
| 1804 | Ga0075368_10469290 | |||
| 1805 | Ga0075363_100017431 | |||
| 1806 | Ga0075363_100691326 | |||
| 1807 | Ga0070716_100377044 | |||
| 1808 | Ga0075362_10015137 | |||
| 1809 | Ga0075362_10024416 | |||
| 1810 | Ga0075362_10118069 | |||
| 1811 | Ga0075362_10120485 | |||
| 1812 | Ga0075362_10262805 | |||
| 1813 | Ga0075367_10002153 | |||
| 1814 | Ga0075367_10106569 | |||
| 1815 | Ga0075367_10540917 | |||
| 1816 | Ga0075369_10158584 | |||
| 1817 | Ga0075369_10237193 | |||
| 1818 | Ga0075369_10541228 | |||
| 1819 | Ga0075366_10000953 | |||
| 1820 | Ga0075366_10011821 | |||
| 1821 | Ga0075366_10012199 | |||
| 1822 | Ga0075366_10016893 | |||
| 1823 | Ga0075366_10032816 | |||
| 1824 | Ga0075366_10035903 | |||
| 1825 | Ga0075366_10036799 | |||
| 1826 | Ga0075366_10038857 | |||
| 1827 | Ga0075366_10053567 | |||
| 1828 | Ga0075366_10057998 | |||
| 1829 | Ga0075366_10084998 | |||
| 1830 | Ga0075366_10109724 | |||
| 1831 | Ga0075366_10130981 | |||
| 1832 | Ga0075366_10140401 | |||
| 1833 | Ga0075366_10177719 | |||
| 1834 | Ga0075366_10216436 | |||
| 1835 | Ga0075366_10218687 | |||
| 1836 | Ga0075366_10240109 | |||
| 1837 | Ga0075366_10343606 | |||
| 1838 | Ga0075366_10718359 | |||
| 1839 | Ga0075366_10733945 | |||
| 1840 | Ga0097621_100025627 | |||
| 1841 | Ga0097621_100035295 | |||
| 1842 | Ga0097621_100215455 | |||
| 1843 | Ga0097621_100474969 | |||
| 1844 | Ga0097621_100513842 | |||
| 1845 | Ga0097621_100852260 | |||
| 1846 | Ga0097621_101454911 | |||
| 1847 | Ga0075370_10000895 | |||
| 1848 | Ga0075370_10010826 | |||
| 1849 | Ga0075370_10011595 | |||
| 1850 | Ga0075370_10026609 | |||
| 1851 | Ga0075370_10038797 | |||
| 1852 | Ga0075370_10049848 | |||
| 1853 | Ga0075370_10072515 | |||
| 1854 | Ga0075370_10094627 | |||
| 1855 | Ga0075370_10096140 | |||
| 1856 | Ga0075370_10218808 | |||
| 1857 | Ga0075370_10409958 | |||
| 1858 | Ga0075370_10433789 | |||
| 1859 | Ga0075370_10527534 | |||
| 1860 | Ga0075370_10643318 | |||
| 1861 | Ga0075370_10654221 | |||
| 1862 | Ga0068871_100004241 | |||
| 1863 | Ga0068871_100094517 | |||
| 1864 | Ga0068871_100195365 | |||
| 1865 | Ga0068871_100614112 | |||
| 1866 | Ga0068871_101606850 | |||
| 1867 | Ga0068871_101863082 | |||
| 1868 | Ga0068871_102233905 | |||
| 1869 | Ga0075430_100025745 | |||
| 1870 | Ga0075433_10658183 | |||
| 1871 | Ga0075429_100034324 | |||
| 1872 | Ga0075429_101789318 | |||
| 1873 | Ga0068865_100036691 | |||
| 1874 | Ga0068865_100125124 | |||
| 1875 | Ga0068865_100139010 | |||
| 1876 | Ga0068865_100188351 | |||
| 1877 | Ga0068865_100532660 | |||
| 1878 | Ga0068865_100625864 | |||
| 1879 | Ga0068865_100714478 | |||
| 1880 | Ga0068865_101013388 | |||
| 1881 | Ga0097620_100166332 | |||
| 1882 | Ga0097620_100617651 | |||
| 1883 | Ga0097620_100709335 | |||
| 1884 | Ga0097620_101094136 | |||
| 1885 | Ga0097620_102786881 | |||
| 1886 | Ga0099823_1000164 | |||
| 1887 | Ga0075435_100757518 | |||
| 1888 | Ga0105251_10594277 | |||
| 1889 | Ga0105240_10020928 | |||
| 1890 | Ga0105240_10091540 | |||
| 1891 | Ga0105240_10192337 | |||
| 1892 | Ga0105240_10514691 | |||
| 1893 | Ga0105240_11916636 | |||
| 1894 | Ga0105240_11999306 | |||
| 1895 | Ga0111539_11587541 | |||
| 1896 | Ga0105245_10004781 | |||
| 1897 | Ga0105245_10447177 | |||
| 1898 | Ga0105245_10848886 | |||
| 1899 | Ga0114129_10457333 | |||
| 1900 | Ga0114129_10582865 | |||
| 1901 | Ga0105243_10001238 | |||
| 1902 | Ga0105243_10070292 | |||
| 1903 | Ga0105243_10185578 | |||
| 1904 | Ga0105243_10282955 | |||
| 1905 | Ga0105243_10448998 | |||
| 1906 | Ga0105243_10691013 | |||
| 1907 | Ga0105241_10619696 | |||
| 1908 | Ga0105241_10740028 | |||
| 1909 | Ga0105241_10920631 | |||
| 1910 | Ga0105242_10078680 | |||
| 1911 | Ga0105242_10261291 | |||
| 1912 | Ga0105242_13280570 | |||
| 1913 | Ga0105248_10025146 | |||
| 1914 | Ga0105248_10115604 | |||
| 1915 | Ga0105248_10126227 | |||
| 1916 | Ga0105248_10560532 | |||
| 1917 | Ga0105237_10010119 | |||
| 1918 | Ga0105238_10020844 | |||
| 1919 | Ga0105238_10261763 | |||
| 1920 | Ga0105238_10609897 | |||
| 1921 | Ga0105238_10711555 | |||
| 1922 | Ga0105238_10960111 | |||
| 1923 | Ga0105249_10015679 | |||
| 1924 | Ga0105249_10022012 | |||
| 1925 | Ga0105249_10027380 | |||
| 1926 | Ga0105239_10000914 | |||
| 1927 | Ga0105239_10253069 | |||
| 1928 | Ga0105239_11107013 | |||
| 1929 | Ga0105239_11416417 | |||
| 1930 | Ga0105239_13094518 | |||
| 1931 | Ga0105246_11304357 | |||
| 1932 | Ga0105246_11406569 | |||
| 1933 | Ga0157340_1013755 | |||
| 1934 | Ga0157325_1018032 | |||
| 1935 | Ga0157319_1000009 | |||
| 1936 | Ga0157315_1006689 | |||
| 1937 | Ga0157327_1050875 | |||
| 1938 | Ga0157373_10178978 | |||
| 1939 | Ga0157373_10547074 | |||
| 1940 | Ga0157373_11048390 | |||
| 1941 | Ga0157371_10273729 | |||
| 1942 | Ga0157371_10393527 | |||
| 1943 | Ga0157370_10300284 | |||
| 1944 | Ga0157370_10603805 | |||
| 1945 | Ga0157370_10896628 | |||
| 1946 | Ga0157369_10038041 | |||
| 1947 | Ga0157369_10720988 | |||
| 1948 | Ga0157369_11860210 | |||
| 1949 | Ga0157374_10031516 | |||
| 1950 | Ga0157374_10071656 | |||
| 1951 | Ga0157374_10091743 | |||
| 1952 | Ga0157374_10109095 | |||
| 1953 | Ga0157374_10347798 | |||
| 1954 | Ga0157378_10013493 | |||
| 1955 | Ga0157378_10024860 | |||
| 1956 | Ga0157378_10083591 | |||
| 1957 | Ga0157378_10206658 | |||
| 1958 | Ga0157378_10234741 | |||
| 1959 | Ga0157378_10565633 | |||
| 1960 | Ga0157378_12004026 | |||
| 1961 | Ga0163162_10036220 | |||
| 1962 | Ga0163162_10050457 | |||
| 1963 | Ga0163162_10133273 | |||
| 1964 | Ga0163162_10531748 | |||
| 1965 | Ga0163162_10603819 | |||
| 1966 | Ga0163162_10628255 | |||
| 1967 | Ga0163162_10632997 | |||
| 1968 | Ga0163162_10941602 | |||
| 1969 | Ga0163162_11862038 | |||
| 1970 | Ga0157372_10219116 | |||
| 1971 | Ga0157372_10424816 | |||
| 1972 | Ga0157372_10822618 | |||
| 1973 | Ga0157372_12403121 | |||
| 1974 | Ga0157375_10006998 | |||
| 1975 | Ga0157375_10012615 | |||
| 1976 | Ga0157375_10014610 | |||
| 1977 | Ga0157375_10017183 | |||
| 1978 | Ga0157375_10097705 | |||
| 1979 | Ga0157375_10132410 | |||
| 1980 | Ga0157375_10204193 | |||
| 1981 | Ga0157375_10751085 | |||
| 1982 | Ga0157375_11566463 | |||
| 1983 | Ga0157375_11827134 | |||
| 1984 | Ga0157375_12140135 | |||
| 1985 | Ga0163163_10000864 | |||
| 1986 | Ga0163163_11053786 | |||
| 1987 | Ga0157380_10057760 | |||
| 1988 | Ga0157380_10172521 | |||
| 1989 | Ga0157380_10202828 | |||
| 1990 | Ga0157380_10696184 | |||
| 1991 | Ga0157380_11033392 | |||
| 1992 | Ga0157380_11358176 | |||
| 1993 | Ga0157377_10000014 | |||
| 1994 | Ga0157377_10002696 | |||
| 1995 | Ga0157377_10709345 | |||
| 1996 | Ga0157377_10808312 | |||
| 1997 | Ga0157379_10004431 | |||
| 1998 | Ga0157379_10028700 | |||
| 1999 | Ga0157379_10031149 | |||
| 2000 | Ga0157379_10053888 | |||
| 2001 | Ga0157379_10077404 | |||
| 2002 | Ga0157379_10212028 | |||
| 2003 | Ga0157379_10341460 | |||
| 2004 | Ga0157379_10412328 | |||
| 2005 | Ga0157379_10562367 | |||
| 2006 | Ga0157376_10024497 | |||
| 2007 | Ga0157376_10135295 | |||
| 2008 | Ga0157376_10144432 | |||
| 2009 | Ga0157376_10238764 | |||
| 2010 | Ga0157376_10246313 | |||
| 2011 | Ga0157376_10541042 | |||
| 2012 | Ga0157376_10555117 | |||
| 2013 | Ga0157376_10589480 | |||
| 2014 | Ga0157376_12906528 | |||
| 2015 | Ga0182006_1211916 | |||
| 2016 | Ga0182007_10266367 | |||
| 2017 | Ga0182005_1091227 | |||
| 2018 | Ga0163161_10012297 | |||
| 2019 | Ga0163161_10019156 | |||
| 2020 | Ga0163161_10040590 | |||
| 2021 | Ga0163161_10123509 | |||
| 2022 | Ga0163161_10181451 | |||
| 2023 | Ga0163161_10268707 | |||
| 2024 | Ga0206353_10514887 | |||
| 2025 | Ga0213872_10002349 | |||
| 2026 | Ga0213872_10043062 | |||
| 2027 | Ga0213872_10251285 | |||
| 2028 | Ga0209258_120493 | |||
| 2029 | Ga0207425_1000511 | |||
| 2030 | Ga0209129_1002180 | |||
| 2031 | Ga0209129_1026616 | |||
| 2032 | Ga0207666_1048305 | |||
| 2033 | Ga0209673_1009744 | |||
| 2034 | Ga0209673_1012171 | |||
| 2035 | Ga0209673_1029638 | |||
| 2036 | Ga0209564_1000003 | |||
| 2037 | Ga0209564_1000196 | |||
| 2038 | Ga0209758_1000181 | |||
| 2039 | Ga0209758_1000207 | |||
| 2040 | Ga0209050_1000858 | |||
| 2041 | Ga0209050_1001266 | |||
| 2042 | Ga0209050_1006370 | |||
| 2043 | Ga0209256_1031332 | |||
| 2044 | Ga0209256_1074696 | |||
| 2045 | Ga0209051_1002697 | |||
| 2046 | Ga0209051_1012833 | |||
| 2047 | Ga0209051_1043460 | |||
| 2048 | Ga0209257_1000021 | |||
| 2049 | Ga0209257_1005175 | |||
| 2050 | Ga0209257_1015510 | |||
| 2051 | Ga0209257_1042771 | |||
| 2052 | Ga0209257_1153677 | |||
| 2053 | Ga0207697_10110727 | |||
| 2054 | Ga0207656_10014661 | |||
| 2055 | Ga0207656_10082290 | |||
| 2056 | Ga0207656_10127880 | |||
| 2057 | Ga0207656_10147672 | |||
| 2058 | Ga0207656_10245505 | |||
| 2059 | Ga0207656_10311423 | |||
| 2060 | Ga0207682_10027282 | |||
| 2061 | Ga0207682_10043554 | |||
| 2062 | Ga0207642_10002666 | |||
| 2063 | Ga0207642_10012484 | |||
| 2064 | Ga0207642_10052446 | |||
| 2065 | Ga0207710_10156056 | |||
| 2066 | Ga0207688_10034955 | |||
| 2067 | Ga0207680_10005278 | |||
| 2068 | Ga0207680_10041270 | |||
| 2069 | Ga0207680_10185664 | |||
| 2070 | Ga0207680_10586460 | |||
| 2071 | Ga0207685_10302143 | |||
| 2072 | Ga0207645_10001190 | |||
| 2073 | Ga0207645_10029270 | |||
| 2074 | Ga0207645_10079243 | |||
| 2075 | Ga0207645_10140960 | |||
| 2076 | Ga0207645_10182418 | |||
| 2077 | Ga0207645_10192193 | |||
| 2078 | Ga0207643_10318077 | |||
| 2079 | Ga0207643_10832915 | |||
| 2080 | Ga0207643_10996285 | |||
| 2081 | Ga0207705_10024072 | |||
| 2082 | Ga0207705_10039570 | |||
| 2083 | Ga0207705_10431687 | |||
| 2084 | Ga0207705_10956916 | |||
| 2085 | Ga0207684_10015609 | |||
| 2086 | Ga0207684_10544836 | |||
| 2087 | Ga0207654_10451245 | |||
| 2088 | Ga0207654_10717037 | |||
| 2089 | Ga0207654_10764005 | |||
| 2090 | Ga0207707_10292186 | |||
| 2091 | Ga0207707_10324237 | |||
| 2092 | Ga0207695_10016280 | |||
| 2093 | Ga0207695_10519502 | |||
| 2094 | Ga0207695_10637486 | |||
| 2095 | Ga0207671_10006390 | |||
| 2096 | Ga0207660_10101515 | |||
| 2097 | Ga0207662_10061901 | |||
| 2098 | Ga0207657_10024402 | |||
| 2099 | Ga0207657_10145653 | |||
| 2100 | Ga0207657_10675112 | |||
| 2101 | Ga0207649_10001484 | |||
| 2102 | Ga0207649_10009940 | |||
| 2103 | Ga0207649_10409486 | |||
| 2104 | Ga0207649_10737510 | |||
| 2105 | Ga0207649_11134876 | |||
| 2106 | Ga0207652_10077074 | |||
| 2107 | Ga0207646_10307947 | |||
| 2108 | Ga0207681_10000214 | |||
| 2109 | Ga0207681_10099546 | |||
| 2110 | Ga0207681_10161918 | |||
| 2111 | Ga0207681_10192341 | |||
| 2112 | Ga0207681_10279077 | |||
| 2113 | Ga0207681_10439878 | |||
| 2114 | Ga0207681_10466410 | |||
| 2115 | Ga0207681_10691665 | |||
| 2116 | Ga0207694_10009034 | |||
| 2117 | Ga0207694_10207529 | |||
| 2118 | Ga0207694_10478137 | |||
| 2119 | Ga0207694_11061595 | |||
| 2120 | Ga0207650_10000937 | |||
| 2121 | Ga0207650_10002494 | |||
| 2122 | Ga0207650_10103958 | |||
| 2123 | Ga0207650_10143131 | |||
| 2124 | Ga0207650_10195655 | |||
| 2125 | Ga0207650_10273263 | |||
| 2126 | Ga0207650_10426023 | |||
| 2127 | Ga0207650_10777543 | |||
| 2128 | Ga0207650_11545158 | |||
| 2129 | Ga0207659_10004306 | |||
| 2130 | Ga0207659_10004991 | |||
| 2131 | Ga0207659_10017778 | |||
| 2132 | Ga0207659_10017801 | |||
| 2133 | Ga0207659_10055052 | |||
| 2134 | Ga0207659_10092294 | |||
| 2135 | Ga0207659_10482749 | |||
| 2136 | Ga0207659_10985527 | |||
| 2137 | Ga0207687_10280279 | |||
| 2138 | Ga0207687_10506091 | |||
| 2139 | Ga0207687_10949392 | |||
| 2140 | Ga0207687_11141610 | |||
| 2141 | Ga0207644_10010554 | |||
| 2142 | Ga0207644_10014021 | |||
| 2143 | Ga0207644_10024213 | |||
| 2144 | Ga0207644_10044789 | |||
| 2145 | Ga0207644_10057347 | |||
| 2146 | Ga0207644_10196979 | |||
| 2147 | Ga0207644_11520441 | |||
| 2148 | Ga0207644_11806127 | |||
| 2149 | Ga0207690_10002792 | |||
| 2150 | Ga0207690_10017607 | |||
| 2151 | Ga0207690_10035310 | |||
| 2152 | Ga0207690_10084537 | |||
| 2153 | Ga0207690_10240615 | |||
| 2154 | Ga0207706_10000449 | |||
| 2155 | Ga0207706_10003147 | |||
| 2156 | Ga0207706_10018191 | |||
| 2157 | Ga0207706_10033988 | |||
| 2158 | Ga0207706_10322887 | |||
| 2159 | Ga0207706_10356451 | |||
| 2160 | Ga0207706_10506314 | |||
| 2161 | Ga0207706_10507711 | |||
| 2162 | Ga0207706_11135284 | |||
| 2163 | Ga0207686_10008428 | |||
| 2164 | Ga0207686_10076296 | |||
| 2165 | Ga0207686_11064645 | |||
| 2166 | Ga0207709_10000804 | |||
| 2167 | Ga0207709_10022408 | |||
| 2168 | Ga0207709_10264068 | |||
| 2169 | Ga0207709_10300940 | |||
| 2170 | Ga0207709_10937051 | |||
| 2171 | Ga0207670_10120453 | |||
| 2172 | Ga0207670_10711682 | |||
| 2173 | Ga0207670_11767725 | |||
| 2174 | Ga0207669_10020710 | |||
| 2175 | Ga0207669_10031788 | |||
| 2176 | Ga0207669_10147654 | |||
| 2177 | Ga0207669_10158936 | |||
| 2178 | Ga0207669_10183787 | |||
| 2179 | Ga0207669_10301815 | |||
| 2180 | Ga0207669_10363569 | |||
| 2181 | Ga0207669_10458253 | |||
| 2182 | Ga0207669_10919911 | |||
| 2183 | Ga0207704_10003076 | |||
| 2184 | Ga0207704_10026016 | |||
| 2185 | Ga0207704_10133576 | |||
| 2186 | Ga0207704_10184203 | |||
| 2187 | Ga0207704_10455008 | |||
| 2188 | Ga0207704_10471995 | |||
| 2189 | Ga0207704_10504016 | |||
| 2190 | Ga0207704_10879031 | |||
| 2191 | Ga0207665_10358200 | |||
| 2192 | Ga0207665_11537807 | |||
| 2193 | Ga0207691_10001841 | |||
| 2194 | Ga0207691_10024826 | |||
| 2195 | Ga0207691_10045546 | |||
| 2196 | Ga0207691_10120992 | |||
| 2197 | Ga0207691_10202067 | |||
| 2198 | Ga0207691_10214760 | |||
| 2199 | Ga0207691_10230990 | |||
| 2200 | Ga0207691_10545743 | |||
| 2201 | Ga0207691_10593261 | |||
| 2202 | Ga0207691_10617357 | |||
| 2203 | Ga0207691_11111503 | |||
| 2204 | Ga0207711_10036125 | |||
| 2205 | Ga0207711_10040995 | |||
| 2206 | Ga0207711_10043521 | |||
| 2207 | Ga0207711_10056982 | |||
| 2208 | Ga0207711_10069942 | |||
| 2209 | Ga0207711_10077629 | |||
| 2210 | Ga0207711_10401642 | |||
| 2211 | Ga0207689_10001542 | |||
| 2212 | Ga0207689_10016843 | |||
| 2213 | Ga0207689_10099988 | |||
| 2214 | Ga0207689_10126213 | |||
| 2215 | Ga0207689_10154252 | |||
| 2216 | Ga0207689_10187388 | |||
| 2217 | Ga0207689_10276067 | |||
| 2218 | Ga0207661_10061440 | |||
| 2219 | Ga0207661_10179565 | |||
| 2220 | Ga0207661_10771878 | |||
| 2221 | Ga0207679_10000220 | |||
| 2222 | Ga0207679_10017939 | |||
| 2223 | Ga0207679_11027953 | |||
| 2224 | Ga0207667_10187364 | |||
| 2225 | Ga0207667_11371211 | |||
| 2226 | Ga0207651_10007714 | |||
| 2227 | Ga0207651_10017944 | |||
| 2228 | Ga0207651_10023971 | |||
| 2229 | Ga0207651_10026542 | |||
| 2230 | Ga0207651_10179679 | |||
| 2231 | Ga0207651_10318084 | |||
| 2232 | Ga0207651_10420766 | |||
| 2233 | Ga0207651_10616424 | |||
| 2234 | Ga0207651_11566746 | |||
| 2235 | Ga0207712_10003685 | |||
| 2236 | Ga0207712_10037266 | |||
| 2237 | Ga0207712_10485526 | |||
| 2238 | Ga0207668_10007597 | |||
| 2239 | Ga0207668_10081814 | |||
| 2240 | Ga0207668_10083356 | |||
| 2241 | Ga0207668_10130917 | |||
| 2242 | Ga0207668_10589541 | |||
| 2243 | Ga0207668_11135661 | |||
| 2244 | Ga0207640_10480671 | |||
| 2245 | Ga0207640_10570827 | |||
| 2246 | Ga0207658_10002329 | |||
| 2247 | Ga0207658_10003279 | |||
| 2248 | Ga0207658_10092681 | |||
| 2249 | Ga0207658_10297802 | |||
| 2250 | Ga0207658_10525847 | |||
| 2251 | Ga0207658_10751053 | |||
| 2252 | Ga0207658_10786591 | |||
| 2253 | Ga0207658_10902915 | |||
| 2254 | Ga0207677_10004256 | |||
| 2255 | Ga0207677_10010920 | |||
| 2256 | Ga0207677_10064331 | |||
| 2257 | Ga0207677_10305442 | |||
| 2258 | Ga0207677_10324344 | |||
| 2259 | Ga0207677_10611657 | |||
| 2260 | Ga0207677_10670329 | |||
| 2261 | Ga0207677_11399452 | |||
| 2262 | Ga0207703_10003713 | |||
| 2263 | Ga0207703_10013980 | |||
| 2264 | Ga0207703_11136695 | |||
| 2265 | Ga0207639_10023473 | |||
| 2266 | Ga0207639_10038242 | |||
| 2267 | Ga0207639_10062937 | |||
| 2268 | Ga0207639_10108330 | |||
| 2269 | Ga0207639_11079247 | |||
| 2270 | Ga0207639_11219935 | |||
| 2271 | Ga0207639_11794840 | |||
| 2272 | Ga0207678_10006005 | |||
| 2273 | Ga0207678_10268879 | |||
| 2274 | Ga0207678_10295515 | |||
| 2275 | Ga0207678_10528083 | |||
| 2276 | Ga0207708_10127265 | |||
| 2277 | Ga0207702_10012956 | |||
| 2278 | Ga0207702_10023008 | |||
| 2279 | Ga0207702_10336198 | |||
| 2280 | Ga0207702_10488907 | |||
| 2281 | Ga0207702_10880880 | |||
| 2282 | Ga0207641_10015342 | |||
| 2283 | Ga0207641_10022787 | |||
| 2284 | Ga0207641_10040936 | |||
| 2285 | Ga0207641_10050442 | |||
| 2286 | Ga0207641_10053534 | |||
| 2287 | Ga0207641_10091665 | |||
| 2288 | Ga0207641_10109554 | |||
| 2289 | Ga0207641_10275304 | |||
| 2290 | Ga0207641_10410947 | |||
| 2291 | Ga0207648_10000062 | |||
| 2292 | Ga0207648_10005680 | |||
| 2293 | Ga0207648_10016056 | |||
| 2294 | Ga0207648_10022315 | |||
| 2295 | Ga0207648_10027768 | |||
| 2296 | Ga0207648_10039524 | |||
| 2297 | Ga0207648_10046362 | |||
| 2298 | Ga0207648_10155583 | |||
| 2299 | Ga0207648_10222240 | |||
| 2300 | Ga0207648_10299880 | |||
| 2301 | Ga0207648_10376683 | |||
| 2302 | Ga0207648_10538976 | |||
| 2303 | Ga0207648_10627432 | |||
| 2304 | Ga0207676_10027995 | |||
| 2305 | Ga0207676_10040197 | |||
| 2306 | Ga0207676_10042173 | |||
| 2307 | Ga0207676_10148970 | |||
| 2308 | Ga0207676_10154293 | |||
| 2309 | Ga0207676_10174215 | |||
| 2310 | Ga0207676_10451756 | |||
| 2311 | Ga0207676_10579893 | |||
| 2312 | Ga0207676_10621491 | |||
| 2313 | Ga0207674_10008358 | |||
| 2314 | Ga0207674_10016738 | |||
| 2315 | Ga0207674_10117874 | |||
| 2316 | Ga0207674_10251500 | |||
| 2317 | Ga0207674_10579628 | |||
| 2318 | Ga0207674_10625124 | |||
| 2319 | Ga0207674_10685603 | |||
| 2320 | Ga0207675_100000214 | |||
| 2321 | Ga0207675_100014189 | |||
| 2322 | Ga0207675_100115029 | |||
| 2323 | Ga0207675_100157793 | |||
| 2324 | Ga0207675_100358683 | |||
| 2325 | Ga0207675_101058402 | |||
| 2326 | Ga0207683_10012322 | |||
| 2327 | Ga0207683_10041309 | |||
| 2328 | Ga0207683_10052458 | |||
| 2329 | Ga0207683_10111911 | |||
| 2330 | Ga0207683_10133661 | |||
| 2331 | Ga0207683_10196025 | |||
| 2332 | Ga0207683_10316180 | |||
| 2333 | Ga0207683_10465761 | |||
| 2334 | Ga0207683_10594593 | |||
| 2335 | Ga0207683_10848548 | |||
| 2336 | Ga0207698_10003539 | |||
| 2337 | Ga0207698_10005500 | |||
| 2338 | Ga0207698_10006533 | |||
| 2339 | Ga0207698_10055990 | |||
| 2340 | Ga0207698_10064769 | |||
| 2341 | Ga0207698_10265655 | |||
| 2342 | Ga0207698_10292521 | |||
| 2343 | Ga0207698_10684324 | |||
| 2344 | Ga0207698_10742882 | |||
| 2345 | Ga0207698_10743730 | |||
| 2346 | Ga0207698_10991956 | |||
| 2347 | Ga0207698_11079274 | |||
| 2348 | Ga0209389_1037396 | |||
| 2349 | Ga0209371_1023370 | |||
| 2350 | Ga0209971_1044781 | |||
| 2351 | Ga0209813_10009766 | |||
| 2352 | Ga0209974_10000044 | |||
| 2353 | Ga0268266_10129746 | |||
| 2354 | Ga0268266_10242316 | |||
| 2355 | Ga0268266_11030168 | |||
| 2356 | Ga0268266_11263554 | |||
| 2357 | Ga0268265_10009334 | |||
| 2358 | Ga0268265_10039299 | |||
| 2359 | Ga0268265_10308172 | |||
| 2360 | Ga0268265_10624783 | |||
| 2361 | Ga0268265_11008029 | |||
| 2362 | Ga0268264_10001033 | |||
| 2363 | Ga0268264_10072983 | |||
| 2364 | Ga0268264_10241607 | |||
| 2365 | Ga0268264_10263534 | |||
| 2366 | Ga0268264_10624264 | |||
| 2367 | Ga0268264_11109104 | |||
| 2368 | Ga0268264_11375056 | |||
| 2369 | Ga0307517_10000708 | |||
| 2370 | Ga0307517_10118579 | |||
| 2371 | Ga0307517_10273449 | |||
| 2372 | Ga0307517_10410674 | |||
| 2373 | Ga0307515_10000150 | |||
| 2374 | Ga0307515_10000187 | |||
| 2375 | Ga0307515_10005172 | |||
| 2376 | Ga0307515_10015579 | |||
| 2377 | Ga0307515_10032801 | |||
| 2378 | Ga0307515_10064599 | |||
| 2379 | Ga0307515_10096842 | |||
| 2380 | Ga0307515_10216175 | |||
| 2381 | Ga0307515_10259736 | |||
| 2382 | Ga0307515_10327804 | |||
| 2383 | Ga0307515_10343198 | |||
| 2384 | Ga0268256_1025964 | |||
| 2385 | Ga0307512_10109325 | |||
| 2386 | Ga0307512_10145132 | |||
| 2387 | Ga0307512_10231385 | |||
| 2388 | Ga0307513_10017100 | |||
| 2389 | Ga0307513_10115414 | |||
| 2390 | Ga0307513_10122795 | |||
| 2391 | Ga0307513_10124857 | |||
| 2392 | Ga0307509_10034015 | |||
| 2393 | Ga0307509_10039232 | |||
| 2394 | Ga0307509_10185497 | |||
| 2395 | Ga0307509_10212909 | |||
| 2396 | Ga0307408_100000010 | |||
| 2397 | Ga0307408_100018381 | |||
| 2398 | Ga0307408_100113110 | |||
| 2399 | Ga0307408_100400521 | |||
| 2400 | Ga0307408_101204470 | |||
| 2401 | Ga0307408_101441961 | |||
| 2402 | Ga0307508_10001596 | |||
| 2403 | Ga0307508_10003456 | |||
| 2404 | Ga0307508_10110633 | |||
| 2405 | Ga0307508_10294188 | |||
| 2406 | Ga0307514_10002176 | |||
| 2407 | Ga0307514_10120644 | |||
| 2408 | Ga0307514_10282290 | |||
| 2409 | Ga0307514_10286116 | |||
| 2410 | Ga0307516_10000268 | |||
| 2411 | Ga0307516_10003906 | |||
| 2412 | Ga0307516_10213559 | |||
| 2413 | Ga0307516_10294015 | |||
| 2414 | Ga0307516_10647278 | |||
| 2415 | Ga0307516_10753397 | |||
| 2416 | Ga0307405_10005746 | |||
| 2417 | Ga0307405_10274690 | |||
| 2418 | Ga0307405_10628796 | |||
| 2419 | Ga0307405_11960169 | |||
| 2420 | Ga0307413_10019225 | |||
| 2421 | Ga0307518_10370619 | |||
| 2422 | Ga0307410_10003356 | |||
| 2423 | Ga0307406_10354766 | |||
| 2424 | Ga0307407_10008822 | |||
| 2425 | Ga0307407_10153575 | |||
| 2426 | Ga0307407_11439400 | |||
| 2427 | Ga0307412_10134374 | |||
| 2428 | Ga0307412_10172020 | |||
| 2429 | Ga0307412_10415390 | |||
| 2430 | Ga0307412_10866769 | |||
| 2431 | Ga0307412_10981464 | |||
| 2432 | Ga0307409_100382829 | |||
| 2433 | Ga0307409_100529484 | |||
| 2434 | Ga0307416_100013304 | |||
| 2435 | Ga0307416_100274638 | |||
| 2436 | Ga0307416_100475036 | |||
| 2437 | Ga0307416_101647897 | |||
| 2438 | Ga0307416_101921852 | |||
| 2439 | Ga0307414_10223977 | |||
| 2440 | Ga0307414_10334425 | |||
| 2441 | Ga0307414_12201286 | |||
| 2442 | Ga0307411_10001686 | |||
| 2443 | Ga0307411_10001815 | |||
| 2444 | Ga0307411_10460262 | |||
| 2445 | Ga0307411_10743021 | |||
| 2446 | Ga0307411_11027769 | |||
| 2447 | Ga0307415_100007903 | |||
| 2448 | Ga0307415_100205875 | |||
| 2449 | Ga0307507_10023516 | |||
| 2450 | Ga0307507_10094001 | |||
| 2451 | Ga0307510_10025175 | |||
| 2452 | Ga0307510_10045192 | |||
| 2453 | Ga0307510_10051426 | |||
| 2454 | Ga0307510_10498148 | |||
| 2455 | Ga0373958_0058867 | |||
| 2456 | Ga0373959_0046453 | |||
| 2457 | Ga0373938_0031692 | |||
| 2458 | Ga0373940_0047582 | |||
| 2459 | Ga0373940_0237584 | |||
| 2460 | Ga0373944_0272924 | |||
| 2461 | Ga0373949_0028332 | |||
| 2462 | Ga0373951_0090239 | |||
| 2463 | Ga0373952_0104597 | |||
| 2464 | Ga0373923_0303749 | |||
| 2465 | Ga0373923_0516054 | |||
| 2466 | Ga0373932_0034081 | |||
| 2467 | Ga0373939_0000272 | |||
| 2468 | Ga0373954_0173704 | |||
| 2469 | Ga0373943_0070104 | |||
| 2470 | Ga0373943_0105381 | |||
| 2471 | Ga0373943_0798885 | |||
| 2472 | Ga0373946_0320684 | |||
| 2473 | Ga0373946_0599319 | |||
| 2474 | Ga0373955_0177348 | |||
| 2475 | Ga0373962_0006206 | |||
| 2476 | Ga0373962_0011842 | |||
| 2477 | Ga0373924_0106397 | |||
| 2478 | Ga0373924_0503637 | |||
| 2479 | Ga0373931_0000665 | |||
| 2480 | Ga0373931_0001429 | |||
| 2481 | Ga0373931_0370700 | |||
| 2482 | Ga0373935_0795653 | |||
| 2483 | Ga0373927_0352780 | |||
| 2484 | Ga0373927_0448564 | |||
| 2485 | Ga0373933_0182375 | |||
| 2486 | Ga0373933_0276253 | |||
| 2487 | Ga0373947_0050825 | |||
| 2488 | Ga0373947_0831150 | |||
| 2489 | Ga0373937_0065617 | |||
| 2490 | Ga0373937_0129239 | |||
| 2491 | Ga0373937_0162313 | |||
| 2492 | Ga0373925_0070801 | |||
| 2493 | Ga0373925_0080994 | |||
| 2494 | Ga0373925_0193368 | |||
| 2495 | Ga0373925_0405428 | |||
| 2496 | Ga0373925_0673822 | |||
| 2497 | Ga0395900_0000535 | |||
| 2498 | Ga0395898_0002836 | |||
| 2499 | Ga0395905_0007293 | |||
| 2500 | Ga0395905_0012706 | |||
| 2501 | Ga0395905_0053650 | |||
| 2502 | Ga0395905_0124032 | |||
| 2503 | Ga0395905_0811662 | |||
| 2504 | Ga0436364_1495413 | |||
| 2505 | Ga0436365_1267282 | |||
| 2506 | Ga0436360_0381654 | |||
| 2507 | Ga0436361_0233952 | |||
| 2508 | Ga0436361_0240417 | |||
| 2509 | Ga0436361_0996052 | |||
| 2510 | Ga0439461_0059791 | |||
| 2511 | Ga0439461_0127329 | |||
| 2512 | Ga0439465_0338149 | |||
| 2513 | Ga0451789_1178356 | |||
| 2514 | Ga0451793_0358311 | |||
| 2515 | Ga0451793_1172903 | |||
| 2516 | Ga0451793_1673427 | |||
| 2517 | Ga0451797_0278276 | |||
| 2518 | Ga0451797_1036550 | |||
| 2519 | Ga0451797_1315304 | |||
| 2520 | Ga0451795_0059148 | |||
| 2521 | Ga0451795_0139934 | |||
| 2522 | Ga0451795_0394184 | |||
| 2523 | Ga0451798_0566853 | |||
| 2524 | Ga0451798_0791769 | |||
| 2525 | Ga0451798_1166708 | |||
| 2526 | Ga0451800_0500868 | |||
| 2527 | Ga0451800_1533257 | |||
| 2528 | Ga0451802_0175899 | |||
| 2529 | Ga0451805_098782 | |||
| 2530 | Ga0451804_0031720 | |||
| 2531 | Ga0451804_0695359 | |||
| 2532 | Ga0451807_0270528 | |||
| 2533 | Ga0451807_0589163 | |||
| 2534 | Ga0451807_0592901 | |||
| 2535 | Ga0451833_1494138 | |||
| 2536 | Ga0451835_0060653 | |||
| 2537 | Ga0451839_0134199 | |||
| 2538 | Ga0451839_0843576 | |||
| 2539 | Ga0451841_0137167 | |||
| 2540 | Ga0451841_0202568 | |||
| 2541 | Ga0451845_0177849 | |||
| 2542 | Ga0451849_0038608 | |||
| 2543 | Ga0451851_0007129 | |||
| 2544 | Ga0451851_0476484 | |||
| 2545 | Ga0451843_0724857 | |||
| 2546 | Ga0451843_1037426 | |||
| 2547 | Ga0451843_1577317 | |||
| 2548 | Ga0451855_0366185 | |||
| 2549 | Ga0451853_2795309 | |||
| 2550 | Ga0451853_3145576 | |||
| 2551 | Ga0451853_3325265 | |||
| 2552 | Ga0451853_3908419 | |||
| 2553 | Ga0439433_0025071 | |||
| 2554 | Ga0439437_022894 | |||
| 2555 | Ga0439445_0030673 | |||
| 2556 | Ga0439449_0117024 | |||
| 2557 | Ga0439450_001164 | |||
| 2558 | Ga0439450_073815 | |||
| 2559 | Ga0439454_110360 | |||
| 2560 | Ga0439455_0049240 | |||
| 2561 | Ga0450912_031564 | |||
| 2562 | Ga0450917_000284 | |||
| 2563 | Ga0450919_000285 | |||
| 2564 | Ga0450920_055118 | |||
| 2565 | Ga0450888_005886 | |||
| 2566 | Ga0450888_010596 | |||
| 2567 | Ga0450890_001614 | |||
| 2568 | Ga0450890_001839 | |||
| 2569 | Ga0450891_001574 | |||
| 2570 | Ga0450892_001645 | |||
| 2571 | Ga0450898_019707 | |||
| 2572 | Ga0450898_028272 | |||
| 2573 | Ga0450898_042079 | |||
| 2574 | Ga0450904_014100 | |||
| 2575 | Ga0450889_001274 | |||
| 2576 | Ga0439446_0069153 | |||
| 2577 | Ga0439458_0046384 | |||
| 2578 | Ga0439458_0105508 | |||
| 2579 | Ga0439435_0169373 | |||
| 2580 | Ga0439444_0022531 | |||
| 2581 | Ga0439464_0004537 | |||
| 2582 | Ga0439460_0071551 | |||
| 2583 | Ga0450918_000434 | |||
| 2584 | Ga0450893_0006947 | |||
| 2585 | Ga0450893_0030477 | |||
| 2586 | Ga0450893_0077745 | |||
| 2587 | Ga0451577_0001608 | |||
| 2588 | Ga0451577_0008143 | |||
| 2589 | Ga0451577_0009084 | |||
| 2590 | Ga0451577_0292353 | |||
| 2591 | Ga0451577_0379735 | |||
| 2592 | Ga0451577_1509607 | |||
| 2593 | Ga0466969_0023536 | |||
| 2594 | Ga0466969_0057161 | |||
| 2595 | Ga0466972_0004153 | |||
| 2596 | Ga0466972_0013057 | |||
| 2597 | Ga0466972_0039081 | |||
| 2598 | Ga0453683_0844060 | |||
| 2599 | Ga0466965_0036600 | |||
| 2600 | Ga0466965_0057540 | |||
| 2601 | Ga0466965_0153621 | |||
| 2602 | Ga0466965_0212190 | |||
| 2603 | Ga0466965_0220200 | |||
| 2604 | Ga0466966_0004224 | |||
| 2605 | Ga0466966_0041477 | |||
| 2606 | Ga0466966_0050824 | |||
| 2607 | Ga0466961_0032915 | |||
| 2608 | Ga0466961_0045694 | |||
| 2609 | Ga0466961_0240990 | |||
| 2610 | Ga0466963_0037909 | |||
| 2611 | Ga0466964_0012532 | |||
| 2612 | Ga0466964_0060667 | |||
| 2613 | Ga0453684_0007620 | |||
| 2614 | Ga0453684_0041964 | |||
| 2615 | Ga0453684_0118560 | |||
| 2616 | Ga0453684_0242660 | |||
| 2617 | Ga0453684_0296619 | |||
| 2618 | Ga0453684_2447925 | |||
| 2619 | Ga0466968_0086394 | |||
| 2620 | Ga0466970_0026135 | |||
| 2621 | Ga0466970_0301278 | |||
| 2622 | Ga0466957_0096817 | |||
| 2623 | Ga0466960_0005145 | |||
| 2624 | Ga0466960_0205627 | |||
| 2625 | Ga0466959_0000793 | |||
| 2626 | Ga0466959_0058453 | |||
| 2627 | Ga0451576_0004508 | |||
| 2628 | Ga0451576_0014073 | |||
| 2629 | Ga0451576_0040276 | |||
| 2630 | Ga0451576_0067461 | |||
| 2631 | Ga0451576_0094271 | |||
| 2632 | Ga0451576_0179084 | |||
| 2633 | Ga0451576_0226207 | |||
| 2634 | Ga0451576_0357938 | |||
| 2635 | Ga0466958_0138502 | |||
| 2636 | Ga0495592_0000295 | |||
| 2637 | Ga0495592_0570222 | |||
| 2638 | Ga0495603_0294798 | |||
| 2639 | Ga0495590_0088566 | |||
| 2640 | Ga0495591_101977 | |||
| 2641 | Ga0495629_0183779 | |||
| 2642 | Ga0495629_0913725 | |||
| 2643 | Ga0495638_0463109 | |||
| 2644 | Ga0495582_0516988 | |||
| 2645 | Ga0495639_0317507 | |||
| 2646 | Ga0495664_0351137 | |||
| 2647 | Ga0495583_0089971 | |||
| 2648 | Ga0495606_0308558 | |||
| 2649 | Ga0495608_0220549 | |||
| 2650 | Ga0495610_0005844 | |||
| 2651 | Ga0495620_0083960 | |||
| 2652 | Ga0495628_0935336 | |||
| 2653 | Ga0495630_1026686 | |||
| 2654 | Ga0495631_0066241 | |||
| 2655 | Ga0495632_0010763 | |||
| 2656 | Ga0495632_0020823 | |||
| 2657 | Ga0495632_0284097 | |||
| 2658 | Ga0495643_0158986 | |||
| 2659 | Ga0495648_0163679 | |||
| 2660 | Ga0495648_0195975 | |||
| 2661 | Ga0495648_0455521 | |||
| 2662 | Ga0495666_0091251 | |||
| 2663 | Ga0495666_0482124 | |||
| 2664 | Ga0495586_0159847 | |||
| 2665 | Ga0495586_0182997 | |||
| 2666 | Ga0495609_0149509 | |||
| 2667 | Ga0495621_0292428 | |||
| 2668 | Ga0495597_0008922 | |||
| 2669 | Ga0495645_0150423 | |||
| 2670 | Ga0495667_0168248 | |||
| 2671 | Ga0495668_0148343 | |||
| 2672 | Ga0495668_0813534 | |||
| 2673 | Ga0495611_0062211 | |||
| 2674 | Ga0495625_0002174 | |||
| 2675 | Ga0495625_0004670 | |||
| 2676 | Ga0495625_0289950 | |||
| 2677 | Ga0495625_0608088 | |||
| 2678 | Ga0495635_0210694 | |||
| 2679 | Ga0495647_0113929 | |||
| 2680 | Ga0495647_0214694 | |||
| 2681 | Ga0495658_0067119 | |||
| 2682 | Ga0495658_0107084 | |||
| 2683 | Ga0495658_0109706 | |||
| 2684 | Ga0495658_0166449 | |||
| 2685 | Ga0495613_0402751 | |||
| 2686 | Ga0495613_0475467 | |||
| 2687 | Ga0495624_0025731 | |||
| 2688 | Ga0495670_0081267 | |||
| 2689 | Ga0495670_0195654 | |||
| 2690 | Ga0495671_0142081 | |||
| 2691 | Ga0495671_0248083 | |||
| 2692 | Ga0495649_0006798 | |||
| 2693 | Ga0495660_0020654 | |||
| 2694 | Ga0495581_0418620 | |||
| 2695 | Ga0495636_0280313 | |||
| 2696 | Ga0495674_0667548 | |||
| 2697 | Ga0495687_000636 | |||
| 2698 | Ga0495673_0076118 | |||
| 2699 | Ga0495684_0179919 | |||
| 2700 | Ga0495684_0941954 | |||
| 2701 | Ga0495686_0002900 | |||
| 2702 | Ga0495686_0069329 | |||
| 2703 | Ga0495602_0403157 | |||
| 2704 | Ga0495626_0133152 | |||
| 2705 | Ga0496101_0221248 | |||
| 2706 | Ga0496101_0573894 | |||
| 2707 | Ga0496101_0997218 | |||
| 2708 | Ga0496101_1062950 | |||
| 2709 | Ga0496102_0027533 | |||
| 2710 | Ga0496102_0652466 | |||
| 2711 | Ga0496104_0214747 | |||
| 2712 | Ga0496104_0308141 | |||
| 2713 | Ga0496105_0026211 | |||
| 2714 | Ga0496105_0231209 | |||
| 2715 | Ga0496105_0302639 | |||
| 2716 | Ga0496105_1066228 | |||
| 2717 | Ga0496106_0010515 | |||
| 2718 | Ga0496106_0125219 | |||
| 2719 | Ga0496107_0007401 | |||
| 2720 | Ga0496107_0373843 | |||
| 2721 | Ga0496108_0028747 | |||
| 2722 | Ga0496108_0216381 | |||
| 2723 | Ga0496108_0332358 | |||
| 2724 | Ga0496108_0378982 | |||
| 2725 | Ga0496108_1201518 | |||
| 2726 | Ga0496109_0304524 | |||
| 2727 | Ga0496109_1588787 | |||
| 2728 | Ga0496110_0031571 | |||
| 2729 | Ga0496110_0297248 | |||
| 2730 | Ga0496110_0938505 | |||
| 2731 | Ga0496111_0640031 | |||
| 2732 | Ga0496111_0913893 | |||
| 2733 | Ga0496112_0263917 | |||
| 2734 | Ga0496113_0272336 | |||
| 2735 | Ga0496113_0350661 | |||
| 2736 | Ga0496114_0263997 | |||
| 2737 | Ga0496114_0272685 | |||
| 2738 | Ga0496114_0957620 | |||
| 2739 | Ga0496114_1025311 | |||
| 2740 | Ga0496115_0200731 | |||
| 2741 | Ga0496121_0018192 | |||
| 2742 | Ga0496123_0302375 | |||
| 2743 | Ga0496124_0071074 | |||
| 2744 | Ga0496125_0006880 | |||
| 2745 | Ga0496125_0137600 | |||
| 2746 | Ga0496125_0361294 | |||
| 2747 | Ga0496126_0100589 | |||
| 2748 | Ga0496126_0200834 | |||
| 2749 | Ga0501309_016098 | |||
| 2750 | Ga0501310_002487 | |||
| 2751 | Ga0501305_009668 | |||
| 2752 | Ga0501292_009653 | |||
| 2753 | Ga0501293_015501 | |||
| 2754 | Ga0501294_005995 | |||
| 2755 | Ga0501295_102340 | |||
| 2756 | Ga0501298_016579 | |||
| 2757 | Ga0501301_011540 | |||
| 2758 | Ga0501303_007065 | |||
| 2759 | Ga0501312_032643 | |||
| 2760 | Ga0501312_078798 | |||
| 2761 | Ga0501313_011837 | |||
| 2762 | Ga0501043_0000075 | |||
| 2763 | Ga0501046_0000195 | |||
| 2764 | Ga0501047_0000145 | |||
| 2765 | Ga0501048_0000999 | |||
| 2766 | Ga0501070_1001267 | |||
| 2767 | Ga0501198_000015 | |||
| 2768 | Ga0501206_010361 | |||
| 2769 | Ga0501207_019830 | |||
| 2770 | Ga0501211_005166 | |||
| 2771 | Ga0501217_146762 | |||
| 2772 | Ga0501222_000040 | |||
| 2773 | Ga0501222_004797 | |||
| 2774 | Ga0501222_059558 | |||
| 2775 | Ga0501223_018194 | |||
| 2776 | Ga0501233_123583 | |||
| 2777 | Ga0501235_018965 | |||
| 2778 | Ga0501249_009208 | |||
| 2779 | Ga0501257_190349 | |||
| 2780 | Ga0501261_048038 | |||
| 2781 | Ga0501229_000012 | |||
| 2782 | Ga0501245_035141 | |||
| 2783 | Ga0501079_0520663 | |||
| 2784 | Ga0501232_059792 | |||
| 2785 | Ga0501262_019485 | |||
| 2786 | Ga0501262_091132 | |||
| 2787 | Ga0501263_091079 | |||
| 2788 | Ga0501265_004388 | |||
| 2789 | Ga0501269_048975 | |||
| 2790 | Ga0501272_001140 | |||
| 2791 | Ga0501274_027674 | |||
| 2792 | Ga0501276_031686 | |||
| 2793 | Ga0501280_042545 | |||
| 2794 | Ga0501035_0067274 | |||
| 2795 | Ga0501045_0010507 | |||
| 2796 | Ga0501226_017971 | |||
| 2797 | nmdc:mga03683_118420_c1 | |||
| 2798 | nmdc:mga03683_12560_c1 | |||
| 2799 | nmdc:mga03683_18823_c1 | |||
| 2800 | nmdc:mga03683_49338_c1 | |||
| 2801 | nmdc:mga00v17_102345_c1 | |||
| 2802 | nmdc:mga0k408_112983_c1 | |||
| 2803 | nmdc:mga0k408_115773_c1 | |||
| 2804 | nmdc:mga0k408_148_c1 | |||
| 2805 | nmdc:mga0k408_157915_c1 | |||
| 2806 | nmdc:mga0k408_187083_c1 | |||
| 2807 | nmdc:mga0k408_199009_c1 | |||
| 2808 | nmdc:mga0k408_204526_c1 | |||
| 2809 | nmdc:mga0k408_20746_c1 | |||
| 2810 | nmdc:mga0k408_209336_c1 | |||
| 2811 | nmdc:mga0k408_228472_c1 | |||
| 2812 | nmdc:mga0k408_2372_c1 | |||
| 2813 | nmdc:mga0k408_2509_c1 | |||
| 2814 | nmdc:mga0k408_26933_c1 | |||
| 2815 | nmdc:mga0k408_283907_c1 | |||
| 2816 | nmdc:mga0k408_29340_c1 | |||
| 2817 | nmdc:mga0k408_37851_c1 | |||
| 2818 | nmdc:mga0k408_39980_c1 | |||
| 2819 | nmdc:mga0k408_422366_c1 | |||
| 2820 | nmdc:mga0k408_48557_c1 | |||
| 2821 | nmdc:mga0k408_565085_c1 | |||
| 2822 | nmdc:mga0k408_631204_c1 | |||
| 2823 | nmdc:mga0k408_69397_c1 | |||
| 2824 | nmdc:mga0k408_7192_c1 | |||
| 2825 | nmdc:mga0k408_816325_c1 | |||
| 2826 | nmdc:mga0k408_9250_c1 | |||
| 2827 | nmdc:mga06z11_250734_c1 | |||
| 2828 | nmdc:mga06z11_27747_c1 | |||
| 2829 | nmdc:mga06z11_36995_c1 | |||
| 2830 | nmdc:mga04h51_11416_c1 | |||
| 2831 | nmdc:mga04h51_143940_c1 | |||
| 2832 | nmdc:mga07m45_141279_c1 | |||
| 2833 | nmdc:mga07m45_1748_c1 | |||
| 2834 | nmdc:mga07m45_17681_c1 | |||
| 2835 | nmdc:mga07m45_195687_c1 | |||
| 2836 | nmdc:mga07m45_207593_c1 | |||
| 2837 | nmdc:mga07m45_219380_c1 | |||
| 2838 | nmdc:mga07m45_26285_c1 | |||
| 2839 | nmdc:mga07m45_454377_c1 | |||
| 2840 | nmdc:mga07m45_507282_c1 | |||
| 2841 | nmdc:mga07m45_5236_c1 | |||
| 2842 | nmdc:mga07m45_569_c1 | |||
| 2843 | nmdc:mga07m45_587096_c1 | |||
| 2844 | nmdc:mga07m45_637902_c1 | |||
| 2845 | nmdc:mga07m45_651412_c1 | |||
| 2846 | nmdc:mga07m45_9266_c1 | |||
| 2847 | nmdc:mga05p37_1042262_c1 | |||
| 2848 | nmdc:mga09592_2500_c1 | |||
| 2849 | nmdc:mga0qj67_687499_c1 | |||
| 2850 | nmdc:mga0rr50_598170_c1 | |||
| 2851 | nmdc:mga0sz30_223290_c1 | |||
| 2852 | nmdc:mga0sz30_485404_c1 | |||
| 2853 | nmdc:mga0sz30_93180_c1 | |||
| 2854 | Ga0495601_0239039 | |||
| 2855 | Ga0495612_0109920 | |||
| 2856 | Ga0495612_0111159 | |||
| 2857 | Ga0500635_0089445 | |||
| 2858 | Ga0495595_0045883 | |||
| 2859 | Ga0495619_0263687 | |||
| 2860 | Ga0495619_1013021 | |||
| 2861 | Ga0500578_0000224 | |||
| 2862 | Ga0500578_0050616 | |||
| 2863 | Ga0500578_0299536 | |||
| 2864 | Ga0500643_034161 | |||
| 2865 | Ga0500644_0010134 | |||
| 2866 | Ga0500644_0120932 | |||
| 2867 | Ga0500646_0004682 | |||
| 2868 | Ga0500646_0164139 | |||
| 2869 | Ga0500583_0036759 | |||
| 2870 | Ga0500583_0149970 | |||
| 2871 | Ga0500651_0017559 | |||
| 2872 | Ga0500651_0135489 | |||
| 2873 | Ga0500651_0269812 | |||
| 2874 | Ga0500650_0082359 | |||
| 2875 | Ga0500650_0114126 | |||
| 2876 | Ga0500562_126507 | |||
| 2877 | Ga0500569_053929 | |||
| 2878 | Ga0500593_000250 | |||
| 2879 | Ga0500594_0016209 | |||
| 2880 | Ga0500614_013639 | |||
| 2881 | Ga0500628_002390 | |||
| 2882 | Ga0500642_0007522 | |||
| 2883 | Ga0500652_001099 | |||
| 2884 | Ga0500652_033825 | |||
| 2885 | Ga0500655_002874 | |||
| 2886 | Ga0500655_042869 | |||
| 2887 | Ga0500658_0007909 | |||
| 2888 | Ga0500658_0187077 | |||
| 2889 | Ga0500559_0000011 | |||
| 2890 | Ga0500559_0126453 | |||
| 2891 | Ga0500564_106111 | |||
| 2892 | Ga0500568_0050224 | |||
| 2893 | Ga0500577_0015015 | |||
| 2894 | Ga0500577_0365620 | |||
| 2895 | Ga0500577_0397043 | |||
| 2896 | Ga0500579_189477 | |||
| 2897 | Ga0500589_123070 | |||
| 2898 | Ga0500619_000143 | |||
| 2899 | Ga0500619_012224 | |||
| 2900 | Ga0500622_0001541 | |||
| 2901 | Ga0500622_0001880 | |||
| 2902 | Ga0500622_0009235 | |||
| 2903 | Ga0500627_0322206 | |||
| 2904 | Ga0500636_0083939 | |||
| 2905 | Ga0500637_0462678 | |||
| 2906 | Ga0500570_080325 | |||
| 2907 | Ga0500570_083568 | |||
| 2908 | Ga0500645_014572 | |||
| 2909 | Ga0500645_096771 | |||
| 2910 | Ga0500587_000945 | |||
| 2911 | Ga0500587_005067 | |||
| 2912 | Ga0500661_106554 | |||
| 2913 | 2644305083 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1b8z-assembly1.cif.gz_B | hu from thermotoga maritima | 0.9392 | 38 | 126 |
| 1riy-assembly1.cif.gz_A-2 | hu mutant v42i from thermotoga maritima | 0.9177 | 38 | 126 |
| 1b8z-assembly1.cif.gz_B | hu from thermotoga maritima | 0.9132 | 38 | 126 |
| 4p3v-assembly1.cif.gz_A-2 | crystal structure of the e. coli hu beta2 protein | 0.9115 | 38 | 126 |
| 1huu-assembly2.cif.gz_B | dna-binding protein hu from bacillus stearothermophilus | 0.9047 | 38 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D6K7_133_320_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9276 | 40 | 62 | 3.30.420.10 |
| af_A0A1D8PLR7_520_680_3.40.50.80 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module | 0.8951 | 40 | 68 | 3.40.50.80 |
| 4dkyA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.8843 | 38 | 133 | 4.10.520.10 |
| 5fbmA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.8736 | 38 | 127 | 4.10.520.10 |
| 4yexA00 | Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins | 0.8694 | 38 | 126 | 4.10.520.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5D9CQ11-F1-model_v4 | HU family DNA-binding protein | 0.952 | 64 | 128 |
GO:0003677
GO:0030261 GO:0030527 |
| AF-A0A3M1RL10-F1-model_v4 | Integration host factor subunit alpha | 0.9456 | 38 | 127 |
GO:0003677
GO:0005829 GO:0006310 GO:0006355 GO:0006417 GO:0030527 |
| AF-A0A6L8C2B3-F1-model_v4 | HU family DNA-binding protein | 0.9444 | 45 | 128 |
GO:0003677
GO:0005829 GO:0030527 |
| AF-A0A316LPA8-F1-model_v4 | deleted | 0.9289 | 37 | 126 |
|
| AF-A0A416MW47-F1-model_v4 | deleted | 0.9277 | 38 | 127 |
|