F494099

General Info

Members Datasets Scaffolds Average Seq Length
1457 658 2914 395

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000032|Ga0495686_0000032_132055_133482
Length 475
Sequence MDAGMPRAGCPASAGASVGAALRLGTSGNMHFEAAGAQQPVHVSALYRAALLPTVSACGFSRGFLPGGSIRCTSRSSGTMIIHSLLDTDLYKFTMMQVVLHHFPAAHAEYKFRCRTQGVDLVPYIDEIREEVRALCQLRFTEDELEYLRRMRFIKSDFIDFLALFHLNEKLVTIKPSAKNNGEIDIDIVGPWLHTILFEIPVLAIVNEVYFRNTQRDPTFETGRDRLRDKIELLGGRPEVSDCKIADYGTRRRFSGKWHEEVILKLKEGLGEQFTGTSNVYYAMKHGLRPLGTMAHEYLQACQALGPRLRDSQVFGFEMWAKEYRGDLGIALSDVYGMKAFLNDFDMYFCKLFDGARHDSGDPFDWGERLIRHYEQNRCDPRTKVLVFSDALDIPKVLRLYERFRGRCQLAFGVGTNLTNDLGYQPLQIVIKMVRCNGQPVAKLSDSPGKNMCEDQAYLAYLRQVFDIAKPVGEL

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
23 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
24 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
25 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
26 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
27 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
105 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
147 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
148 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
149 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
155 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
167 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
233 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
245 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
248 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
249 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
250 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
251 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
259 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
260 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
261 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
262 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
263 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
264 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
268 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
269 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
272 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
283 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
284 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
285 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
286 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
287 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
288 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
289 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
290 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
291 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
292 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
295 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
296 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
297 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
298 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
299 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
300 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
301 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
302 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
303 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
304 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
305 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
306 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
307 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
308 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
309 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
310 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
311 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
312 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
313 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
314 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
321 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
322 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
323 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
324 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
325 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
326 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
327 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
328 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
329 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
330 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
331 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
332 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
333 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
334 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
335 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
336 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
337 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
338 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
339 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
340 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
341 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
342 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
343 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
344 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
345 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
346 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
347 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
348 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
349 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
350 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
351 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
352 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
363 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
364 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
365 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
366 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
369 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
370 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
371 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
372 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
373 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
374 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
375 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
376 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
377 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
378 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
379 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
380 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
381 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
382 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
383 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
384 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
385 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
386 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
387 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
388 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
389 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
390 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
391 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
392 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
393 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
394 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
401 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
402 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
403 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
404 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
405 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
406 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
407 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
408 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
409 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
410 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
413 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
418 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
419 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
424 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
435 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
436 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
437 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
438 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
439 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
440 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
441 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
442 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
445 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
446 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
447 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
448 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
449 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
452 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
453 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
456 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
457 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
458 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
459 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
460 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
461 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
462 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
463 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
464 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
467 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
468 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
469 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
470 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
471 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
472 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
473 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
476 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
477 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
478 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
479 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
480 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
481 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
482 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
483 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
484 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
485 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
486 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
487 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
488 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
489 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
490 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
491 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
492 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
493 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
494 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
495 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
496 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
497 2519103095 Burkholderia sp. KJ006 Isolate Nodule
498 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
499 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
500 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
501 2547132374 Acidovorax radicis N35 Isolate Unclassified
502 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
503 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
504 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
505 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
506 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
507 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
508 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
509 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
510 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
511 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
512 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
513 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
514 2643221569 Achromobacter sp. Root565 Isolate Unclassified
515 2643221570 Acidovorax sp. Root568 Isolate Unclassified
516 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
517 2643221594 Achromobacter sp. Root170 Isolate Unclassified
518 2643221596 Acidovorax sp. Root70 Isolate Unclassified
519 2643221609 Acidovorax sp. Root217 Isolate Unclassified
520 2643221611 Acidovorax sp. Root219 Isolate Unclassified
521 2643221621 Achromobacter sp. Root83 Isolate Unclassified
522 2643221652 Acidovorax sp. Root402 Isolate Unclassified
523 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
524 2643221717 Acidovorax sp. Root267 Isolate Unclassified
525 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
526 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
527 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
528 2721755523 Delftia sp. HK171 Isolate Unclassified
529 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
530 2734482264 Dyella sp. AD052 Isolate Unclassified
531 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
532 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
533 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
534 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
535 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
536 2738543009 Luteibacter sp. OK325 Isolate Unclassified
537 2738543012 Acidovorax sp. CF301 Isolate Unclassified
538 2738543013 Variovorax sp. BT01 Isolate Unclassified
539 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
540 2739367700 Dyella sp. YR388 Isolate Unclassified
541 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
542 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
543 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
544 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
545 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
546 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
547 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
548 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
549 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
550 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
551 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
552 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
553 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
554 2816332133 Acidovorax radicis 2721A Isolate Unclassified
555 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
556 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
557 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
558 2818991436 Collimonas arenae 515 Isolate Unclassified
559 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
560 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
561 2818991450 Burkholderia sp. 604 Isolate Unclassified
562 2818991452 Burkholderia cepacia 561 Isolate Unclassified
563 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
564 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
565 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
566 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
567 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
568 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
569 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
570 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
571 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
572 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
573 2855730933 Achromobacter sp. HZ28 Isolate Nodule
574 2855767633 Achromobacter sp. HZ34 Isolate Nodule
575 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
576 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
577 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
578 2858950400 Achromobacter sp. K91 Isolate Unclassified
579 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
580 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
581 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
582 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
583 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
584 2884411467 Dyella sp. AD56 Isolate Rhizosphere
585 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
586 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
587 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
588 2885266251 Ralstonia sp. SET104 Isolate Nodule
589 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
590 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
591 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
592 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
593 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
594 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
595 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
596 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
597 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
598 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
599 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
600 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
601 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
602 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
603 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
604 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
605 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
606 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
607 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
608 2904564687 Burkholderia sp. 571 Isolate Unclassified
609 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
610 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
611 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
612 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
613 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
614 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
615 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
616 2919404418 Luteibacter sp. 3190 Isolate Unclassified
617 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
618 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
619 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
620 2928058823 Ralstonia sp. 1138 Isolate Unclassified
621 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
622 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
623 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
624 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
625 2928163908 Burkholderia sp. 567 Isolate Unclassified
626 2928170801 Burkholderia sp. 572 Isolate Unclassified
627 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
628 2928536128 Burkholderia sola 565 Isolate Unclassified
629 2928963466 Dyella japonica 1073 Isolate Unclassified
630 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
631 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
632 2941479691
633 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
634 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
635 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
636 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
637 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
638 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
639 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
640 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
641 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
642 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
643 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
644 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
645 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
646 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
647 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
648 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
649 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
650 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
651 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
652 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
653 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
654 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
655 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
656 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
657 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
658 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.23
Metatranscriptomes 0.27
Isolates 12.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.4
Nodule 2.26
Rhizoplane 2.75
Rhizosphere 63.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0000032 3300047472 Bacteria 345132
2 JGI24741J21665_1000010 3300001915 Bacteria 44368
3 JGI24740J21852_10000304 3300001979 Bacteria 20859
4 JGI24740J21852_10000783 3300001979 Bacteria 13957
5 JGI24740J21852_10000978 3300001979 Bacteria 12756
6 JGI24740J21852_10003282 3300001979 Bacteria 7132
7 JGI24739J22299_10000112 3300001989 Bacteria 25198
8 JGI24739J22299_10003808 3300001989 Bacteria 5756
9 JGI24739J22299_10013313 3300001989 Bacteria 3005
10 JGI24739J22299_10025297 3300001989 Bacteria 2088
11 JGI24737J22298_10012110 3300001990 Bacteria 2816
12 JGI24737J22298_10023387 3300001990 Bacteria 1961
13 JGI24735J21928_10000665 3300002067 Bacteria 12156
14 JGI24735J21928_10000684 3300002067 Bacteria 12013
15 JGI24735J21928_10011596 3300002067 Bacteria 2792
16 JGI24735J21928_10018786 3300002067 Bacteria 2129
17 JGI24735J21928_10035330 3300002067 Bacteria 1470
18 JGI24738J21930_10001352 3300002075 Bacteria 6801
19 JGI25155J39150_1000126 3300002704 Bacteria 37345
20 JGI25155J39150_1000177 3300002704 Bacteria 27568
21 JGI25156J39149_1000057 3300002705 Bacteria 86392
22 JGI25156J39149_1000214 3300002705 Bacteria 40310
23 JGI25156J39149_1001009 3300002705 Bacteria 13255
24 JGI25156J39149_1001319 3300002705 Bacteria 10730
25 JGI25156J39149_1002562 3300002705 Bacteria 6442
26 JGI25156J39149_1002845 3300002705 Bacteria 5954
27 JGI25156J39149_1005837 3300002705 Bacteria 3474
28 JGI25156J39149_1009942 3300002705 Bacteria 2272
29 JGI25162J39368_1000138 3300002737 Bacteria 78713
30 JGI25162J39368_1000443 3300002737 Bacteria 32916
31 JGI25162J39368_1000786 3300002737 Bacteria 21328
32 JGI25162J39368_1001136 3300002737 Bacteria 16004
33 JGI25162J39368_1003039 3300002737 Bacteria 5460
34 JGI25154J39366_1000087 3300002738 Bacteria 86392
35 JGI25154J39366_1000206 3300002738 Bacteria 42302
36 JGI25154J39366_1001056 3300002738 Bacteria 10926
37 JGI25157J39369_1000156 3300002741 Bacteria 56715
38 JGI25157J39369_1000172 3300002741 Bacteria 54469
39 JGI25157J39369_1000441 3300002741 Bacteria 26541
40 JGI25157J39369_1000643 3300002741 Bacteria 19536
41 JGI25157J39369_1000992 3300002741 Bacteria 13276
42 JGI25157J39369_1002371 3300002741 Bacteria 4808
43 JGI25163J39215_1000278 3300002771 Bacteria 18020
44 JGI25164J39214_1000170 3300002772 Bacteria 60952
45 JGI25164J39214_1000310 3300002772 Bacteria 32075
46 JGI25164J39214_1000375 3300002772 Bacteria 26542
47 JGI25164J39214_1001368 3300002772 Bacteria 5880
48 JGI25164J39214_1001375 3300002772 Bacteria 5841
49 JGI25151J46595_10005080 3300003187 Bacteria 6844
50 JGI25151J46595_10011877 3300003187 Bacteria 3985
51 JGI25165J46597_1000105 3300003214 Bacteria 152144
52 JGI25165J46597_1000224 3300003214 Bacteria 78713
53 JGI25165J46597_1000549 3300003214 Bacteria 34283
54 JGI25165J46597_1000580 3300003214 Bacteria 32075
55 JGI25165J46597_1002481 3300003214 Bacteria 5880
56 JGI25165J46597_1002491 3300003214 Bacteria 5841
57 JGI25153J46596_10006045 3300003215 Bacteria 6219
58 rootH1_10022880 3300003316 Bacteria 2980
59 rootH2_10000174 3300003320 Bacteria 21671
60 rootH2_10006665 3300003320 Bacteria 3330
61 rootL2_10098200 3300003322 Bacteria 4242
62 JGI25160J50197_1000082 3300003354 Bacteria 97878
63 Ga0055538_1000043 3300003751 Bacteria 152144
64 Ga0055538_1000045 3300003751 Bacteria 139066
65 Ga0055538_1002105 3300003751 Bacteria 3167
66 Ga0055539_1000034 3300003752 Bacteria 223400
67 Ga0055539_1000057 3300003752 Bacteria 152144
68 Ga0055539_1000064 3300003752 Bacteria 139066
69 Ga0055533_1000071 3300003756 Bacteria 152144
70 Ga0055533_1000074 3300003756 Bacteria 139066
71 Ga0055533_1000540 3300003756 Bacteria 13457
72 Ga0055533_1001327 3300003756 Bacteria 6705
73 Ga0055532_1000002 3300003758 Bacteria 576000
74 Ga0055532_1000016 3300003758 Bacteria 327509
75 Ga0055532_1000039 3300003758 Bacteria 198049
76 Ga0055532_1000643 3300003758 Bacteria 13493
77 Ga0055532_1000713 3300003758 Bacteria 12362
78 Ga0055532_1000720 3300003758 Bacteria 12288
79 Ga0055525_1000085 3300003759 Bacteria 152144
80 Ga0055525_1000092 3300003759 Bacteria 139066
81 Ga0055525_1000192 3300003759 Bacteria 72944
82 Ga0055525_1000313 3300003759 Bacteria 39508
83 Ga0055525_1000473 3300003759 Bacteria 22055
84 Ga0055527_1000024 3300003760 Bacteria 198049
85 Ga0055527_1000041 3300003760 Bacteria 116981
86 Ga0055527_1000234 3300003760 Bacteria 34826
87 Ga0055527_1000276 3300003760 Bacteria 30569
88 Ga0055527_1001073 3300003760 Bacteria 6471
89 Ga0055535_1000028 3300003761 Bacteria 198049
90 Ga0055535_1000193 3300003761 Bacteria 64634
91 Ga0055535_1000216 3300003761 Bacteria 60912
92 Ga0055535_1000457 3300003761 Bacteria 37713
93 Ga0055535_1000502 3300003761 Bacteria 34740
94 Ga0055535_1001000 3300003761 Bacteria 18231
95 Ga0055535_1001317 3300003761 Bacteria 13235
96 Ga0055535_1001326 3300003761 Bacteria 13176
97 Ga0055535_1003753 3300003761 Bacteria 4074
98 Ga0055542_1000047 3300003762 Bacteria 198049
99 Ga0055542_1000136 3300003762 Bacteria 93218
100 Ga0055542_1000152 3300003762 Bacteria 87561
101 Ga0055542_1000179 3300003762 Bacteria 78713
102 Ga0055542_1000183 3300003762 Bacteria 77794
103 Ga0055542_1000520 3300003762 Bacteria 34740
104 Ga0055542_1001547 3300003762 Bacteria 10937
105 Ga0055542_1001665 3300003762 Bacteria 9904
106 Ga0055542_1003689 3300003762 Bacteria 4015
107 Ga0055529_1000028 3300003763 Bacteria 287650
108 Ga0055529_1000054 3300003763 Bacteria 198049
109 Ga0055529_1000189 3300003763 Bacteria 84123
110 Ga0055529_1000254 3300003763 Bacteria 64036
111 Ga0055529_1000552 3300003763 Bacteria 31487
112 Ga0055529_1001001 3300003763 Bacteria 13766
113 Ga0055526_1011699 3300003771 Bacteria 3920
114 Ga0055526_1017490 3300003771 Bacteria 2733
115 Ga0055524_1006917 3300003775 Bacteria 4881
116 Ga0055536_1000087 3300003781 Bacteria 79591
117 Ga0055534_1000910 3300003784 Bacteria 13339
118 Ga0055534_1001301 3300003784 Bacteria 10095
119 Ga0055534_1001898 3300003784 Bacteria 7714
120 Ga0055528_1004561 3300003790 Bacteria 6643
121 Ga0055541_1000044 3300003841 Bacteria 152144
122 Ga0055541_1000046 3300003841 Bacteria 139066
123 Ga0055541_1008710 3300003841 Bacteria 1606
124 Ga0058692_1002802 3300003856 Bacteria 5728
125 Ga0065165_1000250 3300005262 Bacteria 93116
126 Ga0065165_1000790 3300005262 Bacteria 42379
127 Ga0065704_10081336 3300005289 Bacteria 3777
128 Ga0065715_10187709 3300005293 Bacteria 1434
129 Ga0065707_10111924 3300005295 Bacteria 2378
130 Ga0070658_10071329 3300005327 Bacteria 2845
131 Ga0070658_10144004 3300005327 Bacteria 1992
132 Ga0070676_10054594 3300005328 Bacteria 2355
133 Ga0070683_100059687 3300005329 Bacteria 3544
134 Ga0070690_100001754 3300005330 Bacteria 11471
135 Ga0070670_100055684 3300005331 Bacteria 3394
136 Ga0070670_100139443 3300005331 Bacteria 2097
137 Ga0068869_100001435 3300005334 Bacteria 14129
138 Ga0070666_10046595 3300005335 Bacteria 2909
139 Ga0070680_100000789 3300005336 Bacteria 22263
140 Ga0070680_100022650 3300005336 Bacteria 5006
141 Ga0070680_100055318 3300005336 Bacteria 3243
142 Ga0070680_100173530 3300005336 Bacteria 1815
143 Ga0070682_100003408 3300005337 Bacteria 8817
144 Ga0070682_100035827 3300005337 Bacteria 3031
145 Ga0068868_100001331 3300005338 Bacteria 17036
146 Ga0070660_100000016 3300005339 Bacteria 102648
147 Ga0070660_100011617 3300005339 Bacteria 6268
148 Ga0070689_100000776 3300005340 Bacteria 19580
149 Ga0070689_100047885 3300005340 Bacteria 3296
150 Ga0070691_10029459 3300005341 Bacteria 2568
151 Ga0070687_100000436 3300005343 Bacteria 14119
152 Ga0070661_100000013 3300005344 Bacteria 163010
153 Ga0070661_100042504 3300005344 Bacteria 3318
154 Ga0070692_10000910 3300005345 Bacteria 10019
155 Ga0070668_100058281 3300005347 Bacteria 2987
156 Ga0070668_100106786 3300005347 Bacteria 2225
157 Ga0070669_100000706 3300005353 Bacteria 24466
158 Ga0070669_100068696 3300005353 Bacteria 2616
159 Ga0070675_100056072 3300005354 Bacteria 3245
160 Ga0070671_100227409 3300005355 Bacteria 1583
161 Ga0070673_100265129 3300005364 Bacteria 1502
162 Ga0070659_100000167 3300005366 Bacteria 50757
163 Ga0070659_100003331 3300005366 Bacteria 11431
164 Ga0070659_100007239 3300005366 Bacteria 8054
165 Ga0070659_100044058 3300005366 Bacteria 3492
166 Ga0070714_100000088 3300005435 Bacteria 77301
167 Ga0070714_100035404 3300005435 Bacteria 4184
168 Ga0070713_100003177 3300005436 Bacteria 10811
169 Ga0070710_10058408 3300005437 Bacteria 2188
170 Ga0070705_100001008 3300005440 Bacteria 15668
171 Ga0070705_100048956 3300005440 Bacteria 2452
172 Ga0070700_100000666 3300005441 Bacteria 16998
173 Ga0070694_100001273 3300005444 Bacteria 14642
174 Ga0070694_100009337 3300005444 Bacteria 6020
175 Ga0070694_100046544 3300005444 Bacteria 2912
176 Ga0070694_100056927 3300005444 Bacteria 2657
177 Ga0070694_100123354 3300005444 Bacteria 1862
178 Ga0070708_100061073 3300005445 Bacteria 3366
179 Ga0070663_100000006 3300005455 Bacteria 208068
180 Ga0070663_100000479 3300005455 Bacteria 21030
181 Ga0070663_100030317 3300005455 Bacteria 3705
182 Ga0070663_100033311 3300005455 Bacteria 3558
183 Ga0070663_100111631 3300005455 Bacteria 2055
184 Ga0070681_10000235 3300005458 Bacteria 43570
185 Ga0070681_10001320 3300005458 Bacteria 21646
186 Ga0070681_10003359 3300005458 Bacteria 14968
187 Ga0070681_10056509 3300005458 Bacteria 3906
188 Ga0068867_100000699 3300005459 Bacteria 22369
189 Ga0068867_100001386 3300005459 Bacteria 16761
190 Ga0070699_100002487 3300005518 Bacteria 16563
191 Ga0070679_100011170 3300005530 Bacteria 8555
192 Ga0070679_100015423 3300005530 Bacteria 7345
193 Ga0070679_100036570 3300005530 Bacteria 4873
194 Ga0070679_100105841 3300005530 Bacteria 2799
195 Ga0070684_100158444 3300005535 Bacteria 2053
196 Ga0070697_100001807 3300005536 Bacteria 16334
197 Ga0070697_100003810 3300005536 Bacteria 11585
198 Ga0068853_100132135 3300005539 Bacteria 2236
199 Ga0070672_100131652 3300005543 Bacteria 2056
200 Ga0070686_100002450 3300005544 Bacteria 10226
201 Ga0070686_100067700 3300005544 Bacteria 2327
202 Ga0070695_100000113 3300005545 Bacteria 35966
203 Ga0070695_100024153 3300005545 Bacteria 3742
204 Ga0070696_100000434 3300005546 Bacteria 26295
205 Ga0070696_100002179 3300005546 Bacteria 12906
206 Ga0070696_100002261 3300005546 Bacteria 12697
207 Ga0070696_100002633 3300005546 Bacteria 11898
208 Ga0070693_100000209 3300005547 Bacteria 27275
209 Ga0070693_100015359 3300005547 Bacteria 3941
210 Ga0070665_100002809 3300005548 Bacteria 18859
211 Ga0068855_100000072 3300005563 Bacteria 121486
212 Ga0068855_100014327 3300005563 Bacteria 9547
213 Ga0068855_100014631 3300005563 Bacteria 9450
214 Ga0068855_100015378 3300005563 Bacteria 9213
215 Ga0068855_100017810 3300005563 Bacteria 8540
216 Ga0068855_100070969 3300005563 Bacteria 4051
217 Ga0068855_100083657 3300005563 Bacteria 3696
218 Ga0068855_100100241 3300005563 Bacteria 3335
219 Ga0068855_100103616 3300005563 Bacteria 3273
220 Ga0070664_100000002 3300005564 Bacteria 458815
221 Ga0070664_100039941 3300005564 Bacteria 3955
222 Ga0068857_100000319 3300005577 Bacteria 33193
223 Ga0068857_100017815 3300005577 Bacteria 6228
224 Ga0068857_100051279 3300005577 Bacteria 3660
225 Ga0068857_100060592 3300005577 Bacteria 3361
226 Ga0068854_100000004 3300005578 Bacteria 216381
227 Ga0068854_100001263 3300005578 Bacteria 15187
228 Ga0068854_100001277 3300005578 Bacteria 15138
229 Ga0068854_100001665 3300005578 Bacteria 13528
230 Ga0068854_100009142 3300005578 Bacteria 6390
231 Ga0068854_100100631 3300005578 Bacteria 2166
232 Ga0068856_100000294 3300005614 Bacteria 54780
233 Ga0068856_100000652 3300005614 Bacteria 37607
234 Ga0068856_100038570 3300005614 Bacteria 4690
235 Ga0068856_100087423 3300005614 Bacteria 3099
236 Ga0068856_100109459 3300005614 Bacteria 2759
237 Ga0070702_100000240 3300005615 Bacteria 18563
238 Ga0068859_100004628 3300005617 Bacteria 14018
239 Ga0068859_100107514 3300005617 Bacteria 2850
240 Ga0068864_100068644 3300005618 Bacteria 3080
241 Ga0068861_100000550 3300005719 Bacteria 22119
242 Ga0068851_10069478 3300005834 Bacteria 1819
243 Ga0068858_100004085 3300005842 Bacteria 14380
244 Ga0068858_100064675 3300005842 Bacteria 3386
245 Ga0068858_100424330 3300005842 Bacteria 1279
246 Ga0068860_100004596 3300005843 Bacteria 14092
247 Ga0068862_100001897 3300005844 Bacteria 18976
248 Ga0068862_100006699 3300005844 Bacteria 9558
249 Ga0068862_100051032 3300005844 Bacteria 3537
250 Ga0081539_10000799 3300005985 Bacteria 61195
251 Ga0075363_100099372 3300006048 Bacteria 1609
252 Ga0075364_10007608 3300006051 Bacteria 6442
253 Ga0075364_10008631 3300006051 Bacteria 6095
254 Ga0075364_10011929 3300006051 Bacteria 5296
255 Ga0075364_10013464 3300006051 Bacteria 5030
256 Ga0075366_10009542 3300006195 Bacteria 5421
257 Ga0075366_10037583 3300006195 Bacteria 2859
258 Ga0097621_100011829 3300006237 Bacteria 6448
259 Ga0075370_10001703 3300006353 Bacteria 9766
260 Ga0075370_10002804 3300006353 Bacteria 8171
261 Ga0075370_10025086 3300006353 Bacteria 3296
262 Ga0068871_100000788 3300006358 Bacteria 21290
263 Ga0068871_100001073 3300006358 Bacteria 18331
264 Ga0075428_100003728 3300006844 Bacteria 16711
265 Ga0075430_100002931 3300006846 Bacteria 14267
266 Ga0075431_100269744 3300006847 Bacteria 1725
267 Ga0075433_10003313 3300006852 Bacteria 12441
268 Ga0075433_10042452 3300006852 Bacteria 3946
269 Ga0075434_100000004 3300006871 Bacteria 112839
270 Ga0075434_100001086 3300006871 Bacteria 22255
271 Ga0075434_100019492 3300006871 Bacteria 6566
272 Ga0075434_100037923 3300006871 Bacteria 4772
273 Ga0075429_100000051 3300006880 Bacteria 55896
274 Ga0068865_100001146 3300006881 Bacteria 15365
275 Ga0075436_100000331 3300006914 Bacteria 30168
276 Ga0075436_100004918 3300006914 Bacteria 9183
277 Ga0075436_100010269 3300006914 Bacteria 6411
278 Ga0075436_100047384 3300006914 Bacteria 2965
279 Ga0097620_100004627 3300006931 Bacteria 14018
280 Ga0097620_100107510 3300006931 Bacteria 2850
281 Ga0079104_1000277 3300006946 Bacteria 66604
282 Ga0099826_10000015 3300006948 Bacteria 254837
283 Ga0075435_100000313 3300007076 Bacteria 29845
284 Ga0075435_100001505 3300007076 Bacteria 14975
285 Ga0075435_100022664 3300007076 Bacteria 4847
286 Ga0105251_10000285 3300009011 Bacteria 50961
287 Ga0105251_10001199 3300009011 Bacteria 22421
288 Ga0105251_10038759 3300009011 Bacteria 2332
289 Ga0105244_10079081 3300009036 Bacteria 1630
290 Ga0105250_10007579 3300009092 Bacteria 4653
291 Ga0105240_10000569 3300009093 Bacteria 68389
292 Ga0105240_10002163 3300009093 Bacteria 32091
293 Ga0105240_10019895 3300009093 Bacteria 8965
294 Ga0105240_10021079 3300009093 Bacteria 8674
295 Ga0105240_10032831 3300009093 Bacteria 6715
296 Ga0105240_10038140 3300009093 Bacteria 6167
297 Ga0105240_10094721 3300009093 Bacteria 3641
298 Ga0105240_10206703 3300009093 Bacteria 2297
299 Ga0105240_10292316 3300009093 Bacteria 1867
300 Ga0111539_10035356 3300009094 Bacteria 6050
301 Ga0111539_10043746 3300009094 Bacteria 5368
302 Ga0105245_10002454 3300009098 Bacteria 16760
303 Ga0114129_10000337 3300009147 Bacteria 54884
304 Ga0105243_10000420 3300009148 Bacteria 44548
305 Ga0105243_10000915 3300009148 Bacteria 27703
306 Ga0105243_10005794 3300009148 Bacteria 9592
307 Ga0105241_10034467 3300009174 Bacteria 3803
308 Ga0105241_10042520 3300009174 Bacteria 3438
309 Ga0105242_10000945 3300009176 Bacteria 22671
310 Ga0105242_10008348 3300009176 Bacteria 7958
311 Ga0105242_10021199 3300009176 Bacteria 5099
312 Ga0105248_10271656 3300009177 Bacteria 1909
313 Ga0105237_10000007 3300009545 Bacteria 367690
314 Ga0105237_10000307 3300009545 Bacteria 68076
315 Ga0105237_10030111 3300009545 Bacteria 5515
316 Ga0105237_10080514 3300009545 Bacteria 3247
317 Ga0105238_10000318 3300009551 Bacteria 52620
318 Ga0105238_10014850 3300009551 Bacteria 7880
319 Ga0105238_10034564 3300009551 Bacteria 5142
320 Ga0105238_10213812 3300009551 Bacteria 1904
321 Ga0105238_10214663 3300009551 Bacteria 1900
322 Ga0105249_10000975 3300009553 Bacteria 25356
323 Ga0105249_10024517 3300009553 Bacteria 5423
324 Ga0105239_10000020 3300010375 Bacteria 264435
325 Ga0105239_10001532 3300010375 Bacteria 30537
326 Ga0105239_10033387 3300010375 Bacteria 5652
327 Ga0105239_10059727 3300010375 Bacteria 4185
328 Ga0157373_10005940 3300013100 Bacteria 9131
329 Ga0157373_10009391 3300013100 Bacteria 7223
330 Ga0157373_10035191 3300013100 Bacteria 3596
331 Ga0157373_10078366 3300013100 Bacteria 2330
332 Ga0157373_10199743 3300013100 Bacteria 1409
333 Ga0157371_10004477 3300013102 Bacteria 12184
334 Ga0157371_10007599 3300013102 Bacteria 8746
335 Ga0157371_10017438 3300013102 Bacteria 5332
336 Ga0157371_10039981 3300013102 Bacteria 3352
337 Ga0157370_10000371 3300013104 Bacteria 56531
338 Ga0157370_10007267 3300013104 Bacteria 12088
339 Ga0157370_10012327 3300013104 Bacteria 8873
340 Ga0157370_10022546 3300013104 Bacteria 6265
341 Ga0157370_10027521 3300013104 Bacteria 5606
342 Ga0157370_10035086 3300013104 Bacteria 4879
343 Ga0157370_10038942 3300013104 Bacteria 4598
344 Ga0157370_10105641 3300013104 Bacteria 2635
345 Ga0157370_10124192 3300013104 Bacteria 2410
346 Ga0157369_10000252 3300013105 Bacteria 73217
347 Ga0157369_10002784 3300013105 Bacteria 20879
348 Ga0157369_10007899 3300013105 Bacteria 12232
349 Ga0157369_10107132 3300013105 Bacteria 2973
350 Ga0157369_10168483 3300013105 Bacteria 2309
351 Ga0157369_10191474 3300013105 Bacteria 2149
352 Ga0157369_10281095 3300013105 Bacteria 1733
353 Ga0157374_10000345 3300013296 Bacteria 42866
354 Ga0157378_10000844 3300013297 Bacteria 28388
355 Ga0163162_10001066 3300013306 Bacteria 25485
356 Ga0157372_10008893 3300013307 Bacteria 10668
357 Ga0157372_10017693 3300013307 Bacteria 7651
358 Ga0157372_10181794 3300013307 Bacteria 2434
359 Ga0157372_10196929 3300013307 Bacteria 2334
360 Ga0157375_10028666 3300013308 Bacteria 5224
361 Ga0157375_10315464 3300013308 Bacteria 1728
362 Ga0182008_10004246 3300014497 Bacteria 8402
363 Ga0182008_10004498 3300014497 Bacteria 8144
364 Ga0182008_10006040 3300014497 Bacteria 6811
365 Ga0182008_10021058 3300014497 Bacteria 3352
366 Ga0182008_10042688 3300014497 Bacteria 2259
367 Ga0157376_10064579 3300014969 Bacteria 3088
368 Ga0157376_10066813 3300014969 Bacteria 3040
369 Ga0182006_1000162 3300015261 Bacteria 71391
370 Ga0182006_1000541 3300015261 Bacteria 28690
371 Ga0182006_1001661 3300015261 Bacteria 13105
372 Ga0182006_1002604 3300015261 Bacteria 9747
373 Ga0182006_1013148 3300015261 Bacteria 3599
374 Ga0182006_1049379 3300015261 Bacteria 1624
375 Ga0182007_10011944 3300015262 Bacteria 3357
376 Ga0182007_10021806 3300015262 Bacteria 2269
377 Ga0182005_1000322 3300015265 Bacteria 28505
378 Ga0182005_1000365 3300015265 Bacteria 25241
379 Ga0182005_1005337 3300015265 Bacteria 4026
380 Ga0182005_1010521 3300015265 Bacteria 2660
381 Ga0183362_10001 3300015683 Bacteria 2046624
382 Ga0183368_1003 3300015687 Bacteria 1276390
383 Ga0183361_10025 3300016635 Bacteria 72014
384 Ga0206351_10556100 3300020077 Bacteria 7205
385 Ga0206350_10021063 3300020080 Bacteria 1455
386 Ga0154015_1099906 3300020610 Bacteria 39484
387 Ga0213872_10003677 3300021361 Bacteria 8397
388 Ga0213872_10009907 3300021361 Bacteria 4551
389 Ga0224712_10012474 3300022467 Bacteria 2676
390 Ga0209435_100016 3300025206 Bacteria 305566
391 Ga0209435_100038 3300025206 Bacteria 120273
392 Ga0209435_100932 3300025206 Bacteria 4355
393 Ga0209435_105321 3300025206 Bacteria 1443
394 Ga0209760_101097 3300025207 Bacteria 3110
395 Ga0209784_100002 3300025224 Bacteria 1753105
396 Ga0209784_100003 3300025224 Bacteria 1379451
397 Ga0209784_100068 3300025224 Bacteria 152526
398 Ga0209784_100069 3300025224 Bacteria 152424
399 Ga0209784_100293 3300025224 Bacteria 27186
400 Ga0209784_100573 3300025224 Bacteria 12620
401 Ga0209566_100002 3300025225 Bacteria 2614868
402 Ga0209566_100003 3300025225 Bacteria 1753105
403 Ga0209566_100083 3300025225 Bacteria 152424
404 Ga0209566_100535 3300025225 Bacteria 25730
405 Ga0209566_100561 3300025225 Bacteria 24375
406 Ga0209674_100004 3300025226 Bacteria 1753105
407 Ga0209674_100008 3300025226 Bacteria 1076909
408 Ga0209674_100012 3300025226 Bacteria 950162
409 Ga0209674_100013 3300025226 Bacteria 813140
410 Ga0209674_100106 3300025226 Bacteria 152424
411 Ga0209674_100122 3300025226 Bacteria 131720
412 Ga0209674_100148 3300025226 Bacteria 98100
413 Ga0209674_100336 3300025226 Bacteria 28357
414 Ga0209674_100424 3300025226 Bacteria 20459
415 Ga0209672_100005 3300025228 Bacteria 1069303
416 Ga0209672_100010 3300025228 Bacteria 873151
417 Ga0209672_100019 3300025228 Bacteria 432215
418 Ga0209672_100045 3300025228 Bacteria 264926
419 Ga0209672_100051 3300025228 Bacteria 234414
420 Ga0209672_100100 3300025228 Bacteria 108785
421 Ga0209672_100350 3300025228 Bacteria 29469
422 Ga0209672_100386 3300025228 Bacteria 26847
423 Ga0209672_100676 3300025228 Bacteria 17169
424 Ga0209672_101672 3300025228 Bacteria 7210
425 Ga0209147_100002 3300025229 Bacteria 2158988
426 Ga0209147_100006 3300025229 Bacteria 873276
427 Ga0209147_100023 3300025229 Bacteria 437803
428 Ga0209147_100026 3300025229 Bacteria 421622
429 Ga0209147_100192 3300025229 Bacteria 70162
430 Ga0209147_100308 3300025229 Bacteria 38671
431 Ga0209147_104223 3300025229 Bacteria 2461
432 Ga0209563_100004 3300025230 Bacteria 1814108
433 Ga0209563_100006 3300025230 Bacteria 1753105
434 Ga0209563_100023 3300025230 Bacteria 636844
435 Ga0209563_100100 3300025230 Bacteria 152424
436 Ga0209563_101103 3300025230 Bacteria 7728
437 Ga0207427_100069 3300025231 Bacteria 161547
438 Ga0207427_100139 3300025231 Bacteria 84807
439 Ga0207427_100140 3300025231 Bacteria 84637
440 Ga0207427_100216 3300025231 Bacteria 50601
441 Ga0207427_100279 3300025231 Bacteria 37306
442 Ga0207427_101443 3300025231 Bacteria 8570
443 Ga0209437_100139 3300025233 Bacteria 172506
444 Ga0209437_100147 3300025233 Bacteria 161997
445 Ga0209437_100154 3300025233 Bacteria 153383
446 Ga0209437_100156 3300025233 Bacteria 152424
447 Ga0209437_100166 3300025233 Bacteria 144787
448 Ga0209437_100462 3300025233 Bacteria 32102
449 Ga0209437_100463 3300025233 Bacteria 32076
450 Ga0209258_100002 3300025242 Bacteria 2158988
451 Ga0209258_100006 3300025242 Bacteria 1069303
452 Ga0209258_100010 3300025242 Bacteria 873276
453 Ga0209258_100024 3300025242 Bacteria 542096
454 Ga0209258_100031 3300025242 Bacteria 463572
455 Ga0209258_100111 3300025242 Bacteria 197019
456 Ga0209258_100200 3300025242 Bacteria 123379
457 Ga0209258_100358 3300025242 Bacteria 61852
458 Ga0209258_100360 3300025242 Bacteria 61533
459 Ga0209258_100368 3300025242 Bacteria 59722
460 Ga0209258_100992 3300025242 Bacteria 13094
461 Ga0209258_101914 3300025242 Bacteria 6145
462 Ga0209646_1000022 3300025246 Bacteria 446621
463 Ga0209646_1000033 3300025246 Bacteria 369507
464 Ga0209646_1000093 3300025246 Bacteria 183840
465 Ga0209646_1001402 3300025246 Bacteria 6566
466 Ga0209026_1000031 3300025250 Bacteria 325747
467 Ga0209026_1000074 3300025250 Bacteria 203820
468 Ga0209026_1000099 3300025250 Bacteria 161750
469 Ga0209026_1000145 3300025250 Bacteria 111490
470 Ga0209026_1000914 3300025250 Bacteria 15138
471 Ga0209026_1001383 3300025250 Bacteria 10811
472 Ga0209026_1003446 3300025250 Bacteria 5175
473 Ga0209677_100003 3300025253 Bacteria 1753105
474 Ga0209677_100013 3300025253 Bacteria 548200
475 Ga0209677_100061 3300025253 Bacteria 152424
476 Ga0209677_103892 3300025253 Bacteria 4572
477 Ga0209148_1000002 3300025254 Bacteria 2399500
478 Ga0209148_1000009 3300025254 Bacteria 1395625
479 Ga0209148_1000010 3300025254 Bacteria 1265567
480 Ga0209148_1000012 3300025254 Bacteria 1069303
481 Ga0209148_1000018 3300025254 Bacteria 756247
482 Ga0209148_1000021 3300025254 Bacteria 714645
483 Ga0209148_1000027 3300025254 Bacteria 616374
484 Ga0209148_1000045 3300025254 Bacteria 448076
485 Ga0209148_1000099 3300025254 Bacteria 227713
486 Ga0209148_1000400 3300025254 Bacteria 50569
487 Ga0209148_1001095 3300025254 Bacteria 16345
488 Ga0209759_1000045 3300025256 Bacteria 235654
489 Ga0209759_1000110 3300025256 Bacteria 144917
490 Ga0209759_1000147 3300025256 Bacteria 121320
491 Ga0209759_1000247 3300025256 Bacteria 80850
492 Ga0209759_1000248 3300025256 Bacteria 80537
493 Ga0209759_1000605 3300025256 Bacteria 34670
494 Ga0209759_1000804 3300025256 Bacteria 25401
495 Ga0209759_1001732 3300025256 Bacteria 11236
496 Ga0209759_1001830 3300025256 Bacteria 10676
497 Ga0209759_1003030 3300025256 Bacteria 6929
498 Ga0209759_1003860 3300025256 Bacteria 5801
499 Ga0209233_1000009 3300025261 Bacteria 1265567
500 Ga0209233_1000083 3300025261 Bacteria 336016
501 Ga0209233_1000092 3300025261 Bacteria 308668
502 Ga0209233_1000135 3300025261 Bacteria 201057
503 Ga0209233_1000165 3300025261 Bacteria 152424
504 Ga0209233_1000191 3300025261 Bacteria 127938
505 Ga0209233_1000251 3300025261 Bacteria 84807
506 Ga0209455_1000008 3300025272 Bacteria 1069303
507 Ga0209455_1000015 3300025272 Bacteria 756128
508 Ga0209455_1000021 3300025272 Bacteria 699993
509 Ga0209455_1000029 3300025272 Bacteria 542096
510 Ga0209455_1000035 3300025272 Bacteria 479071
511 Ga0209455_1000086 3300025272 Bacteria 244650
512 Ga0209455_1000213 3300025272 Bacteria 82040
513 Ga0209455_1000357 3300025272 Bacteria 42718
514 Ga0209455_1000601 3300025272 Bacteria 22986
515 Ga0209455_1001659 3300025272 Bacteria 9644
516 Ga0209455_1015391 3300025272 Bacteria 1683
517 Ga0209673_1000201 3300025273 Bacteria 120059
518 Ga0209130_1002165 3300025284 Bacteria 10351
519 Ga0209675_1001328 3300025291 Bacteria 14629
520 Ga0209675_1001337 3300025291 Bacteria 14563
521 Ga0209675_1018295 3300025291 Bacteria 1965
522 Ga0209676_1000012 3300025292 Bacteria 841431
523 Ga0209676_1004421 3300025292 Bacteria 7842
524 Ga0209025_1000003 3300025294 Bacteria 1366495
525 Ga0209025_1000542 3300025294 Bacteria 71039
526 Ga0209025_1000759 3300025294 Bacteria 53934
527 Ga0209025_1003675 3300025294 Bacteria 14177
528 Ga0209564_1002863 3300025295 Bacteria 12663
529 Ga0209564_1004321 3300025295 Bacteria 8776
530 Ga0209564_1009861 3300025295 Bacteria 4478
531 Ga0209758_1000276 3300025297 Bacteria 102362
532 Ga0209758_1029993 3300025297 Bacteria 2261
533 Ga0209050_1001429 3300025298 Bacteria 25722
534 Ga0209256_1000233 3300025299 Bacteria 99386
535 Ga0207426_1000240 3300025302 Bacteria 123149
536 Ga0207696_1008775 3300025711 Bacteria 3828
537 Ga0207713_1002521 3300025735 Bacteria 13264
538 Ga0207713_1003615 3300025735 Bacteria 10415
539 Ga0207653_10035802 3300025885 Bacteria 1616
540 Ga0207692_10023211 3300025898 Bacteria 2866
541 Ga0207688_10063812 3300025901 Bacteria 2078
542 Ga0207688_10067752 3300025901 Bacteria 2020
543 Ga0207680_10047607 3300025903 Bacteria 2542
544 Ga0207647_10000967 3300025904 Bacteria 22285
545 Ga0207647_10001769 3300025904 Bacteria 16583
546 Ga0207647_10005750 3300025904 Bacteria 9051
547 Ga0207647_10016575 3300025904 Bacteria 5025
548 Ga0207647_10027795 3300025904 Bacteria 3684
549 Ga0207647_10030691 3300025904 Bacteria 3465
550 Ga0207647_10057514 3300025904 Bacteria 2384
551 Ga0207645_10036717 3300025907 Bacteria 3146
552 Ga0207645_10071922 3300025907 Bacteria 2214
553 Ga0207643_10012639 3300025908 Bacteria 4560
554 Ga0207705_10002820 3300025909 Bacteria 13287
555 Ga0207705_10054416 3300025909 Bacteria 2884
556 Ga0207705_10133484 3300025909 Bacteria 1849
557 Ga0207654_10081748 3300025911 Bacteria 1946
558 Ga0207707_10015319 3300025912 Bacteria 6675
559 Ga0207707_10017802 3300025912 Bacteria 6196
560 Ga0207707_10094667 3300025912 Bacteria 2610
561 Ga0207695_10000408 3300025913 Bacteria 95748
562 Ga0207695_10001214 3300025913 Bacteria 44135
563 Ga0207695_10002857 3300025913 Bacteria 25113
564 Ga0207695_10003147 3300025913 Bacteria 23559
565 Ga0207695_10004759 3300025913 Bacteria 18356
566 Ga0207695_10006780 3300025913 Bacteria 14759
567 Ga0207695_10007664 3300025913 Bacteria 13676
568 Ga0207695_10015832 3300025913 Bacteria 8858
569 Ga0207695_10024607 3300025913 Bacteria 6767
570 Ga0207695_10056224 3300025913 Bacteria 4096
571 Ga0207695_10094999 3300025913 Bacteria 2987
572 Ga0207671_10000031 3300025914 Bacteria 247030
573 Ga0207671_10000074 3300025914 Bacteria 156482
574 Ga0207671_10005183 3300025914 Bacteria 12116
575 Ga0207671_10069245 3300025914 Bacteria 2630
576 Ga0207671_10116680 3300025914 Bacteria 2036
577 Ga0207660_10000870 3300025917 Bacteria 19956
578 Ga0207660_10300652 3300025917 Bacteria 1278
579 Ga0207662_10000233 3300025918 Bacteria 25755
580 Ga0207657_10000001 3300025919 Bacteria 458536
581 Ga0207657_10062545 3300025919 Bacteria 3186
582 Ga0207649_10000019 3300025920 Bacteria 212682
583 Ga0207649_10026321 3300025920 Bacteria 3402
584 Ga0207652_10059949 3300025921 Bacteria 3281
585 Ga0207652_10103217 3300025921 Bacteria 2521
586 Ga0207652_10199926 3300025921 Bacteria 1799
587 Ga0207681_10001251 3300025923 Bacteria 16395
588 Ga0207694_10003032 3300025924 Bacteria 13465
589 Ga0207694_10014956 3300025924 Bacteria 5852
590 Ga0207694_10038018 3300025924 Bacteria 3700
591 Ga0207694_10041861 3300025924 Bacteria 3531
592 Ga0207700_10006065 3300025928 Bacteria 7279
593 Ga0207664_10000066 3300025929 Bacteria 109573
594 Ga0207664_10000472 3300025929 Bacteria 28497
595 Ga0207644_10054539 3300025931 Bacteria 2879
596 Ga0207690_10000006 3300025932 Bacteria 433880
597 Ga0207690_10000579 3300025932 Bacteria 23708
598 Ga0207690_10001265 3300025932 Bacteria 15996
599 Ga0207690_10007185 3300025932 Bacteria 6615
600 Ga0207706_10055485 3300025933 Bacteria 3494
601 Ga0207686_10001247 3300025934 Bacteria 14704
602 Ga0207686_10001496 3300025934 Bacteria 13174
603 Ga0207709_10000129 3300025935 Bacteria 111395
604 Ga0207709_10000934 3300025935 Bacteria 21962
605 Ga0207709_10003455 3300025935 Bacteria 9382
606 Ga0207670_10003031 3300025936 Bacteria 8859
607 Ga0207670_10009594 3300025936 Bacteria 5531
608 Ga0207670_10029870 3300025936 Bacteria 3476
609 Ga0207670_10060902 3300025936 Bacteria 2573
610 Ga0207704_10000745 3300025938 Bacteria 14317
611 Ga0207691_10027439 3300025940 Bacteria 5338
612 Ga0207691_10118482 3300025940 Bacteria 2349
613 Ga0207711_10181974 3300025941 Bacteria 1912
614 Ga0207689_10002282 3300025942 Bacteria 17945
615 Ga0207661_10108905 3300025944 Bacteria 2340
616 Ga0207679_10000001 3300025945 Bacteria 777444
617 Ga0207667_10000055 3300025949 Bacteria 223770
618 Ga0207667_10000082 3300025949 Bacteria 157749
619 Ga0207667_10000313 3300025949 Bacteria 67227
620 Ga0207667_10012188 3300025949 Bacteria 9931
621 Ga0207667_10013499 3300025949 Bacteria 9341
622 Ga0207667_10028434 3300025949 Bacteria 6073
623 Ga0207667_10047165 3300025949 Bacteria 4560
624 Ga0207667_10066465 3300025949 Bacteria 3758
625 Ga0207667_10078394 3300025949 Bacteria 3424
626 Ga0207667_10100957 3300025949 Bacteria 2976
627 Ga0207712_10002777 3300025961 Bacteria 11198
628 Ga0207668_10022314 3300025972 Bacteria 4050
629 Ga0207668_10033596 3300025972 Bacteria 3399
630 Ga0207668_10036230 3300025972 Bacteria 3291
631 Ga0207640_10000018 3300025981 Bacteria 193664
632 Ga0207640_10000524 3300025981 Bacteria 23157
633 Ga0207640_10009367 3300025981 Bacteria 5482
634 Ga0207640_10013733 3300025981 Bacteria 4648
635 Ga0207640_10052125 3300025981 Bacteria 2664
636 Ga0207640_10052385 3300025981 Bacteria 2658
637 Ga0207677_10010535 3300026023 Bacteria 5236
638 Ga0207703_10004183 3300026035 Bacteria 11897
639 Ga0207703_10046696 3300026035 Bacteria 3489
640 Ga0207703_10055595 3300026035 Bacteria 3220
641 Ga0207703_10233655 3300026035 Bacteria 1650
642 Ga0207639_10106751 3300026041 Bacteria 2274
643 Ga0207678_10000001 3300026067 Bacteria 433184
644 Ga0207678_10000167 3300026067 Bacteria 55724
645 Ga0207678_10008419 3300026067 Bacteria 9098
646 Ga0207678_10089226 3300026067 Bacteria 2635
647 Ga0207678_10090342 3300026067 Bacteria 2618
648 Ga0207678_10134977 3300026067 Bacteria 2106
649 Ga0207708_10000625 3300026075 Bacteria 27213
650 Ga0207702_10000009 3300026078 Bacteria 305906
651 Ga0207702_10003312 3300026078 Bacteria 14814
652 Ga0207702_10063706 3300026078 Bacteria 3153
653 Ga0207648_10002355 3300026089 Bacteria 20391
654 Ga0207648_10004982 3300026089 Bacteria 13500
655 Ga0207648_10095195 3300026089 Bacteria 2604
656 Ga0207674_10000397 3300026116 Bacteria 56299
657 Ga0207674_10010237 3300026116 Bacteria 10650
658 Ga0207674_10017991 3300026116 Bacteria 7697
659 Ga0207674_10347741 3300026116 Bacteria 1433
660 Ga0207675_100001604 3300026118 Bacteria 22664
661 Ga0207683_10111066 3300026121 Bacteria 2454
662 Ga0207683_10232477 3300026121 Bacteria 1681
663 Ga0207698_10014530 3300026142 Bacteria 5238
664 Ga0207698_10065689 3300026142 Bacteria 2851
665 Ga0209281_1000067 3300027111 Bacteria 284517
666 Ga0209371_1000202 3300027312 Bacteria 85989
667 Ga0209969_1004120 3300027360 Bacteria 2032
668 Ga0209999_1003558 3300027543 Bacteria 2792
669 Ga0209282_1000033 3300027666 Bacteria 141940
670 Ga0209966_1006723 3300027695 Bacteria 2002
671 Ga0209974_10001890 3300027876 Bacteria 7649
672 Ga0207428_10000610 3300027907 Bacteria 42207
673 Ga0268266_10008498 3300028379 Bacteria 9126
674 Ga0268265_10001521 3300028380 Bacteria 19348
675 Ga0268264_10004412 3300028381 Bacteria 12005
676 Ga0307515_10004238 3300028794 Bacteria 29780
677 Ga0265338_10000104 3300028800 Bacteria 156596
678 Ga0265338_10002059 3300028800 Bacteria 31074
679 Ga0268256_1000189 3300030500 Bacteria 72206
680 Ga0265332_10000003 3300031238 Bacteria 482849
681 Ga0307513_10056718 3300031456 Bacteria 4179
682 Ga0307408_100000213 3300031548 Bacteria 61855
683 Ga0307408_100074334 3300031548 Bacteria 2521
684 Ga0307514_10001218 3300031649 Bacteria 34108
685 Ga0316575_10007847 3300031665 Bacteria 3874
686 Ga0316579_10004816 3300031691 Bacteria 5394
687 Ga0307516_10173917 3300031730 Bacteria 1892
688 Ga0307405_10082886 3300031731 Bacteria 2100
689 Ga0307406_10000379 3300031901 Bacteria 25615
690 Ga0307412_10000008 3300031911 Bacteria 461034
691 Ga0307412_10000313 3300031911 Bacteria 30726
692 Ga0307412_10047229 3300031911 Bacteria 2826
693 Ga0307412_10110941 3300031911 Bacteria 1958
694 Ga0307409_100054512 3300031995 Bacteria 3080
695 Ga0307416_100073487 3300032002 Bacteria 2851
696 Ga0307416_100144279 3300032002 Bacteria 2170
697 Ga0307411_10127758 3300032005 Bacteria 1852
698 Ga0373926_0016944 3300035083 Bacteria 2496
699 Ga0373932_0005248 3300035112 Bacteria 3045
700 Ga0373941_0010662 3300035115 Bacteria 2355
701 Ga0373945_0020026 3300035116 Bacteria 2287
702 Ga0373954_0000965 3300035118 Bacteria 11269
703 Ga0373942_0005016 3300035207 Bacteria 3070
704 Ga0373942_0016979 3300035207 Bacteria 1790
705 Ga0373924_0009778 3300035410 Bacteria 3523
706 Ga0373931_0000627 3300035691 Bacteria 14664
707 Ga0373935_0036155 3300035692 Bacteria 3086
708 Ga0373927_0008584 3300035695 Bacteria 6865
709 Ga0373927_0178052 3300035695 Bacteria 1394
710 Ga0373933_0001980 3300035724 Bacteria 11811
711 Ga0373937_0001198 3300036401 Bacteria 21774
712 Ga0373937_0063950 3300036401 Bacteria 3384
713 Ga0373937_0157198 3300036401 Bacteria 2131
714 Ga0316582_0002737 3300036647 Bacteria 8379
715 Ga0316584_0071096 3300036712 Bacteria 2608
716 Ga0373925_0018211 3300037068 Bacteria 5102
717 Ga0395899_0000041 3300037312 Bacteria 255615
718 Ga0395899_0000369 3300037312 Bacteria 54244
719 Ga0395899_0009696 3300037312 Bacteria 7389
720 Ga0395899_0029160 3300037312 Bacteria 4150
721 Ga0395899_0031912 3300037312 Bacteria 3958
722 Ga0395899_0149924 3300037312 Bacteria 1653
723 Ga0395900_0000562 3300037418 Bacteria 51703
724 Ga0395900_0000664 3300037418 Bacteria 45818
725 Ga0395900_0000916 3300037418 Bacteria 38759
726 Ga0395900_0001108 3300037418 Bacteria 34263
727 Ga0395900_0001745 3300037418 Bacteria 25018
728 Ga0395900_0004872 3300037418 Bacteria 14141
729 Ga0395900_0006936 3300037418 Bacteria 11752
730 Ga0395900_0024941 3300037418 Bacteria 6120
731 Ga0395900_0129008 3300037418 Bacteria 2592
732 Ga0395900_0154913 3300037418 Bacteria 2340
733 Ga0395900_0240025 3300037418 Bacteria 1818
734 Ga0395898_0000220 3300037466 Bacteria 146473
735 Ga0395898_0000305 3300037466 Bacteria 116565
736 Ga0395898_0000526 3300037466 Bacteria 73315
737 Ga0395898_0002771 3300037466 Bacteria 20150
738 Ga0395898_0004697 3300037466 Bacteria 14869
739 Ga0395898_0012225 3300037466 Bacteria 8875
740 Ga0395898_0075124 3300037466 Bacteria 3264
741 Ga0395898_0082597 3300037466 Bacteria 3097
742 Ga0395905_0000098 3300037471 Bacteria 145524
743 Ga0316581_0012152 3300037588 Bacteria 2420
744 Ga0395901_0000011 3300038443 Bacteria 400724
745 Ga0395901_0000106 3300038443 Bacteria 114313
746 Ga0395901_0000161 3300038443 Bacteria 87191
747 Ga0395901_0000264 3300038443 Bacteria 65306
748 Ga0395901_0014650 3300038443 Bacteria 7968
749 Ga0395901_0025384 3300038443 Bacteria 6083
750 Ga0395901_0033268 3300038443 Bacteria 5321
751 Ga0395901_0131237 3300038443 Bacteria 2633
752 Ga0237819_01026 3300038705 Bacteria 8382
753 Ga0436361_0310873 3300039447 Bacteria 6772
754 Ga0436361_0560628 3300039447 Bacteria 1444
755 Ga0436361_0710630 3300039447 Bacteria 3523
756 Ga0436361_0762834 3300039447 Bacteria 4551
757 Ga0439436_0000014 3300041404 Bacteria 90241
758 Ga0451800_1450092 3300041459 Bacteria 3263
759 Ga0451806_187053 3300041462 Bacteria 3256
760 Ga0451804_1026683 3300041463 Bacteria 3238
761 Ga0451807_0623916 3300041486 Bacteria 2204
762 Ga0451807_0695512 3300041486 Bacteria 4717
763 Ga0451833_0182207 3300041491 Bacteria 1795
764 Ga0451837_1319545 3300041494 Bacteria 2719
765 Ga0439448_0000048 3300042005 Bacteria 19349
766 Ga0439432_012194 3300042006 Bacteria 2947
767 Ga0439432_022323 3300042006 Bacteria 2090
768 Ga0439449_0002257 3300042007 Bacteria 7574
769 Ga0439462_0002003 3300042015 Bacteria 4663
770 Ga0451577_0003226 3300042876 Bacteria 18332
771 Ga0451577_0049719 3300042876 Bacteria 3744
772 Ga0451577_0300538 3300042876 Bacteria 1454
773 Ga0466986_0105408 3300044650 Bacteria 1941
774 Ga0466969_0006333 3300044656 Bacteria 6299
775 Ga0466969_0091015 3300044656 Bacteria 1445
776 Ga0466977_0000251 3300044666 Bacteria 15079
777 Ga0466965_0017578 3300044683 Bacteria 3419
778 Ga0466965_0045797 3300044683 Bacteria 2164
779 Ga0466965_0046718 3300044683 Bacteria 2143
780 Ga0466966_0000066 3300044684 Bacteria 69299
781 Ga0466966_0001282 3300044684 Bacteria 16095
782 Ga0466966_0001306 3300044684 Bacteria 15966
783 Ga0466966_0002967 3300044684 Bacteria 11167
784 Ga0466966_0014396 3300044684 Bacteria 5236
785 Ga0466961_0000037 3300044693 Bacteria 80759
786 Ga0466961_0001025 3300044693 Bacteria 17250
787 Ga0466961_0001819 3300044693 Bacteria 13234
788 Ga0466961_0002289 3300044693 Bacteria 11895
789 Ga0466961_0004677 3300044693 Bacteria 8597
790 Ga0466961_0011658 3300044693 Bacteria 5618
791 Ga0466961_0064455 3300044693 Bacteria 2328
792 Ga0466961_0075592 3300044693 Bacteria 2135
793 Ga0466961_0133514 3300044693 Bacteria 1555
794 Ga0466964_0001424 3300044706 Bacteria 8167
795 Ga0453684_0001711 3300044712 Bacteria 59001
796 Ga0453684_0062698 3300044712 Bacteria 4760
797 Ga0453684_0246769 3300044712 Bacteria 2052
798 Ga0453684_0395396 3300044712 Bacteria 1549
799 Ga0466971_0002547 3300044719 Bacteria 7710
800 Ga0466971_0008785 3300044719 Bacteria 4408
801 Ga0466971_0015190 3300044719 Bacteria 3388
802 Ga0466968_0001142 3300044735 Bacteria 9419
803 Ga0466968_0060701 3300044735 Bacteria 1630
804 Ga0466970_0000887 3300044765 Bacteria 14425
805 Ga0466970_0003586 3300044765 Bacteria 7568
806 Ga0466970_0013134 3300044765 Bacteria 4244
807 Ga0466970_0026176 3300044765 Bacteria 3057
808 Ga0466970_0026386 3300044765 Bacteria 3044
809 Ga0466970_0028758 3300044765 Bacteria 2922
810 Ga0466957_0001282 3300044842 Bacteria 13102
811 Ga0466957_0003699 3300044842 Bacteria 8447
812 Ga0466957_0008319 3300044842 Bacteria 5899
813 Ga0466957_0100372 3300044842 Bacteria 1824
814 Ga0466959_0005357 3300045049 Bacteria 8780
815 Ga0466959_0007018 3300045049 Bacteria 7872
816 Ga0466959_0014534 3300045049 Bacteria 5725
817 Ga0466959_0046266 3300045049 Bacteria 3202
818 Ga0466959_0048152 3300045049 Bacteria 3133
819 Ga0466959_0054373 3300045049 Bacteria 2925
820 Ga0466959_0081281 3300045049 Bacteria 2335
821 Ga0466959_0083856 3300045049 Bacteria 2294
822 Ga0451576_0002027 3300045051 Bacteria 31971
823 Ga0451576_0004679 3300045051 Bacteria 17624
824 Ga0451576_0026245 3300045051 Bacteria 6266
825 Ga0466958_0004028 3300045836 Bacteria 7706
826 Ga0466958_0007166 3300045836 Bacteria 6113
827 Ga0466958_0134431 3300045836 Bacteria 1554
828 Ga0466967_0003164 3300045976 Bacteria 10613
829 Ga0495617_000111 3300046452 Bacteria 59710
830 Ga0495617_001833 3300046452 Bacteria 9020
831 Ga0495592_0013065 3300046454 Bacteria 6318
832 Ga0495592_0013791 3300046454 Bacteria 6145
833 Ga0495592_0022670 3300046454 Bacteria 4776
834 Ga0495592_0057950 3300046454 Bacteria 2858
835 Ga0495603_0001289 3300046455 Bacteria 14609
836 Ga0495603_0001360 3300046455 Bacteria 14207
837 Ga0495603_0008459 3300046455 Bacteria 6214
838 Ga0495590_0001198 3300046457 Bacteria 11339
839 Ga0495590_0005800 3300046457 Bacteria 4852
840 Ga0495590_0017409 3300046457 Bacteria 2587
841 Ga0495591_000725 3300046458 Bacteria 23888
842 Ga0495629_0000060 3300046459 Bacteria 100921
843 Ga0495629_0000293 3300046459 Bacteria 43087
844 Ga0495629_0003084 3300046459 Bacteria 12643
845 Ga0495629_0017918 3300046459 Bacteria 5076
846 Ga0495629_0018305 3300046459 Bacteria 5015
847 Ga0495629_0077372 3300046459 Bacteria 2322
848 Ga0495638_0000007 3300046460 Bacteria 602783
849 Ga0495638_0000194 3300046460 Bacteria 88601
850 Ga0495638_0000213 3300046460 Bacteria 81547
851 Ga0495638_0000233 3300046460 Bacteria 75994
852 Ga0495638_0003136 3300046460 Bacteria 13084
853 Ga0495641_0014068 3300046461 Bacteria 4350
854 Ga0495651_0102892 3300046462 Bacteria 2123
855 Ga0495653_0003467 3300046463 Bacteria 12675
856 Ga0495653_0005778 3300046463 Bacteria 10126
857 Ga0495653_0016113 3300046463 Bacteria 6090
858 Ga0495653_0073499 3300046463 Bacteria 2551
859 Ga0495653_0304932 3300046463 Bacteria 1037
860 Ga0495650_0000202 3300046471 Bacteria 129910
861 Ga0495650_0001534 3300046471 Bacteria 21930
862 Ga0495650_0011836 3300046471 Bacteria 4737
863 Ga0495580_0001266 3300046472 Bacteria 22305
864 Ga0495580_0005292 3300046472 Bacteria 10711
865 Ga0495580_0008660 3300046472 Bacteria 8067
866 Ga0495580_0010730 3300046472 Bacteria 7115
867 Ga0495580_0011714 3300046472 Bacteria 6776
868 Ga0495580_0029784 3300046472 Bacteria 3959
869 Ga0495580_0081955 3300046472 Bacteria 2249
870 Ga0495580_0122362 3300046472 Bacteria 1806
871 Ga0495582_0018162 3300046473 Bacteria 3849
872 Ga0495605_0002472 3300046474 Bacteria 11435
873 Ga0495605_0006472 3300046474 Bacteria 6730
874 Ga0495605_0010487 3300046474 Bacteria 5182
875 Ga0495605_0014637 3300046474 Bacteria 4290
876 Ga0495639_0022457 3300046475 Bacteria 2768
877 Ga0495662_0013598 3300046476 Bacteria 3961
878 Ga0495664_0000037 3300046477 Bacteria 70108
879 Ga0495664_0002112 3300046477 Bacteria 10632
880 Ga0495585_0000001 3300046492 Bacteria 609804
881 Ga0495585_0013436 3300046492 Bacteria 4791
882 Ga0495596_0000377 3300046500 Bacteria 28417
883 Ga0495596_0003512 3300046500 Bacteria 7904
884 Ga0495596_0012343 3300046500 Bacteria 3659
885 Ga0495607_0000207 3300046501 Bacteria 62802
886 Ga0495607_0020058 3300046501 Bacteria 4232
887 Ga0495607_0097329 3300046501 Bacteria 1582
888 Ga0495583_0004094 3300046506 Bacteria 10696
889 Ga0495583_0011411 3300046506 Bacteria 5103
890 Ga0495583_0060148 3300046506 Bacteria 1699
891 Ga0495583_0067470 3300046506 Bacteria 1580
892 Ga0495606_0013496 3300046507 Bacteria 6445
893 Ga0495606_0020990 3300046507 Bacteria 4794
894 Ga0495606_0030227 3300046507 Bacteria 3788
895 Ga0495606_0057067 3300046507 Bacteria 2516
896 Ga0495608_0013992 3300046511 Bacteria 5566
897 Ga0495608_0014412 3300046511 Bacteria 5484
898 Ga0495610_0001239 3300046512 Bacteria 22926
899 Ga0495610_0003199 3300046512 Bacteria 12972
900 Ga0495610_0016416 3300046512 Bacteria 4263
901 Ga0495616_0000001 3300046513 Bacteria 780061
902 Ga0495616_0005323 3300046513 Bacteria 7935
903 Ga0495616_0038609 3300046513 Bacteria 2450
904 Ga0495618_0022475 3300046514 Bacteria 3896
905 Ga0495620_0000543 3300046515 Bacteria 23917
906 Ga0495620_0004657 3300046515 Bacteria 7707
907 Ga0495620_0004864 3300046515 Bacteria 7537
908 Ga0495628_0017213 3300046516 Bacteria 6020
909 Ga0495628_0017598 3300046516 Bacteria 5943
910 Ga0495628_0031750 3300046516 Bacteria 4270
911 Ga0495628_0032413 3300046516 Bacteria 4218
912 Ga0495628_0064539 3300046516 Bacteria 2866
913 Ga0495630_0021089 3300046517 Bacteria 4810
914 Ga0495630_0021345 3300046517 Bacteria 4782
915 Ga0495630_0078420 3300046517 Bacteria 2490
916 Ga0495631_0000162 3300046518 Bacteria 45464
917 Ga0495631_0000178 3300046518 Bacteria 43329
918 Ga0495632_0028520 3300046519 Bacteria 2913
919 Ga0495632_0076308 3300046519 Bacteria 1603
920 Ga0495637_0010613 3300046520 Bacteria 4449
921 Ga0495648_0000083 3300046524 Bacteria 121164
922 Ga0495648_0004219 3300046524 Bacteria 12340
923 Ga0495648_0004279 3300046524 Bacteria 12239
924 Ga0495648_0006831 3300046524 Bacteria 9213
925 Ga0495666_0001031 3300046526 Bacteria 13216
926 Ga0495666_0002120 3300046526 Bacteria 9835
927 Ga0495666_0005456 3300046526 Bacteria 6405
928 Ga0495666_0043671 3300046526 Bacteria 2165
929 Ga0495666_0045532 3300046526 Bacteria 2116
930 Ga0495642_0020554 3300046528 Bacteria 2594
931 Ga0495642_0029585 3300046528 Bacteria 2188
932 Ga0495652_0006254 3300046529 Bacteria 11102
933 Ga0495652_0056816 3300046529 Bacteria 3321
934 Ga0495654_0007716 3300046530 Bacteria 5989
935 Ga0495665_0004316 3300046531 Bacteria 7681
936 Ga0495665_0007236 3300046531 Bacteria 5990
937 Ga0495665_0026691 3300046531 Bacteria 3101
938 Ga0495640_0012094 3300046533 Bacteria 6611
939 Ga0495640_0016641 3300046533 Bacteria 5498
940 Ga0495640_0017401 3300046533 Bacteria 5359
941 Ga0495640_0051427 3300046533 Bacteria 2832
942 Ga0495640_0051890 3300046533 Bacteria 2817
943 Ga0495586_0000599 3300046535 Bacteria 20870
944 Ga0495586_0013939 3300046535 Bacteria 4265
945 Ga0495586_0052758 3300046535 Bacteria 2202
946 Ga0495587_0014914 3300046536 Bacteria 4860
947 Ga0495609_0000905 3300046538 Bacteria 21595
948 Ga0495609_0001698 3300046538 Bacteria 14284
949 Ga0495597_0000446 3300046542 Bacteria 35360
950 Ga0495597_0005687 3300046542 Bacteria 6559
951 Ga0495597_0012031 3300046542 Bacteria 4182
952 Ga0495645_0001629 3300046543 Bacteria 15204
953 Ga0495645_0011409 3300046543 Bacteria 6251
954 Ga0495645_0038518 3300046543 Bacteria 3486
955 Ga0495645_0081136 3300046543 Bacteria 2327
956 Ga0495645_0109253 3300046543 Bacteria 1958
957 Ga0495645_0119406 3300046543 Bacteria 1858
958 Ga0495622_0076098 3300046557 Bacteria 1547
959 Ga0495622_0090880 3300046557 Bacteria 1403
960 Ga0495633_0033170 3300046558 Bacteria 2491
961 Ga0495667_0059602 3300046559 Bacteria 2505
962 Ga0495668_0011617 3300046616 Bacteria 5266
963 Ga0495634_0133825 3300046642 Bacteria 1578
964 Ga0495611_0000001 3300046648 Bacteria 2628469
965 Ga0495611_0001164 3300046648 Bacteria 13729
966 Ga0495625_0000001 3300046660 Bacteria 1641829
967 Ga0495625_0001424 3300046660 Bacteria 29199
968 Ga0495625_0047787 3300046660 Bacteria 3085
969 Ga0495635_0072251 3300046663 Bacteria 2364
970 Ga0495635_0111910 3300046663 Bacteria 1865
971 Ga0495661_0001053 3300046665 Bacteria 24433
972 Ga0495661_0020112 3300046665 Bacteria 4365
973 Ga0495657_0036580 3300046675 Bacteria 3392
974 Ga0495599_0007027 3300046678 Bacteria 6807
975 Ga0495599_0014004 3300046678 Bacteria 4965
976 Ga0495599_0017978 3300046678 Bacteria 4402
977 Ga0495623_0040503 3300046679 Bacteria 2975
978 Ga0495623_0074231 3300046679 Bacteria 2113
979 Ga0495646_0004989 3300046680 Bacteria 8384
980 Ga0495646_0005973 3300046680 Bacteria 7714
981 Ga0495646_0012055 3300046680 Bacteria 5498
982 Ga0495646_0014953 3300046680 Bacteria 4930
983 Ga0495646_0016450 3300046680 Bacteria 4695
984 Ga0495658_0002184 3300046683 Bacteria 9894
985 Ga0495658_0089631 3300046683 Bacteria 1819
986 Ga0495669_0088224 3300046684 Bacteria 1430
987 Ga0495613_0019153 3300046689 Bacteria 5101
988 Ga0495624_0005054 3300046690 Bacteria 9544
989 Ga0495624_0019642 3300046690 Bacteria 4505
990 Ga0495624_0022859 3300046690 Bacteria 4127
991 Ga0495624_0026366 3300046690 Bacteria 3809
992 Ga0495624_0039331 3300046690 Bacteria 3032
993 Ga0495624_0051628 3300046690 Bacteria 2600
994 Ga0495624_0063927 3300046690 Bacteria 2300
995 Ga0495670_0002966 3300046691 Bacteria 8373
996 Ga0495670_0018062 3300046691 Bacteria 3474
997 Ga0495671_0000723 3300046692 Bacteria 23834
998 Ga0495671_0001770 3300046692 Bacteria 13979
999 Ga0495649_0003681 3300046694 Bacteria 10201
1000 Ga0495649_0016295 3300046694 Bacteria 4212
1001 Ga0495649_0039743 3300046694 Bacteria 2579
1002 Ga0495589_0000314 3300046794 Bacteria 38602
1003 Ga0495589_0005460 3300046794 Bacteria 6707
1004 Ga0495600_0005463 3300046809 Bacteria 7663
1005 Ga0495600_0005952 3300046809 Bacteria 7380
1006 Ga0495600_0027891 3300046809 Bacteria 3651
1007 Ga0495600_0075733 3300046809 Bacteria 2197
1008 Ga0495660_0000008 3300046810 Bacteria 435769
1009 Ga0495660_0000180 3300046810 Bacteria 68501
1010 Ga0495660_0016577 3300046810 Bacteria 4248
1011 Ga0495581_0004067 3300047315 Bacteria 8422
1012 Ga0495581_0016353 3300047315 Bacteria 4315
1013 Ga0495581_0022296 3300047315 Bacteria 3669
1014 Ga0495604_0003896 3300047317 Bacteria 11883
1015 Ga0495604_0027657 3300047317 Bacteria 4508
1016 Ga0495604_0078425 3300047317 Bacteria 2479
1017 Ga0495604_0086440 3300047317 Bacteria 2338
1018 Ga0495604_0106357 3300047317 Bacteria 2052
1019 Ga0495636_0003528 3300047318 Bacteria 6066
1020 Ga0495674_0004951 3300047319 Bacteria 12810
1021 Ga0495674_0020282 3300047319 Bacteria 6156
1022 Ga0495672_0002823 3300047320 Bacteria 15467
1023 Ga0495672_0023096 3300047320 Bacteria 4032
1024 Ga0495676_0004601 3300047321 Bacteria 12639
1025 Ga0495676_0114356 3300047321 Bacteria 1974
1026 Ga0495680_0004438 3300047322 Bacteria 13404
1027 Ga0495680_0023501 3300047322 Bacteria 5123
1028 Ga0495680_0035180 3300047322 Bacteria 4036
1029 Ga0495680_0082652 3300047322 Bacteria 2423
1030 Ga0495683_0001386 3300047323 Bacteria 16060
1031 Ga0495683_0010882 3300047323 Bacteria 4796
1032 Ga0495683_0013641 3300047323 Bacteria 4246
1033 Ga0495683_0023985 3300047323 Bacteria 3133
1034 Ga0495683_0080169 3300047323 Bacteria 1593
1035 Ga0495687_000025 3300047443 Bacteria 310498
1036 Ga0495687_007690 3300047443 Bacteria 6298
1037 Ga0495675_0013400 3300047444 Bacteria 5175
1038 Ga0495679_000001 3300047446 Bacteria 1607568
1039 Ga0495679_000038 3300047446 Bacteria 157311
1040 Ga0495679_001513 3300047446 Bacteria 13139
1041 Ga0495679_013297 3300047446 Bacteria 3098
1042 Ga0495673_0000001 3300047469 Bacteria 1630730
1043 Ga0495673_0000030 3300047469 Bacteria 468915
1044 Ga0495673_0000232 3300047469 Bacteria 81119
1045 Ga0495686_0000077 3300047472 Bacteria 205924
1046 Ga0495686_0007428 3300047472 Bacteria 8221
1047 Ga0495686_0028109 3300047472 Bacteria 3664
1048 Ga0495686_0040502 3300047472 Bacteria 2970
1049 Ga0495593_0010609 3300047673 Bacteria 5313
1050 Ga0495593_0049793 3300047673 Bacteria 2221
1051 Ga0495602_0003086 3300048088 Bacteria 17124
1052 Ga0495602_0013165 3300048088 Bacteria 8462
1053 Ga0495602_0065068 3300048088 Bacteria 3148
1054 Ga0495602_0133850 3300048088 Bacteria 1972
1055 Ga0495614_0003454 3300048089 Bacteria 7069
1056 Ga0495614_0022447 3300048089 Bacteria 2723
1057 Ga0495626_0029076 3300048091 Bacteria 2677
1058 Ga0496100_0001557 3300048903 Bacteria 11277
1059 Ga0496100_0002914 3300048903 Bacteria 8785
1060 Ga0496100_0007357 3300048903 Bacteria 6068
1061 Ga0496101_0000612 3300048904 Bacteria 21816
1062 Ga0496101_0001266 3300048904 Bacteria 15116
1063 Ga0496101_0015890 3300048904 Bacteria 5079
1064 Ga0496101_0146682 3300048904 Bacteria 1802
1065 Ga0496102_0000459 3300048905 Bacteria 45591
1066 Ga0496102_0005874 3300048905 Bacteria 10443
1067 Ga0496102_0011545 3300048905 Bacteria 7621
1068 Ga0496102_0066635 3300048905 Bacteria 3300
1069 Ga0496102_0107158 3300048905 Bacteria 2602
1070 Ga0496103_0000337 3300048906 Bacteria 42834
1071 Ga0496103_0009338 3300048906 Bacteria 5810
1072 Ga0496104_0137350 3300048907 Bacteria 2348
1073 Ga0496105_0017452 3300048908 Bacteria 5756
1074 Ga0496105_0111779 3300048908 Bacteria 2254
1075 Ga0496105_0147632 3300048908 Bacteria 1934
1076 Ga0496106_0000019 3300048909 Bacteria 174698
1077 Ga0496106_0001680 3300048909 Bacteria 16557
1078 Ga0496106_0039738 3300048909 Bacteria 3523
1079 Ga0496110_0001369 3300048913 Bacteria 17558
1080 Ga0496111_0009674 3300048914 Bacteria 6443
1081 Ga0496112_0006477 3300048915 Bacteria 10287
1082 Ga0496113_0002111 3300048916 Bacteria 11463
1083 Ga0496114_0063683 3300048917 Bacteria 3087
1084 Ga0496115_0000337 3300048918 Bacteria 39950
1085 Ga0496115_0000901 3300048918 Bacteria 21555
1086 Ga0496116_0012476 3300048919 Bacteria 6942
1087 Ga0496116_0016236 3300048919 Bacteria 5838
1088 Ga0496116_0021645 3300048919 Bacteria 4841
1089 Ga0496116_0031133 3300048919 Bacteria 3825
1090 Ga0496116_0037807 3300048919 Bacteria 3361
1091 Ga0496116_0080352 3300048919 Bacteria 2025
1092 Ga0496117_0002293 3300048920 Bacteria 24665
1093 Ga0496117_0004900 3300048920 Bacteria 14416
1094 Ga0496117_0014213 3300048920 Bacteria 6876
1095 Ga0496117_0021313 3300048920 Bacteria 5248
1096 Ga0496117_0027009 3300048920 Bacteria 4481
1097 Ga0496117_0028072 3300048920 Bacteria 4363
1098 Ga0496117_0032699 3300048920 Bacteria 3948
1099 Ga0496117_0110476 3300048920 Bacteria 1714
1100 Ga0496118_0000420 3300048921 Bacteria 70373
1101 Ga0496118_0002548 3300048921 Bacteria 24410
1102 Ga0496118_0010050 3300048921 Bacteria 9430
1103 Ga0496118_0020384 3300048921 Bacteria 5879
1104 Ga0496118_0030492 3300048921 Bacteria 4499
1105 Ga0496118_0031291 3300048921 Bacteria 4414
1106 Ga0496118_0047912 3300048921 Bacteria 3307
1107 Ga0496118_0184817 3300048921 Bacteria 1254
1108 Ga0496119_0000058 3300048922 Bacteria 173131
1109 Ga0496119_0019951 3300048922 Bacteria 4910
1110 Ga0496119_0057847 3300048922 Bacteria 2340
1111 Ga0496120_0000184 3300048923 Bacteria 106643
1112 Ga0496120_0000335 3300048923 Bacteria 78595
1113 Ga0496120_0014808 3300048923 Bacteria 5174
1114 Ga0496121_0000306 3300048924 Bacteria 102245
1115 Ga0496121_0000310 3300048924 Bacteria 101522
1116 Ga0496121_0000431 3300048924 Bacteria 82456
1117 Ga0496121_0001587 3300048924 Bacteria 37821
1118 Ga0496121_0003917 3300048924 Bacteria 20644
1119 Ga0496121_0006654 3300048924 Bacteria 14228
1120 Ga0496121_0007409 3300048924 Bacteria 13260
1121 Ga0496121_0032998 3300048924 Bacteria 4695
1122 Ga0496121_0036205 3300048924 Bacteria 4402
1123 Ga0496121_0059448 3300048924 Bacteria 3151
1124 Ga0496121_0083972 3300048924 Bacteria 2512
1125 Ga0496121_0088612 3300048924 Bacteria 2425
1126 Ga0496122_0000375 3300048925 Bacteria 95681
1127 Ga0496122_0000865 3300048925 Bacteria 57024
1128 Ga0496122_0006359 3300048925 Bacteria 13588
1129 Ga0496122_0007677 3300048925 Bacteria 11891
1130 Ga0496122_0084897 3300048925 Bacteria 2187
1131 Ga0496123_0000203 3300048926 Bacteria 121361
1132 Ga0496123_0000267 3300048926 Bacteria 104282
1133 Ga0496123_0001951 3300048926 Bacteria 26821
1134 Ga0496123_0007642 3300048926 Bacteria 10117
1135 Ga0496123_0122905 3300048926 Bacteria 1455
1136 Ga0496124_0000046 3300048927 Bacteria 287043
1137 Ga0496124_0014584 3300048927 Bacteria 7591
1138 Ga0496125_0000011 3300048928 Bacteria 655895
1139 Ga0496125_0000499 3300048928 Bacteria 68475
1140 Ga0496125_0002855 3300048928 Bacteria 21745
1141 Ga0496125_0020330 3300048928 Bacteria 6231
1142 Ga0496126_0000034 3300048929 Bacteria 362440
1143 Ga0496126_0000706 3300048929 Bacteria 60980
1144 Ga0496126_0002194 3300048929 Bacteria 27121
1145 Ga0496126_0002232 3300048929 Bacteria 26785
1146 Ga0496126_0009476 3300048929 Bacteria 10333
1147 Ga0496126_0015371 3300048929 Bacteria 7700
1148 Ga0496126_0016049 3300048929 Bacteria 7510
1149 Ga0496126_0028263 3300048929 Bacteria 5345
1150 Ga0496126_0108462 3300048929 Bacteria 2421
1151 Ga0496126_0119748 3300048929 Bacteria 2284
1152 Ga0496126_0243371 3300048929 Bacteria 1502
1153 Ga0495678_000023 3300049459 Bacteria 233463
1154 Ga0495678_018904 3300049459 Bacteria 3087
1155 Ga0495682_0005399 3300049460 Bacteria 5315
1156 Ga0495682_0006472 3300049460 Bacteria 4731
1157 Ga0501031_0014372 3300049568 Bacteria 5147
1158 Ga0501032_0012518 3300049569 Bacteria 6057
1159 Ga0501033_0002347 3300049570 Bacteria 16140
1160 Ga0501033_0007556 3300049570 Bacteria 8457
1161 Ga0501033_0144939 3300049570 Bacteria 1716
1162 Ga0501034_0000268 3300049571 Bacteria 94149
1163 Ga0501034_0014340 3300049571 Bacteria 8165
1164 Ga0501034_0028679 3300049571 Bacteria 5663
1165 Ga0501036_0047363 3300049572 Bacteria 3641
1166 Ga0501036_0071739 3300049572 Bacteria 2928
1167 Ga0501036_0174845 3300049572 Bacteria 1808
1168 Ga0501036_0263525 3300049572 Bacteria 1443
1169 Ga0501037_0002084 3300049573 Bacteria 14498
1170 Ga0501038_0018830 3300049574 Bacteria 6233
1171 Ga0501038_0218532 3300049574 Bacteria 1521
1172 Ga0501038_0220105 3300049574 Bacteria 1515
1173 Ga0501038_0227818 3300049574 Bacteria 1484
1174 Ga0501039_0016403 3300049575 Bacteria 5674
1175 Ga0501039_0058323 3300049575 Bacteria 2990
1176 Ga0501040_0008966 3300049576 Bacteria 6506
1177 Ga0501040_0011763 3300049576 Bacteria 5725
1178 Ga0501040_0162859 3300049576 Bacteria 1577
1179 Ga0501041_0138624 3300049577 Bacteria 1516
1180 Ga0501042_0006589 3300049578 Bacteria 7553
1181 Ga0501042_0056597 3300049578 Bacteria 2798
1182 Ga0501043_0053884 3300049579 Bacteria 3158
1183 Ga0501046_0076996 3300049580 Bacteria 2583
1184 Ga0501047_0002786 3300049581 Bacteria 16597
1185 Ga0501047_0046666 3300049581 Bacteria 4187
1186 Ga0501047_0047030 3300049581 Bacteria 4169
1187 Ga0501048_0102808 3300049582 Bacteria 2016
1188 Ga0501048_0109594 3300049582 Bacteria 1949
1189 Ga0501067_0047374 3300049583 Bacteria 2384
1190 Ga0501070_0000201 3300049586 Bacteria 56006
1191 Ga0501070_0010763 3300049586 Bacteria 7731
1192 Ga0501072_0096425 3300049588 Bacteria 2350
1193 Ga0501072_0268942 3300049588 Bacteria 1356
1194 Ga0501075_0040394 3300049591 Bacteria 3493
1195 Ga0501075_0073090 3300049591 Bacteria 2593
1196 Ga0501075_0243628 3300049591 Bacteria 1370
1197 Ga0501076_0011826 3300049592 Bacteria 6517
1198 Ga0501076_0017868 3300049592 Bacteria 5394
1199 Ga0501076_0104755 3300049592 Bacteria 2283
1200 Ga0501076_0190485 3300049592 Bacteria 1673
1201 Ga0501079_0028464 3300049741 Bacteria 4288
1202 Ga0501080_0082829 3300049742 Bacteria 2980
1203 Ga0501081_0001856 3300049743 Bacteria 13124
1204 Ga0501081_0006018 3300049743 Bacteria 7853
1205 Ga0501081_0033190 3300049743 Bacteria 3506
1206 Ga0501035_0012600 3300049822 Bacteria 7813
1207 Ga0501035_0037213 3300049822 Bacteria 4408
1208 Ga0501035_0072502 3300049822 Bacteria 3048
1209 Ga0501035_0127926 3300049822 Bacteria 2216
1210 Ga0501044_0000076 3300049823 Bacteria 120755
1211 Ga0501044_0002174 3300049823 Bacteria 22485
1212 Ga0501044_0003619 3300049823 Bacteria 17388
1213 Ga0501044_0004747 3300049823 Bacteria 15193
1214 Ga0501044_0007876 3300049823 Bacteria 11711
1215 Ga0501044_0014630 3300049823 Bacteria 8460
1216 Ga0501044_0106789 3300049823 Bacteria 2811
1217 Ga0501044_0110316 3300049823 Bacteria 2760
1218 Ga0501045_0002662 3300049824 Bacteria 12183
1219 Ga0501045_0102389 3300049824 Bacteria 2120
1220 nmdc:mga03n38_24395_c1 3300050490 Bacteria 2472
1221 nmdc:mga00v17_109959_c1 3300050491 Bacteria 1748
1222 nmdc:mga00v17_16444_c1 3300050491 Bacteria 4169
1223 nmdc:mga00v17_7113_c1 3300050491 Bacteria 5960
1224 nmdc:mga0yw44_133339_c1 3300050492 Bacteria 1610
1225 nmdc:mga0k408_173163_c1 3300050493 Bacteria 1287
1226 nmdc:mga0k408_4449_c1 3300050493 Bacteria 7437
1227 nmdc:mga07m45_33869_c1 3300050496 Bacteria 2838
1228 nmdc:mga07m45_3597_c1 3300050496 Bacteria 7490
1229 nmdc:mga07m45_76859_c1 3300050496 Bacteria 1904
1230 nmdc:mga05p37_758_c1 3300050507 Bacteria 35839
1231 nmdc:mga09592_1050_c1 3300050508 Bacteria 21887
1232 nmdc:mga09592_110466_c1 3300050508 Bacteria 2359
1233 nmdc:mga0qj67_2437_c1 3300050509 Bacteria 13248
1234 nmdc:mga0qj67_32479_c1 3300050509 Bacteria 4071
1235 nmdc:mga0qj67_36310_c1 3300050509 Bacteria 3855
1236 nmdc:mga0qj67_8037_c1 3300050509 Bacteria 7804
1237 nmdc:mga06r32_5201_c1 3300050510 Bacteria 11693
1238 nmdc:mga08y16_166325_c1 3300050511 Bacteria 2291
1239 nmdc:mga08y16_22033_c1 3300050511 Bacteria 6728
1240 nmdc:mga08y16_254907_c1 3300050511 Bacteria 1813
1241 nmdc:mga0n895_1569_c1 3300050512 Bacteria 17184
1242 nmdc:mga0n895_2878_c1 3300050512 Bacteria 13655
1243 nmdc:mga0n895_47507_c1 3300050512 Bacteria 4197
1244 nmdc:mga0rr50_2095_c1 3300050513 Bacteria 11151
1245 nmdc:mga08x19_1254_c1 3300050514 Bacteria 15744
1246 nmdc:mga08x19_16509_c1 3300050514 Bacteria 4504
1247 nmdc:mga08x19_16751_c1 3300050514 Bacteria 4475
1248 nmdc:mga08x19_303_c1 3300050514 Bacteria 35609
1249 nmdc:mga08x19_48686_c1 3300050514 Bacteria 2716
1250 nmdc:mga0a205_147036_c1 3300050515 Bacteria 2257
1251 nmdc:mga0a205_27603_c1 3300050515 Bacteria 5421
1252 nmdc:mga0a205_599_c1 3300050515 Bacteria 28654
1253 Ga0495601_0011862 3300053077 Bacteria 5225
1254 Ga0500610_0000821 3300053079 Bacteria 9897
1255 Ga0495619_0063625 3300053085 Bacteria 2458
1256 Ga0500643_000002 3300053087 Bacteria 1277657
1257 Ga0500555_000716 3300053103 Bacteria 12470
1258 Ga0500593_000835 3300053117 Bacteria 11522
1259 Ga0500595_001911 3300053119 Bacteria 10732
1260 Ga0500607_001548 3300053121 Bacteria 20411
1261 Ga0500618_000877 3300053125 Bacteria 16018
1262 Ga0500618_001593 3300053125 Bacteria 9868
1263 Ga0500618_005380 3300053125 Bacteria 3905
1264 Ga0500652_079452 3300053131 Bacteria 1365
1265 Ga0500574_005155 3300053141 Bacteria 2517
1266 Ga0500600_0012736 3300053149 Bacteria 5107
1267 Ga0500627_0069699 3300053158 Bacteria 1556
1268 Ga0500633_0001927 3300053160 Bacteria 4100
1269 Ga0500645_000704 3300053730 Bacteria 20751
1270 Ga0501084_0144421 3300054114 Bacteria 2004
1271 Ga0501082_0016248 3300060353 Bacteria 6407
1272 Ga0501082_0130687 3300060353 Bacteria 2179
1273 Ga0466962_0000994 3300061719 Bacteria 12945
1274 Ga0466962_0008295 3300061719 Bacteria 4978
1275 Ga0530510_0007953 3300061734 Bacteria 7398
1276 2501073341 2501025501 Bacteria 7768574
1277 2501082663 2501025502 Bacteria 9641094
1278 2501408403 2501025504 Bacteria 8008976
1279 2509132288 2508501125 Bacteria 7208311
1280 2510251804 2510065045 Bacteria 7761063
1281 2511086004 2510917013 Bacteria 9951648
1282 2511096138 2510917014 Bacteria 8296963
1283 2511103139 2510917015 Bacteria 7950052
1284 2511248956 2511231003 Bacteria 5606035
1285 2511387491 2511231026 Bacteria 5225445
1286 2512345227 2512047030 Bacteria 9031815
1287 2513563427 2513237083 Bacteria 8410967
1288 2513956525 2513237150 Bacteria 6553639
1289 2513961449 2513237151 Bacteria 6309801
1290 2514044194 2513237165 Bacteria 6771773
1291 2514050936 2513237166 Bacteria 10373764
1292 2515684318 2515154122 Bacteria 8609520
1293 2515691611 2515154123 Bacteria 6387382
1294 2516022437 2515154189 Bacteria 9629850
1295 2519458237 2519103095 Bacteria 6629912
1296 2521557584 2521172590 Bacteria 5047645
1297 2527080748 2526164713 Bacteria 6780608
1298 2538833115 2537561836 Bacteria 3910579
1299 2548501096 2547132374 Bacteria 5530232
1300 2550696232 2548876994 Bacteria 4904866
1301 2553006612 2551306416 Bacteria 6152985
1302 2563059230 2562617112 Bacteria 10918404
1303 2585294710 2582581311 Bacteria 6763856
1304 2597028872 2596583598 Bacteria 5251611
1305 2599445560 2599185178 Bacteria 5365746
1306 2599738098 2599185239 Bacteria 8686614
1307 2599742530 2599185240 Bacteria 7968121
1308 2599903203 2599185292 Bacteria 6290804
1309 2600204648 2599185355 Bacteria 7968906
1310 2600810828 2600255067 Bacteria 6795583
1311 2643831586 2643221562 Bacteria 4048635
1312 2643862305 2643221569 Bacteria 6064337
1313 2643866797 2643221570 Bacteria 5103772
1314 2643893955 2643221577 Bacteria 3710843
1315 2643980669 2643221594 Bacteria 5811388
1316 2643993519 2643221596 Bacteria 5006805
1317 2644062638 2643221609 Bacteria 6756331
1318 2644076348 2643221611 Bacteria 6820941
1319 2644122097 2643221621 Bacteria 6212786
1320 2644294656 2643221652 Bacteria 5140275
1321 2644476174 2643221685 Bacteria 3673288
1322 2644645810 2643221717 Bacteria 5676132
1323 2676741634 2675903129 Bacteria 7964495
1324 2713479837 2711768613 Bacteria 11048459
1325 2719640915 2718217991 Bacteria 7829542
1326 2722882785 2721755523 Bacteria 6430384
1327 2723876549 2721755763 Bacteria 4464185
1328 2735836770 2734482264 Unclassified 5014763
1329 2738818999 2738541296 Bacteria 7285013
1330 2738830845 2738541298 Bacteria 7286732
1331 2738872372 2738541306 Bacteria 7284992
1332 2739184002 2738543002 Bacteria 7284546
1333 2739218972 2738543008 Bacteria 7282815
1334 2739228686 2738543009 Bacteria 4944499
1335 2739244678 2738543012 Bacteria 7115078
1336 2739252239 2738543013 Bacteria 5618633
1337 2739612173 2739367655 Bacteria 4051151
1338 2739732001 2739367700 Bacteria 4747630
1339 2746088176 2744054900 Bacteria 8399525
1340 2746096930 2744054901 Bacteria 8397047
1341 2748019447 2747842501 Bacteria 5293829
1342 2753571040 2751185846 Bacteria 7242164
1343 2765570251 2765235838 Bacteria 5445269
1344 2792834002 2791355137 Bacteria 9654227
1345 2808970007 2808606384 Bacteria 8474373
1346 2808984390 2808606386 Bacteria 4471946
1347 2809005146 2808606390 Bacteria 8476311
1348 2809011713 2808606391 Bacteria 8308166
1349 2809032014 2808606395 Bacteria 6020352
1350 2809130744 2808606415 Bacteria 4576710
1351 2809149778 2808606419 Bacteria 4576925
1352 2816475119 2816332133 Bacteria 7249298
1353 2817260388 2816332253 Bacteria 6764532
1354 2817278076 2816332256 Bacteria 6891714
1355 2817455643 2816332286 Bacteria 6853759
1356 2819544245 2818991436 Bacteria 5376622
1357 2819591419 2818991445 Bacteria 4955017
1358 2819615276 2818991449 Bacteria 5518009
1359 2819623564 2818991450 Bacteria 6962147
1360 2819632914 2818991452 Bacteria 8442785
1361 2834644904 2834641062 Bacteria 5559922
1362 2839096804 2839094727 Bacteria 5534556
1363 2839138516 2839138175 Bacteria 6549354
1364 2842325092 2842324504 Bacteria 9364110
1365 2842349370 2842348783 Bacteria 9002918
1366 2842459888 2842454564 Bacteria 8730687
1367 2842719770 2842718218 Bacteria 4560148
1368 2842918932 2842918807 Bacteria 4289178
1369 2852620081 2852618963 Bacteria 4577824
1370 2852687714 2852684882 Bacteria 5463342
1371 2855734619 2855730933 Bacteria 7047938
1372 2855770209 2855767633 Bacteria 7049357
1373 2857361004 2857357740 Bacteria 9937880
1374 2857538493 2857537821 Bacteria 5248181
1375 2857546604 2857542790 Bacteria 5326616
1376 2858955765 2858950400 Bacteria 6783797
1377 2863421925 2863421361 Bacteria 7300805
1378 2870072133 2870068957 Bacteria 8925310
1379 2881414430 2881412998 Bacteria 6492157
1380 2883088027 2883087390 Bacteria 9532701
1381 2884340366 2884338543 Bacteria 4610696
1382 2884413860 2884411467 Bacteria 5246714
1383 2884812895 2884811622 Bacteria 5552861
1384 2884812901 2884811622 Bacteria 5552861
1385 2884837223 2884836552 Bacteria 5219991
1386 2884853514 2884852848 Bacteria 5221161
1387 2885266779 2885266251 Bacteria 4796748
1388 2885271087 2885270888 Bacteria 9831543
1389 2887377871 2887375801 Bacteria 5334027
1390 2894026031 2894023352 Bacteria 5167372
1391 2895397007 2895395659 Bacteria 3983269
1392 2895501385 2895498888 Bacteria 5283788
1393 2895514528 2895511927 Bacteria 6802080
1394 2895523990 2895522137 Bacteria 3284416
1395 2895527478 2895525241 Bacteria 3388457
1396 2896155369 2896154374 Bacteria 5221518
1397 2900578647 2900577576 Bacteria 5438534
1398 2900637816 2900634093 Bacteria 10263517
1399 2901312876 2901300506 Bacteria 8463898
1400 2902687098 2902682994 Bacteria 8951596
1401 2904436949 2904434214 Bacteria 6230908
1402 2904441706 2904439833 Bacteria 5931679
1403 2904463563 2904463128 Bacteria 4775606
1404 2904480842 2904479285 Bacteria 5073931
1405 2904487413 2904483920 Bacteria 7545285
1406 2904531372 2904530477 Bacteria 5876334
1407 2904566090 2904564687 Bacteria 7609577
1408 2904573134 2904571731 Bacteria 7608790
1409 2904586973 2904584206 Bacteria 6028872
1410 2904592994 2904589729 Bacteria 6113573
1411 2904603193 2904601388 Bacteria 5884906
1412 2904623551 2904615490 Bacteria 10047340
1413 2919050987 2919046199 Bacteria 5567169
1414 2919082044 2919079590 Bacteria 5946433
1415 2919405256 2919404418 Bacteria 4232372
1416 2919528720 2919527303 Bacteria 7718827
1417 2921648338 2921643360 Bacteria 11448031
1418 2923516281 2923510766 Bacteria 5926163
1419 2928062895 2928058823 Bacteria 5520022
1420 2928110849 2928108538 Bacteria 7360024
1421 2928135075 2928130867 Bacteria 5467269
1422 2928137593 2928135762 Bacteria 7259641
1423 2928159494 2928157003 Bacteria 7522202
1424 2928164446 2928163908 Bacteria 7561269
1425 2928177570 2928170801 Bacteria 8785406
1426 2928510229 2928503688 Bacteria 7268108
1427 2928538344 2928536128 Bacteria 7657547
1428 2928964694 2928963466 Bacteria 5165703
1429 2939614199 2939611941 Bacteria 3892017
1430 2939631547 2939631187 Bacteria 6118131
1431 2941481907
1432 2945937679 2945934425 Bacteria 7444609
1433 2974323846 2974320154 Bacteria 4571377
1434 2981993928 2981990288 Bacteria 7590678
1435 2990705603 2990703756 Bacteria 7715990
1436 2990712755 2990710928 Bacteria 5002431
1437 642427189 641736151 Bacteria 7477263
1438 642417817 641736154 Bacteria 7689995
1439 642592578 642555112 Bacteria 8676562
1440 642622500 642555113 Bacteria 8214658
1441 644748408 644736347 Bacteria 6476522
1442 8002395026 8002392321 Bacteria 4159911
1443 8003401744 8003400568 Bacteria 5535898
1444 8003957814 8003955200 Bacteria 8601927
1445 8018850359 8018845410 Bacteria 8933938
1446 8020808859 8020807995 Bacteria 6801506
1447 8020939385 8020938398 Bacteria 7472757
1448 8020947212 8020945358 Bacteria 8467355
1449 8020954391 8020953355 Bacteria 7439080
1450 8021122821 8021120328 Bacteria 8782274
1451 8039102758 8039098773 Bacteria 6602928
1452 8040169310 8040167225 Bacteria 6542727
1453 8040174987 8040173305 Bacteria 6827067
1454 8048749749 8048746797 Bacteria 3557226
1455 8055227965 8055225921 Bacteria 3341787
1456 8055266965 8055266321 Bacteria 7999742
1457 8055301719 8055301274 Bacteria 8587385
1458 Ga0495686_0000032
1459 JGI24741J21665_1000010
1460 JGI24740J21852_10000304
1461 JGI24740J21852_10000783
1462 JGI24740J21852_10000978
1463 JGI24740J21852_10003282
1464 JGI24739J22299_10000112
1465 JGI24739J22299_10003808
1466 JGI24739J22299_10013313
1467 JGI24739J22299_10025297
1468 JGI24737J22298_10012110
1469 JGI24737J22298_10023387
1470 JGI24735J21928_10000665
1471 JGI24735J21928_10000684
1472 JGI24735J21928_10011596
1473 JGI24735J21928_10018786
1474 JGI24735J21928_10035330
1475 JGI24738J21930_10001352
1476 JGI25155J39150_1000126
1477 JGI25155J39150_1000177
1478 JGI25156J39149_1000057
1479 JGI25156J39149_1000214
1480 JGI25156J39149_1001009
1481 JGI25156J39149_1001319
1482 JGI25156J39149_1002562
1483 JGI25156J39149_1002845
1484 JGI25156J39149_1005837
1485 JGI25156J39149_1009942
1486 JGI25162J39368_1000138
1487 JGI25162J39368_1000443
1488 JGI25162J39368_1000786
1489 JGI25162J39368_1001136
1490 JGI25162J39368_1003039
1491 JGI25154J39366_1000087
1492 JGI25154J39366_1000206
1493 JGI25154J39366_1001056
1494 JGI25157J39369_1000156
1495 JGI25157J39369_1000172
1496 JGI25157J39369_1000441
1497 JGI25157J39369_1000643
1498 JGI25157J39369_1000992
1499 JGI25157J39369_1002371
1500 JGI25163J39215_1000278
1501 JGI25164J39214_1000170
1502 JGI25164J39214_1000310
1503 JGI25164J39214_1000375
1504 JGI25164J39214_1001368
1505 JGI25164J39214_1001375
1506 JGI25151J46595_10005080
1507 JGI25151J46595_10011877
1508 JGI25165J46597_1000105
1509 JGI25165J46597_1000224
1510 JGI25165J46597_1000549
1511 JGI25165J46597_1000580
1512 JGI25165J46597_1002481
1513 JGI25165J46597_1002491
1514 JGI25153J46596_10006045
1515 rootH1_10022880
1516 rootH2_10000174
1517 rootH2_10006665
1518 rootL2_10098200
1519 JGI25160J50197_1000082
1520 Ga0055538_1000043
1521 Ga0055538_1000045
1522 Ga0055538_1002105
1523 Ga0055539_1000034
1524 Ga0055539_1000057
1525 Ga0055539_1000064
1526 Ga0055533_1000071
1527 Ga0055533_1000074
1528 Ga0055533_1000540
1529 Ga0055533_1001327
1530 Ga0055532_1000002
1531 Ga0055532_1000016
1532 Ga0055532_1000039
1533 Ga0055532_1000643
1534 Ga0055532_1000713
1535 Ga0055532_1000720
1536 Ga0055525_1000085
1537 Ga0055525_1000092
1538 Ga0055525_1000192
1539 Ga0055525_1000313
1540 Ga0055525_1000473
1541 Ga0055527_1000024
1542 Ga0055527_1000041
1543 Ga0055527_1000234
1544 Ga0055527_1000276
1545 Ga0055527_1001073
1546 Ga0055535_1000028
1547 Ga0055535_1000193
1548 Ga0055535_1000216
1549 Ga0055535_1000457
1550 Ga0055535_1000502
1551 Ga0055535_1001000
1552 Ga0055535_1001317
1553 Ga0055535_1001326
1554 Ga0055535_1003753
1555 Ga0055542_1000047
1556 Ga0055542_1000136
1557 Ga0055542_1000152
1558 Ga0055542_1000179
1559 Ga0055542_1000183
1560 Ga0055542_1000520
1561 Ga0055542_1001547
1562 Ga0055542_1001665
1563 Ga0055542_1003689
1564 Ga0055529_1000028
1565 Ga0055529_1000054
1566 Ga0055529_1000189
1567 Ga0055529_1000254
1568 Ga0055529_1000552
1569 Ga0055529_1001001
1570 Ga0055526_1011699
1571 Ga0055526_1017490
1572 Ga0055524_1006917
1573 Ga0055536_1000087
1574 Ga0055534_1000910
1575 Ga0055534_1001301
1576 Ga0055534_1001898
1577 Ga0055528_1004561
1578 Ga0055541_1000044
1579 Ga0055541_1000046
1580 Ga0055541_1008710
1581 Ga0058692_1002802
1582 Ga0065165_1000250
1583 Ga0065165_1000790
1584 Ga0065704_10081336
1585 Ga0065715_10187709
1586 Ga0065707_10111924
1587 Ga0070658_10071329
1588 Ga0070658_10144004
1589 Ga0070676_10054594
1590 Ga0070683_100059687
1591 Ga0070690_100001754
1592 Ga0070670_100055684
1593 Ga0070670_100139443
1594 Ga0068869_100001435
1595 Ga0070666_10046595
1596 Ga0070680_100000789
1597 Ga0070680_100022650
1598 Ga0070680_100055318
1599 Ga0070680_100173530
1600 Ga0070682_100003408
1601 Ga0070682_100035827
1602 Ga0068868_100001331
1603 Ga0070660_100000016
1604 Ga0070660_100011617
1605 Ga0070689_100000776
1606 Ga0070689_100047885
1607 Ga0070691_10029459
1608 Ga0070687_100000436
1609 Ga0070661_100000013
1610 Ga0070661_100042504
1611 Ga0070692_10000910
1612 Ga0070668_100058281
1613 Ga0070668_100106786
1614 Ga0070669_100000706
1615 Ga0070669_100068696
1616 Ga0070675_100056072
1617 Ga0070671_100227409
1618 Ga0070673_100265129
1619 Ga0070659_100000167
1620 Ga0070659_100003331
1621 Ga0070659_100007239
1622 Ga0070659_100044058
1623 Ga0070714_100000088
1624 Ga0070714_100035404
1625 Ga0070713_100003177
1626 Ga0070710_10058408
1627 Ga0070705_100001008
1628 Ga0070705_100048956
1629 Ga0070700_100000666
1630 Ga0070694_100001273
1631 Ga0070694_100009337
1632 Ga0070694_100046544
1633 Ga0070694_100056927
1634 Ga0070694_100123354
1635 Ga0070708_100061073
1636 Ga0070663_100000006
1637 Ga0070663_100000479
1638 Ga0070663_100030317
1639 Ga0070663_100033311
1640 Ga0070663_100111631
1641 Ga0070681_10000235
1642 Ga0070681_10001320
1643 Ga0070681_10003359
1644 Ga0070681_10056509
1645 Ga0068867_100000699
1646 Ga0068867_100001386
1647 Ga0070699_100002487
1648 Ga0070679_100011170
1649 Ga0070679_100015423
1650 Ga0070679_100036570
1651 Ga0070679_100105841
1652 Ga0070684_100158444
1653 Ga0070697_100001807
1654 Ga0070697_100003810
1655 Ga0068853_100132135
1656 Ga0070672_100131652
1657 Ga0070686_100002450
1658 Ga0070686_100067700
1659 Ga0070695_100000113
1660 Ga0070695_100024153
1661 Ga0070696_100000434
1662 Ga0070696_100002179
1663 Ga0070696_100002261
1664 Ga0070696_100002633
1665 Ga0070693_100000209
1666 Ga0070693_100015359
1667 Ga0070665_100002809
1668 Ga0068855_100000072
1669 Ga0068855_100014327
1670 Ga0068855_100014631
1671 Ga0068855_100015378
1672 Ga0068855_100017810
1673 Ga0068855_100070969
1674 Ga0068855_100083657
1675 Ga0068855_100100241
1676 Ga0068855_100103616
1677 Ga0070664_100000002
1678 Ga0070664_100039941
1679 Ga0068857_100000319
1680 Ga0068857_100017815
1681 Ga0068857_100051279
1682 Ga0068857_100060592
1683 Ga0068854_100000004
1684 Ga0068854_100001263
1685 Ga0068854_100001277
1686 Ga0068854_100001665
1687 Ga0068854_100009142
1688 Ga0068854_100100631
1689 Ga0068856_100000294
1690 Ga0068856_100000652
1691 Ga0068856_100038570
1692 Ga0068856_100087423
1693 Ga0068856_100109459
1694 Ga0070702_100000240
1695 Ga0068859_100004628
1696 Ga0068859_100107514
1697 Ga0068864_100068644
1698 Ga0068861_100000550
1699 Ga0068851_10069478
1700 Ga0068858_100004085
1701 Ga0068858_100064675
1702 Ga0068858_100424330
1703 Ga0068860_100004596
1704 Ga0068862_100001897
1705 Ga0068862_100006699
1706 Ga0068862_100051032
1707 Ga0081539_10000799
1708 Ga0075363_100099372
1709 Ga0075364_10007608
1710 Ga0075364_10008631
1711 Ga0075364_10011929
1712 Ga0075364_10013464
1713 Ga0075366_10009542
1714 Ga0075366_10037583
1715 Ga0097621_100011829
1716 Ga0075370_10001703
1717 Ga0075370_10002804
1718 Ga0075370_10025086
1719 Ga0068871_100000788
1720 Ga0068871_100001073
1721 Ga0075428_100003728
1722 Ga0075430_100002931
1723 Ga0075431_100269744
1724 Ga0075433_10003313
1725 Ga0075433_10042452
1726 Ga0075434_100000004
1727 Ga0075434_100001086
1728 Ga0075434_100019492
1729 Ga0075434_100037923
1730 Ga0075429_100000051
1731 Ga0068865_100001146
1732 Ga0075436_100000331
1733 Ga0075436_100004918
1734 Ga0075436_100010269
1735 Ga0075436_100047384
1736 Ga0097620_100004627
1737 Ga0097620_100107510
1738 Ga0079104_1000277
1739 Ga0099826_10000015
1740 Ga0075435_100000313
1741 Ga0075435_100001505
1742 Ga0075435_100022664
1743 Ga0105251_10000285
1744 Ga0105251_10001199
1745 Ga0105251_10038759
1746 Ga0105244_10079081
1747 Ga0105250_10007579
1748 Ga0105240_10000569
1749 Ga0105240_10002163
1750 Ga0105240_10019895
1751 Ga0105240_10021079
1752 Ga0105240_10032831
1753 Ga0105240_10038140
1754 Ga0105240_10094721
1755 Ga0105240_10206703
1756 Ga0105240_10292316
1757 Ga0111539_10035356
1758 Ga0111539_10043746
1759 Ga0105245_10002454
1760 Ga0114129_10000337
1761 Ga0105243_10000420
1762 Ga0105243_10000915
1763 Ga0105243_10005794
1764 Ga0105241_10034467
1765 Ga0105241_10042520
1766 Ga0105242_10000945
1767 Ga0105242_10008348
1768 Ga0105242_10021199
1769 Ga0105248_10271656
1770 Ga0105237_10000007
1771 Ga0105237_10000307
1772 Ga0105237_10030111
1773 Ga0105237_10080514
1774 Ga0105238_10000318
1775 Ga0105238_10014850
1776 Ga0105238_10034564
1777 Ga0105238_10213812
1778 Ga0105238_10214663
1779 Ga0105249_10000975
1780 Ga0105249_10024517
1781 Ga0105239_10000020
1782 Ga0105239_10001532
1783 Ga0105239_10033387
1784 Ga0105239_10059727
1785 Ga0157373_10005940
1786 Ga0157373_10009391
1787 Ga0157373_10035191
1788 Ga0157373_10078366
1789 Ga0157373_10199743
1790 Ga0157371_10004477
1791 Ga0157371_10007599
1792 Ga0157371_10017438
1793 Ga0157371_10039981
1794 Ga0157370_10000371
1795 Ga0157370_10007267
1796 Ga0157370_10012327
1797 Ga0157370_10022546
1798 Ga0157370_10027521
1799 Ga0157370_10035086
1800 Ga0157370_10038942
1801 Ga0157370_10105641
1802 Ga0157370_10124192
1803 Ga0157369_10000252
1804 Ga0157369_10002784
1805 Ga0157369_10007899
1806 Ga0157369_10107132
1807 Ga0157369_10168483
1808 Ga0157369_10191474
1809 Ga0157369_10281095
1810 Ga0157374_10000345
1811 Ga0157378_10000844
1812 Ga0163162_10001066
1813 Ga0157372_10008893
1814 Ga0157372_10017693
1815 Ga0157372_10181794
1816 Ga0157372_10196929
1817 Ga0157375_10028666
1818 Ga0157375_10315464
1819 Ga0182008_10004246
1820 Ga0182008_10004498
1821 Ga0182008_10006040
1822 Ga0182008_10021058
1823 Ga0182008_10042688
1824 Ga0157376_10064579
1825 Ga0157376_10066813
1826 Ga0182006_1000162
1827 Ga0182006_1000541
1828 Ga0182006_1001661
1829 Ga0182006_1002604
1830 Ga0182006_1013148
1831 Ga0182006_1049379
1832 Ga0182007_10011944
1833 Ga0182007_10021806
1834 Ga0182005_1000322
1835 Ga0182005_1000365
1836 Ga0182005_1005337
1837 Ga0182005_1010521
1838 Ga0183362_10001
1839 Ga0183368_1003
1840 Ga0183361_10025
1841 Ga0206351_10556100
1842 Ga0206350_10021063
1843 Ga0154015_1099906
1844 Ga0213872_10003677
1845 Ga0213872_10009907
1846 Ga0224712_10012474
1847 Ga0209435_100016
1848 Ga0209435_100038
1849 Ga0209435_100932
1850 Ga0209435_105321
1851 Ga0209760_101097
1852 Ga0209784_100002
1853 Ga0209784_100003
1854 Ga0209784_100068
1855 Ga0209784_100069
1856 Ga0209784_100293
1857 Ga0209784_100573
1858 Ga0209566_100002
1859 Ga0209566_100003
1860 Ga0209566_100083
1861 Ga0209566_100535
1862 Ga0209566_100561
1863 Ga0209674_100004
1864 Ga0209674_100008
1865 Ga0209674_100012
1866 Ga0209674_100013
1867 Ga0209674_100106
1868 Ga0209674_100122
1869 Ga0209674_100148
1870 Ga0209674_100336
1871 Ga0209674_100424
1872 Ga0209672_100005
1873 Ga0209672_100010
1874 Ga0209672_100019
1875 Ga0209672_100045
1876 Ga0209672_100051
1877 Ga0209672_100100
1878 Ga0209672_100350
1879 Ga0209672_100386
1880 Ga0209672_100676
1881 Ga0209672_101672
1882 Ga0209147_100002
1883 Ga0209147_100006
1884 Ga0209147_100023
1885 Ga0209147_100026
1886 Ga0209147_100192
1887 Ga0209147_100308
1888 Ga0209147_104223
1889 Ga0209563_100004
1890 Ga0209563_100006
1891 Ga0209563_100023
1892 Ga0209563_100100
1893 Ga0209563_101103
1894 Ga0207427_100069
1895 Ga0207427_100139
1896 Ga0207427_100140
1897 Ga0207427_100216
1898 Ga0207427_100279
1899 Ga0207427_101443
1900 Ga0209437_100139
1901 Ga0209437_100147
1902 Ga0209437_100154
1903 Ga0209437_100156
1904 Ga0209437_100166
1905 Ga0209437_100462
1906 Ga0209437_100463
1907 Ga0209258_100002
1908 Ga0209258_100006
1909 Ga0209258_100010
1910 Ga0209258_100024
1911 Ga0209258_100031
1912 Ga0209258_100111
1913 Ga0209258_100200
1914 Ga0209258_100358
1915 Ga0209258_100360
1916 Ga0209258_100368
1917 Ga0209258_100992
1918 Ga0209258_101914
1919 Ga0209646_1000022
1920 Ga0209646_1000033
1921 Ga0209646_1000093
1922 Ga0209646_1001402
1923 Ga0209026_1000031
1924 Ga0209026_1000074
1925 Ga0209026_1000099
1926 Ga0209026_1000145
1927 Ga0209026_1000914
1928 Ga0209026_1001383
1929 Ga0209026_1003446
1930 Ga0209677_100003
1931 Ga0209677_100013
1932 Ga0209677_100061
1933 Ga0209677_103892
1934 Ga0209148_1000002
1935 Ga0209148_1000009
1936 Ga0209148_1000010
1937 Ga0209148_1000012
1938 Ga0209148_1000018
1939 Ga0209148_1000021
1940 Ga0209148_1000027
1941 Ga0209148_1000045
1942 Ga0209148_1000099
1943 Ga0209148_1000400
1944 Ga0209148_1001095
1945 Ga0209759_1000045
1946 Ga0209759_1000110
1947 Ga0209759_1000147
1948 Ga0209759_1000247
1949 Ga0209759_1000248
1950 Ga0209759_1000605
1951 Ga0209759_1000804
1952 Ga0209759_1001732
1953 Ga0209759_1001830
1954 Ga0209759_1003030
1955 Ga0209759_1003860
1956 Ga0209233_1000009
1957 Ga0209233_1000083
1958 Ga0209233_1000092
1959 Ga0209233_1000135
1960 Ga0209233_1000165
1961 Ga0209233_1000191
1962 Ga0209233_1000251
1963 Ga0209455_1000008
1964 Ga0209455_1000015
1965 Ga0209455_1000021
1966 Ga0209455_1000029
1967 Ga0209455_1000035
1968 Ga0209455_1000086
1969 Ga0209455_1000213
1970 Ga0209455_1000357
1971 Ga0209455_1000601
1972 Ga0209455_1001659
1973 Ga0209455_1015391
1974 Ga0209673_1000201
1975 Ga0209130_1002165
1976 Ga0209675_1001328
1977 Ga0209675_1001337
1978 Ga0209675_1018295
1979 Ga0209676_1000012
1980 Ga0209676_1004421
1981 Ga0209025_1000003
1982 Ga0209025_1000542
1983 Ga0209025_1000759
1984 Ga0209025_1003675
1985 Ga0209564_1002863
1986 Ga0209564_1004321
1987 Ga0209564_1009861
1988 Ga0209758_1000276
1989 Ga0209758_1029993
1990 Ga0209050_1001429
1991 Ga0209256_1000233
1992 Ga0207426_1000240
1993 Ga0207696_1008775
1994 Ga0207713_1002521
1995 Ga0207713_1003615
1996 Ga0207653_10035802
1997 Ga0207692_10023211
1998 Ga0207688_10063812
1999 Ga0207688_10067752
2000 Ga0207680_10047607
2001 Ga0207647_10000967
2002 Ga0207647_10001769
2003 Ga0207647_10005750
2004 Ga0207647_10016575
2005 Ga0207647_10027795
2006 Ga0207647_10030691
2007 Ga0207647_10057514
2008 Ga0207645_10036717
2009 Ga0207645_10071922
2010 Ga0207643_10012639
2011 Ga0207705_10002820
2012 Ga0207705_10054416
2013 Ga0207705_10133484
2014 Ga0207654_10081748
2015 Ga0207707_10015319
2016 Ga0207707_10017802
2017 Ga0207707_10094667
2018 Ga0207695_10000408
2019 Ga0207695_10001214
2020 Ga0207695_10002857
2021 Ga0207695_10003147
2022 Ga0207695_10004759
2023 Ga0207695_10006780
2024 Ga0207695_10007664
2025 Ga0207695_10015832
2026 Ga0207695_10024607
2027 Ga0207695_10056224
2028 Ga0207695_10094999
2029 Ga0207671_10000031
2030 Ga0207671_10000074
2031 Ga0207671_10005183
2032 Ga0207671_10069245
2033 Ga0207671_10116680
2034 Ga0207660_10000870
2035 Ga0207660_10300652
2036 Ga0207662_10000233
2037 Ga0207657_10000001
2038 Ga0207657_10062545
2039 Ga0207649_10000019
2040 Ga0207649_10026321
2041 Ga0207652_10059949
2042 Ga0207652_10103217
2043 Ga0207652_10199926
2044 Ga0207681_10001251
2045 Ga0207694_10003032
2046 Ga0207694_10014956
2047 Ga0207694_10038018
2048 Ga0207694_10041861
2049 Ga0207700_10006065
2050 Ga0207664_10000066
2051 Ga0207664_10000472
2052 Ga0207644_10054539
2053 Ga0207690_10000006
2054 Ga0207690_10000579
2055 Ga0207690_10001265
2056 Ga0207690_10007185
2057 Ga0207706_10055485
2058 Ga0207686_10001247
2059 Ga0207686_10001496
2060 Ga0207709_10000129
2061 Ga0207709_10000934
2062 Ga0207709_10003455
2063 Ga0207670_10003031
2064 Ga0207670_10009594
2065 Ga0207670_10029870
2066 Ga0207670_10060902
2067 Ga0207704_10000745
2068 Ga0207691_10027439
2069 Ga0207691_10118482
2070 Ga0207711_10181974
2071 Ga0207689_10002282
2072 Ga0207661_10108905
2073 Ga0207679_10000001
2074 Ga0207667_10000055
2075 Ga0207667_10000082
2076 Ga0207667_10000313
2077 Ga0207667_10012188
2078 Ga0207667_10013499
2079 Ga0207667_10028434
2080 Ga0207667_10047165
2081 Ga0207667_10066465
2082 Ga0207667_10078394
2083 Ga0207667_10100957
2084 Ga0207712_10002777
2085 Ga0207668_10022314
2086 Ga0207668_10033596
2087 Ga0207668_10036230
2088 Ga0207640_10000018
2089 Ga0207640_10000524
2090 Ga0207640_10009367
2091 Ga0207640_10013733
2092 Ga0207640_10052125
2093 Ga0207640_10052385
2094 Ga0207677_10010535
2095 Ga0207703_10004183
2096 Ga0207703_10046696
2097 Ga0207703_10055595
2098 Ga0207703_10233655
2099 Ga0207639_10106751
2100 Ga0207678_10000001
2101 Ga0207678_10000167
2102 Ga0207678_10008419
2103 Ga0207678_10089226
2104 Ga0207678_10090342
2105 Ga0207678_10134977
2106 Ga0207708_10000625
2107 Ga0207702_10000009
2108 Ga0207702_10003312
2109 Ga0207702_10063706
2110 Ga0207648_10002355
2111 Ga0207648_10004982
2112 Ga0207648_10095195
2113 Ga0207674_10000397
2114 Ga0207674_10010237
2115 Ga0207674_10017991
2116 Ga0207674_10347741
2117 Ga0207675_100001604
2118 Ga0207683_10111066
2119 Ga0207683_10232477
2120 Ga0207698_10014530
2121 Ga0207698_10065689
2122 Ga0209281_1000067
2123 Ga0209371_1000202
2124 Ga0209969_1004120
2125 Ga0209999_1003558
2126 Ga0209282_1000033
2127 Ga0209966_1006723
2128 Ga0209974_10001890
2129 Ga0207428_10000610
2130 Ga0268266_10008498
2131 Ga0268265_10001521
2132 Ga0268264_10004412
2133 Ga0307515_10004238
2134 Ga0265338_10000104
2135 Ga0265338_10002059
2136 Ga0268256_1000189
2137 Ga0265332_10000003
2138 Ga0307513_10056718
2139 Ga0307408_100000213
2140 Ga0307408_100074334
2141 Ga0307514_10001218
2142 Ga0316575_10007847
2143 Ga0316579_10004816
2144 Ga0307516_10173917
2145 Ga0307405_10082886
2146 Ga0307406_10000379
2147 Ga0307412_10000008
2148 Ga0307412_10000313
2149 Ga0307412_10047229
2150 Ga0307412_10110941
2151 Ga0307409_100054512
2152 Ga0307416_100073487
2153 Ga0307416_100144279
2154 Ga0307411_10127758
2155 Ga0373926_0016944
2156 Ga0373932_0005248
2157 Ga0373941_0010662
2158 Ga0373945_0020026
2159 Ga0373954_0000965
2160 Ga0373942_0005016
2161 Ga0373942_0016979
2162 Ga0373924_0009778
2163 Ga0373931_0000627
2164 Ga0373935_0036155
2165 Ga0373927_0008584
2166 Ga0373927_0178052
2167 Ga0373933_0001980
2168 Ga0373937_0001198
2169 Ga0373937_0063950
2170 Ga0373937_0157198
2171 Ga0316582_0002737
2172 Ga0316584_0071096
2173 Ga0373925_0018211
2174 Ga0395899_0000041
2175 Ga0395899_0000369
2176 Ga0395899_0009696
2177 Ga0395899_0029160
2178 Ga0395899_0031912
2179 Ga0395899_0149924
2180 Ga0395900_0000562
2181 Ga0395900_0000664
2182 Ga0395900_0000916
2183 Ga0395900_0001108
2184 Ga0395900_0001745
2185 Ga0395900_0004872
2186 Ga0395900_0006936
2187 Ga0395900_0024941
2188 Ga0395900_0129008
2189 Ga0395900_0154913
2190 Ga0395900_0240025
2191 Ga0395898_0000220
2192 Ga0395898_0000305
2193 Ga0395898_0000526
2194 Ga0395898_0002771
2195 Ga0395898_0004697
2196 Ga0395898_0012225
2197 Ga0395898_0075124
2198 Ga0395898_0082597
2199 Ga0395905_0000098
2200 Ga0316581_0012152
2201 Ga0395901_0000011
2202 Ga0395901_0000106
2203 Ga0395901_0000161
2204 Ga0395901_0000264
2205 Ga0395901_0014650
2206 Ga0395901_0025384
2207 Ga0395901_0033268
2208 Ga0395901_0131237
2209 Ga0237819_01026
2210 Ga0436361_0310873
2211 Ga0436361_0560628
2212 Ga0436361_0710630
2213 Ga0436361_0762834
2214 Ga0439436_0000014
2215 Ga0451800_1450092
2216 Ga0451806_187053
2217 Ga0451804_1026683
2218 Ga0451807_0623916
2219 Ga0451807_0695512
2220 Ga0451833_0182207
2221 Ga0451837_1319545
2222 Ga0439448_0000048
2223 Ga0439432_012194
2224 Ga0439432_022323
2225 Ga0439449_0002257
2226 Ga0439462_0002003
2227 Ga0451577_0003226
2228 Ga0451577_0049719
2229 Ga0451577_0300538
2230 Ga0466986_0105408
2231 Ga0466969_0006333
2232 Ga0466969_0091015
2233 Ga0466977_0000251
2234 Ga0466965_0017578
2235 Ga0466965_0045797
2236 Ga0466965_0046718
2237 Ga0466966_0000066
2238 Ga0466966_0001282
2239 Ga0466966_0001306
2240 Ga0466966_0002967
2241 Ga0466966_0014396
2242 Ga0466961_0000037
2243 Ga0466961_0001025
2244 Ga0466961_0001819
2245 Ga0466961_0002289
2246 Ga0466961_0004677
2247 Ga0466961_0011658
2248 Ga0466961_0064455
2249 Ga0466961_0075592
2250 Ga0466961_0133514
2251 Ga0466964_0001424
2252 Ga0453684_0001711
2253 Ga0453684_0062698
2254 Ga0453684_0246769
2255 Ga0453684_0395396
2256 Ga0466971_0002547
2257 Ga0466971_0008785
2258 Ga0466971_0015190
2259 Ga0466968_0001142
2260 Ga0466968_0060701
2261 Ga0466970_0000887
2262 Ga0466970_0003586
2263 Ga0466970_0013134
2264 Ga0466970_0026176
2265 Ga0466970_0026386
2266 Ga0466970_0028758
2267 Ga0466957_0001282
2268 Ga0466957_0003699
2269 Ga0466957_0008319
2270 Ga0466957_0100372
2271 Ga0466959_0005357
2272 Ga0466959_0007018
2273 Ga0466959_0014534
2274 Ga0466959_0046266
2275 Ga0466959_0048152
2276 Ga0466959_0054373
2277 Ga0466959_0081281
2278 Ga0466959_0083856
2279 Ga0451576_0002027
2280 Ga0451576_0004679
2281 Ga0451576_0026245
2282 Ga0466958_0004028
2283 Ga0466958_0007166
2284 Ga0466958_0134431
2285 Ga0466967_0003164
2286 Ga0495617_000111
2287 Ga0495617_001833
2288 Ga0495592_0013065
2289 Ga0495592_0013791
2290 Ga0495592_0022670
2291 Ga0495592_0057950
2292 Ga0495603_0001289
2293 Ga0495603_0001360
2294 Ga0495603_0008459
2295 Ga0495590_0001198
2296 Ga0495590_0005800
2297 Ga0495590_0017409
2298 Ga0495591_000725
2299 Ga0495629_0000060
2300 Ga0495629_0000293
2301 Ga0495629_0003084
2302 Ga0495629_0017918
2303 Ga0495629_0018305
2304 Ga0495629_0077372
2305 Ga0495638_0000007
2306 Ga0495638_0000194
2307 Ga0495638_0000213
2308 Ga0495638_0000233
2309 Ga0495638_0003136
2310 Ga0495641_0014068
2311 Ga0495651_0102892
2312 Ga0495653_0003467
2313 Ga0495653_0005778
2314 Ga0495653_0016113
2315 Ga0495653_0073499
2316 Ga0495653_0304932
2317 Ga0495650_0000202
2318 Ga0495650_0001534
2319 Ga0495650_0011836
2320 Ga0495580_0001266
2321 Ga0495580_0005292
2322 Ga0495580_0008660
2323 Ga0495580_0010730
2324 Ga0495580_0011714
2325 Ga0495580_0029784
2326 Ga0495580_0081955
2327 Ga0495580_0122362
2328 Ga0495582_0018162
2329 Ga0495605_0002472
2330 Ga0495605_0006472
2331 Ga0495605_0010487
2332 Ga0495605_0014637
2333 Ga0495639_0022457
2334 Ga0495662_0013598
2335 Ga0495664_0000037
2336 Ga0495664_0002112
2337 Ga0495585_0000001
2338 Ga0495585_0013436
2339 Ga0495596_0000377
2340 Ga0495596_0003512
2341 Ga0495596_0012343
2342 Ga0495607_0000207
2343 Ga0495607_0020058
2344 Ga0495607_0097329
2345 Ga0495583_0004094
2346 Ga0495583_0011411
2347 Ga0495583_0060148
2348 Ga0495583_0067470
2349 Ga0495606_0013496
2350 Ga0495606_0020990
2351 Ga0495606_0030227
2352 Ga0495606_0057067
2353 Ga0495608_0013992
2354 Ga0495608_0014412
2355 Ga0495610_0001239
2356 Ga0495610_0003199
2357 Ga0495610_0016416
2358 Ga0495616_0000001
2359 Ga0495616_0005323
2360 Ga0495616_0038609
2361 Ga0495618_0022475
2362 Ga0495620_0000543
2363 Ga0495620_0004657
2364 Ga0495620_0004864
2365 Ga0495628_0017213
2366 Ga0495628_0017598
2367 Ga0495628_0031750
2368 Ga0495628_0032413
2369 Ga0495628_0064539
2370 Ga0495630_0021089
2371 Ga0495630_0021345
2372 Ga0495630_0078420
2373 Ga0495631_0000162
2374 Ga0495631_0000178
2375 Ga0495632_0028520
2376 Ga0495632_0076308
2377 Ga0495637_0010613
2378 Ga0495648_0000083
2379 Ga0495648_0004219
2380 Ga0495648_0004279
2381 Ga0495648_0006831
2382 Ga0495666_0001031
2383 Ga0495666_0002120
2384 Ga0495666_0005456
2385 Ga0495666_0043671
2386 Ga0495666_0045532
2387 Ga0495642_0020554
2388 Ga0495642_0029585
2389 Ga0495652_0006254
2390 Ga0495652_0056816
2391 Ga0495654_0007716
2392 Ga0495665_0004316
2393 Ga0495665_0007236
2394 Ga0495665_0026691
2395 Ga0495640_0012094
2396 Ga0495640_0016641
2397 Ga0495640_0017401
2398 Ga0495640_0051427
2399 Ga0495640_0051890
2400 Ga0495586_0000599
2401 Ga0495586_0013939
2402 Ga0495586_0052758
2403 Ga0495587_0014914
2404 Ga0495609_0000905
2405 Ga0495609_0001698
2406 Ga0495597_0000446
2407 Ga0495597_0005687
2408 Ga0495597_0012031
2409 Ga0495645_0001629
2410 Ga0495645_0011409
2411 Ga0495645_0038518
2412 Ga0495645_0081136
2413 Ga0495645_0109253
2414 Ga0495645_0119406
2415 Ga0495622_0076098
2416 Ga0495622_0090880
2417 Ga0495633_0033170
2418 Ga0495667_0059602
2419 Ga0495668_0011617
2420 Ga0495634_0133825
2421 Ga0495611_0000001
2422 Ga0495611_0001164
2423 Ga0495625_0000001
2424 Ga0495625_0001424
2425 Ga0495625_0047787
2426 Ga0495635_0072251
2427 Ga0495635_0111910
2428 Ga0495661_0001053
2429 Ga0495661_0020112
2430 Ga0495657_0036580
2431 Ga0495599_0007027
2432 Ga0495599_0014004
2433 Ga0495599_0017978
2434 Ga0495623_0040503
2435 Ga0495623_0074231
2436 Ga0495646_0004989
2437 Ga0495646_0005973
2438 Ga0495646_0012055
2439 Ga0495646_0014953
2440 Ga0495646_0016450
2441 Ga0495658_0002184
2442 Ga0495658_0089631
2443 Ga0495669_0088224
2444 Ga0495613_0019153
2445 Ga0495624_0005054
2446 Ga0495624_0019642
2447 Ga0495624_0022859
2448 Ga0495624_0026366
2449 Ga0495624_0039331
2450 Ga0495624_0051628
2451 Ga0495624_0063927
2452 Ga0495670_0002966
2453 Ga0495670_0018062
2454 Ga0495671_0000723
2455 Ga0495671_0001770
2456 Ga0495649_0003681
2457 Ga0495649_0016295
2458 Ga0495649_0039743
2459 Ga0495589_0000314
2460 Ga0495589_0005460
2461 Ga0495600_0005463
2462 Ga0495600_0005952
2463 Ga0495600_0027891
2464 Ga0495600_0075733
2465 Ga0495660_0000008
2466 Ga0495660_0000180
2467 Ga0495660_0016577
2468 Ga0495581_0004067
2469 Ga0495581_0016353
2470 Ga0495581_0022296
2471 Ga0495604_0003896
2472 Ga0495604_0027657
2473 Ga0495604_0078425
2474 Ga0495604_0086440
2475 Ga0495604_0106357
2476 Ga0495636_0003528
2477 Ga0495674_0004951
2478 Ga0495674_0020282
2479 Ga0495672_0002823
2480 Ga0495672_0023096
2481 Ga0495676_0004601
2482 Ga0495676_0114356
2483 Ga0495680_0004438
2484 Ga0495680_0023501
2485 Ga0495680_0035180
2486 Ga0495680_0082652
2487 Ga0495683_0001386
2488 Ga0495683_0010882
2489 Ga0495683_0013641
2490 Ga0495683_0023985
2491 Ga0495683_0080169
2492 Ga0495687_000025
2493 Ga0495687_007690
2494 Ga0495675_0013400
2495 Ga0495679_000001
2496 Ga0495679_000038
2497 Ga0495679_001513
2498 Ga0495679_013297
2499 Ga0495673_0000001
2500 Ga0495673_0000030
2501 Ga0495673_0000232
2502 Ga0495686_0000077
2503 Ga0495686_0007428
2504 Ga0495686_0028109
2505 Ga0495686_0040502
2506 Ga0495593_0010609
2507 Ga0495593_0049793
2508 Ga0495602_0003086
2509 Ga0495602_0013165
2510 Ga0495602_0065068
2511 Ga0495602_0133850
2512 Ga0495614_0003454
2513 Ga0495614_0022447
2514 Ga0495626_0029076
2515 Ga0496100_0001557
2516 Ga0496100_0002914
2517 Ga0496100_0007357
2518 Ga0496101_0000612
2519 Ga0496101_0001266
2520 Ga0496101_0015890
2521 Ga0496101_0146682
2522 Ga0496102_0000459
2523 Ga0496102_0005874
2524 Ga0496102_0011545
2525 Ga0496102_0066635
2526 Ga0496102_0107158
2527 Ga0496103_0000337
2528 Ga0496103_0009338
2529 Ga0496104_0137350
2530 Ga0496105_0017452
2531 Ga0496105_0111779
2532 Ga0496105_0147632
2533 Ga0496106_0000019
2534 Ga0496106_0001680
2535 Ga0496106_0039738
2536 Ga0496110_0001369
2537 Ga0496111_0009674
2538 Ga0496112_0006477
2539 Ga0496113_0002111
2540 Ga0496114_0063683
2541 Ga0496115_0000337
2542 Ga0496115_0000901
2543 Ga0496116_0012476
2544 Ga0496116_0016236
2545 Ga0496116_0021645
2546 Ga0496116_0031133
2547 Ga0496116_0037807
2548 Ga0496116_0080352
2549 Ga0496117_0002293
2550 Ga0496117_0004900
2551 Ga0496117_0014213
2552 Ga0496117_0021313
2553 Ga0496117_0027009
2554 Ga0496117_0028072
2555 Ga0496117_0032699
2556 Ga0496117_0110476
2557 Ga0496118_0000420
2558 Ga0496118_0002548
2559 Ga0496118_0010050
2560 Ga0496118_0020384
2561 Ga0496118_0030492
2562 Ga0496118_0031291
2563 Ga0496118_0047912
2564 Ga0496118_0184817
2565 Ga0496119_0000058
2566 Ga0496119_0019951
2567 Ga0496119_0057847
2568 Ga0496120_0000184
2569 Ga0496120_0000335
2570 Ga0496120_0014808
2571 Ga0496121_0000306
2572 Ga0496121_0000310
2573 Ga0496121_0000431
2574 Ga0496121_0001587
2575 Ga0496121_0003917
2576 Ga0496121_0006654
2577 Ga0496121_0007409
2578 Ga0496121_0032998
2579 Ga0496121_0036205
2580 Ga0496121_0059448
2581 Ga0496121_0083972
2582 Ga0496121_0088612
2583 Ga0496122_0000375
2584 Ga0496122_0000865
2585 Ga0496122_0006359
2586 Ga0496122_0007677
2587 Ga0496122_0084897
2588 Ga0496123_0000203
2589 Ga0496123_0000267
2590 Ga0496123_0001951
2591 Ga0496123_0007642
2592 Ga0496123_0122905
2593 Ga0496124_0000046
2594 Ga0496124_0014584
2595 Ga0496125_0000011
2596 Ga0496125_0000499
2597 Ga0496125_0002855
2598 Ga0496125_0020330
2599 Ga0496126_0000034
2600 Ga0496126_0000706
2601 Ga0496126_0002194
2602 Ga0496126_0002232
2603 Ga0496126_0009476
2604 Ga0496126_0015371
2605 Ga0496126_0016049
2606 Ga0496126_0028263
2607 Ga0496126_0108462
2608 Ga0496126_0119748
2609 Ga0496126_0243371
2610 Ga0495678_000023
2611 Ga0495678_018904
2612 Ga0495682_0005399
2613 Ga0495682_0006472
2614 Ga0501031_0014372
2615 Ga0501032_0012518
2616 Ga0501033_0002347
2617 Ga0501033_0007556
2618 Ga0501033_0144939
2619 Ga0501034_0000268
2620 Ga0501034_0014340
2621 Ga0501034_0028679
2622 Ga0501036_0047363
2623 Ga0501036_0071739
2624 Ga0501036_0174845
2625 Ga0501036_0263525
2626 Ga0501037_0002084
2627 Ga0501038_0018830
2628 Ga0501038_0218532
2629 Ga0501038_0220105
2630 Ga0501038_0227818
2631 Ga0501039_0016403
2632 Ga0501039_0058323
2633 Ga0501040_0008966
2634 Ga0501040_0011763
2635 Ga0501040_0162859
2636 Ga0501041_0138624
2637 Ga0501042_0006589
2638 Ga0501042_0056597
2639 Ga0501043_0053884
2640 Ga0501046_0076996
2641 Ga0501047_0002786
2642 Ga0501047_0046666
2643 Ga0501047_0047030
2644 Ga0501048_0102808
2645 Ga0501048_0109594
2646 Ga0501067_0047374
2647 Ga0501070_0000201
2648 Ga0501070_0010763
2649 Ga0501072_0096425
2650 Ga0501072_0268942
2651 Ga0501075_0040394
2652 Ga0501075_0073090
2653 Ga0501075_0243628
2654 Ga0501076_0011826
2655 Ga0501076_0017868
2656 Ga0501076_0104755
2657 Ga0501076_0190485
2658 Ga0501079_0028464
2659 Ga0501080_0082829
2660 Ga0501081_0001856
2661 Ga0501081_0006018
2662 Ga0501081_0033190
2663 Ga0501035_0012600
2664 Ga0501035_0037213
2665 Ga0501035_0072502
2666 Ga0501035_0127926
2667 Ga0501044_0000076
2668 Ga0501044_0002174
2669 Ga0501044_0003619
2670 Ga0501044_0004747
2671 Ga0501044_0007876
2672 Ga0501044_0014630
2673 Ga0501044_0106789
2674 Ga0501044_0110316
2675 Ga0501045_0002662
2676 Ga0501045_0102389
2677 nmdc:mga03n38_24395_c1
2678 nmdc:mga00v17_109959_c1
2679 nmdc:mga00v17_16444_c1
2680 nmdc:mga00v17_7113_c1
2681 nmdc:mga0yw44_133339_c1
2682 nmdc:mga0k408_173163_c1
2683 nmdc:mga0k408_4449_c1
2684 nmdc:mga07m45_33869_c1
2685 nmdc:mga07m45_3597_c1
2686 nmdc:mga07m45_76859_c1
2687 nmdc:mga05p37_758_c1
2688 nmdc:mga09592_1050_c1
2689 nmdc:mga09592_110466_c1
2690 nmdc:mga0qj67_2437_c1
2691 nmdc:mga0qj67_32479_c1
2692 nmdc:mga0qj67_36310_c1
2693 nmdc:mga0qj67_8037_c1
2694 nmdc:mga06r32_5201_c1
2695 nmdc:mga08y16_166325_c1
2696 nmdc:mga08y16_22033_c1
2697 nmdc:mga08y16_254907_c1
2698 nmdc:mga0n895_1569_c1
2699 nmdc:mga0n895_2878_c1
2700 nmdc:mga0n895_47507_c1
2701 nmdc:mga0rr50_2095_c1
2702 nmdc:mga08x19_1254_c1
2703 nmdc:mga08x19_16509_c1
2704 nmdc:mga08x19_16751_c1
2705 nmdc:mga08x19_303_c1
2706 nmdc:mga08x19_48686_c1
2707 nmdc:mga0a205_147036_c1
2708 nmdc:mga0a205_27603_c1
2709 nmdc:mga0a205_599_c1
2710 Ga0495601_0011862
2711 Ga0500610_0000821
2712 Ga0495619_0063625
2713 Ga0500643_000002
2714 Ga0500555_000716
2715 Ga0500593_000835
2716 Ga0500595_001911
2717 Ga0500607_001548
2718 Ga0500618_000877
2719 Ga0500618_001593
2720 Ga0500618_005380
2721 Ga0500652_079452
2722 Ga0500574_005155
2723 Ga0500600_0012736
2724 Ga0500627_0069699
2725 Ga0500633_0001927
2726 Ga0500645_000704
2727 Ga0501084_0144421
2728 Ga0501082_0016248
2729 Ga0501082_0130687
2730 Ga0466962_0000994
2731 Ga0466962_0008295
2732 Ga0530510_0007953
2733 2501073341
2734 2501082663
2735 2501408403
2736 2509132288
2737 2510251804
2738 2511086004
2739 2511096138
2740 2511103139
2741 2511248956
2742 2511387491
2743 2512345227
2744 2513563427
2745 2513956525
2746 2513961449
2747 2514044194
2748 2514050936
2749 2515684318
2750 2515691611
2751 2516022437
2752 2519458237
2753 2521557584
2754 2527080748
2755 2538833115
2756 2548501096
2757 2550696232
2758 2553006612
2759 2563059230
2760 2585294710
2761 2597028872
2762 2599445560
2763 2599738098
2764 2599742530
2765 2599903203
2766 2600204648
2767 2600810828
2768 2643831586
2769 2643862305
2770 2643866797
2771 2643893955
2772 2643980669
2773 2643993519
2774 2644062638
2775 2644076348
2776 2644122097
2777 2644294656
2778 2644476174
2779 2644645810
2780 2676741634
2781 2713479837
2782 2719640915
2783 2722882785
2784 2723876549
2785 2735836770
2786 2738818999
2787 2738830845
2788 2738872372
2789 2739184002
2790 2739218972
2791 2739228686
2792 2739244678
2793 2739252239
2794 2739612173
2795 2739732001
2796 2746088176
2797 2746096930
2798 2748019447
2799 2753571040
2800 2765570251
2801 2792834002
2802 2808970007
2803 2808984390
2804 2809005146
2805 2809011713
2806 2809032014
2807 2809130744
2808 2809149778
2809 2816475119
2810 2817260388
2811 2817278076
2812 2817455643
2813 2819544245
2814 2819591419
2815 2819615276
2816 2819623564
2817 2819632914
2818 2834644904
2819 2839096804
2820 2839138516
2821 2842325092
2822 2842349370
2823 2842459888
2824 2842719770
2825 2842918932
2826 2852620081
2827 2852687714
2828 2855734619
2829 2855770209
2830 2857361004
2831 2857538493
2832 2857546604
2833 2858955765
2834 2863421925
2835 2870072133
2836 2881414430
2837 2883088027
2838 2884340366
2839 2884413860
2840 2884812895
2841 2884812901
2842 2884837223
2843 2884853514
2844 2885266779
2845 2885271087
2846 2887377871
2847 2894026031
2848 2895397007
2849 2895501385
2850 2895514528
2851 2895523990
2852 2895527478
2853 2896155369
2854 2900578647
2855 2900637816
2856 2901312876
2857 2902687098
2858 2904436949
2859 2904441706
2860 2904463563
2861 2904480842
2862 2904487413
2863 2904531372
2864 2904566090
2865 2904573134
2866 2904586973
2867 2904592994
2868 2904603193
2869 2904623551
2870 2919050987
2871 2919082044
2872 2919405256
2873 2919528720
2874 2921648338
2875 2923516281
2876 2928062895
2877 2928110849
2878 2928135075
2879 2928137593
2880 2928159494
2881 2928164446
2882 2928177570
2883 2928510229
2884 2928538344
2885 2928964694
2886 2939614199
2887 2939631547
2888 2941481907
2889 2945937679
2890 2974323846
2891 2981993928
2892 2990705603
2893 2990712755
2894 642427189
2895 642417817
2896 642592578
2897 642622500
2898 644748408
2899 8002395026
2900 8003401744
2901 8003957814
2902 8018850359
2903 8020808859
2904 8020939385
2905 8020947212
2906 8020954391
2907 8021122821
2908 8039102758
2909 8040169310
2910 8040174987
2911 8048749749
2912 8055227965
2913 8055266965
2914 8055301719

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04095

NAPRTase

Nicotinate phosphoribosyltransferase (NAPRTase) family

243

470

0.99

PF17767

NAPRTase_N

Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain

86

207

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl7-assembly2.cif.gz_B crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae 0.9606 1 389
3os4-assembly1.cif.gz_A the crystal structure of nicotinate phosphoribosyltransferase from yersinia pestis 0.9589 2 389
4hl7-assembly2.cif.gz_B crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae 0.9582 1 389
1yir-assembly3.cif.gz_C crystal structure of a nicotinate phosphoribosyltransferase 0.9563 1 388
4hl7-assembly1.cif.gz_A crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae 0.9562 2 389
ID Description Score Start End Superfamily
af_P18133_1_400_3.20.140.10 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.9575 2 389 3.20.140.10
af_P18133_1_400_3.20.140.10 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.9502 2 389 3.20.140.10
2im5B00 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.9435 2 388 3.20.140.10
1ybeA00 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.9335 2 389 3.20.140.10
4hl7A00 Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase 0.9304 2 389 3.20.140.10
ID Description Score Start End GO Terms
AF-A0A158K0P2-F1-model_v4 Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) 0.995 1 389 GO:0004516
GO:0005829
GO:0016757
GO:0034355
AF-A0A2R7J1X4-F1-model_v4 deleted 0.9947 2 133
AF-A0A5E4WZV9-F1-model_v4 Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) 0.9945 1 389 GO:0004516
GO:0005829
GO:0016757
GO:0034355
AF-A0A846UPW0-F1-model_v4 Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) 0.9935 1 389 GO:0004516
GO:0005829
GO:0016757
GO:0034355
AF-A0A3R8NDJ0-F1-model_v4 Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) 0.9932 1 389 GO:0004516
GO:0005829
GO:0016757
GO:0034355

Map