F494096

General Info

Members Datasets Scaffolds Average Seq Length
1457 550 1377 333

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0040069|Ga0395899_0040069_2157_3350
Length 397
Sequence MLMDHGRFLCQACIIARDPAIVMRAARGSRLWLTTLAGVPSDEDNTATNVKTVCSFTHMETYMKLKNLLFALSAAALVSGSAYAADAPIIIKFSHVVSKDTPKGKGADRFKELAEKATHGRVKVEVYPNSTLYKDKEEMEALQLGAVQMLAPSLAKFGPLGVKEFELFDLPYIFPGKDVLYRVTEGPIGKKLFQKLESKGITGLAFWDNGFKVMSANKPLHHPADFKGLKMRIQPSKVLDAQMRALGANPQTMAFSEVYQALQTGVVDGTENPPSNLYTQKMHEVQKDVTISNHGYLGYAVIVNKKFWDGLPADIRTELEGAMKEATKYANAIAQQENDKALDEVRKSGKTTVYTLTDAEKAEWKKALLPVQKQMEGRIGKDLIDAVNKESAALGYK

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
4 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
7 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
8 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
9 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
10 2643221556 Massilia sp. Root1485 Isolate Unclassified
11 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
12 2643221645 Massilia sp. Root351 Isolate Unclassified
13 2643221664 Massilia sp. Root418 Isolate Unclassified
14 2643221684 Massilia sp. Root133 Isolate Unclassified
15 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
16 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
17 2738541280 Massilia sp. GV090 Isolate Unclassified
18 2738541297 Duganella sp. GV083 Isolate Unclassified
19 2738541300 Massilia sp. GV016 Isolate Unclassified
20 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
21 2738541357 Duganella sp. GV053 Isolate Unclassified
22 2738543003 Duganella sp. GV066 Isolate Unclassified
23 2738543018 Massilia sp. GV045 Isolate Unclassified
24 2738543026 Duganella sp. GV089 Isolate Unclassified
25 2738543029 Duganella sp. GV039 Isolate Unclassified
26 2738543030 Massilia sp. GV097 Isolate Unclassified
27 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
28 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
29 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
30 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
31 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
32 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
33 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
34 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
35 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
36 2821131069 Duganella sp. 1224 Isolate Unclassified
37 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
38 2842711865 Duganella sp. R-73148 Isolate Unclassified
39 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
40 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
41 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
42 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
43 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
44 2857553236 Duganella sp. R-74557 Isolate Unclassified
45 2857558681 Duganella sp. R-74565 Isolate Unclassified
46 2857564685 Duganella sp. R-74599 Isolate Unclassified
47 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
48 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
49 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
50 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
51 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
52 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
53 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
54 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
55 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
56 2904424332 Duganella sp. 1411 Isolate Rhizosphere
57 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
58 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
59 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
60 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
61 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
62 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
63 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
64 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
65 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
66 2919476304 Duganella sp. 3397 Isolate Unclassified
67 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
68 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
69 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
70 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
71 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
72 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
73 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
74 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
75 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
76 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
77 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
78 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
79 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
80 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
81 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
82 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
83 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
84 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
85 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
86 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
87 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
88 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
89 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
90 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
91 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
92 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
93 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
94 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
95 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
96 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
97 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
98 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
99 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
100 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
101 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
102 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
103 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
104 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
105 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
106 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
107 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
108 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
109 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
110 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
113 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
114 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
115 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
116 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
117 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
118 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
119 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
120 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
121 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
122 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
123 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
124 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
125 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
126 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
127 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
128 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
129 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
130 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
131 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
132 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
133 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
134 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
135 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
136 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
137 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
138 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
139 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
140 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
141 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
142 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
143 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
144 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
145 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
146 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
147 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
148 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
149 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
150 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
151 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
152 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
153 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
154 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
155 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
156 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
159 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
160 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
161 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
162 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
163 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
164 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
165 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
166 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
167 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
168 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
169 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
170 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
171 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
172 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
173 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
174 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
175 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
176 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
177 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
178 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
179 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
180 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
181 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
182 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
183 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
184 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
185 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
186 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
187 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
188 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
189 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
190 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
191 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
192 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
193 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
194 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
195 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
196 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
197 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
198 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
199 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
200 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
201 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
202 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
203 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
204 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
205 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
206 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
207 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
208 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
209 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
210 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
211 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
212 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
213 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
214 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
215 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
216 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
217 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
218 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
219 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
220 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
221 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
222 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
223 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
224 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
225 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
226 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
227 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
228 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
229 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
230 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
237 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
239 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
240 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
241 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
243 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
244 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
248 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
249 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
252 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
254 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
318 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
324 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
325 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
326 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
327 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
328 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
329 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
330 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
331 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
332 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
333 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
334 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
335 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
336 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
337 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
338 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
339 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
340 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
341 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
342 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
343 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
344 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
345 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
346 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
347 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
348 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
349 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
351 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
352 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
353 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
354 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
355 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
356 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
357 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
358 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
359 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
360 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
361 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
362 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
363 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
364 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
365 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
366 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
367 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
368 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
369 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
370 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
371 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
372 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
373 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
374 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
375 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
376 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
377 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
378 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
379 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
380 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
381 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
382 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
383 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
384 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
385 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
386 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
387 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
388 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
389 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
390 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
391 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
392 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
393 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
394 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
395 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
396 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
397 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
398 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
399 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
400 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
401 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
402 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
403 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
404 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
405 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
406 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
407 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
408 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
409 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
410 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
411 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
412 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
413 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
414 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
415 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
416 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
417 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
418 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
419 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
420 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
421 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
422 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
423 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
424 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
425 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
426 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
427 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
428 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
429 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
430 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
431 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
432 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
433 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
434 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
435 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
436 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
437 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
438 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
439 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
440 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
441 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
442 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
443 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
444 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
445 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
446 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
447 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
448 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
449 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
450 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
451 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
452 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
453 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
454 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
455 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
456 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
457 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
458 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
459 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
460 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
461 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
462 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
463 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
464 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
465 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
466 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
467 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
468 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
469 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
470 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
471 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
472 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
473 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
474 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
475 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
476 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
477 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
478 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
479 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
480 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
481 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
482 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
483 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
484 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
485 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
486 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
487 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
488 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
489 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
490 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
491 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
492 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
493 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
494 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
497 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
498 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
502 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
503 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
512 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
513 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
514 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
515 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
516 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
517 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
518 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
519 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
520 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
521 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
522 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
523 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
524 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
525 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
526 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
527 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
528 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
529 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
530 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
531 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
532 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
533 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
534 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
535 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
536 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
537 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
538 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
539 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
540 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
541 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
542 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 641522639 Methylobacterium sp. 4-46 Isolate Nodule
546 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
547 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
548 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
549 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
550 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.82
Metatranscriptomes 0.82
Isolates 5.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 1.03
Rhizoplane 3.5
Rhizosphere 82.29
Stem 0
Stem Tuber 0
Unclassified 6.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1009898 3300001977 Bacteria 1417
2 JGI24033J26618_1007785 3300002155 Bacteria 1223
3 JGI24034J26672_10008792 3300002239 Bacteria 1480
4 JGI25155J39150_1000136 3300002704 Bacteria 34706
5 JGI25156J39149_1000156 3300002705 Bacteria 50177
6 JGI25162J39368_1002181 3300002737 Bacteria 8116
7 JGI25154J39366_1000614 3300002738 Bacteria 17075
8 JGI25154J39366_1000646 3300002738 Bacteria 16292
9 JGI25154J39366_1004141 3300002738 Bacteria 2719
10 JGI25157J39369_1000277 3300002741 Bacteria 37605
11 JGI25150J39212_1000548 3300002774 Bacteria 15195
12 JGI25150J39212_1001175 3300002774 Bacteria 7783
13 JGI25159J45721_1001473 3300002987 Bacteria 9703
14 JGI25159J45721_1003564 3300002987 Bacteria 5460
15 JGI25153J46596_10004840 3300003215 Bacteria 7175
16 JGI25161J50226_1000860 3300003374 Bacteria 11233
17 Ga0007417J51691_1022516 3300003544 Bacteria 1956
18 Ga0007417J51691_1050103 3300003544 Bacteria 1309
19 Ga0007410J51695_1032879 3300003574 Bacteria 2390
20 Ga0007416J51690_1019266 3300003577 Bacteria 1963
21 Ga0007411J51799_110827 3300003611 Bacteria 1049
22 Ga0055538_1000008 3300003751 Bacteria 398547
23 Ga0055539_1000012 3300003752 Bacteria 398547
24 Ga0055533_1000015 3300003756 Bacteria 398547
25 Ga0055532_1000005 3300003758 Bacteria 458107
26 Ga0055525_1000009 3300003759 Bacteria 596899
27 Ga0055525_1000017 3300003759 Bacteria 398547
28 Ga0055535_1005800 3300003761 Bacteria 2626
29 Ga0055529_1000127 3300003763 Bacteria 109148
30 Ga0055526_1000119 3300003771 Bacteria 69036
31 Ga0055526_1000129 3300003771 Bacteria 67279
32 Ga0055526_1002032 3300003771 Bacteria 13915
33 Ga0055537_1000156 3300003773 Bacteria 51559
34 Ga0055537_1000223 3300003773 Bacteria 41876
35 Ga0055537_1000427 3300003773 Bacteria 27480
36 Ga0055524_1000029 3300003775 Bacteria 201332
37 Ga0055524_1000824 3300003775 Bacteria 20504
38 Ga0055524_1003000 3300003775 Bacteria 8372
39 Ga0055534_1000230 3300003784 Bacteria 40350
40 Ga0055528_1000341 3300003790 Bacteria 38736
41 Ga0055541_1000009 3300003841 Bacteria 398547
42 Ga0055543_1000334 3300004625 Bacteria 32185
43 Ga0065165_1000050 3300005262 Bacteria 195237
44 Ga0065165_1001090 3300005262 Bacteria 32306
45 Ga0065165_1001239 3300005262 Bacteria 29150
46 Ga0065165_1023858 3300005262 Bacteria 2066
47 Ga0065714_10131016 3300005288 Bacteria 1242
48 Ga0065712_10165782 3300005290 Bacteria 1274
49 Ga0065715_10111850 3300005293 Bacteria 2556
50 Ga0065715_10234372 3300005293 Bacteria 1221
51 Ga0065707_10109638 3300005295 Bacteria 2462
52 Ga0065707_10177859 3300005295 Bacteria 1436
53 Ga0070658_10022533 3300005327 Bacteria 5055
54 Ga0070658_10199902 3300005327 Bacteria 1686
55 Ga0070676_10004849 3300005328 Bacteria 7119
56 Ga0070676_10011843 3300005328 Bacteria 4750
57 Ga0070676_10019139 3300005328 Bacteria 3805
58 Ga0070676_10073839 3300005328 Bacteria 2053
59 Ga0070676_10131166 3300005328 Bacteria 1585
60 Ga0070683_100082177 3300005329 Bacteria 3016
61 Ga0070683_100156438 3300005329 Bacteria 2162
62 Ga0070690_100010059 3300005330 Bacteria 5491
63 Ga0070690_100031895 3300005330 Bacteria 3286
64 Ga0070690_100169679 3300005330 Bacteria 1501
65 Ga0070690_100205708 3300005330 Bacteria 1372
66 Ga0070670_100031875 3300005331 Bacteria 4539
67 Ga0070670_100064592 3300005331 Bacteria 3140
68 Ga0070670_100067196 3300005331 Bacteria 3076
69 Ga0070670_100170863 3300005331 Bacteria 1885
70 Ga0070670_100256265 3300005331 Bacteria 1525
71 Ga0070677_10001379 3300005333 Bacteria 7748
72 Ga0070677_10002099 3300005333 Bacteria 6352
73 Ga0068869_100008005 3300005334 Bacteria 6789
74 Ga0068869_100014375 3300005334 Bacteria 5285
75 Ga0068869_100040565 3300005334 Bacteria 3329
76 Ga0070666_10000702 3300005335 Bacteria 20297
77 Ga0070666_10003075 3300005335 Bacteria 10127
78 Ga0070666_10005297 3300005335 Bacteria 7902
79 Ga0070680_100022866 3300005336 Bacteria 4981
80 Ga0070682_100006007 3300005337 Bacteria 6795
81 Ga0068868_100000679 3300005338 Bacteria 22831
82 Ga0068868_100004301 3300005338 Bacteria 9974
83 Ga0068868_100043846 3300005338 Bacteria 3495
84 Ga0068868_100132544 3300005338 Bacteria 2040
85 Ga0068868_100223088 3300005338 Bacteria 1579
86 Ga0070660_100002761 3300005339 Bacteria 12057
87 Ga0070660_100040784 3300005339 Bacteria 3535
88 Ga0070689_100025185 3300005340 Bacteria 4468
89 Ga0070689_100050127 3300005340 Bacteria 3225
90 Ga0070687_100069061 3300005343 Bacteria 1891
91 Ga0070661_100004663 3300005344 Bacteria 9443
92 Ga0070661_100006980 3300005344 Bacteria 7795
93 Ga0070661_100073827 3300005344 Bacteria 2511
94 Ga0070661_100254532 3300005344 Bacteria 1356
95 Ga0070668_100000613 3300005347 Bacteria 23905
96 Ga0070668_100013142 3300005347 Bacteria 6172
97 Ga0070668_100017184 3300005347 Bacteria 5414
98 Ga0070668_100018935 3300005347 Bacteria 5172
99 Ga0070668_100305658 3300005347 Bacteria 1335
100 Ga0070669_100000169 3300005353 Bacteria 57353
101 Ga0070669_100045806 3300005353 Bacteria 3188
102 Ga0070669_100157262 3300005353 Bacteria 1764
103 Ga0070669_100196411 3300005353 Bacteria 1585
104 Ga0070675_100001515 3300005354 Bacteria 17170
105 Ga0070675_100002078 3300005354 Bacteria 14820
106 Ga0070675_100006906 3300005354 Bacteria 8717
107 Ga0070675_100006939 3300005354 Bacteria 8697
108 Ga0070675_100007450 3300005354 Bacteria 8455
109 Ga0070675_100053567 3300005354 Bacteria 3318
110 Ga0070675_100193364 3300005354 Bacteria 1764
111 Ga0070675_100374755 3300005354 Bacteria 1266
112 Ga0070671_100002579 3300005355 Bacteria 14054
113 Ga0070671_100012862 3300005355 Bacteria 6748
114 Ga0070671_100057014 3300005355 Bacteria 3250
115 Ga0070671_100202187 3300005355 Bacteria 1685
116 Ga0070671_100246679 3300005355 Bacteria 1516
117 Ga0070674_100001647 3300005356 Bacteria 12039
118 Ga0070674_100023250 3300005356 Bacteria 4009
119 Ga0070674_100131003 3300005356 Bacteria 1870
120 Ga0070673_100000466 3300005364 Bacteria 21542
121 Ga0070673_100001661 3300005364 Bacteria 13169
122 Ga0070673_100003634 3300005364 Bacteria 9655
123 Ga0070673_100072857 3300005364 Bacteria 2764
124 Ga0070673_100181533 3300005364 Bacteria 1802
125 Ga0070673_100334362 3300005364 Bacteria 1341
126 Ga0070688_100044635 3300005365 Bacteria 2736
127 Ga0070688_100163548 3300005365 Bacteria 1531
128 Ga0070659_100025010 3300005366 Bacteria 4582
129 Ga0070659_100034557 3300005366 Bacteria 3932
130 Ga0070659_100071227 3300005366 Bacteria 2763
131 Ga0070659_100220534 3300005366 Bacteria 1565
132 Ga0070659_100260524 3300005366 Bacteria 1439
133 Ga0070659_100302907 3300005366 Bacteria 1333
134 Ga0070667_100001660 3300005367 Bacteria 19880
135 Ga0070667_100006157 3300005367 Bacteria 9970
136 Ga0070667_100006164 3300005367 Bacteria 9968
137 Ga0070667_100182338 3300005367 Bacteria 1857
138 Ga0070667_100297034 3300005367 Bacteria 1454
139 Ga0070709_10108171 3300005434 Bacteria 1864
140 Ga0070714_100071887 3300005435 Bacteria 2993
141 Ga0070714_100392913 3300005435 Bacteria 1309
142 Ga0070713_100000082 3300005436 Bacteria 59649
143 Ga0070713_100000473 3300005436 Bacteria 25644
144 Ga0070713_100005343 3300005436 Bacteria 8768
145 Ga0070713_100141242 3300005436 Bacteria 2134
146 Ga0070710_10052251 3300005437 Bacteria 2298
147 Ga0070701_10020480 3300005438 Bacteria 3141
148 Ga0070711_100148614 3300005439 Bacteria 1765
149 Ga0070711_100389326 3300005439 Bacteria 1129
150 Ga0070705_100007419 3300005440 Bacteria 5392
151 Ga0070694_100014614 3300005444 Bacteria 4916
152 Ga0070708_100017729 3300005445 Bacteria 5945
153 Ga0070708_100089439 3300005445 Bacteria 2802
154 Ga0070663_100026488 3300005455 Bacteria 3929
155 Ga0070663_100030486 3300005455 Bacteria 3697
156 Ga0070663_100031648 3300005455 Bacteria 3638
157 Ga0070663_100054640 3300005455 Bacteria 2855
158 Ga0070663_100061750 3300005455 Bacteria 2699
159 Ga0070678_100000359 3300005456 Bacteria 21211
160 Ga0070678_100001521 3300005456 Bacteria 12382
161 Ga0070678_100006597 3300005456 Bacteria 6821
162 Ga0070678_100036979 3300005456 Bacteria 3423
163 Ga0070678_100278944 3300005456 Bacteria 1412
164 Ga0070662_100014970 3300005457 Bacteria 5188
165 Ga0070662_100057012 3300005457 Bacteria 2837
166 Ga0070662_100069278 3300005457 Bacteria 2595
167 Ga0070681_10044970 3300005458 Bacteria 4419
168 Ga0070681_10070813 3300005458 Bacteria 3452
169 Ga0070681_10137094 3300005458 Bacteria 2377
170 Ga0070681_10174648 3300005458 Bacteria 2070
171 Ga0068867_100020394 3300005459 Bacteria 4723
172 Ga0068867_100023054 3300005459 Bacteria 4455
173 Ga0068867_100028872 3300005459 Bacteria 3994
174 Ga0068867_100029950 3300005459 Bacteria 3924
175 Ga0068867_100040087 3300005459 Bacteria 3416
176 Ga0068867_100072335 3300005459 Bacteria 2581
177 Ga0070685_10115246 3300005466 Bacteria 1662
178 Ga0070706_100040051 3300005467 Bacteria 4325
179 Ga0070707_100024229 3300005468 Bacteria 5744
180 Ga0070707_100025877 3300005468 Bacteria 5570
181 Ga0070698_100089116 3300005471 Bacteria 3069
182 Ga0070698_100144163 3300005471 Bacteria 2332
183 Ga0070699_100005930 3300005518 Bacteria 10669
184 Ga0070679_100008450 3300005530 Bacteria 9692
185 Ga0070679_100014073 3300005530 Bacteria 7673
186 Ga0070679_100074823 3300005530 Bacteria 3377
187 Ga0070679_100102857 3300005530 Bacteria 2843
188 Ga0070679_100404793 3300005530 Bacteria 1310
189 Ga0070684_100105660 3300005535 Bacteria 2520
190 Ga0070684_100130188 3300005535 Bacteria 2269
191 Ga0070697_100002710 3300005536 Bacteria 13647
192 Ga0070697_100015485 3300005536 Bacteria 5986
193 Ga0070697_100060421 3300005536 Bacteria 3089
194 Ga0068853_100010152 3300005539 Bacteria 7609
195 Ga0068853_100116051 3300005539 Bacteria 2384
196 Ga0070672_100000363 3300005543 Bacteria 26119
197 Ga0070672_100003651 3300005543 Bacteria 9995
198 Ga0070672_100005555 3300005543 Bacteria 8378
199 Ga0070672_100094467 3300005543 Bacteria 2417
200 Ga0070672_100126858 3300005543 Bacteria 2093
201 Ga0070695_100017015 3300005545 Bacteria 4410
202 Ga0070695_100047943 3300005545 Bacteria 2730
203 Ga0070693_100005184 3300005547 Bacteria 6236
204 Ga0070693_100022378 3300005547 Bacteria 3360
205 Ga0070693_100072908 3300005547 Bacteria 2027
206 Ga0070665_100003481 3300005548 Bacteria 16772
207 Ga0070665_100038969 3300005548 Bacteria 4778
208 Ga0070665_100406426 3300005548 Bacteria 1370
209 Ga0070665_100628701 3300005548 Bacteria 1087
210 Ga0070704_100014373 3300005549 Bacteria 4942
211 Ga0070704_100115777 3300005549 Bacteria 2049
212 Ga0068855_100001182 3300005563 Bacteria 32433
213 Ga0068855_100026469 3300005563 Bacteria 6938
214 Ga0068855_100036940 3300005563 Bacteria 5812
215 Ga0068855_100073739 3300005563 Bacteria 3965
216 Ga0068855_100090301 3300005563 Bacteria 3535
217 Ga0068855_100102200 3300005563 Bacteria 3299
218 Ga0068855_100114675 3300005563 Bacteria 3089
219 Ga0068855_100168021 3300005563 Bacteria 2485
220 Ga0068855_100270733 3300005563 Bacteria 1889
221 Ga0068855_100361644 3300005563 Bacteria 1597
222 Ga0068855_100389409 3300005563 Bacteria 1529
223 Ga0068855_100396217 3300005563 Bacteria 1514
224 Ga0070664_100077105 3300005564 Bacteria 2865
225 Ga0070664_100078105 3300005564 Bacteria 2847
226 Ga0068857_100004463 3300005577 Bacteria 11823
227 Ga0068857_100081933 3300005577 Bacteria 2882
228 Ga0068857_100192856 3300005577 Bacteria 1856
229 Ga0068857_100265838 3300005577 Bacteria 1575
230 Ga0068854_100013379 3300005578 Bacteria 5384
231 Ga0068854_100068245 3300005578 Bacteria 2592
232 Ga0068854_100076479 3300005578 Bacteria 2460
233 Ga0068854_100098261 3300005578 Bacteria 2190
234 Ga0068856_100004556 3300005614 Bacteria 13773
235 Ga0068856_100282854 3300005614 Bacteria 1675
236 Ga0068856_100405987 3300005614 Bacteria 1382
237 Ga0070702_100011692 3300005615 Bacteria 4374
238 Ga0070702_100115599 3300005615 Bacteria 1671
239 Ga0068852_100005712 3300005616 Bacteria 8924
240 Ga0068852_100012692 3300005616 Bacteria 6410
241 Ga0068852_100034426 3300005616 Bacteria 4214
242 Ga0068852_100069416 3300005616 Bacteria 3089
243 Ga0068852_100216050 3300005616 Bacteria 1821
244 Ga0068852_100508418 3300005616 Bacteria 1200
245 Ga0068859_100001763 3300005617 Bacteria 22021
246 Ga0068859_100035112 3300005617 Bacteria 5031
247 Ga0068859_100072059 3300005617 Bacteria 3491
248 Ga0068864_100002253 3300005618 Bacteria 15949
249 Ga0068864_100011388 3300005618 Bacteria 7349
250 Ga0068864_100015090 3300005618 Bacteria 6422
251 Ga0068864_100062613 3300005618 Bacteria 3223
252 Ga0068864_100213280 3300005618 Bacteria 1779
253 Ga0068864_100418934 3300005618 Bacteria 1276
254 Ga0068866_10001554 3300005718 Bacteria 9755
255 Ga0068866_10002116 3300005718 Bacteria 8258
256 Ga0068866_10122356 3300005718 Bacteria 1468
257 Ga0068861_100006691 3300005719 Bacteria 7874
258 Ga0068861_100174812 3300005719 Bacteria 1783
259 Ga0068851_10004443 3300005834 Bacteria 6325
260 Ga0068851_10033582 3300005834 Bacteria 2558
261 Ga0068870_10059298 3300005840 Bacteria 2051
262 Ga0068870_10068034 3300005840 Bacteria 1934
263 Ga0068863_100002920 3300005841 Bacteria 16928
264 Ga0068863_100005760 3300005841 Bacteria 12160
265 Ga0068863_100050924 3300005841 Bacteria 3925
266 Ga0068863_100066030 3300005841 Bacteria 3423
267 Ga0068858_100037861 3300005842 Bacteria 4473
268 Ga0068858_100110190 3300005842 Bacteria 2570
269 Ga0068860_100011123 3300005843 Bacteria 8865
270 Ga0068860_100014757 3300005843 Bacteria 7640
271 Ga0068860_100023497 3300005843 Bacteria 5957
272 Ga0068860_100025907 3300005843 Bacteria 5658
273 Ga0068860_100091407 3300005843 Bacteria 2899
274 Ga0068860_100200930 3300005843 Bacteria 1931
275 Ga0068860_100314122 3300005843 Bacteria 1537
276 Ga0068860_100369644 3300005843 Bacteria 1414
277 Ga0068862_100026328 3300005844 Bacteria 4888
278 Ga0068862_100055299 3300005844 Bacteria 3399
279 Ga0068862_100376060 3300005844 Bacteria 1324
280 Ga0081455_10242444 3300005937 Bacteria 1324
281 Ga0081539_10013484 3300005985 Bacteria 6154
282 Ga0070716_100061087 3300006173 Bacteria 2179
283 Ga0070716_100123520 3300006173 Bacteria 1625
284 Ga0070712_100034059 3300006175 Bacteria 3450
285 Ga0070712_100103356 3300006175 Bacteria 2112
286 Ga0075362_10011822 3300006177 Bacteria 3448
287 Ga0075362_10143603 3300006177 Bacteria 1142
288 Ga0075367_10044151 3300006178 Bacteria 2611
289 Ga0075369_10030676 3300006186 Bacteria 2265
290 Ga0075366_10010248 3300006195 Bacteria 5258
291 Ga0075366_10040064 3300006195 Bacteria 2770
292 Ga0097621_100000850 3300006237 Bacteria 21530
293 Ga0097621_100037043 3300006237 Bacteria 3905
294 Ga0097621_100133025 3300006237 Bacteria 2119
295 Ga0097621_100197243 3300006237 Bacteria 1746
296 Ga0097621_100284755 3300006237 Bacteria 1456
297 Ga0097621_100315933 3300006237 Bacteria 1383
298 Ga0068871_100000242 3300006358 Bacteria 38319
299 Ga0068871_100019778 3300006358 Bacteria 5145
300 Ga0068871_100027399 3300006358 Bacteria 4456
301 Ga0068871_100040237 3300006358 Bacteria 3744
302 Ga0075434_100009983 3300006871 Bacteria 8886
303 Ga0075434_100071506 3300006871 Bacteria 3461
304 Ga0075434_100102447 3300006871 Bacteria 2870
305 Ga0068865_100009857 3300006881 Bacteria 5936
306 Ga0068865_100058664 3300006881 Bacteria 2689
307 Ga0068865_100076826 3300006881 Bacteria 2385
308 Ga0068865_100439227 3300006881 Bacteria 1077
309 Ga0075436_100002276 3300006914 Bacteria 13250
310 Ga0097620_100001763 3300006931 Bacteria 22021
311 Ga0097620_100035112 3300006931 Bacteria 5031
312 Ga0097620_100072062 3300006931 Bacteria 3491
313 Ga0079104_1009676 3300006946 Bacteria 3246
314 Ga0099826_10000003 3300006948 Bacteria 1067817
315 Ga0075435_100001831 3300007076 Bacteria 13810
316 Ga0075435_100114367 3300007076 Bacteria 2246
317 Ga0075435_100136801 3300007076 Bacteria 2053
318 Ga0075435_100242723 3300007076 Bacteria 1532
319 Ga0105244_10000480 3300009036 Bacteria 36191
320 Ga0105244_10011204 3300009036 Bacteria 5395
321 Ga0105244_10068490 3300009036 Bacteria 1773
322 Ga0105240_10016284 3300009093 Bacteria 10071
323 Ga0105240_10089869 3300009093 Bacteria 3755
324 Ga0105245_10025459 3300009098 Bacteria 5203
325 Ga0105245_10088768 3300009098 Bacteria 2840
326 Ga0105245_10128268 3300009098 Bacteria 2377
327 Ga0105245_10242956 3300009098 Bacteria 1746
328 Ga0105245_10360793 3300009098 Bacteria 1442
329 Ga0105247_10011705 3300009101 Bacteria 5279
330 Ga0114129_10164993 3300009147 Bacteria 3024
331 Ga0114129_10256402 3300009147 Bacteria 2346
332 Ga0105243_10173448 3300009148 Bacteria 1870
333 Ga0105243_10431081 3300009148 Bacteria 1232
334 Ga0105241_10012933 3300009174 Bacteria 6121
335 Ga0105241_10019216 3300009174 Bacteria 5037
336 Ga0105241_10028627 3300009174 Bacteria 4153
337 Ga0105241_10204044 3300009174 Bacteria 1653
338 Ga0105242_10031060 3300009176 Bacteria 4265
339 Ga0105242_10037806 3300009176 Bacteria 3879
340 Ga0105242_10095517 3300009176 Bacteria 2509
341 Ga0105248_10005028 3300009177 Bacteria 14602
342 Ga0105248_10008024 3300009177 Bacteria 11592
343 Ga0105248_10017473 3300009177 Bacteria 7909
344 Ga0105237_10046901 3300009545 Bacteria 4344
345 Ga0105237_10063597 3300009545 Bacteria 3688
346 Ga0105237_10077738 3300009545 Bacteria 3308
347 Ga0105237_10081332 3300009545 Bacteria 3230
348 Ga0105237_10153507 3300009545 Bacteria 2299
349 Ga0105238_10000155 3300009551 Bacteria 74637
350 Ga0105238_10055325 3300009551 Bacteria 3983
351 Ga0105238_10538683 3300009551 Bacteria 1171
352 Ga0105239_10003940 3300010375 Bacteria 17984
353 Ga0105239_10050998 3300010375 Bacteria 4537
354 Ga0105239_10348081 3300010375 Bacteria 1673
355 Ga0105246_10023930 3300011119 Bacteria 3959
356 Ga0105246_10056249 3300011119 Bacteria 2718
357 Ga0105246_10214577 3300011119 Bacteria 1504
358 Ga0157373_10054441 3300013100 Bacteria 2843
359 Ga0157371_10284684 3300013102 Bacteria 1195
360 Ga0157370_10061944 3300013104 Bacteria 3550
361 Ga0157370_10330134 3300013104 Bacteria 1406
362 Ga0157369_10186712 3300013105 Bacteria 2180
363 Ga0157374_10002066 3300013296 Bacteria 16889
364 Ga0157374_10064367 3300013296 Bacteria 3441
365 Ga0157378_10029356 3300013297 Bacteria 4854
366 Ga0157378_10051207 3300013297 Bacteria 3674
367 Ga0157378_10113150 3300013297 Bacteria 2491
368 Ga0157378_10119394 3300013297 Bacteria 2428
369 Ga0157378_10282438 3300013297 Bacteria 1600
370 Ga0163162_10001767 3300013306 Bacteria 20260
371 Ga0163162_10032882 3300013306 Bacteria 5151
372 Ga0163162_10039392 3300013306 Bacteria 4722
373 Ga0163162_10151699 3300013306 Bacteria 2436
374 Ga0163162_10175388 3300013306 Bacteria 2269
375 Ga0163162_10231285 3300013306 Bacteria 1979
376 Ga0163162_10345423 3300013306 Bacteria 1621
377 Ga0157372_10049116 3300013307 Bacteria 4690
378 Ga0157372_10161115 3300013307 Bacteria 2593
379 Ga0157375_10001878 3300013308 Bacteria 18062
380 Ga0157375_10008888 3300013308 Bacteria 8791
381 Ga0163163_10018410 3300014325 Bacteria 6537
382 Ga0163163_10078294 3300014325 Bacteria 3302
383 Ga0163163_10196854 3300014325 Bacteria 2063
384 Ga0157380_10004823 3300014326 Bacteria 9398
385 Ga0157380_10113036 3300014326 Bacteria 2286
386 Ga0182008_10008832 3300014497 Bacteria 5470
387 Ga0182008_10030341 3300014497 Bacteria 2725
388 Ga0157379_10000258 3300014968 Bacteria 41557
389 Ga0157379_10005542 3300014968 Bacteria 10846
390 Ga0157379_10062582 3300014968 Bacteria 3328
391 Ga0157376_10031466 3300014969 Bacteria 4250
392 Ga0157376_10081290 3300014969 Bacteria 2782
393 Ga0182006_1000014 3300015261 Bacteria 340159
394 Ga0182006_1017100 3300015261 Bacteria 3087
395 Ga0182007_10000011 3300015262 Bacteria 264045
396 Ga0182005_1000014 3300015265 Bacteria 389763
397 Ga0163161_10011439 3300017792 Bacteria 6156
398 Ga0163161_10020410 3300017792 Bacteria 4650
399 Ga0163161_10035960 3300017792 Bacteria 3546
400 Ga0163161_10037366 3300017792 Bacteria 3481
401 Ga0163161_10065205 3300017792 Bacteria 2658
402 Ga0163161_10100089 3300017792 Bacteria 2156
403 Ga0214542_1000006 3300021321 Bacteria 345164
404 Ga0214543_1000014 3300021327 Bacteria 324986
405 Ga0213872_10000002 3300021361 Bacteria 554092
406 Ga0213872_10001185 3300021361 Bacteria 17711
407 Ga0213872_10003823 3300021361 Bacteria 8202
408 Ga0213872_10019757 3300021361 Bacteria 3102
409 Ga0213872_10040600 3300021361 Bacteria 2125
410 Ga0213876_10037332 3300021384 Bacteria 2563
411 Ga0209435_100004 3300025206 Bacteria 633417
412 Ga0209435_100156 3300025206 Bacteria 22357
413 Ga0209436_100758 3300025208 Bacteria 13374
414 Ga0209784_100005 3300025224 Bacteria 1040422
415 Ga0209566_100005 3300025225 Bacteria 1040422
416 Ga0209674_100009 3300025226 Bacteria 1040422
417 Ga0209672_104210 3300025228 Bacteria 2730
418 Ga0209147_100011 3300025229 Bacteria 702140
419 Ga0209563_100012 3300025230 Bacteria 1040422
420 Ga0209563_100015 3300025230 Bacteria 879901
421 Ga0209437_100084 3300025233 Bacteria 255423
422 Ga0209437_106034 3300025233 Bacteria 2035
423 Ga0209437_113411 3300025233 Bacteria 1171
424 Ga0209258_100264 3300025242 Bacteria 90298
425 Ga0207425_1000006 3300025245 Bacteria 808854
426 Ga0207425_1001662 3300025245 Bacteria 8929
427 Ga0209646_1000032 3300025246 Bacteria 375315
428 Ga0209646_1000047 3300025246 Bacteria 323416
429 Ga0209646_1000052 3300025246 Bacteria 286370
430 Ga0209026_1000062 3300025250 Bacteria 213298
431 Ga0209677_100006 3300025253 Bacteria 1040422
432 Ga0209759_1000054 3300025256 Bacteria 211422
433 Ga0209759_1000514 3300025256 Bacteria 41893
434 Ga0209129_1000090 3300025258 Bacteria 175755
435 Ga0209565_1000006 3300025263 Bacteria 897294
436 Ga0209565_1004584 3300025263 Bacteria 4172
437 Ga0209565_1005783 3300025263 Bacteria 3551
438 Ga0209565_1021985 3300025263 Bacteria 1325
439 Ga0209455_1000051 3300025272 Bacteria 369818
440 Ga0209455_1007667 3300025272 Bacteria 3015
441 Ga0209673_1000004 3300025273 Bacteria 896155
442 Ga0209130_1000065 3300025284 Bacteria 195251
443 Ga0209130_1001171 3300025284 Bacteria 18835
444 Ga0209675_1000006 3300025291 Bacteria 732267
445 Ga0209025_1007826 3300025294 Bacteria 7854
446 Ga0209564_1000006 3300025295 Bacteria 1100927
447 Ga0209564_1000038 3300025295 Bacteria 414357
448 Ga0209564_1000064 3300025295 Bacteria 316431
449 Ga0209564_1000248 3300025295 Bacteria 116617
450 Ga0209564_1015568 3300025295 Bacteria 3082
451 Ga0209758_1000047 3300025297 Bacteria 360971
452 Ga0209758_1001064 3300025297 Bacteria 35767
453 Ga0209256_1000013 3300025299 Bacteria 689442
454 Ga0209256_1000179 3300025299 Bacteria 123865
455 Ga0209256_1000863 3300025299 Bacteria 37690
456 Ga0207426_1040084 3300025302 Bacteria 1462
457 Ga0207697_10003849 3300025315 Bacteria 7323
458 Ga0207697_10004348 3300025315 Bacteria 6781
459 Ga0207697_10043730 3300025315 Bacteria 1842
460 Ga0207656_10012331 3300025321 Bacteria 3247
461 Ga0207656_10028498 3300025321 Bacteria 2293
462 Ga0207655_1009262 3300025728 Bacteria 6138
463 Ga0207682_10000737 3300025893 Bacteria 15157
464 Ga0207682_10001905 3300025893 Bacteria 9471
465 Ga0207692_10054486 3300025898 Bacteria 2042
466 Ga0207642_10002098 3300025899 Bacteria 6164
467 Ga0207688_10010293 3300025901 Bacteria 5091
468 Ga0207680_10001229 3300025903 Bacteria 12109
469 Ga0207680_10016616 3300025903 Bacteria 3868
470 Ga0207680_10024188 3300025903 Bacteria 3329
471 Ga0207680_10036114 3300025903 Bacteria 2844
472 Ga0207680_10125819 3300025903 Bacteria 1683
473 Ga0207699_10098509 3300025906 Bacteria 1850
474 Ga0207699_10116127 3300025906 Bacteria 1723
475 Ga0207645_10001462 3300025907 Bacteria 19304
476 Ga0207645_10003592 3300025907 Bacteria 11736
477 Ga0207645_10016958 3300025907 Bacteria 4812
478 Ga0207645_10042831 3300025907 Bacteria 2896
479 Ga0207645_10066483 3300025907 Bacteria 2304
480 Ga0207645_10081608 3300025907 Bacteria 2073
481 Ga0207643_10002620 3300025908 Bacteria 9739
482 Ga0207643_10023277 3300025908 Bacteria 3416
483 Ga0207705_10002897 3300025909 Bacteria 13128
484 Ga0207705_10044821 3300025909 Bacteria 3179
485 Ga0207705_10065653 3300025909 Bacteria 2624
486 Ga0207684_10097880 3300025910 Bacteria 2505
487 Ga0207684_10122131 3300025910 Bacteria 2233
488 Ga0207684_10161083 3300025910 Bacteria 1932
489 Ga0207654_10010071 3300025911 Bacteria 4808
490 Ga0207654_10073423 3300025911 Bacteria 2039
491 Ga0207654_10091475 3300025911 Bacteria 1855
492 Ga0207654_10147548 3300025911 Bacteria 1506
493 Ga0207707_10041254 3300025912 Bacteria 4031
494 Ga0207707_10052467 3300025912 Bacteria 3550
495 Ga0207695_10002162 3300025913 Bacteria 29707
496 Ga0207695_10003436 3300025913 Bacteria 22346
497 Ga0207695_10036222 3300025913 Bacteria 5336
498 Ga0207695_10100861 3300025913 Bacteria 2882
499 Ga0207695_10177212 3300025913 Bacteria 2054
500 Ga0207671_10043668 3300025914 Bacteria 3314
501 Ga0207671_10064504 3300025914 Bacteria 2723
502 Ga0207671_10071057 3300025914 Bacteria 2596
503 Ga0207693_10019572 3300025915 Bacteria 5383
504 Ga0207693_10125293 3300025915 Bacteria 2019
505 Ga0207693_10132244 3300025915 Bacteria 1961
506 Ga0207660_10026345 3300025917 Bacteria 3959
507 Ga0207657_10002340 3300025919 Bacteria 20552
508 Ga0207657_10002609 3300025919 Bacteria 19479
509 Ga0207657_10005841 3300025919 Bacteria 12824
510 Ga0207657_10035654 3300025919 Bacteria 4459
511 Ga0207649_10003159 3300025920 Bacteria 9042
512 Ga0207649_10013642 3300025920 Bacteria 4540
513 Ga0207649_10014966 3300025920 Bacteria 4354
514 Ga0207649_10059850 3300025920 Bacteria 2391
515 Ga0207649_10122979 3300025920 Bacteria 1752
516 Ga0207649_10258272 3300025920 Bacteria 1258
517 Ga0207652_10030770 3300025921 Bacteria 4498
518 Ga0207646_10015366 3300025922 Bacteria 7232
519 Ga0207681_10021185 3300025923 Bacteria 4128
520 Ga0207681_10040604 3300025923 Bacteria 3097
521 Ga0207681_10067744 3300025923 Bacteria 2476
522 Ga0207694_10000625 3300025924 Bacteria 32139
523 Ga0207694_10037796 3300025924 Bacteria 3710
524 Ga0207694_10168931 3300025924 Bacteria 1770
525 Ga0207650_10000814 3300025925 Bacteria 23955
526 Ga0207650_10020385 3300025925 Bacteria 4674
527 Ga0207650_10046077 3300025925 Bacteria 3210
528 Ga0207650_10054378 3300025925 Bacteria 2969
529 Ga0207650_10062689 3300025925 Bacteria 2778
530 Ga0207650_10131004 3300025925 Bacteria 1962
531 Ga0207659_10001002 3300025926 Bacteria 16791
532 Ga0207659_10003004 3300025926 Bacteria 10055
533 Ga0207659_10027086 3300025926 Bacteria 3876
534 Ga0207659_10061112 3300025926 Bacteria 2714
535 Ga0207659_10074474 3300025926 Bacteria 2488
536 Ga0207659_10168300 3300025926 Bacteria 1727
537 Ga0207659_10318511 3300025926 Bacteria 1282
538 Ga0207687_10009285 3300025927 Bacteria 6433
539 Ga0207687_10014734 3300025927 Bacteria 5120
540 Ga0207687_10034795 3300025927 Bacteria 3423
541 Ga0207687_10163427 3300025927 Bacteria 1711
542 Ga0207700_10000190 3300025928 Bacteria 36688
543 Ga0207700_10000606 3300025928 Bacteria 21010
544 Ga0207700_10068507 3300025928 Bacteria 2720
545 Ga0207700_10115769 3300025928 Bacteria 2165
546 Ga0207664_10003701 3300025929 Bacteria 10251
547 Ga0207664_10071733 3300025929 Bacteria 2791
548 Ga0207644_10012754 3300025931 Bacteria 5588
549 Ga0207644_10016384 3300025931 Bacteria 4985
550 Ga0207644_10041745 3300025931 Bacteria 3247
551 Ga0207644_10054594 3300025931 Bacteria 2878
552 Ga0207690_10065340 3300025932 Bacteria 2488
553 Ga0207690_10347695 3300025932 Bacteria 1172
554 Ga0207706_10014421 3300025933 Bacteria 7163
555 Ga0207706_10021145 3300025933 Bacteria 5846
556 Ga0207706_10023776 3300025933 Bacteria 5497
557 Ga0207706_10029415 3300025933 Bacteria 4903
558 Ga0207706_10162895 3300025933 Bacteria 1960
559 Ga0207686_10002320 3300025934 Bacteria 10418
560 Ga0207686_10018025 3300025934 Bacteria 3989
561 Ga0207686_10053076 3300025934 Bacteria 2533
562 Ga0207686_10074101 3300025934 Bacteria 2199
563 Ga0207686_10120696 3300025934 Bacteria 1784
564 Ga0207709_10007318 3300025935 Bacteria 6154
565 Ga0207709_10013585 3300025935 Bacteria 4492
566 Ga0207670_10000723 3300025936 Bacteria 17406
567 Ga0207670_10034337 3300025936 Bacteria 3277
568 Ga0207669_10002931 3300025937 Bacteria 7327
569 Ga0207669_10011960 3300025937 Bacteria 4248
570 Ga0207669_10173125 3300025937 Bacteria 1539
571 Ga0207704_10066762 3300025938 Bacteria 2260
572 Ga0207704_10173011 3300025938 Bacteria 1551
573 Ga0207665_10006550 3300025939 Bacteria 7721
574 Ga0207665_10105568 3300025939 Bacteria 1973
575 Ga0207691_10000073 3300025940 Bacteria 83553
576 Ga0207691_10000250 3300025940 Bacteria 53186
577 Ga0207691_10000906 3300025940 Bacteria 29417
578 Ga0207691_10026837 3300025940 Bacteria 5404
579 Ga0207691_10046606 3300025940 Bacteria 3982
580 Ga0207691_10168208 3300025940 Bacteria 1920
581 Ga0207711_10004442 3300025941 Bacteria 11957
582 Ga0207711_10005459 3300025941 Bacteria 10749
583 Ga0207711_10010225 3300025941 Bacteria 7790
584 Ga0207711_10046171 3300025941 Bacteria 3722
585 Ga0207711_10332731 3300025941 Bacteria 1405
586 Ga0207689_10000693 3300025942 Bacteria 32269
587 Ga0207689_10002991 3300025942 Bacteria 15584
588 Ga0207689_10032006 3300025942 Bacteria 4375
589 Ga0207689_10032521 3300025942 Bacteria 4339
590 Ga0207689_10047608 3300025942 Bacteria 3538
591 Ga0207661_10058502 3300025944 Bacteria 3102
592 Ga0207661_10168288 3300025944 Bacteria 1906
593 Ga0207679_10008600 3300025945 Bacteria 6507
594 Ga0207679_10018817 3300025945 Bacteria 4633
595 Ga0207679_10026288 3300025945 Bacteria 4012
596 Ga0207679_10050470 3300025945 Bacteria 3040
597 Ga0207679_10071194 3300025945 Bacteria 2622
598 Ga0207679_10379712 3300025945 Bacteria 1238
599 Ga0207667_10000019 3300025949 Bacteria 386233
600 Ga0207667_10100630 3300025949 Bacteria 2981
601 Ga0207667_10101473 3300025949 Bacteria 2968
602 Ga0207667_10133975 3300025949 Bacteria 2552
603 Ga0207667_10192588 3300025949 Bacteria 2092
604 Ga0207667_10204498 3300025949 Bacteria 2025
605 Ga0207651_10006970 3300025960 Bacteria 5981
606 Ga0207651_10050771 3300025960 Bacteria 2818
607 Ga0207651_10240384 3300025960 Bacteria 1475
608 Ga0207651_10307554 3300025960 Bacteria 1321
609 Ga0207712_10018557 3300025961 Bacteria 4532
610 Ga0207668_10001922 3300025972 Bacteria 12168
611 Ga0207668_10004960 3300025972 Bacteria 7829
612 Ga0207668_10023034 3300025972 Bacteria 3996
613 Ga0207668_10034668 3300025972 Bacteria 3353
614 Ga0207668_10036354 3300025972 Bacteria 3286
615 Ga0207668_10293629 3300025972 Bacteria 1338
616 Ga0207668_10331386 3300025972 Bacteria 1266
617 Ga0207640_10014111 3300025981 Bacteria 4594
618 Ga0207640_10025219 3300025981 Bacteria 3596
619 Ga0207640_10092269 3300025981 Bacteria 2100
620 Ga0207658_10001054 3300025986 Bacteria 22355
621 Ga0207658_10002792 3300025986 Bacteria 12572
622 Ga0207658_10011808 3300025986 Bacteria 5950
623 Ga0207658_10036950 3300025986 Bacteria 3504
624 Ga0207658_10137006 3300025986 Bacteria 1975
625 Ga0207658_10156469 3300025986 Bacteria 1863
626 Ga0207658_10267716 3300025986 Bacteria 1459
627 Ga0207677_10005852 3300026023 Bacteria 6692
628 Ga0207677_10011449 3300026023 Bacteria 5061
629 Ga0207677_10013070 3300026023 Bacteria 4797
630 Ga0207677_10014449 3300026023 Bacteria 4611
631 Ga0207677_10074865 3300026023 Bacteria 2404
632 Ga0207677_10083176 3300026023 Bacteria 2303
633 Ga0207677_10102280 3300026023 Bacteria 2112
634 Ga0207703_10001830 3300026035 Bacteria 18952
635 Ga0207703_10023902 3300026035 Bacteria 4805
636 Ga0207703_10042917 3300026035 Bacteria 3628
637 Ga0207703_10045919 3300026035 Bacteria 3515
638 Ga0207703_10400663 3300026035 Bacteria 1273
639 Ga0207703_10542298 3300026035 Bacteria 1096
640 Ga0207639_10010774 3300026041 Bacteria 6336
641 Ga0207639_10066023 3300026041 Bacteria 2811
642 Ga0207639_10107478 3300026041 Bacteria 2267
643 Ga0207639_10205379 3300026041 Bacteria 1692
644 Ga0207639_10468458 3300026041 Bacteria 1146
645 Ga0207678_10015275 3300026067 Bacteria 6753
646 Ga0207678_10028449 3300026067 Bacteria 4880
647 Ga0207678_10042669 3300026067 Bacteria 3928
648 Ga0207678_10213494 3300026067 Bacteria 1651
649 Ga0207708_10006169 3300026075 Bacteria 8884
650 Ga0207708_10097963 3300026075 Bacteria 2266
651 Ga0207702_10079389 3300026078 Bacteria 2844
652 Ga0207702_10122231 3300026078 Bacteria 2332
653 Ga0207702_10308840 3300026078 Bacteria 1503
654 Ga0207641_10004911 3300026088 Bacteria 11490
655 Ga0207641_10068717 3300026088 Bacteria 3038
656 Ga0207641_10143351 3300026088 Bacteria 2158
657 Ga0207641_10473403 3300026088 Bacteria 1213
658 Ga0207648_10000812 3300026089 Bacteria 35314
659 Ga0207648_10003243 3300026089 Bacteria 17119
660 Ga0207648_10004233 3300026089 Bacteria 14833
661 Ga0207648_10052591 3300026089 Bacteria 3562
662 Ga0207648_10064965 3300026089 Bacteria 3181
663 Ga0207648_10097852 3300026089 Bacteria 2568
664 Ga0207676_10004737 3300026095 Bacteria 9645
665 Ga0207676_10008753 3300026095 Bacteria 7200
666 Ga0207676_10010013 3300026095 Bacteria 6746
667 Ga0207676_10013940 3300026095 Bacteria 5770
668 Ga0207676_10019795 3300026095 Bacteria 4915
669 Ga0207676_10138947 3300026095 Bacteria 2077
670 Ga0207676_10327340 3300026095 Bacteria 1409
671 Ga0207676_10372837 3300026095 Bacteria 1326
672 Ga0207674_10003982 3300026116 Bacteria 17963
673 Ga0207674_10087362 3300026116 Bacteria 3112
674 Ga0207674_10131915 3300026116 Bacteria 2461
675 Ga0207674_10206589 3300026116 Bacteria 1913
676 Ga0207675_100005134 3300026118 Bacteria 12603
677 Ga0207675_100010454 3300026118 Bacteria 8691
678 Ga0207675_100028419 3300026118 Bacteria 5207
679 Ga0207675_100055382 3300026118 Bacteria 3699
680 Ga0207675_100139696 3300026118 Bacteria 2301
681 Ga0207675_100309405 3300026118 Bacteria 1540
682 Ga0207675_100537949 3300026118 Bacteria 1166
683 Ga0207683_10000125 3300026121 Bacteria 62664
684 Ga0207683_10000135 3300026121 Bacteria 61049
685 Ga0207683_10001991 3300026121 Bacteria 18082
686 Ga0207683_10022436 3300026121 Bacteria 5419
687 Ga0207683_10035316 3300026121 Bacteria 4346
688 Ga0207683_10067190 3300026121 Bacteria 3162
689 Ga0207683_10297767 3300026121 Bacteria 1476
690 Ga0207698_10012974 3300026142 Bacteria 5479
691 Ga0207698_10016062 3300026142 Bacteria 5036
692 Ga0207698_10017379 3300026142 Bacteria 4877
693 Ga0207698_10037610 3300026142 Bacteria 3567
694 Ga0207698_10058971 3300026142 Bacteria 2978
695 Ga0207698_10167900 3300026142 Bacteria 1928
696 Ga0209282_1000002 3300027666 Bacteria 1067825
697 Ga0209971_1003086 3300027682 Bacteria 3977
698 Ga0209974_10005862 3300027876 Bacteria 4309
699 Ga0268266_10004460 3300028379 Bacteria 13385
700 Ga0268266_10025721 3300028379 Bacteria 5008
701 Ga0268266_10051042 3300028379 Bacteria 3550
702 Ga0268266_10180719 3300028379 Bacteria 1920
703 Ga0268265_10060363 3300028380 Bacteria 2905
704 Ga0268264_10001218 3300028381 Bacteria 24739
705 Ga0268264_10013163 3300028381 Bacteria 6804
706 Ga0268264_10028514 3300028381 Bacteria 4567
707 Ga0268264_10034463 3300028381 Bacteria 4164
708 Ga0268264_10036930 3300028381 Bacteria 4026
709 Ga0268264_10068722 3300028381 Bacteria 2995
710 Ga0268264_10069971 3300028381 Bacteria 2969
711 Ga0268264_10257818 3300028381 Bacteria 1623
712 Ga0307515_10129488 3300028794 Bacteria 2790
713 Ga0316177_1094480 3300030731 Bacteria 2864
714 Ga0265330_10004748 3300031235 Bacteria 6865
715 Ga0265332_10000782 3300031238 Bacteria 19376
716 Ga0265332_10006275 3300031238 Bacteria 5408
717 Ga0265328_10004680 3300031239 Bacteria 5916
718 Ga0265339_10097186 3300031249 Bacteria 1537
719 Ga0265331_10000875 3300031250 Bacteria 24557
720 Ga0265331_10001966 3300031250 Bacteria 14350
721 Ga0265331_10012966 3300031250 Bacteria 4493
722 Ga0265327_10000120 3300031251 Bacteria 171108
723 Ga0265327_10000184 3300031251 Bacteria 133023
724 Ga0265327_10001071 3300031251 Bacteria 38153
725 Ga0265327_10001501 3300031251 Bacteria 28923
726 Ga0265327_10009022 3300031251 Bacteria 7295
727 Ga0265327_10011522 3300031251 Bacteria 6073
728 Ga0307408_100001134 3300031548 Bacteria 20242
729 Ga0265313_10000459 3300031595 Bacteria 43090
730 Ga0265313_10035104 3300031595 Bacteria 2529
731 Ga0265314_10000093 3300031711 Bacteria 136857
732 Ga0265314_10009432 3300031711 Bacteria 8231
733 Ga0265314_10012723 3300031711 Bacteria 6839
734 Ga0265314_10013652 3300031711 Bacteria 6550
735 Ga0265314_10050813 3300031711 Bacteria 2891
736 Ga0265342_10001756 3300031712 Bacteria 19792
737 Ga0265342_10021351 3300031712 Bacteria 4137
738 Ga0316576_10100039 3300031727 Bacteria 2166
739 Ga0316578_10016384 3300031728 Bacteria 4010
740 Ga0307405_10005974 3300031731 Bacteria 5941
741 Ga0307413_10001664 3300031824 Bacteria 8632
742 Ga0307410_10002322 3300031852 Bacteria 9143
743 Ga0307406_10024627 3300031901 Bacteria 3596
744 Ga0307407_10056194 3300031903 Bacteria 2277
745 Ga0307412_10019789 3300031911 Bacteria 4084
746 Ga0307409_100003079 3300031995 Bacteria 8924
747 Ga0307416_100219551 3300032002 Bacteria 1821
748 Ga0307414_10044318 3300032004 Bacteria 3037
749 Ga0307411_10000379 3300032005 Bacteria 15163
750 Ga0307415_100040640 3300032126 Bacteria 3082
751 Ga0316583_10001693 3300032133 Bacteria 7487
752 Ga0316588_1018741 3300033528 Bacteria 1553
753 Ga0373938_0006659 3300034957 Bacteria 2006
754 Ga0373949_0026300 3300035090 Bacteria 1363
755 Ga0373931_0001543 3300035691 Bacteria 9932
756 Ga0373931_0039416 3300035691 Bacteria 2475
757 Ga0373927_0047115 3300035695 Bacteria 2788
758 Ga0373933_0143407 3300035724 Bacteria 1509
759 Ga0373937_0034885 3300036401 Bacteria 4577
760 Ga0316582_0058070 3300036647 Bacteria 2473
761 Ga0373925_0011187 3300037068 Bacteria 6509
762 Ga0373925_0085475 3300037068 Bacteria 2405
763 Ga0373925_0125368 3300037068 Bacteria 1997
764 Ga0395899_0000166 3300037312 Bacteria 101803
765 Ga0395899_0001102 3300037312 Bacteria 24197
766 Ga0395899_0001535 3300037312 Bacteria 19501
767 Ga0395899_0004707 3300037312 Bacteria 10647
768 Ga0395899_0040069 3300037312 Bacteria 3504
769 Ga0395899_0052470 3300037312 Bacteria 3022
770 Ga0395899_0115400 3300037312 Bacteria 1927
771 Ga0395899_0157712 3300037312 Bacteria 1605
772 Ga0395900_0000729 3300037418 Bacteria 43752
773 Ga0395900_0001738 3300037418 Bacteria 25108
774 Ga0395900_0007959 3300037418 Bacteria 10910
775 Ga0395900_0016478 3300037418 Bacteria 7536
776 Ga0395900_0096018 3300037418 Bacteria 3045
777 Ga0395900_0129789 3300037418 Bacteria 2583
778 Ga0395900_0247888 3300037418 Bacteria 1783
779 Ga0395900_0252459 3300037418 Bacteria 1764
780 Ga0395900_0260678 3300037418 Bacteria 1731
781 Ga0395900_0271465 3300037418 Bacteria 1690
782 Ga0395900_0308171 3300037418 Bacteria 1567
783 Ga0395898_0071585 3300037466 Bacteria 3350
784 Ga0395898_0136478 3300037466 Bacteria 2349
785 Ga0395898_0161206 3300037466 Bacteria 2145
786 Ga0395898_0165475 3300037466 Bacteria 2115
787 Ga0395898_0265677 3300037466 Bacteria 1636
788 Ga0395905_0001956 3300037471 Bacteria 23575
789 Ga0395905_0008938 3300037471 Bacteria 9836
790 Ga0395905_0010966 3300037471 Bacteria 8772
791 Ga0395905_0023198 3300037471 Bacteria 5865
792 Ga0395905_0080666 3300037471 Bacteria 3049
793 Ga0395905_0101001 3300037471 Bacteria 2708
794 Ga0395905_0172013 3300037471 Bacteria 2035
795 Ga0395905_0410001 3300037471 Bacteria 1250
796 Ga0395901_0000073 3300038443 Bacteria 139769
797 Ga0395901_0001782 3300038443 Bacteria 22209
798 Ga0395901_0004488 3300038443 Bacteria 14071
799 Ga0395901_0010976 3300038443 Bacteria 9177
800 Ga0395901_0037900 3300038443 Bacteria 4984
801 Ga0395901_0051872 3300038443 Bacteria 4264
802 Ga0395901_0114976 3300038443 Bacteria 2826
803 Ga0395901_0135919 3300038443 Bacteria 2584
804 Ga0436360_1319670 3300039438 Bacteria 2585
805 Ga0436361_0191290 3300039447 Bacteria 1530
806 Ga0436361_0301322 3300039447 Bacteria 54194
807 Ga0436361_0334934 3300039447 Bacteria 33477
808 Ga0436361_0418283 3300039447 Bacteria 2412
809 Ga0436361_0594091 3300039447 Bacteria 35115
810 Ga0436361_0738173 3300039447 Bacteria 11067
811 Ga0436361_0912286 3300039447 Bacteria 1958
812 Ga0436361_1043665 3300039447 Bacteria 3999
813 Ga0436361_1068376 3300039447 Bacteria 3928
814 Ga0439448_0001500 3300042005 Bacteria 6072
815 Ga0439448_0002930 3300042005 Bacteria 4680
816 Ga0439455_0017270 3300042012 Bacteria 1679
817 Ga0450904_000311 3300042139 Bacteria 10307
818 Ga0439458_0006360 3300042157 Bacteria 2635
819 Ga0451577_0000234 3300042876 Bacteria 110808
820 Ga0451577_0004153 3300042876 Bacteria 15518
821 Ga0451577_0004958 3300042876 Bacteria 13836
822 Ga0451577_0030145 3300042876 Bacteria 4902
823 Ga0451577_0074220 3300042876 Bacteria 3034
824 Ga0451577_0090390 3300042876 Bacteria 2733
825 Ga0451577_0095452 3300042876 Bacteria 2655
826 Ga0451577_0143805 3300042876 Bacteria 2144
827 Ga0451577_0254237 3300042876 Bacteria 1590
828 Ga0466969_0045016 3300044656 Bacteria 2192
829 Ga0466972_0000106 3300044658 Bacteria 72246
830 Ga0466972_0007507 3300044658 Bacteria 5474
831 Ga0466972_0080097 3300044658 Bacteria 1555
832 Ga0453683_0001267 3300044673 Bacteria 22460
833 Ga0453683_0005769 3300044673 Bacteria 8582
834 Ga0453683_0019365 3300044673 Bacteria 4361
835 Ga0453683_0024809 3300044673 Bacteria 3813
836 Ga0453683_0096106 3300044673 Bacteria 1859
837 Ga0453683_0158661 3300044673 Bacteria 1431
838 Ga0453683_0307168 3300044673 Bacteria 1015
839 Ga0466965_0002743 3300044683 Bacteria 7551
840 Ga0466965_0012390 3300044683 Bacteria 4009
841 Ga0466965_0018510 3300044683 Bacteria 3340
842 Ga0466965_0035262 3300044683 Bacteria 2450
843 Ga0466966_0015329 3300044684 Bacteria 5068
844 Ga0466966_0038015 3300044684 Bacteria 3102
845 Ga0466961_0096127 3300044693 Bacteria 1868
846 Ga0466964_0002817 3300044706 Bacteria 6260
847 Ga0466964_0004462 3300044706 Bacteria 5171
848 Ga0453684_0000005 3300044712 Bacteria 1431632
849 Ga0453684_0000006 3300044712 Bacteria 1364191
850 Ga0453684_0000069 3300044712 Bacteria 456439
851 Ga0453684_0000102 3300044712 Bacteria 366870
852 Ga0453684_0000410 3300044712 Bacteria 175627
853 Ga0453684_0001096 3300044712 Bacteria 85305
854 Ga0453684_0001336 3300044712 Bacteria 72324
855 Ga0453684_0003107 3300044712 Bacteria 38231
856 Ga0453684_0004556 3300044712 Bacteria 29006
857 Ga0453684_0005643 3300044712 Bacteria 24606
858 Ga0453684_0007758 3300044712 Bacteria 19575
859 Ga0453684_0015338 3300044712 Bacteria 12137
860 Ga0453684_0018397 3300044712 Bacteria 10725
861 Ga0453684_0027105 3300044712 Bacteria 8234
862 Ga0453684_0027141 3300044712 Bacteria 8228
863 Ga0453684_0029443 3300044712 Bacteria 7794
864 Ga0453684_0035901 3300044712 Bacteria 6841
865 Ga0453684_0037762 3300044712 Bacteria 6623
866 Ga0453684_0075947 3300044712 Bacteria 4220
867 Ga0453684_0304832 3300044712 Bacteria 1809
868 Ga0453684_0417631 3300044712 Bacteria 1499
869 Ga0466968_0001997 3300044735 Bacteria 7413
870 Ga0466968_0009097 3300044735 Bacteria 3818
871 Ga0466968_0053588 3300044735 Bacteria 1728
872 Ga0466968_0056523 3300044735 Bacteria 1686
873 Ga0466957_0000747 3300044842 Bacteria 16583
874 Ga0466957_0006602 3300044842 Bacteria 6561
875 Ga0466957_0067943 3300044842 Bacteria 2200
876 Ga0466957_0187862 3300044842 Bacteria 1352
877 Ga0466959_0071183 3300045049 Bacteria 2518
878 Ga0451576_0000086 3300045051 Bacteria 235554
879 Ga0451576_0000936 3300045051 Bacteria 55015
880 Ga0451576_0001338 3300045051 Bacteria 42621
881 Ga0451576_0001655 3300045051 Bacteria 37013
882 Ga0451576_0002897 3300045051 Bacteria 24477
883 Ga0451576_0008417 3300045051 Bacteria 12110
884 Ga0451576_0016446 3300045051 Bacteria 8165
885 Ga0451576_0017345 3300045051 Bacteria 7919
886 Ga0451576_0019016 3300045051 Bacteria 7507
887 Ga0451576_0061838 3300045051 Bacteria 3904
888 Ga0451576_0069983 3300045051 Bacteria 3652
889 Ga0451576_0114020 3300045051 Bacteria 2813
890 Ga0451576_0136021 3300045051 Bacteria 2563
891 Ga0451576_0228262 3300045051 Bacteria 1944
892 Ga0451576_0355984 3300045051 Bacteria 1533
893 Ga0466958_0184054 3300045836 Bacteria 1326
894 Ga0466967_0012639 3300045976 Bacteria 6474
895 Ga0466967_0016460 3300045976 Bacteria 5833
896 Ga0466967_0044026 3300045976 Bacteria 3869
897 Ga0495617_000002 3300046452 Bacteria 710121
898 Ga0495617_000007 3300046452 Bacteria 369986
899 Ga0495617_000098 3300046452 Bacteria 62441
900 Ga0495627_000006 3300046453 Bacteria 581750
901 Ga0495627_000339 3300046453 Bacteria 44178
902 Ga0495627_017797 3300046453 Bacteria 2407
903 Ga0495627_027626 3300046453 Bacteria 1819
904 Ga0495592_0156382 3300046454 Bacteria 1572
905 Ga0495590_0000004 3300046457 Bacteria 402091
906 Ga0495590_0000007 3300046457 Bacteria 331108
907 Ga0495590_0001878 3300046457 Bacteria 8883
908 Ga0495591_000039 3300046458 Bacteria 156460
909 Ga0495638_0000023 3300046460 Bacteria 363063
910 Ga0495638_0020398 3300046460 Bacteria 4380
911 Ga0495638_0025361 3300046460 Bacteria 3855
912 Ga0495638_0027894 3300046460 Bacteria 3650
913 Ga0495638_0046882 3300046460 Bacteria 2712
914 Ga0495638_0110211 3300046460 Bacteria 1636
915 Ga0495651_0007016 3300046462 Bacteria 8618
916 Ga0495651_0049037 3300046462 Bacteria 3260
917 Ga0495653_0000042 3300046463 Bacteria 117284
918 Ga0495653_0007300 3300046463 Bacteria 9052
919 Ga0495653_0009244 3300046463 Bacteria 8064
920 Ga0495653_0053914 3300046463 Bacteria 3074
921 Ga0495653_0092078 3300046463 Bacteria 2214
922 Ga0495650_0000151 3300046471 Bacteria 157969
923 Ga0495650_0000215 3300046471 Bacteria 122533
924 Ga0495650_0000357 3300046471 Bacteria 80726
925 Ga0495650_0000399 3300046471 Bacteria 72364
926 Ga0495650_0000579 3300046471 Bacteria 51254
927 Ga0495650_0003026 3300046471 Bacteria 12688
928 Ga0495650_0007857 3300046471 Bacteria 6335
929 Ga0495580_0039498 3300046472 Bacteria 3376
930 Ga0495582_0002941 3300046473 Bacteria 9536
931 Ga0495582_0003581 3300046473 Bacteria 8756
932 Ga0495582_0059814 3300046473 Bacteria 2102
933 Ga0495605_0000015 3300046474 Bacteria 300227
934 Ga0495605_0000085 3300046474 Bacteria 121011
935 Ga0495605_0000108 3300046474 Bacteria 104865
936 Ga0495605_0083975 3300046474 Bacteria 1485
937 Ga0495605_0125122 3300046474 Bacteria 1163
938 Ga0495584_0000022 3300046491 Bacteria 128471
939 Ga0495584_0000282 3300046491 Bacteria 35813
940 Ga0495584_0000956 3300046491 Bacteria 18154
941 Ga0495584_0005152 3300046491 Bacteria 6937
942 Ga0495584_0005836 3300046491 Bacteria 6486
943 Ga0495584_0118086 3300046491 Bacteria 1343
944 Ga0495585_0000004 3300046492 Bacteria 348260
945 Ga0495585_0000172 3300046492 Bacteria 69900
946 Ga0495585_0000298 3300046492 Bacteria 49916
947 Ga0495585_0001332 3300046492 Bacteria 19618
948 Ga0495585_0006644 3300046492 Bacteria 7148
949 Ga0495585_0022006 3300046492 Bacteria 3659
950 Ga0495585_0036207 3300046492 Bacteria 2785
951 Ga0495585_0046785 3300046492 Bacteria 2411
952 Ga0495594_0008580 3300046499 Bacteria 5267
953 Ga0495594_0012431 3300046499 Bacteria 4433
954 Ga0495594_0029232 3300046499 Bacteria 2977
955 Ga0495594_0032455 3300046499 Bacteria 2834
956 Ga0495594_0045160 3300046499 Bacteria 2418
957 Ga0495596_0000186 3300046500 Bacteria 43253
958 Ga0495596_0000659 3300046500 Bacteria 21597
959 Ga0495596_0000902 3300046500 Bacteria 17794
960 Ga0495607_0004205 3300046501 Bacteria 10682
961 Ga0495607_0007031 3300046501 Bacteria 7825
962 Ga0495607_0011199 3300046501 Bacteria 5985
963 Ga0495607_0014625 3300046501 Bacteria 5102
964 Ga0495607_0031667 3300046501 Bacteria 3235
965 Ga0495607_0039867 3300046501 Bacteria 2802
966 Ga0495607_0066550 3300046501 Bacteria 2027
967 Ga0495607_0124310 3300046501 Bacteria 1350
968 Ga0495583_0000004 3300046506 Bacteria 655287
969 Ga0495583_0000093 3300046506 Bacteria 158708
970 Ga0495583_0000423 3300046506 Bacteria 63964
971 Ga0495583_0001606 3300046506 Bacteria 22176
972 Ga0495583_0001608 3300046506 Bacteria 22146
973 Ga0495583_0002014 3300046506 Bacteria 18506
974 Ga0495606_0000037 3300046507 Bacteria 231282
975 Ga0495606_0000290 3300046507 Bacteria 87022
976 Ga0495606_0000331 3300046507 Bacteria 81871
977 Ga0495606_0001806 3300046507 Bacteria 27233
978 Ga0495606_0017776 3300046507 Bacteria 5359
979 Ga0495606_0051389 3300046507 Bacteria 2688
980 Ga0495606_0062952 3300046507 Bacteria 2366
981 Ga0495608_0088230 3300046511 Bacteria 2008
982 Ga0495610_0000004 3300046512 Bacteria 1006135
983 Ga0495610_0003295 3300046512 Bacteria 12710
984 Ga0495610_0007524 3300046512 Bacteria 7221
985 Ga0495610_0016633 3300046512 Bacteria 4225
986 Ga0495610_0034857 3300046512 Bacteria 2588
987 Ga0495616_0000145 3300046513 Bacteria 62415
988 Ga0495616_0000412 3300046513 Bacteria 33007
989 Ga0495616_0005744 3300046513 Bacteria 7595
990 Ga0495616_0006281 3300046513 Bacteria 7211
991 Ga0495616_0006679 3300046513 Bacteria 6962
992 Ga0495616_0008398 3300046513 Bacteria 6120
993 Ga0495616_0031060 3300046513 Bacteria 2801
994 Ga0495616_0074638 3300046513 Bacteria 1633
995 Ga0495616_0102883 3300046513 Bacteria 1338
996 Ga0495616_0108379 3300046513 Bacteria 1293
997 Ga0495628_0006927 3300046516 Bacteria 9843
998 Ga0495628_0109720 3300046516 Bacteria 2123
999 Ga0495628_0282003 3300046516 Bacteria 1233
1000 Ga0495630_0241047 3300046517 Bacteria 1382
1001 Ga0495631_0000109 3300046518 Bacteria 54778
1002 Ga0495631_0021271 3300046518 Bacteria 3021
1003 Ga0495631_0022342 3300046518 Bacteria 2941
1004 Ga0495631_0078776 3300046518 Bacteria 1422
1005 Ga0495632_0000374 3300046519 Bacteria 42607
1006 Ga0495632_0012217 3300046519 Bacteria 4961
1007 Ga0495632_0060042 3300046519 Bacteria 1849
1008 Ga0495637_0000006 3300046520 Bacteria 435763
1009 Ga0495637_0000338 3300046520 Bacteria 36248
1010 Ga0495643_0000183 3300046522 Bacteria 100113
1011 Ga0495643_0000681 3300046522 Bacteria 39588
1012 Ga0495643_0001242 3300046522 Bacteria 24461
1013 Ga0495643_0017464 3300046522 Bacteria 4193
1014 Ga0495643_0039623 3300046522 Bacteria 2576
1015 Ga0495643_0115365 3300046522 Bacteria 1361
1016 Ga0495644_0002286 3300046523 Bacteria 7664
1017 Ga0495644_0006951 3300046523 Bacteria 4380
1018 Ga0495644_0053389 3300046523 Bacteria 1518
1019 Ga0495648_0000025 3300046524 Bacteria 233415
1020 Ga0495648_0000044 3300046524 Bacteria 175587
1021 Ga0495648_0000220 3300046524 Bacteria 65480
1022 Ga0495648_0001128 3300046524 Bacteria 27039
1023 Ga0495648_0008204 3300046524 Bacteria 8237
1024 Ga0495648_0018513 3300046524 Bacteria 4926
1025 Ga0495648_0023511 3300046524 Bacteria 4219
1026 Ga0495648_0042060 3300046524 Bacteria 2878
1027 Ga0495663_0010508 3300046525 Bacteria 2576
1028 Ga0495666_0000941 3300046526 Bacteria 13674
1029 Ga0495666_0020696 3300046526 Bacteria 3257
1030 Ga0495642_0014258 3300046528 Bacteria 3079
1031 Ga0495642_0021899 3300046528 Bacteria 2515
1032 Ga0495642_0041231 3300046528 Bacteria 1877
1033 Ga0495652_0001279 3300046529 Bacteria 28174
1034 Ga0495652_0002634 3300046529 Bacteria 18302
1035 Ga0495652_0056252 3300046529 Bacteria 3342
1036 Ga0495652_0073344 3300046529 Bacteria 2850
1037 Ga0495654_0000004 3300046530 Bacteria 515304
1038 Ga0495654_0019773 3300046530 Bacteria 3517
1039 Ga0495665_0066355 3300046531 Bacteria 1904
1040 Ga0495586_0007863 3300046535 Bacteria 5686
1041 Ga0495586_0008698 3300046535 Bacteria 5405
1042 Ga0495586_0008995 3300046535 Bacteria 5314
1043 Ga0495587_0018631 3300046536 Bacteria 4303
1044 Ga0495587_0018659 3300046536 Bacteria 4300
1045 Ga0495587_0046754 3300046536 Bacteria 2567
1046 Ga0495609_0000002 3300046538 Bacteria 739816
1047 Ga0495609_0000268 3300046538 Bacteria 48889
1048 Ga0495609_0001284 3300046538 Bacteria 17142
1049 Ga0495609_0002231 3300046538 Bacteria 12123
1050 Ga0495609_0009285 3300046538 Bacteria 4764
1051 Ga0495609_0009796 3300046538 Bacteria 4621
1052 Ga0495609_0019747 3300046538 Bacteria 3115
1053 Ga0495597_0000295 3300046542 Bacteria 44823
1054 Ga0495597_0004054 3300046542 Bacteria 8198
1055 Ga0495597_0007330 3300046542 Bacteria 5613
1056 Ga0495597_0029215 3300046542 Bacteria 2518
1057 Ga0495597_0034548 3300046542 Bacteria 2285
1058 Ga0495645_0001835 3300046543 Bacteria 14455
1059 Ga0495645_0006318 3300046543 Bacteria 8220
1060 Ga0495645_0071721 3300046543 Bacteria 2497
1061 Ga0495622_0000007 3300046557 Bacteria 239352
1062 Ga0495622_0000063 3300046557 Bacteria 95713
1063 Ga0495622_0011293 3300046557 Bacteria 4124
1064 Ga0495633_0000107 3300046558 Bacteria 111541
1065 Ga0495633_0000234 3300046558 Bacteria 67824
1066 Ga0495633_0003009 3300046558 Bacteria 11496
1067 Ga0495633_0003567 3300046558 Bacteria 10287
1068 Ga0495633_0009671 3300046558 Bacteria 5303
1069 Ga0495633_0014592 3300046558 Bacteria 4100
1070 Ga0495633_0027354 3300046558 Bacteria 2788
1071 Ga0495667_0036606 3300046559 Bacteria 3274
1072 Ga0495656_0008883 3300046615 Bacteria 3604
1073 Ga0495656_0044396 3300046615 Bacteria 1871
1074 Ga0495668_0000049 3300046616 Bacteria 217657
1075 Ga0495668_0000177 3300046616 Bacteria 94811
1076 Ga0495668_0000198 3300046616 Bacteria 88730
1077 Ga0495668_0000861 3300046616 Bacteria 34228
1078 Ga0495668_0002828 3300046616 Bacteria 13802
1079 Ga0495668_0008440 3300046616 Bacteria 6438
1080 Ga0495668_0030377 3300046616 Bacteria 3050
1081 Ga0495668_0035316 3300046616 Bacteria 2802
1082 Ga0495668_0085696 3300046616 Bacteria 1727
1083 Ga0495611_0000116 3300046648 Bacteria 56573
1084 Ga0495611_0008084 3300046648 Bacteria 4466
1085 Ga0495611_0049416 3300046648 Bacteria 1892
1086 Ga0495611_0112883 3300046648 Bacteria 1265
1087 Ga0495625_0000123 3300046660 Bacteria 120958
1088 Ga0495625_0027675 3300046660 Bacteria 4261
1089 Ga0495625_0034998 3300046660 Bacteria 3704
1090 Ga0495635_0007881 3300046663 Bacteria 7439
1091 Ga0495635_0195118 3300046663 Bacteria 1374
1092 Ga0495659_0000206 3300046664 Bacteria 25424
1093 Ga0495659_0001065 3300046664 Bacteria 9582
1094 Ga0495659_0013762 3300046664 Bacteria 2638
1095 Ga0495661_0000271 3300046665 Bacteria 59543
1096 Ga0495661_0000669 3300046665 Bacteria 34300
1097 Ga0495661_0003800 3300046665 Bacteria 11050
1098 Ga0495661_0016926 3300046665 Bacteria 4817
1099 Ga0495661_0017654 3300046665 Bacteria 4708
1100 Ga0495661_0043717 3300046665 Bacteria 2751
1101 Ga0495661_0047317 3300046665 Bacteria 2620
1102 Ga0495661_0093720 3300046665 Bacteria 1703
1103 Ga0495661_0101400 3300046665 Bacteria 1619
1104 Ga0495588_0000135 3300046674 Bacteria 117387
1105 Ga0495588_0032059 3300046674 Bacteria 2647
1106 Ga0495588_0056099 3300046674 Bacteria 2033
1107 Ga0495588_0087465 3300046674 Bacteria 1630
1108 Ga0495657_0037487 3300046675 Bacteria 3341
1109 Ga0495657_0180007 3300046675 Bacteria 1298
1110 Ga0495599_0003373 3300046678 Bacteria 9340
1111 Ga0495599_0015585 3300046678 Bacteria 4718
1112 Ga0495623_0001059 3300046679 Bacteria 18646
1113 Ga0495623_0030023 3300046679 Bacteria 3498
1114 Ga0495623_0090851 3300046679 Bacteria 1874
1115 Ga0495623_0103940 3300046679 Bacteria 1727
1116 Ga0495646_0003807 3300046680 Bacteria 9434
1117 Ga0495646_0101648 3300046680 Bacteria 1647
1118 Ga0495669_0000168 3300046684 Bacteria 41171
1119 Ga0495669_0002466 3300046684 Bacteria 7554
1120 Ga0495669_0003227 3300046684 Bacteria 6713
1121 Ga0495669_0019496 3300046684 Bacteria 2927
1122 Ga0495624_0146909 3300046690 Bacteria 1443
1123 Ga0495670_0000757 3300046691 Bacteria 15507
1124 Ga0495670_0007526 3300046691 Bacteria 5354
1125 Ga0495670_0007789 3300046691 Bacteria 5267
1126 Ga0495670_0015818 3300046691 Bacteria 3707
1127 Ga0495670_0048952 3300046691 Bacteria 2114
1128 Ga0495671_0000613 3300046692 Bacteria 26136
1129 Ga0495671_0021437 3300046692 Bacteria 3395
1130 Ga0495649_0000183 3300046694 Bacteria 54730
1131 Ga0495649_0003503 3300046694 Bacteria 10565
1132 Ga0495649_0005677 3300046694 Bacteria 7874
1133 Ga0495589_0000030 3300046794 Bacteria 170254
1134 Ga0495589_0000146 3300046794 Bacteria 65628
1135 Ga0495589_0018675 3300046794 Bacteria 3555
1136 Ga0495589_0030779 3300046794 Bacteria 2702
1137 Ga0495600_0047465 3300046809 Bacteria 2801
1138 Ga0495660_0000423 3300046810 Bacteria 35820
1139 Ga0495660_0000542 3300046810 Bacteria 30925
1140 Ga0495660_0006467 3300046810 Bacteria 6931
1141 Ga0495660_0009807 3300046810 Bacteria 5577
1142 Ga0495660_0028652 3300046810 Bacteria 3144
1143 Ga0495660_0058224 3300046810 Bacteria 2082
1144 Ga0495660_0075421 3300046810 Bacteria 1779
1145 Ga0495581_0037696 3300047315 Bacteria 2798
1146 Ga0495604_0020264 3300047317 Bacteria 5314
1147 Ga0495604_0024792 3300047317 Bacteria 4786
1148 Ga0495604_0047105 3300047317 Bacteria 3360
1149 Ga0495604_0077415 3300047317 Bacteria 2499
1150 Ga0495636_0004477 3300047318 Bacteria 5473
1151 Ga0495636_0006708 3300047318 Bacteria 4527
1152 Ga0495636_0052089 3300047318 Bacteria 1716
1153 Ga0495674_0001536 3300047319 Bacteria 22570
1154 Ga0495674_0284102 3300047319 Bacteria 1355
1155 Ga0495672_0000060 3300047320 Bacteria 214547
1156 Ga0495672_0000118 3300047320 Bacteria 124396
1157 Ga0495672_0000159 3300047320 Bacteria 98262
1158 Ga0495672_0000351 3300047320 Bacteria 59020
1159 Ga0495672_0000833 3300047320 Bacteria 32978
1160 Ga0495676_0034046 3300047321 Bacteria 4278
1161 Ga0495676_0107493 3300047321 Bacteria 2054
1162 Ga0495680_0011739 3300047322 Bacteria 7738
1163 Ga0495683_0000342 3300047323 Bacteria 38556
1164 Ga0495683_0001362 3300047323 Bacteria 16270
1165 Ga0495683_0010061 3300047323 Bacteria 5015
1166 Ga0495683_0024372 3300047323 Bacteria 3105
1167 Ga0495683_0025356 3300047323 Bacteria 3040
1168 Ga0495683_0035915 3300047323 Bacteria 2518
1169 Ga0495687_000047 3300047443 Bacteria 206452
1170 Ga0495687_000049 3300047443 Bacteria 205432
1171 Ga0495687_000088 3300047443 Bacteria 142499
1172 Ga0495687_000112 3300047443 Bacteria 124725
1173 Ga0495687_000832 3300047443 Bacteria 32951
1174 Ga0495687_001101 3300047443 Bacteria 26384
1175 Ga0495687_008674 3300047443 Bacteria 5790
1176 Ga0495675_0002560 3300047444 Bacteria 10889
1177 Ga0495677_0000044 3300047445 Bacteria 74340
1178 Ga0495677_0005907 3300047445 Bacteria 4636
1179 Ga0495677_0006367 3300047445 Bacteria 4459
1180 Ga0495677_0013878 3300047445 Bacteria 2933
1181 Ga0495677_0014784 3300047445 Bacteria 2839
1182 Ga0495677_0025466 3300047445 Bacteria 2146
1183 Ga0495677_0040880 3300047445 Bacteria 1695
1184 Ga0495679_004742 3300047446 Bacteria 6169
1185 Ga0495685_000039 3300047447 Bacteria 53918
1186 Ga0495685_011960 3300047447 Bacteria 2935
1187 Ga0495673_0000017 3300047469 Bacteria 574970
1188 Ga0495673_0000027 3300047469 Bacteria 475440
1189 Ga0495673_0000037 3300047469 Bacteria 307717
1190 Ga0495673_0028762 3300047469 Bacteria 2629
1191 Ga0495681_0001608 3300047470 Bacteria 16816
1192 Ga0495681_0010288 3300047470 Bacteria 5669
1193 Ga0495681_0014148 3300047470 Bacteria 4592
1194 Ga0495681_0022278 3300047470 Bacteria 3395
1195 Ga0495681_0024779 3300047470 Bacteria 3149
1196 Ga0495686_0000140 3300047472 Bacteria 144956
1197 Ga0495686_0000334 3300047472 Bacteria 77666
1198 Ga0495686_0000838 3300047472 Bacteria 39459
1199 Ga0495686_0017704 3300047472 Bacteria 4795
1200 Ga0495593_0017718 3300047673 Bacteria 4010
1201 Ga0495593_0061543 3300047673 Bacteria 1963
1202 Ga0495602_0002688 3300048088 Bacteria 18170
1203 Ga0495602_0253411 3300048088 Bacteria 1310
1204 Ga0495614_0062329 3300048089 Bacteria 1602
1205 Ga0495626_0000006 3300048091 Bacteria 284977
1206 Ga0495626_0000034 3300048091 Bacteria 183391
1207 Ga0495626_0000266 3300048091 Bacteria 59029
1208 Ga0495626_0004486 3300048091 Bacteria 8555
1209 Ga0495626_0006398 3300048091 Bacteria 6704
1210 Ga0495626_0013643 3300048091 Bacteria 4216
1211 Ga0495626_0018710 3300048091 Bacteria 3471
1212 Ga0496100_0019474 3300048903 Bacteria 4050
1213 Ga0496101_0094650 3300048904 Bacteria 2227
1214 Ga0496101_0235942 3300048904 Bacteria 1423
1215 Ga0496102_0000098 3300048905 Bacteria 123789
1216 Ga0496102_0000220 3300048905 Bacteria 75547
1217 Ga0496102_0021444 3300048905 Bacteria 5712
1218 Ga0496102_0057539 3300048905 Bacteria 3550
1219 Ga0496102_0066472 3300048905 Bacteria 3304
1220 Ga0496102_0099795 3300048905 Bacteria 2695
1221 Ga0496102_0101113 3300048905 Bacteria 2678
1222 Ga0496102_0250224 3300048905 Bacteria 1671
1223 Ga0496103_0004261 3300048906 Bacteria 8693
1224 Ga0496103_0060539 3300048906 Bacteria 2353
1225 Ga0496103_0069778 3300048906 Bacteria 2198
1226 Ga0496103_0085093 3300048906 Bacteria 1993
1227 Ga0496104_0010266 3300048907 Bacteria 8365
1228 Ga0496104_0099932 3300048907 Bacteria 2777
1229 Ga0496104_0107758 3300048907 Bacteria 2670
1230 Ga0496105_0101221 3300048908 Bacteria 2379
1231 Ga0496106_0009099 3300048909 Bacteria 7339
1232 Ga0496106_0079413 3300048909 Bacteria 2519
1233 Ga0496106_0191474 3300048909 Bacteria 1626
1234 Ga0496107_0008400 3300048910 Bacteria 7146
1235 Ga0496108_0025353 3300048911 Bacteria 4886
1236 Ga0496108_0085555 3300048911 Bacteria 2677
1237 Ga0496108_0156476 3300048911 Bacteria 1968
1238 Ga0496108_0213414 3300048911 Bacteria 1675
1239 Ga0496108_0223880 3300048911 Bacteria 1635
1240 Ga0496109_0009882 3300048912 Bacteria 8147
1241 Ga0496109_0037479 3300048912 Bacteria 4380
1242 Ga0496109_0189231 3300048912 Bacteria 1934
1243 Ga0496110_0002899 3300048913 Bacteria 12983
1244 Ga0496110_0042326 3300048913 Bacteria 3975
1245 Ga0496110_0160374 3300048913 Bacteria 2038
1246 Ga0496110_0179119 3300048913 Bacteria 1924
1247 Ga0496110_0242179 3300048913 Bacteria 1641
1248 Ga0496111_0026798 3300048914 Bacteria 4071
1249 Ga0496111_0041285 3300048914 Bacteria 3310
1250 Ga0496111_0243277 3300048914 Bacteria 1336
1251 Ga0496112_0162120 3300048915 Bacteria 2203
1252 Ga0496112_0199770 3300048915 Bacteria 1959
1253 Ga0496112_0215243 3300048915 Bacteria 1878
1254 Ga0496112_0228368 3300048915 Bacteria 1816
1255 Ga0496112_0383627 3300048915 Bacteria 1346
1256 Ga0496112_0512841 3300048915 Bacteria 1134
1257 Ga0496113_0001174 3300048916 Bacteria 14315
1258 Ga0496113_0044739 3300048916 Bacteria 3281
1259 Ga0496113_0194217 3300048916 Bacteria 1612
1260 Ga0496115_0005515 3300048918 Bacteria 9210
1261 Ga0496115_0058595 3300048918 Bacteria 3099
1262 Ga0496116_0017989 3300048919 Bacteria 5464
1263 Ga0496117_0000001 3300048920 Bacteria 2526244
1264 Ga0496118_0000008 3300048921 Bacteria 644537
1265 Ga0496118_0113947 3300048921 Bacteria 1784
1266 Ga0496119_0074646 3300048922 Bacteria 1974
1267 Ga0496120_0061138 3300048923 Bacteria 2104
1268 Ga0496121_0000894 3300048924 Bacteria 53831
1269 Ga0496121_0004217 3300048924 Bacteria 19593
1270 Ga0496121_0034213 3300048924 Bacteria 4577
1271 Ga0496121_0036748 3300048924 Bacteria 4359
1272 Ga0496121_0109336 3300048924 Bacteria 2113
1273 Ga0496122_0002399 3300048925 Bacteria 26741
1274 Ga0496122_0003354 3300048925 Bacteria 21106
1275 Ga0496122_0005566 3300048925 Bacteria 14917
1276 Ga0496122_0070897 3300048925 Bacteria 2486
1277 Ga0496122_0186258 3300048925 Bacteria 1231
1278 Ga0496123_0002554 3300048926 Bacteria 22188
1279 Ga0496123_0004083 3300048926 Bacteria 15709
1280 Ga0496123_0023175 3300048926 Bacteria 4758
1281 Ga0496123_0026774 3300048926 Bacteria 4311
1282 Ga0496123_0055763 3300048926 Bacteria 2589
1283 Ga0496123_0073215 3300048926 Bacteria 2126
1284 Ga0496124_0007558 3300048927 Bacteria 11528
1285 Ga0496124_0016583 3300048927 Bacteria 6991
1286 Ga0496124_0160405 3300048927 Bacteria 1753
1287 Ga0496124_0305830 3300048927 Bacteria 1146
1288 Ga0496125_0000093 3300048928 Bacteria 210896
1289 Ga0496125_0006029 3300048928 Bacteria 13256
1290 Ga0496125_0074425 3300048928 Bacteria 2633
1291 Ga0496125_0092146 3300048928 Bacteria 2267
1292 Ga0496126_0013325 3300048929 Bacteria 8370
1293 Ga0496126_0056801 3300048929 Bacteria 3536
1294 Ga0496126_0065612 3300048929 Bacteria 3248
1295 Ga0501309_004387 3300049129 Bacteria 1642
1296 Ga0501307_005598 3300049162 Bacteria 1330
1297 Ga0495678_000013 3300049459 Bacteria 316375
1298 Ga0495678_000424 3300049459 Bacteria 42503
1299 Ga0495678_000981 3300049459 Bacteria 24425
1300 Ga0495678_001101 3300049459 Bacteria 22735
1301 Ga0495678_018392 3300049459 Bacteria 3144
1302 Ga0495678_024112 3300049459 Bacteria 2632
1303 Ga0495682_0010647 3300049460 Bacteria 3552
1304 Ga0501323_002001 3300049539 Bacteria 1917
1305 Ga0501031_0010582 3300049568 Bacteria 6005
1306 Ga0501032_0080613 3300049569 Bacteria 2166
1307 Ga0501033_0004167 3300049570 Bacteria 11640
1308 Ga0501034_0143060 3300049571 Bacteria 2370
1309 Ga0501034_0266610 3300049571 Bacteria 1654
1310 Ga0501036_0005162 3300049572 Bacteria 10559
1311 Ga0501036_0101876 3300049572 Bacteria 2429
1312 Ga0501036_0128080 3300049572 Bacteria 2143
1313 Ga0501037_0008068 3300049573 Bacteria 7714
1314 Ga0501037_0072255 3300049573 Bacteria 2509
1315 Ga0501038_0016205 3300049574 Bacteria 6759
1316 Ga0501038_0130044 3300049574 Bacteria 2068
1317 Ga0501039_0004376 3300049575 Bacteria 10649
1318 Ga0501039_0164604 3300049575 Bacteria 1744
1319 Ga0501040_0261436 3300049576 Bacteria 1235
1320 Ga0501043_0023973 3300049579 Bacteria 4787
1321 Ga0501043_0151309 3300049579 Bacteria 1816
1322 Ga0501046_0023826 3300049580 Bacteria 5029
1323 Ga0501046_0047797 3300049580 Bacteria 3391
1324 Ga0501047_0045538 3300049581 Bacteria 4242
1325 Ga0501047_0091763 3300049581 Bacteria 2916
1326 Ga0501070_0019308 3300049586 Bacteria 5716
1327 Ga0501070_0073732 3300049586 Bacteria 2824
1328 Ga0501071_0112926 3300049587 Bacteria 2009
1329 Ga0501074_0100626 3300049590 Bacteria 2069
1330 Ga0501217_050877 3300049661 Bacteria 1083
1331 Ga0501230_006293 3300049667 Bacteria 1717
1332 Ga0501080_0021602 3300049742 Bacteria 5958
1333 Ga0501035_0002518 3300049822 Bacteria 17917
1334 Ga0501035_0004815 3300049822 Bacteria 12793
1335 Ga0501035_0046398 3300049822 Bacteria 3908
1336 Ga0501044_0038050 3300049823 Bacteria 5024
1337 Ga0501044_0087145 3300049823 Bacteria 3154
1338 Ga0501044_0137250 3300049823 Bacteria 2436
1339 nmdc:mga03683_1692_c2 3300050489 Bacteria 4950
1340 nmdc:mga0k408_50583_c1 3300050493 Bacteria 2406
1341 nmdc:mga05p37_182389_c1 3300050507 Bacteria 2553
1342 nmdc:mga05p37_99457_c1 3300050507 Bacteria 3582
1343 nmdc:mga08y16_349484_c1 3300050511 Bacteria 1519
1344 nmdc:mga0n895_138025_c1 3300050512 Bacteria 2465
1345 nmdc:mga0n895_339025_c1 3300050512 Bacteria 1523
1346 nmdc:mga0n895_7965_c1 3300050512 Bacteria 9138
1347 nmdc:mga0rr50_128358_c1 3300050513 Bacteria 2027
1348 nmdc:mga0rr50_55269_c1 3300050513 Bacteria 2961
1349 nmdc:mga0rr50_8812_c1 3300050513 Bacteria 6296
1350 nmdc:mga08x19_231006_c1 3300050514 Bacteria 1273
1351 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
1352 nmdc:mga0a205_16634_c1 3300050515 Bacteria 6888
1353 nmdc:mga0a205_5666_c1 3300050515 Bacteria 11253
1354 Ga0495601_0009873 3300053077 Bacteria 5652
1355 Ga0495601_0027642 3300053077 Bacteria 3508
1356 Ga0495601_0086688 3300053077 Bacteria 2012
1357 Ga0495595_0050552 3300053084 Bacteria 1925
1358 Ga0495619_0042239 3300053085 Bacteria 2985
1359 Ga0500581_040622 3300053089 Bacteria 2383
1360 Ga0500566_0000066 3300053094 Bacteria 50309
1361 Ga0500641_0055865 3300053096 Bacteria 1635
1362 Ga0500556_0000058 3300053104 Bacteria 114257
1363 Ga0500618_000769 3300053125 Bacteria 18126
1364 Ga0500618_000965 3300053125 Bacteria 14663
1365 Ga0500652_001533 3300053131 Bacteria 7081
1366 Ga0500658_0097416 3300053134 Bacteria 1280
1367 Ga0500559_0006778 3300053136 Bacteria 5142
1368 Ga0500574_000073 3300053141 Bacteria 11348
1369 Ga0500616_0000031 3300053153 Bacteria 415013
1370 Ga0500616_0000166 3300053153 Bacteria 110141
1371 Ga0500616_0001080 3300053153 Bacteria 28464
1372 Ga0500622_0000783 3300053156 Bacteria 27611
1373 Ga0500636_0008090 3300053177 Bacteria 6087
1374 Ga0500636_0023610 3300053177 Bacteria 3635
1375 Ga0587069_001415 3300059642 Bacteria 2196
1376 Ga0587076_017365 3300059645 Bacteria 1146
1377 Ga0587079_006406 3300059647 Bacteria 1713

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0085555 Ga0496108_0085555_925_1935 309
2 3300044706 Ga0466964_0002817 Ga0466964_0002817_2998_4026 313
3 3300045976 Ga0466967_0016460 Ga0466967_0016460_609_1637 313
4 3300046473 Ga0495582_0003581 Ga0495582_0003581_7176_8186 313
5 3300046499 Ga0495594_0029232 Ga0495594_0029232_323_1333 313
6 3300046557 Ga0495622_0011293 Ga0495622_0011293_1773_2783 313
7 3300046684 Ga0495669_0000168 Ga0495669_0000168_6074_7084 313
8 3300049568 Ga0501031_0010582 Ga0501031_0010582_33_1034 313
9 3300049571 Ga0501034_0143060 Ga0501034_0143060_641_1642 313
10 3300049572 Ga0501036_0005162 Ga0501036_0005162_4356_5357 313
11 3300049572 Ga0501036_0128080 Ga0501036_0128080_502_1503 313
12 3300049573 Ga0501037_0008068 Ga0501037_0008068_4437_5438 313
13 3300049574 Ga0501038_0016205 Ga0501038_0016205_2050_3051 313
14 3300049574 Ga0501038_0130044 Ga0501038_0130044_685_1686 313
15 3300049575 Ga0501039_0004376 Ga0501039_0004376_4894_5895 313
16 3300049586 Ga0501070_0019308 Ga0501070_0019308_4217_5218 313
17 3300049586 Ga0501070_0073732 Ga0501070_0073732_919_1920 313
18 3300049587 Ga0501071_0112926 Ga0501071_0112926_230_1231 313
19 3300049822 Ga0501035_0046398 Ga0501035_0046398_2124_3125 313
20 3300037418 Ga0395900_0247888 Ga0395900_0247888_554_1579 314
21 3300037466 Ga0395898_0265677 Ga0395898_0265677_392_1417 314
22 3300046665 Ga0495661_0003800 Ga0495661_0003800_9104_10108 314
23 3300048905 Ga0496102_0250224 Ga0496102_0250224_237_1262 314
24 3300048916 Ga0496113_0194217 Ga0496113_0194217_612_1598 314
25 3300048927 Ga0496124_0007558 Ga0496124_0007558_1760_2788 314
26 3300048927 Ga0496124_0305830 Ga0496124_0305830_14_997 314
27 3300025945 Ga0207679_10379712 Ga0207679_103797121 315
28 3300042005 Ga0439448_0001500 Ga0439448_0001500_3936_4964 315
29 3300042012 Ga0439455_0017270 Ga0439455_0017270_503_1531 315
30 3300042157 Ga0439458_0006360 Ga0439458_0006360_192_1220 315
31 3300044842 Ga0466957_0006602 Ga0466957_0006602_1835_2935 315
32 3300005293 Ga0065715_10111850 Ga0065715_101118501 316
33 3300005328 Ga0070676_10011843 Ga0070676_100118433 316
34 3300005330 Ga0070690_100169679 Ga0070690_1001696791 316
35 3300005331 Ga0070670_100064592 Ga0070670_1000645923 316
36 3300005335 Ga0070666_10000702 Ga0070666_1000070215 316
37 3300005338 Ga0068868_100000679 Ga0068868_10000067919 316
38 3300005347 Ga0070668_100000613 Ga0070668_10000061310 316
39 3300005353 Ga0070669_100000169 Ga0070669_10000016939 316
40 3300005354 Ga0070675_100001515 Ga0070675_10000151514 316
41 3300005355 Ga0070671_100057014 Ga0070671_1000570143 316
42 3300005364 Ga0070673_100000466 Ga0070673_1000004668 316
43 3300005367 Ga0070667_100001660 Ga0070667_10000166015 316
44 3300005456 Ga0070678_100000359 Ga0070678_10000035913 316
45 3300005459 Ga0068867_100020394 Ga0068867_1000203944 316
46 3300005543 Ga0070672_100000363 Ga0070672_1000003634 316
47 3300005548 Ga0070665_100003481 Ga0070665_1000034818 316
48 3300005617 Ga0068859_100001763 Ga0068859_1000017639 316
49 3300005618 Ga0068864_100015090 Ga0068864_1000150903 316
50 3300005841 Ga0068863_100005760 Ga0068863_10000576010 316
51 3300005843 Ga0068860_100014757 Ga0068860_1000147573 316
52 3300006237 Ga0097621_100000850 Ga0097621_10000085015 316
53 3300006358 Ga0068871_100000242 Ga0068871_10000024224 316
54 3300006881 Ga0068865_100009857 Ga0068865_1000098573 316
55 3300006931 Ga0097620_100001763 Ga0097620_1000017639 316
56 3300009098 Ga0105245_10360793 Ga0105245_103607931 316
57 3300009177 Ga0105248_10005028 Ga0105248_100050287 316
58 3300013306 Ga0163162_10001767 Ga0163162_100017677 316
59 3300013308 Ga0157375_10001878 Ga0157375_1000187813 316
60 3300014968 Ga0157379_10005542 Ga0157379_1000554210 316
61 3300025315 Ga0207697_10003849 Ga0207697_100038494 316
62 3300025903 Ga0207680_10001229 Ga0207680_1000122911 316
63 3300025907 Ga0207645_10016958 Ga0207645_100169583 316
64 3300025925 Ga0207650_10046077 Ga0207650_100460772 316
65 3300025926 Ga0207659_10001002 Ga0207659_100010023 316
66 3300025931 Ga0207644_10041745 Ga0207644_100417453 316
67 3300025938 Ga0207704_10173011 Ga0207704_101730111 316
68 3300025940 Ga0207691_10000250 Ga0207691_1000025037 316
69 3300025941 Ga0207711_10004442 Ga0207711_100044426 316
70 3300025942 Ga0207689_10032006 Ga0207689_100320062 316
71 3300025972 Ga0207668_10001922 Ga0207668_100019229 316
72 3300025986 Ga0207658_10001054 Ga0207658_1000105415 316
73 3300026023 Ga0207677_10005852 Ga0207677_100058527 316
74 3300026041 Ga0207639_10107478 Ga0207639_101074782 316
75 3300026088 Ga0207641_10004911 Ga0207641_100049112 316
76 3300026089 Ga0207648_10000812 Ga0207648_1000081237 316
77 3300026095 Ga0207676_10010013 Ga0207676_100100136 316
78 3300026118 Ga0207675_100139696 Ga0207675_1001396962 316
79 3300026121 Ga0207683_10000135 Ga0207683_1000013515 316
80 3300028379 Ga0268266_10004460 Ga0268266_100044609 316
81 3300028381 Ga0268264_10001218 Ga0268264_1000121815 316
82 3300046474 Ga0495605_0000085 Ga0495605_0000085_101221_102252 316
83 3300046501 Ga0495607_0007031 Ga0495607_0007031_274_1305 316
84 3300046519 Ga0495632_0060042 Ga0495632_0060042_81_1112 316
85 3300046522 Ga0495643_0017464 Ga0495643_0017464_2889_3920 316
86 3300046694 Ga0495649_0005677 Ga0495649_0005677_6108_7139 316
87 3300046794 Ga0495589_0000146 Ga0495589_0000146_56856_57887 316
88 3300046810 Ga0495660_0000423 Ga0495660_0000423_24044_25075 316
89 3300047320 Ga0495672_0000833 Ga0495672_0000833_25060_26091 316
90 3300047323 Ga0495683_0025356 Ga0495683_0025356_1621_2652 316
91 3300047443 Ga0495687_001101 Ga0495687_001101_13804_14835 316
92 3300047445 Ga0495677_0006367 Ga0495677_0006367_2705_3736 316
93 3300048091 Ga0495626_0000006 Ga0495626_0000006_250965_251996 316
94 3300053177 Ga0500636_0023610 Ga0500636_0023610_1684_2679 316
95 3300049571 Ga0501034_0266610 Ga0501034_0266610_678_1640 317
96 3300005366 Ga0070659_100034557 Ga0070659_1000345572 318
97 3300006946 Ga0079104_1009676 Ga0079104_10096761 318
98 3300025919 Ga0207657_10005841 Ga0207657_1000584114 318
99 3300031251 Ga0265327_10000184 Ga0265327_1000018457 318
100 3300037418 Ga0395900_0001738 Ga0395900_0001738_7722_8750 318
101 3300048905 Ga0496102_0099795 Ga0496102_0099795_853_1881 318
102 3300048906 Ga0496103_0069778 Ga0496103_0069778_232_1260 318
103 3300048915 Ga0496112_0199770 Ga0496112_0199770_584_1588 318
104 3300048925 Ga0496122_0003354 Ga0496122_0003354_3030_4034 318
105 3300048926 Ga0496123_0002554 Ga0496123_0002554_17185_18189 318
106 3300048928 Ga0496125_0006029 Ga0496125_0006029_8146_9150 318
107 3300005563 Ga0068855_100168021 Ga0068855_1001680212 319
108 3300013297 Ga0157378_10113150 Ga0157378_101131503 319
109 3300025949 Ga0207667_10101473 Ga0207667_101014732 319
110 3300037471 Ga0395905_0023198 Ga0395905_0023198_1184_2191 319
111 3300045049 Ga0466959_0071183 Ga0466959_0071183_1110_2138 319
112 3300048912 Ga0496109_0189231 Ga0496109_0189231_61_1089 319
113 3300048915 Ga0496112_0162120 Ga0496112_0162120_662_1690 319
114 3300048916 Ga0496113_0044739 Ga0496113_0044739_376_1404 319
115 3300048925 Ga0496122_0005566 Ga0496122_0005566_9541_10569 319
116 3300048926 Ga0496123_0055763 Ga0496123_0055763_130_1158 319
117 3300048928 Ga0496125_0092146 Ga0496125_0092146_138_1166 319
118 3300005367 Ga0070667_100297034 Ga0070667_1002970342 320
119 3300025321 Ga0207656_10028498 Ga0207656_100284982 320
120 3300044712 Ga0453684_0000006 Ga0453684_0000006_40753_41748 320
121 3300046463 Ga0495653_0092078 Ga0495653_0092078_1050_2048 320
122 3300046472 Ga0495580_0039498 Ga0495580_0039498_2029_3027 320
123 3300046473 Ga0495582_0002941 Ga0495582_0002941_3276_4274 320
124 3300046535 Ga0495586_0007863 Ga0495586_0007863_3335_4333 320
125 3300046536 Ga0495587_0018631 Ga0495587_0018631_175_1173 320
126 3300046674 Ga0495588_0087465 Ga0495588_0087465_469_1467 320
127 3300046679 Ga0495623_0001059 Ga0495623_0001059_11494_12492 320
128 3300047317 Ga0495604_0020264 Ga0495604_0020264_3434_4432 320
129 3300048091 Ga0495626_0000034 Ga0495626_0000034_105385_106380 320
130 iso_pu_bacteria 2643221556 2643797856 320
131 iso_pu_bacteria 2643221684 2644473036 320
132 iso_pu_bacteria 8047673197 8047677858 320
133 3300003759 Ga0055525_1000009 Ga0055525_1000009248 321
134 3300005262 Ga0065165_1023858 Ga0065165_10238582 321
135 3300025230 Ga0209563_100015 Ga0209563_100015362 321
136 3300037471 Ga0395905_0010966 Ga0395905_0010966_4187_5164 321
137 3300044656 Ga0466969_0045016 Ga0466969_0045016_999_2027 321
138 3300044658 Ga0466972_0007507 Ga0466972_0007507_2916_3914 321
139 3300044683 Ga0466965_0012390 Ga0466965_0012390_82_1110 321
140 3300044684 Ga0466966_0015329 Ga0466966_0015329_879_1907 321
141 3300044706 Ga0466964_0004462 Ga0466964_0004462_1437_2444 321
142 3300044735 Ga0466968_0001997 Ga0466968_0001997_5396_6403 321
143 3300044842 Ga0466957_0067943 Ga0466957_0067943_227_1225 321
144 3300045051 Ga0451576_0355984 Ga0451576_0355984_486_1496 321
145 3300046491 Ga0495584_0000282 Ga0495584_0000282_22429_23448 321
146 3300046501 Ga0495607_0014625 Ga0495607_0014625_181_1209 321
147 3300046507 Ga0495606_0051389 Ga0495606_0051389_744_1763 321
148 3300046522 Ga0495643_0115365 Ga0495643_0115365_60_1088 321
149 3300046665 Ga0495661_0000669 Ga0495661_0000669_22684_23703 321
150 3300046810 Ga0495660_0075421 Ga0495660_0075421_180_1193 321
151 3300047443 Ga0495687_000112 Ga0495687_000112_32088_33107 321
152 3300047445 Ga0495677_0013878 Ga0495677_0013878_1648_2676 321
153 3300048914 Ga0496111_0243277 Ga0496111_0243277_188_1204 321
154 3300048926 Ga0496123_0004083 Ga0496123_0004083_11244_12263 321
155 3300006186 Ga0075369_10030676 Ga0075369_100306763 322
156 3300031239 Ga0265328_10004680 Ga0265328_100046805 322
157 3300031250 Ga0265331_10012966 Ga0265331_100129663 322
158 3300031251 Ga0265327_10000120 Ga0265327_1000012052 322
159 3300036647 Ga0316582_0058070 Ga0316582_0058070_1017_2003 322
160 3300037471 Ga0395905_0410001 Ga0395905_0410001_12_1022 322
161 3300046454 Ga0495592_0156382 Ga0495592_0156382_63_1043 322
162 3300046462 Ga0495651_0007016 Ga0495651_0007016_2947_3927 322
163 3300046463 Ga0495653_0009244 Ga0495653_0009244_4290_5270 322
164 3300046471 Ga0495650_0003026 Ga0495650_0003026_10000_10992 322
165 3300046471 Ga0495650_0003026 Ga0495650_0003026_11138_12130 322
166 3300046511 Ga0495608_0088230 Ga0495608_0088230_119_1099 322
167 3300046516 Ga0495628_0006927 Ga0495628_0006927_3407_4387 322
168 3300046516 Ga0495628_0282003 Ga0495628_0282003_128_1108 322
169 3300046529 Ga0495652_0001279 Ga0495652_0001279_7435_8415 322
170 3300046529 Ga0495652_0002634 Ga0495652_0002634_5420_6400 322
171 3300046529 Ga0495652_0073344 Ga0495652_0073344_386_1366 322
172 3300046543 Ga0495645_0001835 Ga0495645_0001835_9301_10281 322
173 3300046543 Ga0495645_0071721 Ga0495645_0071721_338_1318 322
174 3300046674 Ga0495588_0000135 Ga0495588_0000135_26088_27113 322
175 3300046675 Ga0495657_0180007 Ga0495657_0180007_249_1229 322
176 3300046678 Ga0495599_0003373 Ga0495599_0003373_5301_6281 322
177 3300046680 Ga0495646_0003807 Ga0495646_0003807_6499_7479 322
178 3300046680 Ga0495646_0101648 Ga0495646_0101648_90_1070 322
179 3300048088 Ga0495602_0002688 Ga0495602_0002688_12023_13003 322
180 3300048928 Ga0496125_0074425 Ga0496125_0074425_899_1882 322
181 3300053077 Ga0495601_0086688 Ga0495601_0086688_146_1126 322
182 3300053141 Ga0500574_000073 Ga0500574_000073_5608_6588 322
183 iso_pu_bacteria 2808606418 2809144345 322
184 3300009148 Ga0105243_10431081 Ga0105243_104310811 323
185 3300037418 Ga0395900_0000729 Ga0395900_0000729_32922_33947 323
186 3300038443 Ga0395901_0000073 Ga0395901_0000073_124558_125583 323
187 3300046460 Ga0495638_0025361 Ga0495638_0025361_350_1342 323
188 3300046471 Ga0495650_0000399 Ga0495650_0000399_53390_54388 323
189 3300046474 Ga0495605_0125122 Ga0495605_0125122_69_1061 323
190 3300046506 Ga0495583_0001606 Ga0495583_0001606_12272_13264 323
191 3300046507 Ga0495606_0000037 Ga0495606_0000037_153517_154506 323
192 3300046513 Ga0495616_0000412 Ga0495616_0000412_29311_30366 323
193 3300046513 Ga0495616_0108379 Ga0495616_0108379_40_1032 323
194 3300046522 Ga0495643_0000183 Ga0495643_0000183_57004_57996 323
195 3300046523 Ga0495644_0053389 Ga0495644_0053389_33_1043 323
196 3300046665 Ga0495661_0017654 Ga0495661_0017654_3524_4516 323
197 3300046691 Ga0495670_0048952 Ga0495670_0048952_670_1662 323
198 3300047320 Ga0495672_0000060 Ga0495672_0000060_23177_24190 323
199 3300047472 Ga0495686_0000838 Ga0495686_0000838_5612_6619 323
200 3300049459 Ga0495678_001101 Ga0495678_001101_19058_20053 323
201 3300049459 Ga0495678_018392 Ga0495678_018392_1301_2299 323
202 3300049573 Ga0501037_0072255 Ga0501037_0072255_1264_2256 323
203 iso_pu_bacteria 2600255292 2601670640 323
204 iso_pu_bacteria 2643221645 2644250884 323
205 iso_pu_bacteria 2643221664 2644356303 323
206 iso_pu_bacteria 2713897090 2715499195 323
207 iso_pu_bacteria 2738541280 2738739055 323
208 iso_pu_bacteria 2738541297 2738825453 323
209 iso_pu_bacteria 2738541300 2738846287 323
210 iso_pu_bacteria 2738541357 2739149250 323
211 iso_pu_bacteria 2738543003 2739191169 323
212 iso_pu_bacteria 2738543018 2739275064 323
213 iso_pu_bacteria 2738543026 2739317646 323
214 iso_pu_bacteria 2738543029 2739335887 323
215 iso_pu_bacteria 2738543030 2739344108 323
216 iso_pu_bacteria 2821131069 2821134046 323
217 iso_pu_bacteria 2842711865 2842717934 323
218 iso_pu_bacteria 2857547612 2857548015 323
219 iso_pu_bacteria 2857558681 2857561128 323
220 iso_pu_bacteria 2857564685 2857565858 323
221 iso_pu_bacteria 2904424332 2904429148 323
222 iso_pu_bacteria 2932410948 2932412606 323
223 iso_pu_bacteria 2932416698 2932420121 323
224 3300002738 JGI25154J39366_1000646 JGI25154J39366_100064613 324
225 3300002774 JGI25150J39212_1001175 JGI25150J39212_10011753 324
226 3300003544 Ga0007417J51691_1050103 Ga0007417J51691_10501031 324
227 3300003763 Ga0055529_1000127 Ga0055529_10001276 324
228 3300003771 Ga0055526_1000119 Ga0055526_100011948 324
229 3300003771 Ga0055526_1000129 Ga0055526_100012923 324
230 3300003771 Ga0055526_1002032 Ga0055526_100203212 324
231 3300003773 Ga0055537_1000156 Ga0055537_100015619 324
232 3300003773 Ga0055537_1000223 Ga0055537_100022325 324
233 3300003773 Ga0055537_1000427 Ga0055537_10004276 324
234 3300003775 Ga0055524_1000029 Ga0055524_1000029120 324
235 3300003775 Ga0055524_1000824 Ga0055524_100082412 324
236 3300003784 Ga0055534_1000230 Ga0055534_100023020 324
237 3300003790 Ga0055528_1000341 Ga0055528_100034111 324
238 3300005288 Ga0065714_10131016 Ga0065714_101310161 324
239 3300005354 Ga0070675_100374755 Ga0070675_1003747551 324
240 3300005457 Ga0070662_100057012 Ga0070662_1000570122 324
241 3300005563 Ga0068855_100102200 Ga0068855_1001022001 324
242 3300005563 Ga0068855_100389409 Ga0068855_1003894092 324
243 3300005616 Ga0068852_100216050 Ga0068852_1002160501 324
244 3300005718 Ga0068866_10122356 Ga0068866_101223562 324
245 3300006881 Ga0068865_100058664 Ga0068865_1000586643 324
246 3300006948 Ga0099826_10000003 Ga0099826_10000003485 324
247 3300009036 Ga0105244_10000480 Ga0105244_1000048013 324
248 3300009036 Ga0105244_10011204 Ga0105244_100112044 324
249 3300009036 Ga0105244_10068490 Ga0105244_100684901 324
250 3300009098 Ga0105245_10088768 Ga0105245_100887683 324
251 3300009174 Ga0105241_10019216 Ga0105241_100192162 324
252 3300011119 Ga0105246_10056249 Ga0105246_100562493 324
253 3300014497 Ga0182008_10030341 Ga0182008_100303412 324
254 3300015261 Ga0182006_1000014 Ga0182006_100001424 324
255 3300015262 Ga0182007_10000011 Ga0182007_100000113 324
256 3300015265 Ga0182005_1000014 Ga0182005_100001425 324
257 3300017792 Ga0163161_10011439 Ga0163161_100114392 324
258 3300017792 Ga0163161_10100089 Ga0163161_101000892 324
259 3300021361 Ga0213872_10000002 Ga0213872_10000002477 324
260 3300021361 Ga0213872_10001185 Ga0213872_1000118515 324
261 3300021361 Ga0213872_10003823 Ga0213872_100038232 324
262 3300021361 Ga0213872_10019757 Ga0213872_100197572 324
263 3300021384 Ga0213876_10037332 Ga0213876_100373323 324
264 3300025233 Ga0209437_106034 Ga0209437_1060341 324
265 3300025233 Ga0209437_113411 Ga0209437_1134111 324
266 3300025245 Ga0207425_1001662 Ga0207425_10016623 324
267 3300025246 Ga0209646_1000047 Ga0209646_100004713 324
268 3300025263 Ga0209565_1000006 Ga0209565_1000006202 324
269 3300025263 Ga0209565_1004584 Ga0209565_10045842 324
270 3300025272 Ga0209455_1000051 Ga0209455_1000051216 324
271 3300025273 Ga0209673_1000004 Ga0209673_1000004627 324
272 3300025291 Ga0209675_1000006 Ga0209675_1000006201 324
273 3300025294 Ga0209025_1007826 Ga0209025_10078264 324
274 3300025295 Ga0209564_1000006 Ga0209564_1000006393 324
275 3300025295 Ga0209564_1000038 Ga0209564_1000038321 324
276 3300025295 Ga0209564_1000064 Ga0209564_100006476 324
277 3300025297 Ga0209758_1001064 Ga0209758_100106437 324
278 3300025299 Ga0209256_1000013 Ga0209256_100001383 324
279 3300025299 Ga0209256_1000179 Ga0209256_1000179112 324
280 3300025728 Ga0207655_1009262 Ga0207655_10092624 324
281 3300025909 Ga0207705_10002897 Ga0207705_100028973 324
282 3300025911 Ga0207654_10010071 Ga0207654_100100712 324
283 3300025919 Ga0207657_10035654 Ga0207657_100356544 324
284 3300025920 Ga0207649_10122979 Ga0207649_101229792 324
285 3300025933 Ga0207706_10029415 Ga0207706_100294154 324
286 3300025934 Ga0207686_10018025 Ga0207686_100180252 324
287 3300025935 Ga0207709_10007318 Ga0207709_100073185 324
288 3300025945 Ga0207679_10018817 Ga0207679_100188175 324
289 3300027666 Ga0209282_1000002 Ga0209282_1000002513 324
290 3300028794 Ga0307515_10129488 Ga0307515_101294882 324
291 3300030731 Ga0316177_1094480 Ga0316177_10944801 324
292 3300031711 Ga0265314_10009432 Ga0265314_100094323 324
293 3300031711 Ga0265314_10050813 Ga0265314_100508132 324
294 3300031727 Ga0316576_10100039 Ga0316576_101000392 324
295 3300031728 Ga0316578_10016384 Ga0316578_100163846 324
296 3300033528 Ga0316588_1018741 Ga0316588_10187412 324
297 3300037312 Ga0395899_0052470 Ga0395899_0052470_994_2022 324
298 3300037418 Ga0395900_0096018 Ga0395900_0096018_1001_2029 324
299 3300037418 Ga0395900_0260678 Ga0395900_0260678_177_1205 324
300 3300037418 Ga0395900_0308171 Ga0395900_0308171_72_1097 324
301 3300037466 Ga0395898_0165475 Ga0395898_0165475_104_1132 324
302 3300037471 Ga0395905_0101001 Ga0395905_0101001_703_1728 324
303 3300037471 Ga0395905_0172013 Ga0395905_0172013_512_1504 324
304 3300038443 Ga0395901_0001782 Ga0395901_0001782_5425_6453 324
305 3300039447 Ga0436361_0594091 Ga0436361_0594091_27542_28528 324
306 3300039447 Ga0436361_0738173 Ga0436361_0738173_1068_2054 324
307 3300039447 Ga0436361_1043665 Ga0436361_1043665_2627_3613 324
308 3300039447 Ga0436361_1068376 Ga0436361_1068376_2619_3605 324
309 3300042005 Ga0439448_0002930 Ga0439448_0002930_1994_3022 324
310 3300044683 Ga0466965_0035262 Ga0466965_0035262_35_1063 324
311 3300044693 Ga0466961_0096127 Ga0466961_0096127_112_1140 324
312 3300044735 Ga0466968_0053588 Ga0466968_0053588_411_1397 324
313 3300044842 Ga0466957_0000747 Ga0466957_0000747_14562_15590 324
314 3300044842 Ga0466957_0187862 Ga0466957_0187862_194_1222 324
315 3300045836 Ga0466958_0184054 Ga0466958_0184054_58_1086 324
316 3300045976 Ga0466967_0012639 Ga0466967_0012639_1114_2142 324
317 3300046452 Ga0495617_000007 Ga0495617_000007_300638_301624 324
318 3300046457 Ga0495590_0000004 Ga0495590_0000004_33978_34964 324
319 3300046460 Ga0495638_0000023 Ga0495638_0000023_82184_83170 324
320 3300046460 Ga0495638_0020398 Ga0495638_0020398_3280_4272 324
321 3300046460 Ga0495638_0110211 Ga0495638_0110211_274_1260 324
322 3300046463 Ga0495653_0000042 Ga0495653_0000042_84020_85006 324
323 3300046471 Ga0495650_0000151 Ga0495650_0000151_68572_69558 324
324 3300046471 Ga0495650_0000215 Ga0495650_0000215_70995_71981 324
325 3300046471 Ga0495650_0000357 Ga0495650_0000357_39478_40464 324
326 3300046471 Ga0495650_0000579 Ga0495650_0000579_4100_5086 324
327 3300046471 Ga0495650_0007857 Ga0495650_0007857_3055_4041 324
328 3300046474 Ga0495605_0000015 Ga0495605_0000015_52933_53919 324
329 3300046474 Ga0495605_0083975 Ga0495605_0083975_350_1336 324
330 3300046491 Ga0495584_0000956 Ga0495584_0000956_12014_13000 324
331 3300046491 Ga0495584_0005836 Ga0495584_0005836_2562_3554 324
332 3300046492 Ga0495585_0006644 Ga0495585_0006644_981_1967 324
333 3300046492 Ga0495585_0022006 Ga0495585_0022006_1748_2734 324
334 3300046500 Ga0495596_0000902 Ga0495596_0000902_14747_15751 324
335 3300046501 Ga0495607_0004205 Ga0495607_0004205_1966_2952 324
336 3300046501 Ga0495607_0031667 Ga0495607_0031667_357_1349 324
337 3300046501 Ga0495607_0039867 Ga0495607_0039867_446_1432 324
338 3300046506 Ga0495583_0000004 Ga0495583_0000004_36570_37556 324
339 3300046506 Ga0495583_0000093 Ga0495583_0000093_68203_69189 324
340 3300046507 Ga0495606_0000290 Ga0495606_0000290_26342_27328 324
341 3300046507 Ga0495606_0000331 Ga0495606_0000331_65540_66526 324
342 3300046507 Ga0495606_0001806 Ga0495606_0001806_25762_26748 324
343 3300046507 Ga0495606_0062952 Ga0495606_0062952_498_1484 324
344 3300046512 Ga0495610_0000004 Ga0495610_0000004_724227_725213 324
345 3300046512 Ga0495610_0003295 Ga0495610_0003295_308_1294 324
346 3300046512 Ga0495610_0016633 Ga0495610_0016633_814_1800 324
347 3300046512 Ga0495610_0034857 Ga0495610_0034857_775_1761 324
348 3300046513 Ga0495616_0005744 Ga0495616_0005744_2445_3431 324
349 3300046513 Ga0495616_0031060 Ga0495616_0031060_1518_2510 324
350 3300046520 Ga0495637_0000338 Ga0495637_0000338_31261_32247 324
351 3300046522 Ga0495643_0000681 Ga0495643_0000681_15188_16174 324
352 3300046522 Ga0495643_0001242 Ga0495643_0001242_20679_21665 324
353 3300046524 Ga0495648_0000025 Ga0495648_0000025_163884_164870 324
354 3300046524 Ga0495648_0001128 Ga0495648_0001128_14003_15007 324
355 3300046524 Ga0495648_0008204 Ga0495648_0008204_3750_4736 324
356 3300046524 Ga0495648_0018513 Ga0495648_0018513_2520_3506 324
357 3300046524 Ga0495648_0023511 Ga0495648_0023511_2249_3235 324
358 3300046524 Ga0495648_0042060 Ga0495648_0042060_766_1752 324
359 3300046530 Ga0495654_0000004 Ga0495654_0000004_449883_450869 324
360 3300046530 Ga0495654_0019773 Ga0495654_0019773_2514_3500 324
361 3300046538 Ga0495609_0000268 Ga0495609_0000268_28571_29575 324
362 3300046538 Ga0495609_0001284 Ga0495609_0001284_15069_16055 324
363 3300046538 Ga0495609_0002231 Ga0495609_0002231_4185_5177 324
364 3300046542 Ga0495597_0000295 Ga0495597_0000295_29792_30778 324
365 3300046557 Ga0495622_0000007 Ga0495622_0000007_31981_32967 324
366 3300046557 Ga0495622_0000063 Ga0495622_0000063_64981_65967 324
367 3300046558 Ga0495633_0000107 Ga0495633_0000107_84780_85766 324
368 3300046558 Ga0495633_0000234 Ga0495633_0000234_1100_2086 324
369 3300046558 Ga0495633_0003009 Ga0495633_0003009_9378_10376 324
370 3300046558 Ga0495633_0003567 Ga0495633_0003567_7404_8390 324
371 3300046616 Ga0495668_0000177 Ga0495668_0000177_21725_22711 324
372 3300046616 Ga0495668_0000198 Ga0495668_0000198_55503_56489 324
373 3300046616 Ga0495668_0008440 Ga0495668_0008440_1011_1997 324
374 3300046616 Ga0495668_0030377 Ga0495668_0030377_99_1091 324
375 3300046648 Ga0495611_0008084 Ga0495611_0008084_1110_2096 324
376 3300046660 Ga0495625_0000123 Ga0495625_0000123_31519_32505 324
377 3300046660 Ga0495625_0027675 Ga0495625_0027675_2524_3516 324
378 3300046660 Ga0495625_0034998 Ga0495625_0034998_1680_2666 324
379 3300046664 Ga0495659_0000206 Ga0495659_0000206_19161_20147 324
380 3300046664 Ga0495659_0001065 Ga0495659_0001065_4853_5845 324
381 3300046665 Ga0495661_0093720 Ga0495661_0093720_532_1518 324
382 3300046665 Ga0495661_0101400 Ga0495661_0101400_293_1285 324
383 3300046684 Ga0495669_0002466 Ga0495669_0002466_1968_2960 324
384 3300046691 Ga0495670_0007526 Ga0495670_0007526_2478_3464 324
385 3300046691 Ga0495670_0015818 Ga0495670_0015818_1886_2872 324
386 3300046694 Ga0495649_0003503 Ga0495649_0003503_1950_2942 324
387 3300046794 Ga0495589_0018675 Ga0495589_0018675_2169_3173 324
388 3300046810 Ga0495660_0006467 Ga0495660_0006467_2847_3833 324
389 3300047318 Ga0495636_0004477 Ga0495636_0004477_592_1578 324
390 3300047318 Ga0495636_0006708 Ga0495636_0006708_3524_4510 324
391 3300047318 Ga0495636_0052089 Ga0495636_0052089_93_1085 324
392 3300047320 Ga0495672_0000159 Ga0495672_0000159_36970_37956 324
393 3300047320 Ga0495672_0000351 Ga0495672_0000351_55274_56278 324
394 3300047323 Ga0495683_0010061 Ga0495683_0010061_3768_4772 324
395 3300047323 Ga0495683_0035915 Ga0495683_0035915_383_1369 324
396 3300047443 Ga0495687_000832 Ga0495687_000832_17642_18628 324
397 3300047443 Ga0495687_008674 Ga0495687_008674_3498_4484 324
398 3300047445 Ga0495677_0014784 Ga0495677_0014784_632_1624 324
399 3300047445 Ga0495677_0040880 Ga0495677_0040880_378_1364 324
400 3300047446 Ga0495679_004742 Ga0495679_004742_2419_3405 324
401 3300047447 Ga0495685_000039 Ga0495685_000039_41860_42846 324
402 3300047447 Ga0495685_011960 Ga0495685_011960_1100_2092 324
403 3300047469 Ga0495673_0000017 Ga0495673_0000017_400905_401891 324
404 3300047469 Ga0495673_0000027 Ga0495673_0000027_225590_226576 324
405 3300047469 Ga0495673_0000037 Ga0495673_0000037_175567_176553 324
406 3300047469 Ga0495673_0028762 Ga0495673_0028762_294_1280 324
407 3300047470 Ga0495681_0010288 Ga0495681_0010288_4358_5350 324
408 3300047472 Ga0495686_0000334 Ga0495686_0000334_37559_38563 324
409 3300048091 Ga0495626_0004486 Ga0495626_0004486_5339_6343 324
410 3300048905 Ga0496102_0000220 Ga0496102_0000220_29698_30684 324
411 3300048905 Ga0496102_0021444 Ga0496102_0021444_3200_4186 324
412 3300048905 Ga0496102_0101113 Ga0496102_0101113_305_1333 324
413 3300048906 Ga0496103_0004261 Ga0496103_0004261_1955_2941 324
414 3300048906 Ga0496103_0085093 Ga0496103_0085093_51_1037 324
415 3300048907 Ga0496104_0107758 Ga0496104_0107758_923_1951 324
416 3300048909 Ga0496106_0009099 Ga0496106_0009099_5735_6763 324
417 3300048910 Ga0496107_0008400 Ga0496107_0008400_5867_6895 324
418 3300048912 Ga0496109_0037479 Ga0496109_0037479_3206_4180 324
419 3300048919 Ga0496116_0017989 Ga0496116_0017989_4442_5440 324
420 3300048920 Ga0496117_0000001 Ga0496117_0000001_2503344_2504342 324
421 3300048921 Ga0496118_0000008 Ga0496118_0000008_621637_622635 324
422 3300048924 Ga0496121_0034213 Ga0496121_0034213_2695_3693 324
423 3300048924 Ga0496121_0036748 Ga0496121_0036748_2751_3749 324
424 3300048925 Ga0496122_0002399 Ga0496122_0002399_1025_2023 324
425 3300048925 Ga0496122_0186258 Ga0496122_0186258_203_1189 324
426 3300048926 Ga0496123_0023175 Ga0496123_0023175_2291_3277 324
427 3300048926 Ga0496123_0026774 Ga0496123_0026774_1196_2200 324
428 3300048926 Ga0496123_0073215 Ga0496123_0073215_91_1089 324
429 3300048927 Ga0496124_0016583 Ga0496124_0016583_4344_5348 324
430 3300048927 Ga0496124_0160405 Ga0496124_0160405_644_1630 324
431 3300048928 Ga0496125_0000093 Ga0496125_0000093_8263_9267 324
432 3300048929 Ga0496126_0013325 Ga0496126_0013325_6848_7834 324
433 3300048929 Ga0496126_0056801 Ga0496126_0056801_1620_2624 324
434 3300049129 Ga0501309_004387 Ga0501309_004387_48_1034 324
435 3300049162 Ga0501307_005598 Ga0501307_005598_35_1021 324
436 3300049459 Ga0495678_000424 Ga0495678_000424_5037_6023 324
437 3300049459 Ga0495678_000981 Ga0495678_000981_20640_21626 324
438 3300049459 Ga0495678_024112 Ga0495678_024112_1613_2599 324
439 3300049539 Ga0501323_002001 Ga0501323_002001_325_1311 324
440 3300049661 Ga0501217_050877 Ga0501217_050877_82_1068 324
441 3300049667 Ga0501230_006293 Ga0501230_006293_471_1457 324
442 3300053125 Ga0500618_000769 Ga0500618_000769_12744_13730 324
443 3300059647 Ga0587079_006406 Ga0587079_006406_320_1348 324
444 iso_pu_bacteria 2885080285 2885080736 324
445 iso_pu_bacteria 643348564 643603567 324
446 iso_pu_bacteria 8039098773 8039100231 324
447 3300005295 Ga0065707_10109638 Ga0065707_101096382 325
448 3300005437 Ga0070710_10052251 Ga0070710_100522512 325
449 3300006177 Ga0075362_10011822 Ga0075362_100118222 325
450 3300021321 Ga0214542_1000006 Ga0214542_1000006200 325
451 3300021327 Ga0214543_1000014 Ga0214543_1000014123 325
452 3300037068 Ga0373925_0085475 Ga0373925_0085475_203_1207 325
453 3300037312 Ga0395899_0004707 Ga0395899_0004707_2385_3389 325
454 3300038443 Ga0395901_0037900 Ga0395901_0037900_3565_4569 325
455 3300044712 Ga0453684_0018397 Ga0453684_0018397_8019_9023 325
456 3300045051 Ga0451576_0114020 Ga0451576_0114020_668_1660 325
457 3300045051 Ga0451576_0136021 Ga0451576_0136021_569_1558 325
458 3300046471 Ga0495650_0000399 Ga0495650_0000399_56693_57760 325
459 3300046492 Ga0495585_0046785 Ga0495585_0046785_931_1920 325
460 3300046499 Ga0495594_0012431 Ga0495594_0012431_3048_4037 325
461 3300046506 Ga0495583_0000423 Ga0495583_0000423_26862_27866 325
462 3300046513 Ga0495616_0000145 Ga0495616_0000145_32279_33313 325
463 3300046522 Ga0495643_0039623 Ga0495643_0039623_1215_2219 325
464 3300046538 Ga0495609_0000002 Ga0495609_0000002_102988_104022 325
465 3300046542 Ga0495597_0004054 Ga0495597_0004054_6886_7875 325
466 3300046542 Ga0495597_0029215 Ga0495597_0029215_524_1513 325
467 3300046542 Ga0495597_0034548 Ga0495597_0034548_1243_2247 325
468 3300046615 Ga0495656_0044396 Ga0495656_0044396_96_1130 325
469 3300046664 Ga0495659_0013762 Ga0495659_0013762_226_1230 325
470 3300046665 Ga0495661_0000271 Ga0495661_0000271_19460_20494 325
471 3300046794 Ga0495589_0000030 Ga0495589_0000030_114768_115802 325
472 3300047319 Ga0495674_0001536 Ga0495674_0001536_10061_11050 325
473 3300047319 Ga0495674_0284102 Ga0495674_0284102_355_1338 325
474 3300047321 Ga0495676_0034046 Ga0495676_0034046_2474_3463 325
475 3300047321 Ga0495676_0107493 Ga0495676_0107493_567_1556 325
476 3300047443 Ga0495687_000047 Ga0495687_000047_114770_115804 325
477 3300047445 Ga0495677_0000044 Ga0495677_0000044_53847_54881 325
478 3300047470 Ga0495681_0022278 Ga0495681_0022278_1419_2408 325
479 3300047673 Ga0495593_0017718 Ga0495593_0017718_2437_3426 325
480 3300048091 Ga0495626_0000266 Ga0495626_0000266_19460_20494 325
481 3300048091 Ga0495626_0013643 Ga0495626_0013643_2740_3729 325
482 3300048905 Ga0496102_0057539 Ga0496102_0057539_2428_3417 325
483 3300048918 Ga0496115_0058595 Ga0496115_0058595_1007_1999 325
484 3300050489 nmdc:mga03683_1692_c2 nmdc:mga03683_1692_c2_590_1585 325
485 iso_pu_bacteria 2657244999 2657683150 325
486 iso_pu_bacteria 2791355082 2792584275 325
487 iso_pu_bacteria 2802429268 2804751461 325
488 iso_pu_bacteria 2857553236 2857556504 325
489 iso_pu_bacteria 8049293176 8049294113 325
490 3300002774 JGI25150J39212_1000548 JGI25150J39212_10005481 326
491 3300002987 JGI25159J45721_1001473 JGI25159J45721_10014738 326
492 3300002987 JGI25159J45721_1003564 JGI25159J45721_10035644 326
493 3300003215 JGI25153J46596_10004840 JGI25153J46596_100048405 326
494 3300003374 JGI25161J50226_1000860 JGI25161J50226_10008601 326
495 3300003775 Ga0055524_1003000 Ga0055524_10030005 326
496 3300004625 Ga0055543_1000334 Ga0055543_10003349 326
497 3300005262 Ga0065165_1000050 Ga0065165_100005049 326
498 3300005262 Ga0065165_1001090 Ga0065165_10010909 326
499 3300005436 Ga0070713_100000473 Ga0070713_1000004739 326
500 3300005439 Ga0070711_100389326 Ga0070711_1003893261 326
501 3300025208 Ga0209436_100758 Ga0209436_1007589 326
502 3300025245 Ga0207425_1000006 Ga0207425_1000006136 326
503 3300025258 Ga0209129_1000090 Ga0209129_1000090136 326
504 3300025263 Ga0209565_1005783 Ga0209565_10057833 326
505 3300025263 Ga0209565_1021985 Ga0209565_10219851 326
506 3300025284 Ga0209130_1000065 Ga0209130_100006549 326
507 3300025284 Ga0209130_1001171 Ga0209130_10011719 326
508 3300025295 Ga0209564_1015568 Ga0209564_10155681 326
509 3300025297 Ga0209758_1000047 Ga0209758_1000047204 326
510 3300025299 Ga0209256_1000863 Ga0209256_100086337 326
511 3300025302 Ga0207426_1040084 Ga0207426_10400842 326
512 3300025928 Ga0207700_10000190 Ga0207700_1000019011 326
513 3300031235 Ga0265330_10004748 Ga0265330_100047488 326
514 3300031238 Ga0265332_10006275 Ga0265332_100062755 326
515 3300031250 Ga0265331_10001966 Ga0265331_1000196613 326
516 3300031251 Ga0265327_10009022 Ga0265327_100090225 326
517 3300031711 Ga0265314_10013652 Ga0265314_100136529 326
518 3300037312 Ga0395899_0000166 Ga0395899_0000166_21678_22673 326
519 3300037466 Ga0395898_0161206 Ga0395898_0161206_250_1251 326
520 3300037471 Ga0395905_0001956 Ga0395905_0001956_16075_17079 326
521 3300042139 Ga0450904_000311 Ga0450904_000311_6247_7239 326
522 3300042876 Ga0451577_0000234 Ga0451577_0000234_40960_41958 326
523 3300044712 Ga0453684_0000005 Ga0453684_0000005_1219461_1220459 326
524 3300044712 Ga0453684_0000102 Ga0453684_0000102_110056_111054 326
525 3300044735 Ga0466968_0009097 Ga0466968_0009097_1052_2053 326
526 3300045051 Ga0451576_0228262 Ga0451576_0228262_621_1613 326
527 3300046452 Ga0495617_000098 Ga0495617_000098_8350_9345 326
528 3300046453 Ga0495627_000006 Ga0495627_000006_369377_370396 326
529 3300046453 Ga0495627_017797 Ga0495627_017797_1304_2377 326
530 3300046460 Ga0495638_0027894 Ga0495638_0027894_2398_3393 326
531 3300046463 Ga0495653_0053914 Ga0495653_0053914_1361_2353 326
532 3300046491 Ga0495584_0000022 Ga0495584_0000022_97630_98625 326
533 3300046491 Ga0495584_0005152 Ga0495584_0005152_1994_2989 326
534 3300046492 Ga0495585_0000004 Ga0495585_0000004_180126_181121 326
535 3300046492 Ga0495585_0000172 Ga0495585_0000172_43878_44873 326
536 3300046492 Ga0495585_0000298 Ga0495585_0000298_1029_2021 326
537 3300046499 Ga0495594_0032455 Ga0495594_0032455_986_1978 326
538 3300046500 Ga0495596_0000186 Ga0495596_0000186_41274_42269 326
539 3300046500 Ga0495596_0000659 Ga0495596_0000659_20532_21527 326
540 3300046506 Ga0495583_0001608 Ga0495583_0001608_13510_14505 326
541 3300046507 Ga0495606_0017776 Ga0495606_0017776_2238_3233 326
542 3300046513 Ga0495616_0006281 Ga0495616_0006281_4706_5701 326
543 3300046518 Ga0495631_0022342 Ga0495631_0022342_336_1409 326
544 3300046518 Ga0495631_0078776 Ga0495631_0078776_66_1061 326
545 3300046519 Ga0495632_0012217 Ga0495632_0012217_1140_2135 326
546 3300046524 Ga0495648_0000044 Ga0495648_0000044_101585_102580 326
547 3300046525 Ga0495663_0010508 Ga0495663_0010508_1379_2452 326
548 3300046526 Ga0495666_0020696 Ga0495666_0020696_558_1550 326
549 3300046528 Ga0495642_0014258 Ga0495642_0014258_1907_2902 326
550 3300046528 Ga0495642_0041231 Ga0495642_0041231_77_1150 326
551 3300046535 Ga0495586_0008995 Ga0495586_0008995_1203_2195 326
552 3300046536 Ga0495587_0046754 Ga0495587_0046754_819_1811 326
553 3300046538 Ga0495609_0009285 Ga0495609_0009285_2756_3775 326
554 3300046542 Ga0495597_0007330 Ga0495597_0007330_2824_3897 326
555 3300046558 Ga0495633_0014592 Ga0495633_0014592_1411_2484 326
556 3300046558 Ga0495633_0027354 Ga0495633_0027354_808_1803 326
557 3300046615 Ga0495656_0008883 Ga0495656_0008883_2415_3488 326
558 3300046616 Ga0495668_0000049 Ga0495668_0000049_110801_111793 326
559 3300046616 Ga0495668_0035316 Ga0495668_0035316_1019_2092 326
560 3300046616 Ga0495668_0085696 Ga0495668_0085696_397_1392 326
561 3300046648 Ga0495611_0049416 Ga0495611_0049416_769_1764 326
562 3300046674 Ga0495588_0032059 Ga0495588_0032059_1609_2604 326
563 3300046674 Ga0495588_0056099 Ga0495588_0056099_171_1163 326
564 3300046679 Ga0495623_0103940 Ga0495623_0103940_721_1713 326
565 3300046684 Ga0495669_0003227 Ga0495669_0003227_5448_6443 326
566 3300046691 Ga0495670_0007789 Ga0495670_0007789_1051_2124 326
567 3300046692 Ga0495671_0021437 Ga0495671_0021437_1632_2705 326
568 3300046810 Ga0495660_0000542 Ga0495660_0000542_14754_15764 326
569 3300046810 Ga0495660_0009807 Ga0495660_0009807_1969_2988 326
570 3300046810 Ga0495660_0058224 Ga0495660_0058224_631_1626 326
571 3300047315 Ga0495581_0037696 Ga0495581_0037696_898_1890 326
572 3300047317 Ga0495604_0077415 Ga0495604_0077415_855_1847 326
573 3300047323 Ga0495683_0000342 Ga0495683_0000342_1002_1997 326
574 3300047445 Ga0495677_0025466 Ga0495677_0025466_654_1727 326
575 3300047470 Ga0495681_0014148 Ga0495681_0014148_3521_4540 326
576 3300047470 Ga0495681_0024779 Ga0495681_0024779_268_1341 326
577 3300047472 Ga0495686_0017704 Ga0495686_0017704_243_1235 326
578 3300047673 Ga0495593_0061543 Ga0495593_0061543_447_1439 326
579 3300048091 Ga0495626_0006398 Ga0495626_0006398_4506_5498 326
580 3300048091 Ga0495626_0018710 Ga0495626_0018710_452_1447 326
581 3300049459 Ga0495678_000013 Ga0495678_000013_108714_109733 326
582 3300050513 nmdc:mga0rr50_128358_c1 nmdc:mga0rr50_128358_c1_446_1444 326
583 3300053153 Ga0500616_0001080 Ga0500616_0001080_11157_12155 326
584 iso_pu_bacteria 2511231003 2511248138 326
585 iso_pu_bacteria 2511231221 2512032674 326
586 iso_pu_bacteria 2545555834 2545675036 326
587 iso_pu_bacteria 2548876994 2550697277 326
588 iso_pu_bacteria 2643221603 2644027901 326
589 iso_pu_bacteria 2738541317 2738947261 326
590 iso_pu_bacteria 2765235838 2765567958 326
591 iso_pu_bacteria 2808606386 2808983818 326
592 iso_pu_bacteria 2808606415 2809129490 326
593 iso_pu_bacteria 2808606419 2809149455 326
594 iso_pu_bacteria 2818991445 2819592498 326
595 iso_pu_bacteria 2839094727 2839097753 326
596 iso_pu_bacteria 2852618963 2852619601 326
597 iso_pu_bacteria 2884811622 2884814655 326
598 iso_pu_bacteria 2884836552 2884839014 326
599 iso_pu_bacteria 2884852848 2884855305 326
600 iso_pu_bacteria 2889306138 2889309290 326
601 iso_pu_bacteria 2896154374 2896159188 326
602 iso_pu_bacteria 2897803580 2897809830 326
603 iso_pu_bacteria 2902405164 2902409365 326
604 iso_pu_bacteria 2913308742 2913312642 326
605 iso_pu_bacteria 2919476304 2919480734 326
606 iso_pu_bacteria 2928130867 2928132417 326
607 iso_pu_bacteria 3003665799 3003667366 326
608 iso_pu_bacteria 641522639 641645362 326
609 iso_pu_bacteria 8054002106 8054006186 326
610 3300002704 JGI25155J39150_1000136 JGI25155J39150_100013617 327
611 3300002705 JGI25156J39149_1000156 JGI25156J39149_100015619 327
612 3300002737 JGI25162J39368_1002181 JGI25162J39368_10021815 327
613 3300002738 JGI25154J39366_1000614 JGI25154J39366_10006146 327
614 3300002738 JGI25154J39366_1004141 JGI25154J39366_10041413 327
615 3300002741 JGI25157J39369_1000277 JGI25157J39369_100027719 327
616 3300003544 Ga0007417J51691_1022516 Ga0007417J51691_10225161 327
617 3300003574 Ga0007410J51695_1032879 Ga0007410J51695_10328791 327
618 3300003577 Ga0007416J51690_1019266 Ga0007416J51690_10192661 327
619 3300003611 Ga0007411J51799_110827 Ga0007411J51799_1108271 327
620 3300003751 Ga0055538_1000008 Ga0055538_100000860 327
621 3300003752 Ga0055539_1000012 Ga0055539_100001260 327
622 3300003756 Ga0055533_1000015 Ga0055533_100001560 327
623 3300003758 Ga0055532_1000005 Ga0055532_1000005203 327
624 3300003759 Ga0055525_1000017 Ga0055525_1000017284 327
625 3300003761 Ga0055535_1005800 Ga0055535_10058003 327
626 3300003841 Ga0055541_1000009 Ga0055541_100000960 327
627 3300005262 Ga0065165_1001239 Ga0065165_100123922 327
628 3300005295 Ga0065707_10177859 Ga0065707_101778591 327
629 3300005327 Ga0070658_10199902 Ga0070658_101999022 327
630 3300005339 Ga0070660_100002761 Ga0070660_1000027613 327
631 3300005344 Ga0070661_100004663 Ga0070661_1000046636 327
632 3300005367 Ga0070667_100182338 Ga0070667_1001823382 327
633 3300005563 Ga0068855_100001182 Ga0068855_10000118213 327
634 3300005563 Ga0068855_100026469 Ga0068855_1000264697 327
635 3300005615 Ga0070702_100115599 Ga0070702_1001155992 327
636 3300005616 Ga0068852_100005712 Ga0068852_1000057126 327
637 3300006175 Ga0070712_100103356 Ga0070712_1001033562 327
638 3300006871 Ga0075434_100071506 Ga0075434_1000715063 327
639 3300006914 Ga0075436_100002276 Ga0075436_10000227613 327
640 3300007076 Ga0075435_100242723 Ga0075435_1002427232 327
641 3300009093 Ga0105240_10016284 Ga0105240_100162849 327
642 3300009148 Ga0105243_10173448 Ga0105243_101734481 327
643 3300010375 Ga0105239_10348081 Ga0105239_103480812 327
644 3300013306 Ga0163162_10039392 Ga0163162_100393924 327
645 3300013306 Ga0163162_10345423 Ga0163162_103454232 327
646 3300014497 Ga0182008_10008832 Ga0182008_100088322 327
647 3300021361 Ga0213872_10040600 Ga0213872_100406003 327
648 3300025206 Ga0209435_100004 Ga0209435_100004133 327
649 3300025206 Ga0209435_100156 Ga0209435_1001568 327
650 3300025224 Ga0209784_100005 Ga0209784_10000559 327
651 3300025225 Ga0209566_100005 Ga0209566_10000559 327
652 3300025226 Ga0209674_100009 Ga0209674_10000959 327
653 3300025228 Ga0209672_104210 Ga0209672_1042102 327
654 3300025229 Ga0209147_100011 Ga0209147_100011231 327
655 3300025230 Ga0209563_100012 Ga0209563_10001259 327
656 3300025233 Ga0209437_100084 Ga0209437_10008470 327
657 3300025242 Ga0209258_100264 Ga0209258_10026434 327
658 3300025246 Ga0209646_1000032 Ga0209646_1000032229 327
659 3300025246 Ga0209646_1000052 Ga0209646_1000052225 327
660 3300025250 Ga0209026_1000062 Ga0209026_100006289 327
661 3300025253 Ga0209677_100006 Ga0209677_10000659 327
662 3300025256 Ga0209759_1000054 Ga0209759_100005474 327
663 3300025256 Ga0209759_1000514 Ga0209759_100051418 327
664 3300025272 Ga0209455_1007667 Ga0209455_10076672 327
665 3300025913 Ga0207695_10002162 Ga0207695_1000216214 327
666 3300025913 Ga0207695_10036222 Ga0207695_100362222 327
667 3300025915 Ga0207693_10132244 Ga0207693_101322441 327
668 3300025919 Ga0207657_10002609 Ga0207657_1000260913 327
669 3300025920 Ga0207649_10003159 Ga0207649_100031595 327
670 3300025920 Ga0207649_10014966 Ga0207649_100149662 327
671 3300025933 Ga0207706_10162895 Ga0207706_101628952 327
672 3300025941 Ga0207711_10046171 Ga0207711_100461712 327
673 3300025945 Ga0207679_10008600 Ga0207679_100086003 327
674 3300025949 Ga0207667_10000019 Ga0207667_1000001915 327
675 3300025986 Ga0207658_10156469 Ga0207658_101564692 327
676 3300026078 Ga0207702_10122231 Ga0207702_101222312 327
677 3300026142 Ga0207698_10017379 Ga0207698_100173793 327
678 3300031251 Ga0265327_10001071 Ga0265327_1000107120 327
679 3300031251 Ga0265327_10001501 Ga0265327_1000150114 327
680 3300035724 Ga0373933_0143407 Ga0373933_0143407_344_1357 327
681 3300037312 Ga0395899_0001102 Ga0395899_0001102_11768_12946 327
682 3300037312 Ga0395899_0001535 Ga0395899_0001535_247_1251 327
683 3300037312 Ga0395899_0040069 Ga0395899_0040069_2157_3350 327
684 3300037312 Ga0395899_0115400 Ga0395899_0115400_161_1348 327
685 3300037312 Ga0395899_0157712 Ga0395899_0157712_75_1085 327
686 3300037418 Ga0395900_0007959 Ga0395900_0007959_3318_4322 327
687 3300037418 Ga0395900_0016478 Ga0395900_0016478_2682_3692 327
688 3300037418 Ga0395900_0129789 Ga0395900_0129789_1212_2216 327
689 3300037418 Ga0395900_0252459 Ga0395900_0252459_159_1352 327
690 3300037466 Ga0395898_0136478 Ga0395898_0136478_545_1549 327
691 3300037471 Ga0395905_0008938 Ga0395905_0008938_7264_8268 327
692 3300038443 Ga0395901_0004488 Ga0395901_0004488_4910_6103 327
693 3300038443 Ga0395901_0114976 Ga0395901_0114976_1534_2721 327
694 3300038443 Ga0395901_0135919 Ga0395901_0135919_1560_2564 327
695 3300039447 Ga0436361_0191290 Ga0436361_0191290_152_1153 327
696 3300039447 Ga0436361_0334934 Ga0436361_0334934_25702_26715 327
697 3300039447 Ga0436361_0418283 Ga0436361_0418283_889_1893 327
698 3300039447 Ga0436361_0912286 Ga0436361_0912286_603_1604 327
699 3300042876 Ga0451577_0004958 Ga0451577_0004958_8788_9780 327
700 3300044658 Ga0466972_0000106 Ga0466972_0000106_54226_55227 327
701 3300044658 Ga0466972_0080097 Ga0466972_0080097_522_1526 327
702 3300044673 Ga0453683_0005769 Ga0453683_0005769_6382_7416 327
703 3300044673 Ga0453683_0024809 Ga0453683_0024809_1560_2552 327
704 3300044673 Ga0453683_0096106 Ga0453683_0096106_429_1472 327
705 3300044673 Ga0453683_0307168 Ga0453683_0307168_16_1005 327
706 3300044683 Ga0466965_0002743 Ga0466965_0002743_3714_4718 327
707 3300044683 Ga0466965_0018510 Ga0466965_0018510_1637_2641 327
708 3300044684 Ga0466966_0038015 Ga0466966_0038015_1364_2368 327
709 3300044712 Ga0453684_0001096 Ga0453684_0001096_4173_5165 327
710 3300044712 Ga0453684_0004556 Ga0453684_0004556_20116_21108 327
711 3300044712 Ga0453684_0007758 Ga0453684_0007758_3396_4439 327
712 3300044712 Ga0453684_0035901 Ga0453684_0035901_734_1729 327
713 3300045051 Ga0451576_0000936 Ga0451576_0000936_13600_14643 327
714 3300045051 Ga0451576_0008417 Ga0451576_0008417_7095_8087 327
715 3300046452 Ga0495617_000002 Ga0495617_000002_315013_316017 327
716 3300046453 Ga0495627_000339 Ga0495627_000339_20930_21934 327
717 3300046453 Ga0495627_027626 Ga0495627_027626_539_1543 327
718 3300046457 Ga0495590_0000007 Ga0495590_0000007_96226_97230 327
719 3300046457 Ga0495590_0001878 Ga0495590_0001878_5378_6382 327
720 3300046458 Ga0495591_000039 Ga0495591_000039_36613_37617 327
721 3300046462 Ga0495651_0049037 Ga0495651_0049037_602_1615 327
722 3300046463 Ga0495653_0007300 Ga0495653_0007300_4572_5576 327
723 3300046474 Ga0495605_0000108 Ga0495605_0000108_78613_79617 327
724 3300046492 Ga0495585_0001332 Ga0495585_0001332_1134_2138 327
725 3300046492 Ga0495585_0036207 Ga0495585_0036207_586_1590 327
726 3300046499 Ga0495594_0008580 Ga0495594_0008580_4020_5024 327
727 3300046499 Ga0495594_0045160 Ga0495594_0045160_882_1886 327
728 3300046501 Ga0495607_0011199 Ga0495607_0011199_3406_4410 327
729 3300046501 Ga0495607_0124310 Ga0495607_0124310_41_1054 327
730 3300046506 Ga0495583_0002014 Ga0495583_0002014_16455_17459 327
731 3300046512 Ga0495610_0007524 Ga0495610_0007524_832_1836 327
732 3300046513 Ga0495616_0006679 Ga0495616_0006679_1826_2830 327
733 3300046513 Ga0495616_0008398 Ga0495616_0008398_2816_3817 327
734 3300046513 Ga0495616_0074638 Ga0495616_0074638_557_1570 327
735 3300046518 Ga0495631_0000109 Ga0495631_0000109_22106_23110 327
736 3300046518 Ga0495631_0021271 Ga0495631_0021271_564_1568 327
737 3300046519 Ga0495632_0000374 Ga0495632_0000374_18492_19496 327
738 3300046520 Ga0495637_0000006 Ga0495637_0000006_347983_348987 327
739 3300046523 Ga0495644_0002286 Ga0495644_0002286_4888_5892 327
740 3300046523 Ga0495644_0006951 Ga0495644_0006951_1455_2459 327
741 3300046524 Ga0495648_0000220 Ga0495648_0000220_42247_43251 327
742 3300046526 Ga0495666_0000941 Ga0495666_0000941_6177_7181 327
743 3300046528 Ga0495642_0021899 Ga0495642_0021899_746_1750 327
744 3300046529 Ga0495652_0056252 Ga0495652_0056252_1226_2239 327
745 3300046531 Ga0495665_0066355 Ga0495665_0066355_857_1861 327
746 3300046535 Ga0495586_0008698 Ga0495586_0008698_673_1677 327
747 3300046536 Ga0495587_0018659 Ga0495587_0018659_1972_2985 327
748 3300046538 Ga0495609_0009796 Ga0495609_0009796_989_1993 327
749 3300046538 Ga0495609_0019747 Ga0495609_0019747_1403_2407 327
750 3300046543 Ga0495645_0006318 Ga0495645_0006318_4312_5325 327
751 3300046558 Ga0495633_0009671 Ga0495633_0009671_275_1279 327
752 3300046559 Ga0495667_0036606 Ga0495667_0036606_652_1665 327
753 3300046616 Ga0495668_0000861 Ga0495668_0000861_2217_3221 327
754 3300046616 Ga0495668_0002828 Ga0495668_0002828_1676_2680 327
755 3300046648 Ga0495611_0000116 Ga0495611_0000116_48792_49796 327
756 3300046648 Ga0495611_0112883 Ga0495611_0112883_250_1254 327
757 3300046663 Ga0495635_0007881 Ga0495635_0007881_432_1436 327
758 3300046665 Ga0495661_0016926 Ga0495661_0016926_890_1894 327
759 3300046665 Ga0495661_0043717 Ga0495661_0043717_1189_2193 327
760 3300046665 Ga0495661_0047317 Ga0495661_0047317_204_1205 327
761 3300046675 Ga0495657_0037487 Ga0495657_0037487_1255_2268 327
762 3300046678 Ga0495599_0015585 Ga0495599_0015585_2262_3275 327
763 3300046679 Ga0495623_0030023 Ga0495623_0030023_1972_2985 327
764 3300046679 Ga0495623_0090851 Ga0495623_0090851_215_1219 327
765 3300046684 Ga0495669_0019496 Ga0495669_0019496_1049_2053 327
766 3300046692 Ga0495671_0000613 Ga0495671_0000613_4403_5407 327
767 3300046694 Ga0495649_0000183 Ga0495649_0000183_39558_40562 327
768 3300046794 Ga0495589_0030779 Ga0495589_0030779_557_1570 327
769 3300046809 Ga0495600_0047465 Ga0495600_0047465_1149_2162 327
770 3300046810 Ga0495660_0028652 Ga0495660_0028652_706_1710 327
771 3300047317 Ga0495604_0024792 Ga0495604_0024792_29_1033 327
772 3300047317 Ga0495604_0047105 Ga0495604_0047105_990_2003 327
773 3300047320 Ga0495672_0000118 Ga0495672_0000118_101888_102892 327
774 3300047322 Ga0495680_0011739 Ga0495680_0011739_6690_7694 327
775 3300047323 Ga0495683_0001362 Ga0495683_0001362_1472_2476 327
776 3300047323 Ga0495683_0024372 Ga0495683_0024372_1193_2197 327
777 3300047443 Ga0495687_000049 Ga0495687_000049_201000_202004 327
778 3300047443 Ga0495687_000088 Ga0495687_000088_11665_12669 327
779 3300047444 Ga0495675_0002560 Ga0495675_0002560_201_1205 327
780 3300047445 Ga0495677_0005907 Ga0495677_0005907_1171_2184 327
781 3300047470 Ga0495681_0001608 Ga0495681_0001608_11911_12924 327
782 3300047472 Ga0495686_0000140 Ga0495686_0000140_34703_35707 327
783 3300048089 Ga0495614_0062329 Ga0495614_0062329_64_1068 327
784 3300048905 Ga0496102_0000098 Ga0496102_0000098_1928_2932 327
785 3300048911 Ga0496108_0156476 Ga0496108_0156476_719_1729 327
786 3300048913 Ga0496110_0002899 Ga0496110_0002899_7350_8354 327
787 3300048913 Ga0496110_0042326 Ga0496110_0042326_1039_2049 327
788 3300049460 Ga0495682_0010647 Ga0495682_0010647_886_1890 327
789 3300049575 Ga0501039_0164604 Ga0501039_0164604_441_1436 327
790 3300049576 Ga0501040_0261436 Ga0501040_0261436_141_1136 327
791 3300049822 Ga0501035_0004815 Ga0501035_0004815_10271_11287 327
792 3300050512 nmdc:mga0n895_339025_c1 nmdc:mga0n895_339025_c1_462_1454 327
793 3300053077 Ga0495601_0009873 Ga0495601_0009873_718_1731 327
794 3300053084 Ga0495595_0050552 Ga0495595_0050552_715_1728 327
795 3300053085 Ga0495619_0042239 Ga0495619_0042239_969_1982 327
796 3300059642 Ga0587069_001415 Ga0587069_001415_167_1171 327
797 3300059645 Ga0587076_017365 Ga0587076_017365_102_1106 327
798 iso_pu_bacteria 2511231026 2511387020 327
799 iso_pu_bacteria 2521172590 2521556766 327
800 iso_pu_bacteria 2551306416 2553004533 327
801 iso_pu_bacteria 2597490356 2599104911 327
802 iso_pu_bacteria 2818991449 2819618615 327
803 iso_pu_bacteria 2846952575 2846954368 327
804 iso_pu_bacteria 2848858292 2848859374 327
805 iso_pu_bacteria 2857524615 2857530039 327
806 iso_pu_bacteria 2893066018 2893066825 327
807 iso_pu_bacteria 2904439833 2904440657 327
808 iso_pu_bacteria 2904530477 2904535751 327
809 iso_pu_bacteria 2904584206 2904586088 327
810 iso_pu_bacteria 2904589729 2904592099 327
811 iso_pu_bacteria 2904601388 2904601744 327
812 iso_pu_bacteria 2919046199 2919049570 327
813 iso_pu_bacteria 2919073203 2919077044 327
814 iso_pu_bacteria 2919079590 2919084801 327
815 iso_pu_bacteria 2923510766 2923515359 327
816 3300005328 Ga0070676_10073839 Ga0070676_100738393 328
817 3300005328 Ga0070676_10131166 Ga0070676_101311661 328
818 3300005330 Ga0070690_100205708 Ga0070690_1002057081 328
819 3300005331 Ga0070670_100256265 Ga0070670_1002562652 328
820 3300005334 Ga0068869_100008005 Ga0068869_1000080053 328
821 3300005338 Ga0068868_100043846 Ga0068868_1000438462 328
822 3300005347 Ga0070668_100013142 Ga0070668_1000131425 328
823 3300005353 Ga0070669_100157262 Ga0070669_1001572622 328
824 3300005354 Ga0070675_100053567 Ga0070675_1000535673 328
825 3300005356 Ga0070674_100131003 Ga0070674_1001310031 328
826 3300005364 Ga0070673_100181533 Ga0070673_1001815332 328
827 3300005365 Ga0070688_100163548 Ga0070688_1001635482 328
828 3300005366 Ga0070659_100220534 Ga0070659_1002205343 328
829 3300005366 Ga0070659_100260524 Ga0070659_1002605242 328
830 3300005435 Ga0070714_100392913 Ga0070714_1003929132 328
831 3300005455 Ga0070663_100061750 Ga0070663_1000617502 328
832 3300005458 Ga0070681_10044970 Ga0070681_100449703 328
833 3300005458 Ga0070681_10070813 Ga0070681_100708131 328
834 3300005459 Ga0068867_100028872 Ga0068867_1000288723 328
835 3300005459 Ga0068867_100040087 Ga0068867_1000400873 328
836 3300005530 Ga0070679_100008450 Ga0070679_1000084507 328
837 3300005530 Ga0070679_100014073 Ga0070679_1000140736 328
838 3300005536 Ga0070697_100002710 Ga0070697_10000271013 328
839 3300005545 Ga0070695_100017015 Ga0070695_1000170154 328
840 3300005563 Ga0068855_100270733 Ga0068855_1002707332 328
841 3300005563 Ga0068855_100361644 Ga0068855_1003616441 328
842 3300005577 Ga0068857_100004463 Ga0068857_1000044634 328
843 3300005578 Ga0068854_100076479 Ga0068854_1000764792 328
844 3300005616 Ga0068852_100508418 Ga0068852_1005084181 328
845 3300005617 Ga0068859_100035112 Ga0068859_1000351123 328
846 3300005618 Ga0068864_100002253 Ga0068864_1000022533 328
847 3300005618 Ga0068864_100418934 Ga0068864_1004189341 328
848 3300005843 Ga0068860_100011123 Ga0068860_1000111232 328
849 3300005843 Ga0068860_100369644 Ga0068860_1003696442 328
850 3300006237 Ga0097621_100197243 Ga0097621_1001972432 328
851 3300006931 Ga0097620_100035112 Ga0097620_1000351123 328
852 3300007076 Ga0075435_100114367 Ga0075435_1001143672 328
853 3300009098 Ga0105245_10242956 Ga0105245_102429562 328
854 3300009101 Ga0105247_10011705 Ga0105247_100117053 328
855 3300009176 Ga0105242_10037806 Ga0105242_100378063 328
856 3300009177 Ga0105248_10008024 Ga0105248_100080249 328
857 3300009545 Ga0105237_10077738 Ga0105237_100777382 328
858 3300009545 Ga0105237_10153507 Ga0105237_101535071 328
859 3300009551 Ga0105238_10000155 Ga0105238_1000015514 328
860 3300010375 Ga0105239_10003940 Ga0105239_100039407 328
861 3300013297 Ga0157378_10119394 Ga0157378_101193942 328
862 3300014325 Ga0163163_10018410 Ga0163163_100184102 328
863 3300014326 Ga0157380_10113036 Ga0157380_101130361 328
864 3300014968 Ga0157379_10000258 Ga0157379_1000025811 328
865 3300015261 Ga0182006_1017100 Ga0182006_10171002 328
866 3300017792 Ga0163161_10035960 Ga0163161_100359602 328
867 3300025295 Ga0209564_1000248 Ga0209564_100024852 328
868 3300025907 Ga0207645_10081608 Ga0207645_100816081 328
869 3300025911 Ga0207654_10147548 Ga0207654_101475482 328
870 3300025912 Ga0207707_10041254 Ga0207707_100412543 328
871 3300025913 Ga0207695_10003436 Ga0207695_100034367 328
872 3300025915 Ga0207693_10125293 Ga0207693_101252933 328
873 3300025924 Ga0207694_10000625 Ga0207694_1000062511 328
874 3300025925 Ga0207650_10062689 Ga0207650_100626893 328
875 3300025926 Ga0207659_10027086 Ga0207659_100270862 328
876 3300025929 Ga0207664_10071733 Ga0207664_100717333 328
877 3300025937 Ga0207669_10173125 Ga0207669_101731251 328
878 3300025941 Ga0207711_10005459 Ga0207711_100054598 328
879 3300025941 Ga0207711_10332731 Ga0207711_103327311 328
880 3300025942 Ga0207689_10000693 Ga0207689_100006934 328
881 3300025972 Ga0207668_10034668 Ga0207668_100346683 328
882 3300025981 Ga0207640_10025219 Ga0207640_100252193 328
883 3300025986 Ga0207658_10002792 Ga0207658_100027926 328
884 3300026023 Ga0207677_10102280 Ga0207677_101022803 328
885 3300026035 Ga0207703_10001830 Ga0207703_100018306 328
886 3300026035 Ga0207703_10045919 Ga0207703_100459192 328
887 3300026035 Ga0207703_10542298 Ga0207703_105422981 328
888 3300026089 Ga0207648_10004233 Ga0207648_100042338 328
889 3300026089 Ga0207648_10064965 Ga0207648_100649652 328
890 3300026095 Ga0207676_10004737 Ga0207676_100047371 328
891 3300026095 Ga0207676_10372837 Ga0207676_103728371 328
892 3300026116 Ga0207674_10003982 Ga0207674_100039826 328
893 3300026118 Ga0207675_100005134 Ga0207675_10000513412 328
894 3300026118 Ga0207675_100028419 Ga0207675_1000284194 328
895 3300026118 Ga0207675_100309405 Ga0207675_1003094052 328
896 3300026121 Ga0207683_10067190 Ga0207683_100671903 328
897 3300028381 Ga0268264_10013163 Ga0268264_100131636 328
898 3300031249 Ga0265339_10097186 Ga0265339_100971861 328
899 3300031595 Ga0265313_10035104 Ga0265313_100351041 328
900 3300031711 Ga0265314_10000093 Ga0265314_1000009328 328
901 3300031712 Ga0265342_10001756 Ga0265342_100017569 328
902 3300032133 Ga0316583_10001693 Ga0316583_100016935 328
903 3300037068 Ga0373925_0011187 Ga0373925_0011187_2355_3359 328
904 3300037418 Ga0395900_0271465 Ga0395900_0271465_329_1333 328
905 3300037466 Ga0395898_0071585 Ga0395898_0071585_1290_2294 328
906 3300038443 Ga0395901_0010976 Ga0395901_0010976_6353_7357 328
907 3300039447 Ga0436361_0301322 Ga0436361_0301322_28391_29413 328
908 3300042876 Ga0451577_0074220 Ga0451577_0074220_1134_2138 328
909 3300042876 Ga0451577_0254237 Ga0451577_0254237_41_1045 328
910 3300044673 Ga0453683_0158661 Ga0453683_0158661_147_1145 328
911 3300044712 Ga0453684_0000069 Ga0453684_0000069_4749_5753 328
912 3300044712 Ga0453684_0001336 Ga0453684_0001336_62012_63019 328
913 3300044712 Ga0453684_0005643 Ga0453684_0005643_5317_6321 328
914 3300044712 Ga0453684_0027141 Ga0453684_0027141_4552_5547 328
915 3300044712 Ga0453684_0029443 Ga0453684_0029443_6757_7767 328
916 3300044712 Ga0453684_0417631 Ga0453684_0417631_480_1481 328
917 3300045051 Ga0451576_0016446 Ga0451576_0016446_4011_5015 328
918 3300045051 Ga0451576_0017345 Ga0451576_0017345_4749_5753 328
919 3300045051 Ga0451576_0019016 Ga0451576_0019016_2500_3501 328
920 3300045051 Ga0451576_0061838 Ga0451576_0061838_1940_2944 328
921 3300045051 Ga0451576_0069983 Ga0451576_0069983_933_1937 328
922 3300045976 Ga0466967_0044026 Ga0466967_0044026_695_1696 328
923 3300046460 Ga0495638_0046882 Ga0495638_0046882_1397_2458 328
924 3300046473 Ga0495582_0059814 Ga0495582_0059814_1063_2064 328
925 3300046501 Ga0495607_0066550 Ga0495607_0066550_147_1244 328
926 3300046513 Ga0495616_0102883 Ga0495616_0102883_18_1079 328
927 3300046690 Ga0495624_0146909 Ga0495624_0146909_116_1117 328
928 3300046691 Ga0495670_0000757 Ga0495670_0000757_642_1703 328
929 3300048904 Ga0496101_0094650 Ga0496101_0094650_461_1462 328
930 3300048907 Ga0496104_0010266 Ga0496104_0010266_5018_6019 328
931 3300048911 Ga0496108_0025353 Ga0496108_0025353_1034_2029 328
932 3300048911 Ga0496108_0213414 Ga0496108_0213414_266_1267 328
933 3300048912 Ga0496109_0009882 Ga0496109_0009882_2778_3779 328
934 3300048913 Ga0496110_0160374 Ga0496110_0160374_165_1166 328
935 3300048913 Ga0496110_0242179 Ga0496110_0242179_436_1431 328
936 3300048914 Ga0496111_0026798 Ga0496111_0026798_409_1410 328
937 3300048916 Ga0496113_0001174 Ga0496113_0001174_10359_11360 328
938 3300048918 Ga0496115_0005515 Ga0496115_0005515_4592_5593 328
939 3300048921 Ga0496118_0113947 Ga0496118_0113947_268_1329 328
940 3300048922 Ga0496119_0074646 Ga0496119_0074646_28_1089 328
941 3300048923 Ga0496120_0061138 Ga0496120_0061138_493_1494 328
942 3300048924 Ga0496121_0000894 Ga0496121_0000894_51587_52582 328
943 3300048924 Ga0496121_0004217 Ga0496121_0004217_11369_12448 328
944 3300048924 Ga0496121_0109336 Ga0496121_0109336_706_1707 328
945 3300048925 Ga0496122_0070897 Ga0496122_0070897_1080_2141 328
946 3300048929 Ga0496126_0065612 Ga0496126_0065612_285_1280 328
947 3300049569 Ga0501032_0080613 Ga0501032_0080613_141_1211 328
948 3300049570 Ga0501033_0004167 Ga0501033_0004167_2894_3964 328
949 3300049579 Ga0501043_0023973 Ga0501043_0023973_866_1936 328
950 3300049580 Ga0501046_0023826 Ga0501046_0023826_3004_4074 328
951 3300049580 Ga0501046_0047797 Ga0501046_0047797_571_1647 328
952 3300049581 Ga0501047_0045538 Ga0501047_0045538_1268_2338 328
953 3300049822 Ga0501035_0002518 Ga0501035_0002518_13929_14999 328
954 3300049823 Ga0501044_0038050 Ga0501044_0038050_1048_2058 328
955 3300049823 Ga0501044_0087145 Ga0501044_0087145_359_1429 328
956 3300049823 Ga0501044_0137250 Ga0501044_0137250_385_1461 328
957 3300050513 nmdc:mga0rr50_55269_c1 nmdc:mga0rr50_55269_c1_790_1791 328
958 3300050514 nmdc:mga08x19_35_c1 nmdc:mga08x19_35_c1_15480_16481 328
959 3300053089 Ga0500581_040622 Ga0500581_040622_423_1484 328
960 3300053094 Ga0500566_0000066 Ga0500566_0000066_37110_38189 328
961 3300053096 Ga0500641_0055865 Ga0500641_0055865_203_1204 328
962 3300053104 Ga0500556_0000058 Ga0500556_0000058_104588_105610 328
963 3300053125 Ga0500618_000965 Ga0500618_000965_12729_13859 328
964 3300053131 Ga0500652_001533 Ga0500652_001533_5800_6861 328
965 3300053136 Ga0500559_0006778 Ga0500559_0006778_644_1723 328
966 3300053153 Ga0500616_0000031 Ga0500616_0000031_407120_408142 328
967 3300053153 Ga0500616_0000166 Ga0500616_0000166_19184_20185 328
968 3300053156 Ga0500622_0000783 Ga0500622_0000783_12902_13981 328
969 3300053177 Ga0500636_0008090 Ga0500636_0008090_1281_2360 328
970 iso_pu_bacteria 2548876994 2550696492 328
971 3300005327 Ga0070658_10022533 Ga0070658_100225333 329
972 3300005328 Ga0070676_10004849 Ga0070676_100048498 329
973 3300005329 Ga0070683_100156438 Ga0070683_1001564383 329
974 3300005330 Ga0070690_100010059 Ga0070690_1000100593 329
975 3300005333 Ga0070677_10001379 Ga0070677_100013797 329
976 3300005335 Ga0070666_10003075 Ga0070666_100030759 329
977 3300005338 Ga0068868_100004301 Ga0068868_1000043019 329
978 3300005340 Ga0070689_100025185 Ga0070689_1000251853 329
979 3300005344 Ga0070661_100006980 Ga0070661_1000069803 329
980 3300005347 Ga0070668_100017184 Ga0070668_1000171843 329
981 3300005347 Ga0070668_100305658 Ga0070668_1003056581 329
982 3300005354 Ga0070675_100002078 Ga0070675_1000020788 329
983 3300005354 Ga0070675_100193364 Ga0070675_1001933641 329
984 3300005355 Ga0070671_100002579 Ga0070671_10000257912 329
985 3300005356 Ga0070674_100001647 Ga0070674_10000164711 329
986 3300005364 Ga0070673_100001661 Ga0070673_1000016618 329
987 3300005366 Ga0070659_100071227 Ga0070659_1000712272 329
988 3300005366 Ga0070659_100302907 Ga0070659_1003029072 329
989 3300005367 Ga0070667_100006164 Ga0070667_1000061649 329
990 3300005436 Ga0070713_100005343 Ga0070713_1000053437 329
991 3300005455 Ga0070663_100030486 Ga0070663_1000304863 329
992 3300005455 Ga0070663_100054640 Ga0070663_1000546403 329
993 3300005456 Ga0070678_100001521 Ga0070678_1000015215 329
994 3300005456 Ga0070678_100278944 Ga0070678_1002789441 329
995 3300005458 Ga0070681_10174648 Ga0070681_101746482 329
996 3300005459 Ga0068867_100023054 Ga0068867_1000230543 329
997 3300005471 Ga0070698_100089116 Ga0070698_1000891163 329
998 3300005471 Ga0070698_100144163 Ga0070698_1001441631 329
999 3300005530 Ga0070679_100102857 Ga0070679_1001028572 329
1000 3300005530 Ga0070679_100404793 Ga0070679_1004047932 329
1001 3300005535 Ga0070684_100105660 Ga0070684_1001056601 329
1002 3300005539 Ga0068853_100010152 Ga0068853_1000101524 329
1003 3300005539 Ga0068853_100116051 Ga0068853_1001160513 329
1004 3300005543 Ga0070672_100003651 Ga0070672_1000036515 329
1005 3300005543 Ga0070672_100126858 Ga0070672_1001268582 329
1006 3300005547 Ga0070693_100072908 Ga0070693_1000729081 329
1007 3300005548 Ga0070665_100038969 Ga0070665_1000389695 329
1008 3300005563 Ga0068855_100073739 Ga0068855_1000737392 329
1009 3300005563 Ga0068855_100090301 Ga0068855_1000903012 329
1010 3300005564 Ga0070664_100077105 Ga0070664_1000771052 329
1011 3300005577 Ga0068857_100081933 Ga0068857_1000819331 329
1012 3300005577 Ga0068857_100192856 Ga0068857_1001928562 329
1013 3300005578 Ga0068854_100013379 Ga0068854_1000133793 329
1014 3300005578 Ga0068854_100068245 Ga0068854_1000682452 329
1015 3300005616 Ga0068852_100012692 Ga0068852_1000126924 329
1016 3300005616 Ga0068852_100034426 Ga0068852_1000344264 329
1017 3300005618 Ga0068864_100011388 Ga0068864_1000113883 329
1018 3300005719 Ga0068861_100174812 Ga0068861_1001748122 329
1019 3300005834 Ga0068851_10004443 Ga0068851_100044435 329
1020 3300005840 Ga0068870_10068034 Ga0068870_100680342 329
1021 3300005843 Ga0068860_100023497 Ga0068860_1000234973 329
1022 3300005844 Ga0068862_100055299 Ga0068862_1000552993 329
1023 3300005937 Ga0081455_10242444 Ga0081455_102424442 329
1024 3300006173 Ga0070716_100123520 Ga0070716_1001235202 329
1025 3300006177 Ga0075362_10143603 Ga0075362_101436031 329
1026 3300006178 Ga0075367_10044151 Ga0075367_100441512 329
1027 3300006195 Ga0075366_10010248 Ga0075366_100102484 329
1028 3300006195 Ga0075366_10040064 Ga0075366_100400642 329
1029 3300006237 Ga0097621_100133025 Ga0097621_1001330252 329
1030 3300006358 Ga0068871_100040237 Ga0068871_1000402373 329
1031 3300006871 Ga0075434_100102447 Ga0075434_1001024472 329
1032 3300006881 Ga0068865_100076826 Ga0068865_1000768262 329
1033 3300006881 Ga0068865_100439227 Ga0068865_1004392271 329
1034 3300007076 Ga0075435_100136801 Ga0075435_1001368012 329
1035 3300009174 Ga0105241_10204044 Ga0105241_102040442 329
1036 3300009176 Ga0105242_10095517 Ga0105242_100955173 329
1037 3300009545 Ga0105237_10063597 Ga0105237_100635972 329
1038 3300009545 Ga0105237_10081332 Ga0105237_100813322 329
1039 3300009551 Ga0105238_10538683 Ga0105238_105386831 329
1040 3300010375 Ga0105239_10050998 Ga0105239_100509984 329
1041 3300011119 Ga0105246_10214577 Ga0105246_102145772 329
1042 3300013102 Ga0157371_10284684 Ga0157371_102846842 329
1043 3300013104 Ga0157370_10330134 Ga0157370_103301342 329
1044 3300013105 Ga0157369_10186712 Ga0157369_101867122 329
1045 3300013296 Ga0157374_10002066 Ga0157374_100020666 329
1046 3300013296 Ga0157374_10064367 Ga0157374_100643673 329
1047 3300013297 Ga0157378_10051207 Ga0157378_100512073 329
1048 3300013306 Ga0163162_10151699 Ga0163162_101516992 329
1049 3300013306 Ga0163162_10175388 Ga0163162_101753882 329
1050 3300013307 Ga0157372_10049116 Ga0157372_100491163 329
1051 3300013307 Ga0157372_10161115 Ga0157372_101611152 329
1052 3300013308 Ga0157375_10008888 Ga0157375_100088888 329
1053 3300014325 Ga0163163_10078294 Ga0163163_100782942 329
1054 3300014325 Ga0163163_10196854 Ga0163163_101968543 329
1055 3300017792 Ga0163161_10037366 Ga0163161_100373663 329
1056 3300025315 Ga0207697_10043730 Ga0207697_100437302 329
1057 3300025321 Ga0207656_10012331 Ga0207656_100123313 329
1058 3300025893 Ga0207682_10000737 Ga0207682_100007377 329
1059 3300025903 Ga0207680_10016616 Ga0207680_100166162 329
1060 3300025903 Ga0207680_10125819 Ga0207680_101258192 329
1061 3300025906 Ga0207699_10098509 Ga0207699_100985092 329
1062 3300025906 Ga0207699_10116127 Ga0207699_101161272 329
1063 3300025907 Ga0207645_10001462 Ga0207645_1000146211 329
1064 3300025907 Ga0207645_10042831 Ga0207645_100428312 329
1065 3300025908 Ga0207643_10023277 Ga0207643_100232772 329
1066 3300025909 Ga0207705_10044821 Ga0207705_100448212 329
1067 3300025911 Ga0207654_10091475 Ga0207654_100914752 329
1068 3300025913 Ga0207695_10100861 Ga0207695_101008613 329
1069 3300025914 Ga0207671_10043668 Ga0207671_100436681 329
1070 3300025914 Ga0207671_10064504 Ga0207671_100645042 329
1071 3300025920 Ga0207649_10013642 Ga0207649_100136422 329
1072 3300025923 Ga0207681_10040604 Ga0207681_100406043 329
1073 3300025924 Ga0207694_10037796 Ga0207694_100377962 329
1074 3300025926 Ga0207659_10003004 Ga0207659_100030048 329
1075 3300025926 Ga0207659_10168300 Ga0207659_101683002 329
1076 3300025928 Ga0207700_10068507 Ga0207700_100685073 329
1077 3300025931 Ga0207644_10016384 Ga0207644_100163843 329
1078 3300025932 Ga0207690_10065340 Ga0207690_100653401 329
1079 3300025932 Ga0207690_10347695 Ga0207690_103476952 329
1080 3300025934 Ga0207686_10074101 Ga0207686_100741012 329
1081 3300025934 Ga0207686_10120696 Ga0207686_101206962 329
1082 3300025936 Ga0207670_10000723 Ga0207670_1000072316 329
1083 3300025937 Ga0207669_10002931 Ga0207669_100029316 329
1084 3300025938 Ga0207704_10066762 Ga0207704_100667622 329
1085 3300025939 Ga0207665_10105568 Ga0207665_101055681 329
1086 3300025940 Ga0207691_10000073 Ga0207691_100000738 329
1087 3300025940 Ga0207691_10168208 Ga0207691_101682081 329
1088 3300025944 Ga0207661_10058502 Ga0207661_100585023 329
1089 3300025945 Ga0207679_10026288 Ga0207679_100262883 329
1090 3300025949 Ga0207667_10100630 Ga0207667_101006303 329
1091 3300025949 Ga0207667_10192588 Ga0207667_101925882 329
1092 3300025960 Ga0207651_10006970 Ga0207651_100069703 329
1093 3300025972 Ga0207668_10004960 Ga0207668_100049604 329
1094 3300025972 Ga0207668_10331386 Ga0207668_103313862 329
1095 3300025981 Ga0207640_10014111 Ga0207640_100141113 329
1096 3300025986 Ga0207658_10011808 Ga0207658_100118083 329
1097 3300025986 Ga0207658_10267716 Ga0207658_102677161 329
1098 3300026023 Ga0207677_10013070 Ga0207677_100130701 329
1099 3300026041 Ga0207639_10010774 Ga0207639_100107745 329
1100 3300026041 Ga0207639_10205379 Ga0207639_102053792 329
1101 3300026041 Ga0207639_10468458 Ga0207639_104684581 329
1102 3300026067 Ga0207678_10015275 Ga0207678_100152753 329
1103 3300026067 Ga0207678_10028449 Ga0207678_100284493 329
1104 3300026095 Ga0207676_10013940 Ga0207676_100139403 329
1105 3300026095 Ga0207676_10138947 Ga0207676_101389471 329
1106 3300026116 Ga0207674_10087362 Ga0207674_100873623 329
1107 3300026116 Ga0207674_10131915 Ga0207674_101319153 329
1108 3300026118 Ga0207675_100055382 Ga0207675_1000553824 329
1109 3300026121 Ga0207683_10000125 Ga0207683_1000012563 329
1110 3300026121 Ga0207683_10035316 Ga0207683_100353163 329
1111 3300026121 Ga0207683_10297767 Ga0207683_102977672 329
1112 3300026142 Ga0207698_10012974 Ga0207698_100129744 329
1113 3300026142 Ga0207698_10016062 Ga0207698_100160623 329
1114 3300027682 Ga0209971_1003086 Ga0209971_10030862 329
1115 3300027876 Ga0209974_10005862 Ga0209974_100058625 329
1116 3300028379 Ga0268266_10025721 Ga0268266_100257212 329
1117 3300028379 Ga0268266_10180719 Ga0268266_101807192 329
1118 3300028381 Ga0268264_10028514 Ga0268264_100285144 329
1119 3300031595 Ga0265313_10000459 Ga0265313_1000045918 329
1120 3300031711 Ga0265314_10012723 Ga0265314_100127232 329
1121 3300034957 Ga0373938_0006659 Ga0373938_0006659_715_1719 329
1122 3300035090 Ga0373949_0026300 Ga0373949_0026300_263_1267 329
1123 3300035691 Ga0373931_0001543 Ga0373931_0001543_476_1480 329
1124 3300035691 Ga0373931_0039416 Ga0373931_0039416_1093_2112 329
1125 3300037068 Ga0373925_0125368 Ga0373925_0125368_102_1106 329
1126 3300039438 Ga0436360_1319670 Ga0436360_1319670_1316_2323 329
1127 3300042876 Ga0451577_0030145 Ga0451577_0030145_838_1845 329
1128 3300042876 Ga0451577_0090390 Ga0451577_0090390_320_1333 329
1129 3300042876 Ga0451577_0143805 Ga0451577_0143805_497_1546 329
1130 3300044673 Ga0453683_0001267 Ga0453683_0001267_15372_16373 329
1131 3300044673 Ga0453683_0019365 Ga0453683_0019365_2882_3895 329
1132 3300044712 Ga0453684_0000410 Ga0453684_0000410_17020_18069 329
1133 3300044712 Ga0453684_0003107 Ga0453684_0003107_23332_24345 329
1134 3300044712 Ga0453684_0015338 Ga0453684_0015338_10779_11792 329
1135 3300044712 Ga0453684_0037762 Ga0453684_0037762_2252_3271 329
1136 3300045051 Ga0451576_0000086 Ga0451576_0000086_8102_9115 329
1137 3300045051 Ga0451576_0001338 Ga0451576_0001338_7209_8216 329
1138 3300045051 Ga0451576_0001655 Ga0451576_0001655_1055_2068 329
1139 3300046491 Ga0495584_0118086 Ga0495584_0118086_41_1114 329
1140 3300046516 Ga0495628_0109720 Ga0495628_0109720_306_1331 329
1141 3300046517 Ga0495630_0241047 Ga0495630_0241047_364_1368 329
1142 3300046663 Ga0495635_0195118 Ga0495635_0195118_22_1026 329
1143 3300048903 Ga0496100_0019474 Ga0496100_0019474_2545_3564 329
1144 3300048907 Ga0496104_0099932 Ga0496104_0099932_444_1463 329
1145 3300048908 Ga0496105_0101221 Ga0496105_0101221_69_1073 329
1146 3300048909 Ga0496106_0191474 Ga0496106_0191474_153_1172 329
1147 3300048913 Ga0496110_0179119 Ga0496110_0179119_248_1267 329
1148 3300048914 Ga0496111_0041285 Ga0496111_0041285_1140_2144 329
1149 3300048915 Ga0496112_0228368 Ga0496112_0228368_601_1605 329
1150 3300050493 nmdc:mga0k408_50583_c1 nmdc:mga0k408_50583_c1_197_1201 329
1151 3300050514 nmdc:mga08x19_231006_c1 nmdc:mga08x19_231006_c1_72_1091 329
1152 3300050515 nmdc:mga0a205_16634_c1 nmdc:mga0a205_16634_c1_3257_4264 329
1153 3300053134 Ga0500658_0097416 Ga0500658_0097416_42_1058 329
1154 3300005331 Ga0070670_100067196 Ga0070670_1000671963 330
1155 3300005344 Ga0070661_100254532 Ga0070661_1002545321 330
1156 3300005353 Ga0070669_100045806 Ga0070669_1000458063 330
1157 3300005355 Ga0070671_100246679 Ga0070671_1002466791 330
1158 3300005364 Ga0070673_100003634 Ga0070673_1000036342 330
1159 3300005457 Ga0070662_100014970 Ga0070662_1000149704 330
1160 3300005459 Ga0068867_100072335 Ga0068867_1000723353 330
1161 3300005466 Ga0070685_10115246 Ga0070685_101152462 330
1162 3300005543 Ga0070672_100005555 Ga0070672_1000055556 330
1163 3300005548 Ga0070665_100628701 Ga0070665_1006287012 330
1164 3300005563 Ga0068855_100396217 Ga0068855_1003962172 330
1165 3300005614 Ga0068856_100004556 Ga0068856_1000045562 330
1166 3300005614 Ga0068856_100405987 Ga0068856_1004059872 330
1167 3300005617 Ga0068859_100072059 Ga0068859_1000720594 330
1168 3300005841 Ga0068863_100002920 Ga0068863_10000292014 330
1169 3300005842 Ga0068858_100037861 Ga0068858_1000378614 330
1170 3300005843 Ga0068860_100025907 Ga0068860_1000259073 330
1171 3300005843 Ga0068860_100091407 Ga0068860_1000914073 330
1172 3300005843 Ga0068860_100200930 Ga0068860_1002009301 330
1173 3300005844 Ga0068862_100376060 Ga0068862_1003760601 330
1174 3300005985 Ga0081539_10013484 Ga0081539_100134845 330
1175 3300006237 Ga0097621_100284755 Ga0097621_1002847552 330
1176 3300006931 Ga0097620_100072062 Ga0097620_1000720624 330
1177 3300025920 Ga0207649_10258272 Ga0207649_102582721 330
1178 3300025923 Ga0207681_10067744 Ga0207681_100677441 330
1179 3300025925 Ga0207650_10020385 Ga0207650_100203852 330
1180 3300025925 Ga0207650_10131004 Ga0207650_101310042 330
1181 3300025933 Ga0207706_10021145 Ga0207706_100211455 330
1182 3300025940 Ga0207691_10000906 Ga0207691_1000090612 330
1183 3300025940 Ga0207691_10026837 Ga0207691_100268372 330
1184 3300025945 Ga0207679_10050470 Ga0207679_100504703 330
1185 3300025949 Ga0207667_10133975 Ga0207667_101339752 330
1186 3300026023 Ga0207677_10083176 Ga0207677_100831762 330
1187 3300026035 Ga0207703_10023902 Ga0207703_100239024 330
1188 3300026041 Ga0207639_10066023 Ga0207639_100660233 330
1189 3300026075 Ga0207708_10097963 Ga0207708_100979632 330
1190 3300026078 Ga0207702_10308840 Ga0207702_103088401 330
1191 3300026089 Ga0207648_10052591 Ga0207648_100525913 330
1192 3300026095 Ga0207676_10019795 Ga0207676_100197952 330
1193 3300026095 Ga0207676_10327340 Ga0207676_103273402 330
1194 3300026118 Ga0207675_100537949 Ga0207675_1005379492 330
1195 3300028379 Ga0268266_10051042 Ga0268266_100510423 330
1196 3300028381 Ga0268264_10034463 Ga0268264_100344634 330
1197 3300028381 Ga0268264_10068722 Ga0268264_100687222 330
1198 3300042876 Ga0451577_0095452 Ga0451577_0095452_1040_2059 330
1199 3300044712 Ga0453684_0027105 Ga0453684_0027105_825_1850 330
1200 3300044712 Ga0453684_0075947 Ga0453684_0075947_1913_2923 330
1201 3300044712 Ga0453684_0304832 Ga0453684_0304832_504_1514 330
1202 3300048915 Ga0496112_0383627 Ga0496112_0383627_70_1068 330
1203 3300049572 Ga0501036_0101876 Ga0501036_0101876_883_1938 330
1204 3300049579 Ga0501043_0151309 Ga0501043_0151309_97_1152 330
1205 3300049581 Ga0501047_0091763 Ga0501047_0091763_656_1711 330
1206 3300049590 Ga0501074_0100626 Ga0501074_0100626_778_1833 330
1207 3300049742 Ga0501080_0021602 Ga0501080_0021602_3235_4290 330
1208 3300001977 JGI24746J21847_1009898 JGI24746J21847_10098982 331
1209 3300002155 JGI24033J26618_1007785 JGI24033J26618_10077851 331
1210 3300002239 JGI24034J26672_10008792 JGI24034J26672_100087922 331
1211 3300005290 Ga0065712_10165782 Ga0065712_101657821 331
1212 3300005293 Ga0065715_10234372 Ga0065715_102343722 331
1213 3300005328 Ga0070676_10019139 Ga0070676_100191394 331
1214 3300005329 Ga0070683_100082177 Ga0070683_1000821773 331
1215 3300005330 Ga0070690_100031895 Ga0070690_1000318952 331
1216 3300005331 Ga0070670_100031875 Ga0070670_1000318752 331
1217 3300005331 Ga0070670_100170863 Ga0070670_1001708631 331
1218 3300005333 Ga0070677_10002099 Ga0070677_100020994 331
1219 3300005334 Ga0068869_100014375 Ga0068869_1000143754 331
1220 3300005334 Ga0068869_100040565 Ga0068869_1000405652 331
1221 3300005335 Ga0070666_10005297 Ga0070666_100052977 331
1222 3300005336 Ga0070680_100022866 Ga0070680_1000228664 331
1223 3300005337 Ga0070682_100006007 Ga0070682_1000060076 331
1224 3300005338 Ga0068868_100132544 Ga0068868_1001325441 331
1225 3300005338 Ga0068868_100223088 Ga0068868_1002230882 331
1226 3300005339 Ga0070660_100040784 Ga0070660_1000407842 331
1227 3300005340 Ga0070689_100050127 Ga0070689_1000501272 331
1228 3300005343 Ga0070687_100069061 Ga0070687_1000690612 331
1229 3300005344 Ga0070661_100073827 Ga0070661_1000738273 331
1230 3300005347 Ga0070668_100018935 Ga0070668_1000189353 331
1231 3300005353 Ga0070669_100196411 Ga0070669_1001964112 331
1232 3300005354 Ga0070675_100006906 Ga0070675_1000069062 331
1233 3300005354 Ga0070675_100006939 Ga0070675_1000069392 331
1234 3300005354 Ga0070675_100007450 Ga0070675_1000074507 331
1235 3300005355 Ga0070671_100012862 Ga0070671_1000128623 331
1236 3300005355 Ga0070671_100202187 Ga0070671_1002021872 331
1237 3300005356 Ga0070674_100023250 Ga0070674_1000232503 331
1238 3300005364 Ga0070673_100072857 Ga0070673_1000728572 331
1239 3300005364 Ga0070673_100334362 Ga0070673_1003343621 331
1240 3300005365 Ga0070688_100044635 Ga0070688_1000446352 331
1241 3300005366 Ga0070659_100025010 Ga0070659_1000250102 331
1242 3300005367 Ga0070667_100006157 Ga0070667_1000061574 331
1243 3300005434 Ga0070709_10108171 Ga0070709_101081712 331
1244 3300005435 Ga0070714_100071887 Ga0070714_1000718873 331
1245 3300005436 Ga0070713_100000082 Ga0070713_10000008212 331
1246 3300005436 Ga0070713_100141242 Ga0070713_1001412422 331
1247 3300005438 Ga0070701_10020480 Ga0070701_100204803 331
1248 3300005439 Ga0070711_100148614 Ga0070711_1001486142 331
1249 3300005440 Ga0070705_100007419 Ga0070705_1000074193 331
1250 3300005444 Ga0070694_100014614 Ga0070694_1000146142 331
1251 3300005445 Ga0070708_100017729 Ga0070708_1000177294 331
1252 3300005445 Ga0070708_100089439 Ga0070708_1000894392 331
1253 3300005455 Ga0070663_100026488 Ga0070663_1000264883 331
1254 3300005455 Ga0070663_100031648 Ga0070663_1000316482 331
1255 3300005456 Ga0070678_100006597 Ga0070678_1000065972 331
1256 3300005456 Ga0070678_100036979 Ga0070678_1000369793 331
1257 3300005457 Ga0070662_100069278 Ga0070662_1000692783 331
1258 3300005458 Ga0070681_10137094 Ga0070681_101370942 331
1259 3300005459 Ga0068867_100029950 Ga0068867_1000299502 331
1260 3300005467 Ga0070706_100040051 Ga0070706_1000400512 331
1261 3300005468 Ga0070707_100024229 Ga0070707_1000242291 331
1262 3300005468 Ga0070707_100025877 Ga0070707_1000258775 331
1263 3300005518 Ga0070699_100005930 Ga0070699_1000059306 331
1264 3300005530 Ga0070679_100074823 Ga0070679_1000748233 331
1265 3300005535 Ga0070684_100130188 Ga0070684_1001301882 331
1266 3300005536 Ga0070697_100015485 Ga0070697_1000154856 331
1267 3300005536 Ga0070697_100060421 Ga0070697_1000604212 331
1268 3300005543 Ga0070672_100094467 Ga0070672_1000944672 331
1269 3300005545 Ga0070695_100047943 Ga0070695_1000479433 331
1270 3300005547 Ga0070693_100005184 Ga0070693_1000051844 331
1271 3300005547 Ga0070693_100022378 Ga0070693_1000223783 331
1272 3300005548 Ga0070665_100406426 Ga0070665_1004064262 331
1273 3300005549 Ga0070704_100014373 Ga0070704_1000143732 331
1274 3300005549 Ga0070704_100115777 Ga0070704_1001157772 331
1275 3300005563 Ga0068855_100036940 Ga0068855_1000369402 331
1276 3300005563 Ga0068855_100114675 Ga0068855_1001146753 331
1277 3300005564 Ga0070664_100078105 Ga0070664_1000781053 331
1278 3300005577 Ga0068857_100265838 Ga0068857_1002658381 331
1279 3300005578 Ga0068854_100098261 Ga0068854_1000982613 331
1280 3300005614 Ga0068856_100282854 Ga0068856_1002828542 331
1281 3300005615 Ga0070702_100011692 Ga0070702_1000116922 331
1282 3300005616 Ga0068852_100069416 Ga0068852_1000694162 331
1283 3300005618 Ga0068864_100062613 Ga0068864_1000626133 331
1284 3300005618 Ga0068864_100213280 Ga0068864_1002132802 331
1285 3300005718 Ga0068866_10001554 Ga0068866_100015544 331
1286 3300005718 Ga0068866_10002116 Ga0068866_100021166 331
1287 3300005719 Ga0068861_100006691 Ga0068861_1000066916 331
1288 3300005834 Ga0068851_10033582 Ga0068851_100335823 331
1289 3300005840 Ga0068870_10059298 Ga0068870_100592982 331
1290 3300005841 Ga0068863_100050924 Ga0068863_1000509242 331
1291 3300005841 Ga0068863_100066030 Ga0068863_1000660302 331
1292 3300005842 Ga0068858_100110190 Ga0068858_1001101902 331
1293 3300005843 Ga0068860_100314122 Ga0068860_1003141222 331
1294 3300005844 Ga0068862_100026328 Ga0068862_1000263285 331
1295 3300006173 Ga0070716_100061087 Ga0070716_1000610873 331
1296 3300006175 Ga0070712_100034059 Ga0070712_1000340592 331
1297 3300006237 Ga0097621_100037043 Ga0097621_1000370433 331
1298 3300006237 Ga0097621_100315933 Ga0097621_1003159332 331
1299 3300006358 Ga0068871_100019778 Ga0068871_1000197783 331
1300 3300006358 Ga0068871_100027399 Ga0068871_1000273993 331
1301 3300006871 Ga0075434_100009983 Ga0075434_1000099833 331
1302 3300007076 Ga0075435_100001831 Ga0075435_10000183111 331
1303 3300009093 Ga0105240_10089869 Ga0105240_100898692 331
1304 3300009098 Ga0105245_10025459 Ga0105245_100254594 331
1305 3300009098 Ga0105245_10128268 Ga0105245_101282683 331
1306 3300009147 Ga0114129_10164993 Ga0114129_101649932 331
1307 3300009147 Ga0114129_10256402 Ga0114129_102564022 331
1308 3300009174 Ga0105241_10012933 Ga0105241_100129333 331
1309 3300009174 Ga0105241_10028627 Ga0105241_100286272 331
1310 3300009176 Ga0105242_10031060 Ga0105242_100310603 331
1311 3300009177 Ga0105248_10017473 Ga0105248_100174733 331
1312 3300009545 Ga0105237_10046901 Ga0105237_100469013 331
1313 3300009551 Ga0105238_10055325 Ga0105238_100553252 331
1314 3300011119 Ga0105246_10023930 Ga0105246_100239302 331
1315 3300013100 Ga0157373_10054441 Ga0157373_100544412 331
1316 3300013104 Ga0157370_10061944 Ga0157370_100619442 331
1317 3300013297 Ga0157378_10029356 Ga0157378_100293563 331
1318 3300013297 Ga0157378_10282438 Ga0157378_102824381 331
1319 3300013306 Ga0163162_10032882 Ga0163162_100328823 331
1320 3300013306 Ga0163162_10231285 Ga0163162_102312852 331
1321 3300014326 Ga0157380_10004823 Ga0157380_100048234 331
1322 3300014968 Ga0157379_10062582 Ga0157379_100625822 331
1323 3300014969 Ga0157376_10031466 Ga0157376_100314663 331
1324 3300014969 Ga0157376_10081290 Ga0157376_100812903 331
1325 3300017792 Ga0163161_10020410 Ga0163161_100204103 331
1326 3300017792 Ga0163161_10065205 Ga0163161_100652052 331
1327 3300025315 Ga0207697_10004348 Ga0207697_100043483 331
1328 3300025893 Ga0207682_10001905 Ga0207682_100019053 331
1329 3300025898 Ga0207692_10054486 Ga0207692_100544863 331
1330 3300025899 Ga0207642_10002098 Ga0207642_100020983 331
1331 3300025901 Ga0207688_10010293 Ga0207688_100102934 331
1332 3300025903 Ga0207680_10024188 Ga0207680_100241883 331
1333 3300025903 Ga0207680_10036114 Ga0207680_100361143 331
1334 3300025907 Ga0207645_10003592 Ga0207645_100035923 331
1335 3300025907 Ga0207645_10066483 Ga0207645_100664832 331
1336 3300025908 Ga0207643_10002620 Ga0207643_100026205 331
1337 3300025909 Ga0207705_10065653 Ga0207705_100656533 331
1338 3300025910 Ga0207684_10097880 Ga0207684_100978802 331
1339 3300025910 Ga0207684_10122131 Ga0207684_101221312 331
1340 3300025910 Ga0207684_10161083 Ga0207684_101610832 331
1341 3300025911 Ga0207654_10073423 Ga0207654_100734232 331
1342 3300025912 Ga0207707_10052467 Ga0207707_100524673 331
1343 3300025913 Ga0207695_10177212 Ga0207695_101772122 331
1344 3300025914 Ga0207671_10071057 Ga0207671_100710573 331
1345 3300025915 Ga0207693_10019572 Ga0207693_100195725 331
1346 3300025917 Ga0207660_10026345 Ga0207660_100263452 331
1347 3300025919 Ga0207657_10002340 Ga0207657_1000234012 331
1348 3300025920 Ga0207649_10059850 Ga0207649_100598502 331
1349 3300025921 Ga0207652_10030770 Ga0207652_100307702 331
1350 3300025922 Ga0207646_10015366 Ga0207646_100153666 331
1351 3300025923 Ga0207681_10021185 Ga0207681_100211853 331
1352 3300025924 Ga0207694_10168931 Ga0207694_101689312 331
1353 3300025925 Ga0207650_10000814 Ga0207650_1000081418 331
1354 3300025925 Ga0207650_10054378 Ga0207650_100543782 331
1355 3300025926 Ga0207659_10061112 Ga0207659_100611122 331
1356 3300025926 Ga0207659_10074474 Ga0207659_100744742 331
1357 3300025926 Ga0207659_10318511 Ga0207659_103185111 331
1358 3300025927 Ga0207687_10009285 Ga0207687_100092854 331
1359 3300025927 Ga0207687_10014734 Ga0207687_100147343 331
1360 3300025927 Ga0207687_10034795 Ga0207687_100347952 331
1361 3300025927 Ga0207687_10163427 Ga0207687_101634272 331
1362 3300025928 Ga0207700_10000606 Ga0207700_100006061 331
1363 3300025928 Ga0207700_10115769 Ga0207700_101157692 331
1364 3300025929 Ga0207664_10003701 Ga0207664_1000370110 331
1365 3300025931 Ga0207644_10012754 Ga0207644_100127545 331
1366 3300025931 Ga0207644_10054594 Ga0207644_100545943 331
1367 3300025933 Ga0207706_10014421 Ga0207706_100144212 331
1368 3300025933 Ga0207706_10023776 Ga0207706_100237763 331
1369 3300025934 Ga0207686_10002320 Ga0207686_100023207 331
1370 3300025934 Ga0207686_10053076 Ga0207686_100530762 331
1371 3300025935 Ga0207709_10013585 Ga0207709_100135852 331
1372 3300025936 Ga0207670_10034337 Ga0207670_100343372 331
1373 3300025937 Ga0207669_10011960 Ga0207669_100119603 331
1374 3300025939 Ga0207665_10006550 Ga0207665_100065503 331
1375 3300025940 Ga0207691_10046606 Ga0207691_100466063 331
1376 3300025941 Ga0207711_10010225 Ga0207711_100102254 331
1377 3300025942 Ga0207689_10002991 Ga0207689_100029919 331
1378 3300025942 Ga0207689_10032521 Ga0207689_100325213 331
1379 3300025942 Ga0207689_10047608 Ga0207689_100476082 331
1380 3300025944 Ga0207661_10168288 Ga0207661_101682882 331
1381 3300025945 Ga0207679_10071194 Ga0207679_100711943 331
1382 3300025949 Ga0207667_10204498 Ga0207667_102044982 331
1383 3300025960 Ga0207651_10050771 Ga0207651_100507712 331
1384 3300025960 Ga0207651_10240384 Ga0207651_102403841 331
1385 3300025960 Ga0207651_10307554 Ga0207651_103075542 331
1386 3300025961 Ga0207712_10018557 Ga0207712_100185573 331
1387 3300025972 Ga0207668_10023034 Ga0207668_100230343 331
1388 3300025972 Ga0207668_10036354 Ga0207668_100363542 331
1389 3300025972 Ga0207668_10293629 Ga0207668_102936291 331
1390 3300025981 Ga0207640_10092269 Ga0207640_100922692 331
1391 3300025986 Ga0207658_10036950 Ga0207658_100369502 331
1392 3300025986 Ga0207658_10137006 Ga0207658_101370062 331
1393 3300026023 Ga0207677_10011449 Ga0207677_100114493 331
1394 3300026023 Ga0207677_10014449 Ga0207677_100144492 331
1395 3300026023 Ga0207677_10074865 Ga0207677_100748652 331
1396 3300026035 Ga0207703_10042917 Ga0207703_100429173 331
1397 3300026035 Ga0207703_10400663 Ga0207703_104006631 331
1398 3300026067 Ga0207678_10042669 Ga0207678_100426692 331
1399 3300026067 Ga0207678_10213494 Ga0207678_102134942 331
1400 3300026075 Ga0207708_10006169 Ga0207708_100061697 331
1401 3300026078 Ga0207702_10079389 Ga0207702_100793892 331
1402 3300026088 Ga0207641_10068717 Ga0207641_100687172 331
1403 3300026088 Ga0207641_10143351 Ga0207641_101433511 331
1404 3300026088 Ga0207641_10473403 Ga0207641_104734031 331
1405 3300026089 Ga0207648_10003243 Ga0207648_100032437 331
1406 3300026089 Ga0207648_10097852 Ga0207648_100978522 331
1407 3300026095 Ga0207676_10008753 Ga0207676_100087531 331
1408 3300026116 Ga0207674_10206589 Ga0207674_102065891 331
1409 3300026118 Ga0207675_100010454 Ga0207675_1000104547 331
1410 3300026121 Ga0207683_10001991 Ga0207683_100019914 331
1411 3300026121 Ga0207683_10022436 Ga0207683_100224364 331
1412 3300026142 Ga0207698_10037610 Ga0207698_100376103 331
1413 3300026142 Ga0207698_10058971 Ga0207698_100589712 331
1414 3300026142 Ga0207698_10167900 Ga0207698_101679002 331
1415 3300028380 Ga0268265_10060363 Ga0268265_100603633 331
1416 3300028381 Ga0268264_10036930 Ga0268264_100369303 331
1417 3300028381 Ga0268264_10069971 Ga0268264_100699712 331
1418 3300028381 Ga0268264_10257818 Ga0268264_102578181 331
1419 3300031238 Ga0265332_10000782 Ga0265332_100007828 331
1420 3300031250 Ga0265331_10000875 Ga0265331_1000087514 331
1421 3300031251 Ga0265327_10011522 Ga0265327_100115223 331
1422 3300031548 Ga0307408_100001134 Ga0307408_1000011344 331
1423 3300031712 Ga0265342_10021351 Ga0265342_100213512 331
1424 3300031731 Ga0307405_10005974 Ga0307405_100059743 331
1425 3300031824 Ga0307413_10001664 Ga0307413_100016648 331
1426 3300031852 Ga0307410_10002322 Ga0307410_100023222 331
1427 3300031901 Ga0307406_10024627 Ga0307406_100246273 331
1428 3300031903 Ga0307407_10056194 Ga0307407_100561943 331
1429 3300031911 Ga0307412_10019789 Ga0307412_100197892 331
1430 3300031995 Ga0307409_100003079 Ga0307409_1000030798 331
1431 3300032002 Ga0307416_100219551 Ga0307416_1002195512 331
1432 3300032004 Ga0307414_10044318 Ga0307414_100443182 331
1433 3300032005 Ga0307411_10000379 Ga0307411_1000037912 331
1434 3300032126 Ga0307415_100040640 Ga0307415_1000406401 331
1435 3300035695 Ga0373927_0047115 Ga0373927_0047115_710_1711 331
1436 3300036401 Ga0373937_0034885 Ga0373937_0034885_1589_2590 331
1437 3300037471 Ga0395905_0080666 Ga0395905_0080666_795_1796 331
1438 3300038443 Ga0395901_0051872 Ga0395901_0051872_816_1817 331
1439 3300042876 Ga0451577_0004153 Ga0451577_0004153_11801_12832 331
1440 3300044735 Ga0466968_0056523 Ga0466968_0056523_90_1091 331
1441 3300045051 Ga0451576_0002897 Ga0451576_0002897_1903_2934 331
1442 3300048088 Ga0495602_0253411 Ga0495602_0253411_294_1295 331
1443 3300048904 Ga0496101_0235942 Ga0496101_0235942_37_1038 331
1444 3300048905 Ga0496102_0066472 Ga0496102_0066472_1811_2812 331
1445 3300048906 Ga0496103_0060539 Ga0496103_0060539_499_1500 331
1446 3300048909 Ga0496106_0079413 Ga0496106_0079413_488_1489 331
1447 3300048911 Ga0496108_0223880 Ga0496108_0223880_106_1101 331
1448 3300048915 Ga0496112_0215243 Ga0496112_0215243_823_1824 331
1449 3300048915 Ga0496112_0512841 Ga0496112_0512841_97_1101 331
1450 3300050507 nmdc:mga05p37_182389_c1 nmdc:mga05p37_182389_c1_1369_2370 331
1451 3300050507 nmdc:mga05p37_99457_c1 nmdc:mga05p37_99457_c1_874_1875 331
1452 3300050511 nmdc:mga08y16_349484_c1 nmdc:mga08y16_349484_c1_300_1343 331
1453 3300050512 nmdc:mga0n895_138025_c1 nmdc:mga0n895_138025_c1_305_1306 331
1454 3300050512 nmdc:mga0n895_7965_c1 nmdc:mga0n895_7965_c1_6751_7752 331
1455 3300050513 nmdc:mga0rr50_8812_c1 nmdc:mga0rr50_8812_c1_4521_5522 331
1456 3300050515 nmdc:mga0a205_5666_c1 nmdc:mga0a205_5666_c1_5534_6535 331
1457 3300053077 Ga0495601_0027642 Ga0495601_0027642_1954_2955 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

93

378

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nf0-assembly7.cif.gz_G crystal structure of a trap periplasmic solute binding protein from pseudomonas aeruginosa pao1 (pa4616), target efi-510182, with bound l-malate 0.984 24 310
4o94-assembly2.cif.gz_B crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_3329), target efi-510223, with bound succinate 0.9838 23 326
4o7m-assembly3.cif.gz_C crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4, target efi-510273, with bound l-malate 0.9828 24 304
4mx6-assembly1.cif.gz_A crystal structure of a trap periplasmic solute binding protein from shewanella oneidensis (so_3134), target efi-510275, with bound succinate 0.9809 24 327
4oa4-assembly4.cif.gz_D crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4 (shew_1446), target efi-510273, with bound succinate 0.9806 24 326
ID Description Score Start End Superfamily
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.984 24 310 3.40.190.170
4oa4B00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9785 24 327 3.40.190.170
4nf0G00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9772 24 310 3.40.190.170
4oa4B00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9689 24 327 3.40.190.170
4nf0E00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9632 27 302 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A7Y3AIK7-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9873 23 252 GO:0015740
GO:0030288
GO:0055085
AF-A0A643FFV0-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9864 24 331 GO:0015740
GO:0030288
GO:0055085
AF-A0A1F4Q9L9-F1-model_v4 C4-dicarboxylate ABC transporter 0.9816 16 323 GO:0030288
GO:0055085
AF-A0A7C2JR81-F1-model_v4 DctP family TRAP transporter solute-binding subunit 0.9811 17 331 GO:0015740
GO:0030288
GO:0055085
AF-A0A423FV79-F1-model_v4 C4-dicarboxylate ABC transporter 0.9792 17 331 GO:0015740
GO:0030288
GO:0055085

Feature Viewer

pLDDT pTM Quality
93.82 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map