F494099
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1457 | 658 | 2914 | 395 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0000032|Ga0495686_0000032_132055_133482 |
| Length | 475 |
| Sequence | MDAGMPRAGCPASAGASVGAALRLGTSGNMHFEAAGAQQPVHVSALYRAALLPTVSACGFSRGFLPGGSIRCTSRSSGTMIIHSLLDTDLYKFTMMQVVLHHFPAAHAEYKFRCRTQGVDLVPYIDEIREEVRALCQLRFTEDELEYLRRMRFIKSDFIDFLALFHLNEKLVTIKPSAKNNGEIDIDIVGPWLHTILFEIPVLAIVNEVYFRNTQRDPTFETGRDRLRDKIELLGGRPEVSDCKIADYGTRRRFSGKWHEEVILKLKEGLGEQFTGTSNVYYAMKHGLRPLGTMAHEYLQACQALGPRLRDSQVFGFEMWAKEYRGDLGIALSDVYGMKAFLNDFDMYFCKLFDGARHDSGDPFDWGERLIRHYEQNRCDPRTKVLVFSDALDIPKVLRLYERFRGRCQLAFGVGTNLTNDLGYQPLQIVIKMVRCNGQPVAKLSDSPGKNMCEDQAYLAYLRQVFDIAKPVGEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 9 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 10 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 100 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 105 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 106 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 107 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 108 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 109 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 110 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 111 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 115 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 147 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 148 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 149 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 153 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 170 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 246 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 249 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 250 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 251 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 252 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 253 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 259 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 260 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 269 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 272 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 273 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 279 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 280 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 281 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 282 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 283 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 288 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 289 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 290 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 291 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 292 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 293 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 294 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 295 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 296 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 297 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 298 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 299 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 300 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 301 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 302 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 303 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 304 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 305 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 306 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 307 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 308 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 309 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 310 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 396 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 397 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 398 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 399 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 400 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 401 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 402 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 403 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 404 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 405 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 406 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 407 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 408 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 409 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 410 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 413 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 414 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 415 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 416 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 417 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 446 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 447 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 448 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 449 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 450 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 454 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 455 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 456 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 457 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 458 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 463 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 464 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 465 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 466 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 467 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 468 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 469 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 470 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 471 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 472 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 473 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 474 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 477 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 478 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 479 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 480 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 481 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 482 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 483 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 484 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 485 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 486 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 487 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 488 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 489 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 490 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 491 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 492 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 493 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 494 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 495 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 496 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 497 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 498 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 499 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 500 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 501 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 502 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 503 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 504 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 505 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 506 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 507 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 508 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 509 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 510 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 511 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 512 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 513 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 514 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 515 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 516 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 517 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 518 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 519 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 520 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 521 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 522 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 523 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 524 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 525 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 526 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 527 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 528 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 529 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 530 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 531 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 532 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 533 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 534 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 535 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 536 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 537 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 538 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 539 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 540 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 541 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 542 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 543 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 544 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 545 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 546 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 547 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 548 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 549 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 550 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 551 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 552 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 553 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 554 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 555 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 556 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 557 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 558 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 559 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 560 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 561 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 562 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 563 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 564 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 565 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 566 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 567 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 568 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 569 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 570 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 571 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 572 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 573 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 574 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 575 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 576 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 577 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 578 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 579 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 580 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 581 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 582 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 583 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 584 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 585 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 586 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 587 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 588 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 589 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 590 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 591 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 592 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 593 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 594 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 595 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 596 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 597 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 598 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 599 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 600 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 601 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 602 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 603 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 604 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 605 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 606 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 607 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 608 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 609 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 610 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 611 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 612 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 613 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 614 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 615 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 616 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 617 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 618 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 619 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 620 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 621 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 622 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 623 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 624 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 625 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 626 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 627 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 628 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 629 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 630 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 631 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 632 | 2941479691 | |||
| 633 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 634 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 635 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 636 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 637 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 638 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 639 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 640 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 641 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 642 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 643 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 644 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 645 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 646 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 647 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 648 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 649 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 650 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 651 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 652 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 653 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 654 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 655 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 656 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 657 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 658 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.23 |
| Metatranscriptomes | 0.27 |
| Isolates | 12.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.4 |
| Nodule | 2.26 |
| Rhizoplane | 2.75 |
| Rhizosphere | 63.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495686_0000032 | 3300047472 | Bacteria | 345132 |
| 2 | JGI24741J21665_1000010 | 3300001915 | Bacteria | 44368 |
| 3 | JGI24740J21852_10000304 | 3300001979 | Bacteria | 20859 |
| 4 | JGI24740J21852_10000783 | 3300001979 | Bacteria | 13957 |
| 5 | JGI24740J21852_10000978 | 3300001979 | Bacteria | 12756 |
| 6 | JGI24740J21852_10003282 | 3300001979 | Bacteria | 7132 |
| 7 | JGI24739J22299_10000112 | 3300001989 | Bacteria | 25198 |
| 8 | JGI24739J22299_10003808 | 3300001989 | Bacteria | 5756 |
| 9 | JGI24739J22299_10013313 | 3300001989 | Bacteria | 3005 |
| 10 | JGI24739J22299_10025297 | 3300001989 | Bacteria | 2088 |
| 11 | JGI24737J22298_10012110 | 3300001990 | Bacteria | 2816 |
| 12 | JGI24737J22298_10023387 | 3300001990 | Bacteria | 1961 |
| 13 | JGI24735J21928_10000665 | 3300002067 | Bacteria | 12156 |
| 14 | JGI24735J21928_10000684 | 3300002067 | Bacteria | 12013 |
| 15 | JGI24735J21928_10011596 | 3300002067 | Bacteria | 2792 |
| 16 | JGI24735J21928_10018786 | 3300002067 | Bacteria | 2129 |
| 17 | JGI24735J21928_10035330 | 3300002067 | Bacteria | 1470 |
| 18 | JGI24738J21930_10001352 | 3300002075 | Bacteria | 6801 |
| 19 | JGI25155J39150_1000126 | 3300002704 | Bacteria | 37345 |
| 20 | JGI25155J39150_1000177 | 3300002704 | Bacteria | 27568 |
| 21 | JGI25156J39149_1000057 | 3300002705 | Bacteria | 86392 |
| 22 | JGI25156J39149_1000214 | 3300002705 | Bacteria | 40310 |
| 23 | JGI25156J39149_1001009 | 3300002705 | Bacteria | 13255 |
| 24 | JGI25156J39149_1001319 | 3300002705 | Bacteria | 10730 |
| 25 | JGI25156J39149_1002562 | 3300002705 | Bacteria | 6442 |
| 26 | JGI25156J39149_1002845 | 3300002705 | Bacteria | 5954 |
| 27 | JGI25156J39149_1005837 | 3300002705 | Bacteria | 3474 |
| 28 | JGI25156J39149_1009942 | 3300002705 | Bacteria | 2272 |
| 29 | JGI25162J39368_1000138 | 3300002737 | Bacteria | 78713 |
| 30 | JGI25162J39368_1000443 | 3300002737 | Bacteria | 32916 |
| 31 | JGI25162J39368_1000786 | 3300002737 | Bacteria | 21328 |
| 32 | JGI25162J39368_1001136 | 3300002737 | Bacteria | 16004 |
| 33 | JGI25162J39368_1003039 | 3300002737 | Bacteria | 5460 |
| 34 | JGI25154J39366_1000087 | 3300002738 | Bacteria | 86392 |
| 35 | JGI25154J39366_1000206 | 3300002738 | Bacteria | 42302 |
| 36 | JGI25154J39366_1001056 | 3300002738 | Bacteria | 10926 |
| 37 | JGI25157J39369_1000156 | 3300002741 | Bacteria | 56715 |
| 38 | JGI25157J39369_1000172 | 3300002741 | Bacteria | 54469 |
| 39 | JGI25157J39369_1000441 | 3300002741 | Bacteria | 26541 |
| 40 | JGI25157J39369_1000643 | 3300002741 | Bacteria | 19536 |
| 41 | JGI25157J39369_1000992 | 3300002741 | Bacteria | 13276 |
| 42 | JGI25157J39369_1002371 | 3300002741 | Bacteria | 4808 |
| 43 | JGI25163J39215_1000278 | 3300002771 | Bacteria | 18020 |
| 44 | JGI25164J39214_1000170 | 3300002772 | Bacteria | 60952 |
| 45 | JGI25164J39214_1000310 | 3300002772 | Bacteria | 32075 |
| 46 | JGI25164J39214_1000375 | 3300002772 | Bacteria | 26542 |
| 47 | JGI25164J39214_1001368 | 3300002772 | Bacteria | 5880 |
| 48 | JGI25164J39214_1001375 | 3300002772 | Bacteria | 5841 |
| 49 | JGI25151J46595_10005080 | 3300003187 | Bacteria | 6844 |
| 50 | JGI25151J46595_10011877 | 3300003187 | Bacteria | 3985 |
| 51 | JGI25165J46597_1000105 | 3300003214 | Bacteria | 152144 |
| 52 | JGI25165J46597_1000224 | 3300003214 | Bacteria | 78713 |
| 53 | JGI25165J46597_1000549 | 3300003214 | Bacteria | 34283 |
| 54 | JGI25165J46597_1000580 | 3300003214 | Bacteria | 32075 |
| 55 | JGI25165J46597_1002481 | 3300003214 | Bacteria | 5880 |
| 56 | JGI25165J46597_1002491 | 3300003214 | Bacteria | 5841 |
| 57 | JGI25153J46596_10006045 | 3300003215 | Bacteria | 6219 |
| 58 | rootH1_10022880 | 3300003316 | Bacteria | 2980 |
| 59 | rootH2_10000174 | 3300003320 | Bacteria | 21671 |
| 60 | rootH2_10006665 | 3300003320 | Bacteria | 3330 |
| 61 | rootL2_10098200 | 3300003322 | Bacteria | 4242 |
| 62 | JGI25160J50197_1000082 | 3300003354 | Bacteria | 97878 |
| 63 | Ga0055538_1000043 | 3300003751 | Bacteria | 152144 |
| 64 | Ga0055538_1000045 | 3300003751 | Bacteria | 139066 |
| 65 | Ga0055538_1002105 | 3300003751 | Bacteria | 3167 |
| 66 | Ga0055539_1000034 | 3300003752 | Bacteria | 223400 |
| 67 | Ga0055539_1000057 | 3300003752 | Bacteria | 152144 |
| 68 | Ga0055539_1000064 | 3300003752 | Bacteria | 139066 |
| 69 | Ga0055533_1000071 | 3300003756 | Bacteria | 152144 |
| 70 | Ga0055533_1000074 | 3300003756 | Bacteria | 139066 |
| 71 | Ga0055533_1000540 | 3300003756 | Bacteria | 13457 |
| 72 | Ga0055533_1001327 | 3300003756 | Bacteria | 6705 |
| 73 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 74 | Ga0055532_1000016 | 3300003758 | Bacteria | 327509 |
| 75 | Ga0055532_1000039 | 3300003758 | Bacteria | 198049 |
| 76 | Ga0055532_1000643 | 3300003758 | Bacteria | 13493 |
| 77 | Ga0055532_1000713 | 3300003758 | Bacteria | 12362 |
| 78 | Ga0055532_1000720 | 3300003758 | Bacteria | 12288 |
| 79 | Ga0055525_1000085 | 3300003759 | Bacteria | 152144 |
| 80 | Ga0055525_1000092 | 3300003759 | Bacteria | 139066 |
| 81 | Ga0055525_1000192 | 3300003759 | Bacteria | 72944 |
| 82 | Ga0055525_1000313 | 3300003759 | Bacteria | 39508 |
| 83 | Ga0055525_1000473 | 3300003759 | Bacteria | 22055 |
| 84 | Ga0055527_1000024 | 3300003760 | Bacteria | 198049 |
| 85 | Ga0055527_1000041 | 3300003760 | Bacteria | 116981 |
| 86 | Ga0055527_1000234 | 3300003760 | Bacteria | 34826 |
| 87 | Ga0055527_1000276 | 3300003760 | Bacteria | 30569 |
| 88 | Ga0055527_1001073 | 3300003760 | Bacteria | 6471 |
| 89 | Ga0055535_1000028 | 3300003761 | Bacteria | 198049 |
| 90 | Ga0055535_1000193 | 3300003761 | Bacteria | 64634 |
| 91 | Ga0055535_1000216 | 3300003761 | Bacteria | 60912 |
| 92 | Ga0055535_1000457 | 3300003761 | Bacteria | 37713 |
| 93 | Ga0055535_1000502 | 3300003761 | Bacteria | 34740 |
| 94 | Ga0055535_1001000 | 3300003761 | Bacteria | 18231 |
| 95 | Ga0055535_1001317 | 3300003761 | Bacteria | 13235 |
| 96 | Ga0055535_1001326 | 3300003761 | Bacteria | 13176 |
| 97 | Ga0055535_1003753 | 3300003761 | Bacteria | 4074 |
| 98 | Ga0055542_1000047 | 3300003762 | Bacteria | 198049 |
| 99 | Ga0055542_1000136 | 3300003762 | Bacteria | 93218 |
| 100 | Ga0055542_1000152 | 3300003762 | Bacteria | 87561 |
| 101 | Ga0055542_1000179 | 3300003762 | Bacteria | 78713 |
| 102 | Ga0055542_1000183 | 3300003762 | Bacteria | 77794 |
| 103 | Ga0055542_1000520 | 3300003762 | Bacteria | 34740 |
| 104 | Ga0055542_1001547 | 3300003762 | Bacteria | 10937 |
| 105 | Ga0055542_1001665 | 3300003762 | Bacteria | 9904 |
| 106 | Ga0055542_1003689 | 3300003762 | Bacteria | 4015 |
| 107 | Ga0055529_1000028 | 3300003763 | Bacteria | 287650 |
| 108 | Ga0055529_1000054 | 3300003763 | Bacteria | 198049 |
| 109 | Ga0055529_1000189 | 3300003763 | Bacteria | 84123 |
| 110 | Ga0055529_1000254 | 3300003763 | Bacteria | 64036 |
| 111 | Ga0055529_1000552 | 3300003763 | Bacteria | 31487 |
| 112 | Ga0055529_1001001 | 3300003763 | Bacteria | 13766 |
| 113 | Ga0055526_1011699 | 3300003771 | Bacteria | 3920 |
| 114 | Ga0055526_1017490 | 3300003771 | Bacteria | 2733 |
| 115 | Ga0055524_1006917 | 3300003775 | Bacteria | 4881 |
| 116 | Ga0055536_1000087 | 3300003781 | Bacteria | 79591 |
| 117 | Ga0055534_1000910 | 3300003784 | Bacteria | 13339 |
| 118 | Ga0055534_1001301 | 3300003784 | Bacteria | 10095 |
| 119 | Ga0055534_1001898 | 3300003784 | Bacteria | 7714 |
| 120 | Ga0055528_1004561 | 3300003790 | Bacteria | 6643 |
| 121 | Ga0055541_1000044 | 3300003841 | Bacteria | 152144 |
| 122 | Ga0055541_1000046 | 3300003841 | Bacteria | 139066 |
| 123 | Ga0055541_1008710 | 3300003841 | Bacteria | 1606 |
| 124 | Ga0058692_1002802 | 3300003856 | Bacteria | 5728 |
| 125 | Ga0065165_1000250 | 3300005262 | Bacteria | 93116 |
| 126 | Ga0065165_1000790 | 3300005262 | Bacteria | 42379 |
| 127 | Ga0065704_10081336 | 3300005289 | Bacteria | 3777 |
| 128 | Ga0065715_10187709 | 3300005293 | Bacteria | 1434 |
| 129 | Ga0065707_10111924 | 3300005295 | Bacteria | 2378 |
| 130 | Ga0070658_10071329 | 3300005327 | Bacteria | 2845 |
| 131 | Ga0070658_10144004 | 3300005327 | Bacteria | 1992 |
| 132 | Ga0070676_10054594 | 3300005328 | Bacteria | 2355 |
| 133 | Ga0070683_100059687 | 3300005329 | Bacteria | 3544 |
| 134 | Ga0070690_100001754 | 3300005330 | Bacteria | 11471 |
| 135 | Ga0070670_100055684 | 3300005331 | Bacteria | 3394 |
| 136 | Ga0070670_100139443 | 3300005331 | Bacteria | 2097 |
| 137 | Ga0068869_100001435 | 3300005334 | Bacteria | 14129 |
| 138 | Ga0070666_10046595 | 3300005335 | Bacteria | 2909 |
| 139 | Ga0070680_100000789 | 3300005336 | Bacteria | 22263 |
| 140 | Ga0070680_100022650 | 3300005336 | Bacteria | 5006 |
| 141 | Ga0070680_100055318 | 3300005336 | Bacteria | 3243 |
| 142 | Ga0070680_100173530 | 3300005336 | Bacteria | 1815 |
| 143 | Ga0070682_100003408 | 3300005337 | Bacteria | 8817 |
| 144 | Ga0070682_100035827 | 3300005337 | Bacteria | 3031 |
| 145 | Ga0068868_100001331 | 3300005338 | Bacteria | 17036 |
| 146 | Ga0070660_100000016 | 3300005339 | Bacteria | 102648 |
| 147 | Ga0070660_100011617 | 3300005339 | Bacteria | 6268 |
| 148 | Ga0070689_100000776 | 3300005340 | Bacteria | 19580 |
| 149 | Ga0070689_100047885 | 3300005340 | Bacteria | 3296 |
| 150 | Ga0070691_10029459 | 3300005341 | Bacteria | 2568 |
| 151 | Ga0070687_100000436 | 3300005343 | Bacteria | 14119 |
| 152 | Ga0070661_100000013 | 3300005344 | Bacteria | 163010 |
| 153 | Ga0070661_100042504 | 3300005344 | Bacteria | 3318 |
| 154 | Ga0070692_10000910 | 3300005345 | Bacteria | 10019 |
| 155 | Ga0070668_100058281 | 3300005347 | Bacteria | 2987 |
| 156 | Ga0070668_100106786 | 3300005347 | Bacteria | 2225 |
| 157 | Ga0070669_100000706 | 3300005353 | Bacteria | 24466 |
| 158 | Ga0070669_100068696 | 3300005353 | Bacteria | 2616 |
| 159 | Ga0070675_100056072 | 3300005354 | Bacteria | 3245 |
| 160 | Ga0070671_100227409 | 3300005355 | Bacteria | 1583 |
| 161 | Ga0070673_100265129 | 3300005364 | Bacteria | 1502 |
| 162 | Ga0070659_100000167 | 3300005366 | Bacteria | 50757 |
| 163 | Ga0070659_100003331 | 3300005366 | Bacteria | 11431 |
| 164 | Ga0070659_100007239 | 3300005366 | Bacteria | 8054 |
| 165 | Ga0070659_100044058 | 3300005366 | Bacteria | 3492 |
| 166 | Ga0070714_100000088 | 3300005435 | Bacteria | 77301 |
| 167 | Ga0070714_100035404 | 3300005435 | Bacteria | 4184 |
| 168 | Ga0070713_100003177 | 3300005436 | Bacteria | 10811 |
| 169 | Ga0070710_10058408 | 3300005437 | Bacteria | 2188 |
| 170 | Ga0070705_100001008 | 3300005440 | Bacteria | 15668 |
| 171 | Ga0070705_100048956 | 3300005440 | Bacteria | 2452 |
| 172 | Ga0070700_100000666 | 3300005441 | Bacteria | 16998 |
| 173 | Ga0070694_100001273 | 3300005444 | Bacteria | 14642 |
| 174 | Ga0070694_100009337 | 3300005444 | Bacteria | 6020 |
| 175 | Ga0070694_100046544 | 3300005444 | Bacteria | 2912 |
| 176 | Ga0070694_100056927 | 3300005444 | Bacteria | 2657 |
| 177 | Ga0070694_100123354 | 3300005444 | Bacteria | 1862 |
| 178 | Ga0070708_100061073 | 3300005445 | Bacteria | 3366 |
| 179 | Ga0070663_100000006 | 3300005455 | Bacteria | 208068 |
| 180 | Ga0070663_100000479 | 3300005455 | Bacteria | 21030 |
| 181 | Ga0070663_100030317 | 3300005455 | Bacteria | 3705 |
| 182 | Ga0070663_100033311 | 3300005455 | Bacteria | 3558 |
| 183 | Ga0070663_100111631 | 3300005455 | Bacteria | 2055 |
| 184 | Ga0070681_10000235 | 3300005458 | Bacteria | 43570 |
| 185 | Ga0070681_10001320 | 3300005458 | Bacteria | 21646 |
| 186 | Ga0070681_10003359 | 3300005458 | Bacteria | 14968 |
| 187 | Ga0070681_10056509 | 3300005458 | Bacteria | 3906 |
| 188 | Ga0068867_100000699 | 3300005459 | Bacteria | 22369 |
| 189 | Ga0068867_100001386 | 3300005459 | Bacteria | 16761 |
| 190 | Ga0070699_100002487 | 3300005518 | Bacteria | 16563 |
| 191 | Ga0070679_100011170 | 3300005530 | Bacteria | 8555 |
| 192 | Ga0070679_100015423 | 3300005530 | Bacteria | 7345 |
| 193 | Ga0070679_100036570 | 3300005530 | Bacteria | 4873 |
| 194 | Ga0070679_100105841 | 3300005530 | Bacteria | 2799 |
| 195 | Ga0070684_100158444 | 3300005535 | Bacteria | 2053 |
| 196 | Ga0070697_100001807 | 3300005536 | Bacteria | 16334 |
| 197 | Ga0070697_100003810 | 3300005536 | Bacteria | 11585 |
| 198 | Ga0068853_100132135 | 3300005539 | Bacteria | 2236 |
| 199 | Ga0070672_100131652 | 3300005543 | Bacteria | 2056 |
| 200 | Ga0070686_100002450 | 3300005544 | Bacteria | 10226 |
| 201 | Ga0070686_100067700 | 3300005544 | Bacteria | 2327 |
| 202 | Ga0070695_100000113 | 3300005545 | Bacteria | 35966 |
| 203 | Ga0070695_100024153 | 3300005545 | Bacteria | 3742 |
| 204 | Ga0070696_100000434 | 3300005546 | Bacteria | 26295 |
| 205 | Ga0070696_100002179 | 3300005546 | Bacteria | 12906 |
| 206 | Ga0070696_100002261 | 3300005546 | Bacteria | 12697 |
| 207 | Ga0070696_100002633 | 3300005546 | Bacteria | 11898 |
| 208 | Ga0070693_100000209 | 3300005547 | Bacteria | 27275 |
| 209 | Ga0070693_100015359 | 3300005547 | Bacteria | 3941 |
| 210 | Ga0070665_100002809 | 3300005548 | Bacteria | 18859 |
| 211 | Ga0068855_100000072 | 3300005563 | Bacteria | 121486 |
| 212 | Ga0068855_100014327 | 3300005563 | Bacteria | 9547 |
| 213 | Ga0068855_100014631 | 3300005563 | Bacteria | 9450 |
| 214 | Ga0068855_100015378 | 3300005563 | Bacteria | 9213 |
| 215 | Ga0068855_100017810 | 3300005563 | Bacteria | 8540 |
| 216 | Ga0068855_100070969 | 3300005563 | Bacteria | 4051 |
| 217 | Ga0068855_100083657 | 3300005563 | Bacteria | 3696 |
| 218 | Ga0068855_100100241 | 3300005563 | Bacteria | 3335 |
| 219 | Ga0068855_100103616 | 3300005563 | Bacteria | 3273 |
| 220 | Ga0070664_100000002 | 3300005564 | Bacteria | 458815 |
| 221 | Ga0070664_100039941 | 3300005564 | Bacteria | 3955 |
| 222 | Ga0068857_100000319 | 3300005577 | Bacteria | 33193 |
| 223 | Ga0068857_100017815 | 3300005577 | Bacteria | 6228 |
| 224 | Ga0068857_100051279 | 3300005577 | Bacteria | 3660 |
| 225 | Ga0068857_100060592 | 3300005577 | Bacteria | 3361 |
| 226 | Ga0068854_100000004 | 3300005578 | Bacteria | 216381 |
| 227 | Ga0068854_100001263 | 3300005578 | Bacteria | 15187 |
| 228 | Ga0068854_100001277 | 3300005578 | Bacteria | 15138 |
| 229 | Ga0068854_100001665 | 3300005578 | Bacteria | 13528 |
| 230 | Ga0068854_100009142 | 3300005578 | Bacteria | 6390 |
| 231 | Ga0068854_100100631 | 3300005578 | Bacteria | 2166 |
| 232 | Ga0068856_100000294 | 3300005614 | Bacteria | 54780 |
| 233 | Ga0068856_100000652 | 3300005614 | Bacteria | 37607 |
| 234 | Ga0068856_100038570 | 3300005614 | Bacteria | 4690 |
| 235 | Ga0068856_100087423 | 3300005614 | Bacteria | 3099 |
| 236 | Ga0068856_100109459 | 3300005614 | Bacteria | 2759 |
| 237 | Ga0070702_100000240 | 3300005615 | Bacteria | 18563 |
| 238 | Ga0068859_100004628 | 3300005617 | Bacteria | 14018 |
| 239 | Ga0068859_100107514 | 3300005617 | Bacteria | 2850 |
| 240 | Ga0068864_100068644 | 3300005618 | Bacteria | 3080 |
| 241 | Ga0068861_100000550 | 3300005719 | Bacteria | 22119 |
| 242 | Ga0068851_10069478 | 3300005834 | Bacteria | 1819 |
| 243 | Ga0068858_100004085 | 3300005842 | Bacteria | 14380 |
| 244 | Ga0068858_100064675 | 3300005842 | Bacteria | 3386 |
| 245 | Ga0068858_100424330 | 3300005842 | Bacteria | 1279 |
| 246 | Ga0068860_100004596 | 3300005843 | Bacteria | 14092 |
| 247 | Ga0068862_100001897 | 3300005844 | Bacteria | 18976 |
| 248 | Ga0068862_100006699 | 3300005844 | Bacteria | 9558 |
| 249 | Ga0068862_100051032 | 3300005844 | Bacteria | 3537 |
| 250 | Ga0081539_10000799 | 3300005985 | Bacteria | 61195 |
| 251 | Ga0075363_100099372 | 3300006048 | Bacteria | 1609 |
| 252 | Ga0075364_10007608 | 3300006051 | Bacteria | 6442 |
| 253 | Ga0075364_10008631 | 3300006051 | Bacteria | 6095 |
| 254 | Ga0075364_10011929 | 3300006051 | Bacteria | 5296 |
| 255 | Ga0075364_10013464 | 3300006051 | Bacteria | 5030 |
| 256 | Ga0075366_10009542 | 3300006195 | Bacteria | 5421 |
| 257 | Ga0075366_10037583 | 3300006195 | Bacteria | 2859 |
| 258 | Ga0097621_100011829 | 3300006237 | Bacteria | 6448 |
| 259 | Ga0075370_10001703 | 3300006353 | Bacteria | 9766 |
| 260 | Ga0075370_10002804 | 3300006353 | Bacteria | 8171 |
| 261 | Ga0075370_10025086 | 3300006353 | Bacteria | 3296 |
| 262 | Ga0068871_100000788 | 3300006358 | Bacteria | 21290 |
| 263 | Ga0068871_100001073 | 3300006358 | Bacteria | 18331 |
| 264 | Ga0075428_100003728 | 3300006844 | Bacteria | 16711 |
| 265 | Ga0075430_100002931 | 3300006846 | Bacteria | 14267 |
| 266 | Ga0075431_100269744 | 3300006847 | Bacteria | 1725 |
| 267 | Ga0075433_10003313 | 3300006852 | Bacteria | 12441 |
| 268 | Ga0075433_10042452 | 3300006852 | Bacteria | 3946 |
| 269 | Ga0075434_100000004 | 3300006871 | Bacteria | 112839 |
| 270 | Ga0075434_100001086 | 3300006871 | Bacteria | 22255 |
| 271 | Ga0075434_100019492 | 3300006871 | Bacteria | 6566 |
| 272 | Ga0075434_100037923 | 3300006871 | Bacteria | 4772 |
| 273 | Ga0075429_100000051 | 3300006880 | Bacteria | 55896 |
| 274 | Ga0068865_100001146 | 3300006881 | Bacteria | 15365 |
| 275 | Ga0075436_100000331 | 3300006914 | Bacteria | 30168 |
| 276 | Ga0075436_100004918 | 3300006914 | Bacteria | 9183 |
| 277 | Ga0075436_100010269 | 3300006914 | Bacteria | 6411 |
| 278 | Ga0075436_100047384 | 3300006914 | Bacteria | 2965 |
| 279 | Ga0097620_100004627 | 3300006931 | Bacteria | 14018 |
| 280 | Ga0097620_100107510 | 3300006931 | Bacteria | 2850 |
| 281 | Ga0079104_1000277 | 3300006946 | Bacteria | 66604 |
| 282 | Ga0099826_10000015 | 3300006948 | Bacteria | 254837 |
| 283 | Ga0075435_100000313 | 3300007076 | Bacteria | 29845 |
| 284 | Ga0075435_100001505 | 3300007076 | Bacteria | 14975 |
| 285 | Ga0075435_100022664 | 3300007076 | Bacteria | 4847 |
| 286 | Ga0105251_10000285 | 3300009011 | Bacteria | 50961 |
| 287 | Ga0105251_10001199 | 3300009011 | Bacteria | 22421 |
| 288 | Ga0105251_10038759 | 3300009011 | Bacteria | 2332 |
| 289 | Ga0105244_10079081 | 3300009036 | Bacteria | 1630 |
| 290 | Ga0105250_10007579 | 3300009092 | Bacteria | 4653 |
| 291 | Ga0105240_10000569 | 3300009093 | Bacteria | 68389 |
| 292 | Ga0105240_10002163 | 3300009093 | Bacteria | 32091 |
| 293 | Ga0105240_10019895 | 3300009093 | Bacteria | 8965 |
| 294 | Ga0105240_10021079 | 3300009093 | Bacteria | 8674 |
| 295 | Ga0105240_10032831 | 3300009093 | Bacteria | 6715 |
| 296 | Ga0105240_10038140 | 3300009093 | Bacteria | 6167 |
| 297 | Ga0105240_10094721 | 3300009093 | Bacteria | 3641 |
| 298 | Ga0105240_10206703 | 3300009093 | Bacteria | 2297 |
| 299 | Ga0105240_10292316 | 3300009093 | Bacteria | 1867 |
| 300 | Ga0111539_10035356 | 3300009094 | Bacteria | 6050 |
| 301 | Ga0111539_10043746 | 3300009094 | Bacteria | 5368 |
| 302 | Ga0105245_10002454 | 3300009098 | Bacteria | 16760 |
| 303 | Ga0114129_10000337 | 3300009147 | Bacteria | 54884 |
| 304 | Ga0105243_10000420 | 3300009148 | Bacteria | 44548 |
| 305 | Ga0105243_10000915 | 3300009148 | Bacteria | 27703 |
| 306 | Ga0105243_10005794 | 3300009148 | Bacteria | 9592 |
| 307 | Ga0105241_10034467 | 3300009174 | Bacteria | 3803 |
| 308 | Ga0105241_10042520 | 3300009174 | Bacteria | 3438 |
| 309 | Ga0105242_10000945 | 3300009176 | Bacteria | 22671 |
| 310 | Ga0105242_10008348 | 3300009176 | Bacteria | 7958 |
| 311 | Ga0105242_10021199 | 3300009176 | Bacteria | 5099 |
| 312 | Ga0105248_10271656 | 3300009177 | Bacteria | 1909 |
| 313 | Ga0105237_10000007 | 3300009545 | Bacteria | 367690 |
| 314 | Ga0105237_10000307 | 3300009545 | Bacteria | 68076 |
| 315 | Ga0105237_10030111 | 3300009545 | Bacteria | 5515 |
| 316 | Ga0105237_10080514 | 3300009545 | Bacteria | 3247 |
| 317 | Ga0105238_10000318 | 3300009551 | Bacteria | 52620 |
| 318 | Ga0105238_10014850 | 3300009551 | Bacteria | 7880 |
| 319 | Ga0105238_10034564 | 3300009551 | Bacteria | 5142 |
| 320 | Ga0105238_10213812 | 3300009551 | Bacteria | 1904 |
| 321 | Ga0105238_10214663 | 3300009551 | Bacteria | 1900 |
| 322 | Ga0105249_10000975 | 3300009553 | Bacteria | 25356 |
| 323 | Ga0105249_10024517 | 3300009553 | Bacteria | 5423 |
| 324 | Ga0105239_10000020 | 3300010375 | Bacteria | 264435 |
| 325 | Ga0105239_10001532 | 3300010375 | Bacteria | 30537 |
| 326 | Ga0105239_10033387 | 3300010375 | Bacteria | 5652 |
| 327 | Ga0105239_10059727 | 3300010375 | Bacteria | 4185 |
| 328 | Ga0157373_10005940 | 3300013100 | Bacteria | 9131 |
| 329 | Ga0157373_10009391 | 3300013100 | Bacteria | 7223 |
| 330 | Ga0157373_10035191 | 3300013100 | Bacteria | 3596 |
| 331 | Ga0157373_10078366 | 3300013100 | Bacteria | 2330 |
| 332 | Ga0157373_10199743 | 3300013100 | Bacteria | 1409 |
| 333 | Ga0157371_10004477 | 3300013102 | Bacteria | 12184 |
| 334 | Ga0157371_10007599 | 3300013102 | Bacteria | 8746 |
| 335 | Ga0157371_10017438 | 3300013102 | Bacteria | 5332 |
| 336 | Ga0157371_10039981 | 3300013102 | Bacteria | 3352 |
| 337 | Ga0157370_10000371 | 3300013104 | Bacteria | 56531 |
| 338 | Ga0157370_10007267 | 3300013104 | Bacteria | 12088 |
| 339 | Ga0157370_10012327 | 3300013104 | Bacteria | 8873 |
| 340 | Ga0157370_10022546 | 3300013104 | Bacteria | 6265 |
| 341 | Ga0157370_10027521 | 3300013104 | Bacteria | 5606 |
| 342 | Ga0157370_10035086 | 3300013104 | Bacteria | 4879 |
| 343 | Ga0157370_10038942 | 3300013104 | Bacteria | 4598 |
| 344 | Ga0157370_10105641 | 3300013104 | Bacteria | 2635 |
| 345 | Ga0157370_10124192 | 3300013104 | Bacteria | 2410 |
| 346 | Ga0157369_10000252 | 3300013105 | Bacteria | 73217 |
| 347 | Ga0157369_10002784 | 3300013105 | Bacteria | 20879 |
| 348 | Ga0157369_10007899 | 3300013105 | Bacteria | 12232 |
| 349 | Ga0157369_10107132 | 3300013105 | Bacteria | 2973 |
| 350 | Ga0157369_10168483 | 3300013105 | Bacteria | 2309 |
| 351 | Ga0157369_10191474 | 3300013105 | Bacteria | 2149 |
| 352 | Ga0157369_10281095 | 3300013105 | Bacteria | 1733 |
| 353 | Ga0157374_10000345 | 3300013296 | Bacteria | 42866 |
| 354 | Ga0157378_10000844 | 3300013297 | Bacteria | 28388 |
| 355 | Ga0163162_10001066 | 3300013306 | Bacteria | 25485 |
| 356 | Ga0157372_10008893 | 3300013307 | Bacteria | 10668 |
| 357 | Ga0157372_10017693 | 3300013307 | Bacteria | 7651 |
| 358 | Ga0157372_10181794 | 3300013307 | Bacteria | 2434 |
| 359 | Ga0157372_10196929 | 3300013307 | Bacteria | 2334 |
| 360 | Ga0157375_10028666 | 3300013308 | Bacteria | 5224 |
| 361 | Ga0157375_10315464 | 3300013308 | Bacteria | 1728 |
| 362 | Ga0182008_10004246 | 3300014497 | Bacteria | 8402 |
| 363 | Ga0182008_10004498 | 3300014497 | Bacteria | 8144 |
| 364 | Ga0182008_10006040 | 3300014497 | Bacteria | 6811 |
| 365 | Ga0182008_10021058 | 3300014497 | Bacteria | 3352 |
| 366 | Ga0182008_10042688 | 3300014497 | Bacteria | 2259 |
| 367 | Ga0157376_10064579 | 3300014969 | Bacteria | 3088 |
| 368 | Ga0157376_10066813 | 3300014969 | Bacteria | 3040 |
| 369 | Ga0182006_1000162 | 3300015261 | Bacteria | 71391 |
| 370 | Ga0182006_1000541 | 3300015261 | Bacteria | 28690 |
| 371 | Ga0182006_1001661 | 3300015261 | Bacteria | 13105 |
| 372 | Ga0182006_1002604 | 3300015261 | Bacteria | 9747 |
| 373 | Ga0182006_1013148 | 3300015261 | Bacteria | 3599 |
| 374 | Ga0182006_1049379 | 3300015261 | Bacteria | 1624 |
| 375 | Ga0182007_10011944 | 3300015262 | Bacteria | 3357 |
| 376 | Ga0182007_10021806 | 3300015262 | Bacteria | 2269 |
| 377 | Ga0182005_1000322 | 3300015265 | Bacteria | 28505 |
| 378 | Ga0182005_1000365 | 3300015265 | Bacteria | 25241 |
| 379 | Ga0182005_1005337 | 3300015265 | Bacteria | 4026 |
| 380 | Ga0182005_1010521 | 3300015265 | Bacteria | 2660 |
| 381 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 382 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 383 | Ga0183361_10025 | 3300016635 | Bacteria | 72014 |
| 384 | Ga0206351_10556100 | 3300020077 | Bacteria | 7205 |
| 385 | Ga0206350_10021063 | 3300020080 | Bacteria | 1455 |
| 386 | Ga0154015_1099906 | 3300020610 | Bacteria | 39484 |
| 387 | Ga0213872_10003677 | 3300021361 | Bacteria | 8397 |
| 388 | Ga0213872_10009907 | 3300021361 | Bacteria | 4551 |
| 389 | Ga0224712_10012474 | 3300022467 | Bacteria | 2676 |
| 390 | Ga0209435_100016 | 3300025206 | Bacteria | 305566 |
| 391 | Ga0209435_100038 | 3300025206 | Bacteria | 120273 |
| 392 | Ga0209435_100932 | 3300025206 | Bacteria | 4355 |
| 393 | Ga0209435_105321 | 3300025206 | Bacteria | 1443 |
| 394 | Ga0209760_101097 | 3300025207 | Bacteria | 3110 |
| 395 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 396 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 397 | Ga0209784_100068 | 3300025224 | Bacteria | 152526 |
| 398 | Ga0209784_100069 | 3300025224 | Bacteria | 152424 |
| 399 | Ga0209784_100293 | 3300025224 | Bacteria | 27186 |
| 400 | Ga0209784_100573 | 3300025224 | Bacteria | 12620 |
| 401 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 402 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 403 | Ga0209566_100083 | 3300025225 | Bacteria | 152424 |
| 404 | Ga0209566_100535 | 3300025225 | Bacteria | 25730 |
| 405 | Ga0209566_100561 | 3300025225 | Bacteria | 24375 |
| 406 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 407 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 408 | Ga0209674_100012 | 3300025226 | Bacteria | 950162 |
| 409 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 410 | Ga0209674_100106 | 3300025226 | Bacteria | 152424 |
| 411 | Ga0209674_100122 | 3300025226 | Bacteria | 131720 |
| 412 | Ga0209674_100148 | 3300025226 | Bacteria | 98100 |
| 413 | Ga0209674_100336 | 3300025226 | Bacteria | 28357 |
| 414 | Ga0209674_100424 | 3300025226 | Bacteria | 20459 |
| 415 | Ga0209672_100005 | 3300025228 | Bacteria | 1069303 |
| 416 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 417 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 418 | Ga0209672_100045 | 3300025228 | Bacteria | 264926 |
| 419 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 420 | Ga0209672_100100 | 3300025228 | Bacteria | 108785 |
| 421 | Ga0209672_100350 | 3300025228 | Bacteria | 29469 |
| 422 | Ga0209672_100386 | 3300025228 | Bacteria | 26847 |
| 423 | Ga0209672_100676 | 3300025228 | Bacteria | 17169 |
| 424 | Ga0209672_101672 | 3300025228 | Bacteria | 7210 |
| 425 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 426 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 427 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 428 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 429 | Ga0209147_100192 | 3300025229 | Bacteria | 70162 |
| 430 | Ga0209147_100308 | 3300025229 | Bacteria | 38671 |
| 431 | Ga0209147_104223 | 3300025229 | Bacteria | 2461 |
| 432 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 433 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 434 | Ga0209563_100023 | 3300025230 | Bacteria | 636844 |
| 435 | Ga0209563_100100 | 3300025230 | Bacteria | 152424 |
| 436 | Ga0209563_101103 | 3300025230 | Bacteria | 7728 |
| 437 | Ga0207427_100069 | 3300025231 | Bacteria | 161547 |
| 438 | Ga0207427_100139 | 3300025231 | Bacteria | 84807 |
| 439 | Ga0207427_100140 | 3300025231 | Bacteria | 84637 |
| 440 | Ga0207427_100216 | 3300025231 | Bacteria | 50601 |
| 441 | Ga0207427_100279 | 3300025231 | Bacteria | 37306 |
| 442 | Ga0207427_101443 | 3300025231 | Bacteria | 8570 |
| 443 | Ga0209437_100139 | 3300025233 | Bacteria | 172506 |
| 444 | Ga0209437_100147 | 3300025233 | Bacteria | 161997 |
| 445 | Ga0209437_100154 | 3300025233 | Bacteria | 153383 |
| 446 | Ga0209437_100156 | 3300025233 | Bacteria | 152424 |
| 447 | Ga0209437_100166 | 3300025233 | Bacteria | 144787 |
| 448 | Ga0209437_100462 | 3300025233 | Bacteria | 32102 |
| 449 | Ga0209437_100463 | 3300025233 | Bacteria | 32076 |
| 450 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 451 | Ga0209258_100006 | 3300025242 | Bacteria | 1069303 |
| 452 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 453 | Ga0209258_100024 | 3300025242 | Bacteria | 542096 |
| 454 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 455 | Ga0209258_100111 | 3300025242 | Bacteria | 197019 |
| 456 | Ga0209258_100200 | 3300025242 | Bacteria | 123379 |
| 457 | Ga0209258_100358 | 3300025242 | Bacteria | 61852 |
| 458 | Ga0209258_100360 | 3300025242 | Bacteria | 61533 |
| 459 | Ga0209258_100368 | 3300025242 | Bacteria | 59722 |
| 460 | Ga0209258_100992 | 3300025242 | Bacteria | 13094 |
| 461 | Ga0209258_101914 | 3300025242 | Bacteria | 6145 |
| 462 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 463 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 464 | Ga0209646_1000093 | 3300025246 | Bacteria | 183840 |
| 465 | Ga0209646_1001402 | 3300025246 | Bacteria | 6566 |
| 466 | Ga0209026_1000031 | 3300025250 | Bacteria | 325747 |
| 467 | Ga0209026_1000074 | 3300025250 | Bacteria | 203820 |
| 468 | Ga0209026_1000099 | 3300025250 | Bacteria | 161750 |
| 469 | Ga0209026_1000145 | 3300025250 | Bacteria | 111490 |
| 470 | Ga0209026_1000914 | 3300025250 | Bacteria | 15138 |
| 471 | Ga0209026_1001383 | 3300025250 | Bacteria | 10811 |
| 472 | Ga0209026_1003446 | 3300025250 | Bacteria | 5175 |
| 473 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 474 | Ga0209677_100013 | 3300025253 | Bacteria | 548200 |
| 475 | Ga0209677_100061 | 3300025253 | Bacteria | 152424 |
| 476 | Ga0209677_103892 | 3300025253 | Bacteria | 4572 |
| 477 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 478 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 479 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 480 | Ga0209148_1000012 | 3300025254 | Bacteria | 1069303 |
| 481 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 482 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 483 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 484 | Ga0209148_1000045 | 3300025254 | Bacteria | 448076 |
| 485 | Ga0209148_1000099 | 3300025254 | Bacteria | 227713 |
| 486 | Ga0209148_1000400 | 3300025254 | Bacteria | 50569 |
| 487 | Ga0209148_1001095 | 3300025254 | Bacteria | 16345 |
| 488 | Ga0209759_1000045 | 3300025256 | Bacteria | 235654 |
| 489 | Ga0209759_1000110 | 3300025256 | Bacteria | 144917 |
| 490 | Ga0209759_1000147 | 3300025256 | Bacteria | 121320 |
| 491 | Ga0209759_1000247 | 3300025256 | Bacteria | 80850 |
| 492 | Ga0209759_1000248 | 3300025256 | Bacteria | 80537 |
| 493 | Ga0209759_1000605 | 3300025256 | Bacteria | 34670 |
| 494 | Ga0209759_1000804 | 3300025256 | Bacteria | 25401 |
| 495 | Ga0209759_1001732 | 3300025256 | Bacteria | 11236 |
| 496 | Ga0209759_1001830 | 3300025256 | Bacteria | 10676 |
| 497 | Ga0209759_1003030 | 3300025256 | Bacteria | 6929 |
| 498 | Ga0209759_1003860 | 3300025256 | Bacteria | 5801 |
| 499 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 500 | Ga0209233_1000083 | 3300025261 | Bacteria | 336016 |
| 501 | Ga0209233_1000092 | 3300025261 | Bacteria | 308668 |
| 502 | Ga0209233_1000135 | 3300025261 | Bacteria | 201057 |
| 503 | Ga0209233_1000165 | 3300025261 | Bacteria | 152424 |
| 504 | Ga0209233_1000191 | 3300025261 | Bacteria | 127938 |
| 505 | Ga0209233_1000251 | 3300025261 | Bacteria | 84807 |
| 506 | Ga0209455_1000008 | 3300025272 | Bacteria | 1069303 |
| 507 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 508 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 509 | Ga0209455_1000029 | 3300025272 | Bacteria | 542096 |
| 510 | Ga0209455_1000035 | 3300025272 | Bacteria | 479071 |
| 511 | Ga0209455_1000086 | 3300025272 | Bacteria | 244650 |
| 512 | Ga0209455_1000213 | 3300025272 | Bacteria | 82040 |
| 513 | Ga0209455_1000357 | 3300025272 | Bacteria | 42718 |
| 514 | Ga0209455_1000601 | 3300025272 | Bacteria | 22986 |
| 515 | Ga0209455_1001659 | 3300025272 | Bacteria | 9644 |
| 516 | Ga0209455_1015391 | 3300025272 | Bacteria | 1683 |
| 517 | Ga0209673_1000201 | 3300025273 | Bacteria | 120059 |
| 518 | Ga0209130_1002165 | 3300025284 | Bacteria | 10351 |
| 519 | Ga0209675_1001328 | 3300025291 | Bacteria | 14629 |
| 520 | Ga0209675_1001337 | 3300025291 | Bacteria | 14563 |
| 521 | Ga0209675_1018295 | 3300025291 | Bacteria | 1965 |
| 522 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 523 | Ga0209676_1004421 | 3300025292 | Bacteria | 7842 |
| 524 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 525 | Ga0209025_1000542 | 3300025294 | Bacteria | 71039 |
| 526 | Ga0209025_1000759 | 3300025294 | Bacteria | 53934 |
| 527 | Ga0209025_1003675 | 3300025294 | Bacteria | 14177 |
| 528 | Ga0209564_1002863 | 3300025295 | Bacteria | 12663 |
| 529 | Ga0209564_1004321 | 3300025295 | Bacteria | 8776 |
| 530 | Ga0209564_1009861 | 3300025295 | Bacteria | 4478 |
| 531 | Ga0209758_1000276 | 3300025297 | Bacteria | 102362 |
| 532 | Ga0209758_1029993 | 3300025297 | Bacteria | 2261 |
| 533 | Ga0209050_1001429 | 3300025298 | Bacteria | 25722 |
| 534 | Ga0209256_1000233 | 3300025299 | Bacteria | 99386 |
| 535 | Ga0207426_1000240 | 3300025302 | Bacteria | 123149 |
| 536 | Ga0207696_1008775 | 3300025711 | Bacteria | 3828 |
| 537 | Ga0207713_1002521 | 3300025735 | Bacteria | 13264 |
| 538 | Ga0207713_1003615 | 3300025735 | Bacteria | 10415 |
| 539 | Ga0207653_10035802 | 3300025885 | Bacteria | 1616 |
| 540 | Ga0207692_10023211 | 3300025898 | Bacteria | 2866 |
| 541 | Ga0207688_10063812 | 3300025901 | Bacteria | 2078 |
| 542 | Ga0207688_10067752 | 3300025901 | Bacteria | 2020 |
| 543 | Ga0207680_10047607 | 3300025903 | Bacteria | 2542 |
| 544 | Ga0207647_10000967 | 3300025904 | Bacteria | 22285 |
| 545 | Ga0207647_10001769 | 3300025904 | Bacteria | 16583 |
| 546 | Ga0207647_10005750 | 3300025904 | Bacteria | 9051 |
| 547 | Ga0207647_10016575 | 3300025904 | Bacteria | 5025 |
| 548 | Ga0207647_10027795 | 3300025904 | Bacteria | 3684 |
| 549 | Ga0207647_10030691 | 3300025904 | Bacteria | 3465 |
| 550 | Ga0207647_10057514 | 3300025904 | Bacteria | 2384 |
| 551 | Ga0207645_10036717 | 3300025907 | Bacteria | 3146 |
| 552 | Ga0207645_10071922 | 3300025907 | Bacteria | 2214 |
| 553 | Ga0207643_10012639 | 3300025908 | Bacteria | 4560 |
| 554 | Ga0207705_10002820 | 3300025909 | Bacteria | 13287 |
| 555 | Ga0207705_10054416 | 3300025909 | Bacteria | 2884 |
| 556 | Ga0207705_10133484 | 3300025909 | Bacteria | 1849 |
| 557 | Ga0207654_10081748 | 3300025911 | Bacteria | 1946 |
| 558 | Ga0207707_10015319 | 3300025912 | Bacteria | 6675 |
| 559 | Ga0207707_10017802 | 3300025912 | Bacteria | 6196 |
| 560 | Ga0207707_10094667 | 3300025912 | Bacteria | 2610 |
| 561 | Ga0207695_10000408 | 3300025913 | Bacteria | 95748 |
| 562 | Ga0207695_10001214 | 3300025913 | Bacteria | 44135 |
| 563 | Ga0207695_10002857 | 3300025913 | Bacteria | 25113 |
| 564 | Ga0207695_10003147 | 3300025913 | Bacteria | 23559 |
| 565 | Ga0207695_10004759 | 3300025913 | Bacteria | 18356 |
| 566 | Ga0207695_10006780 | 3300025913 | Bacteria | 14759 |
| 567 | Ga0207695_10007664 | 3300025913 | Bacteria | 13676 |
| 568 | Ga0207695_10015832 | 3300025913 | Bacteria | 8858 |
| 569 | Ga0207695_10024607 | 3300025913 | Bacteria | 6767 |
| 570 | Ga0207695_10056224 | 3300025913 | Bacteria | 4096 |
| 571 | Ga0207695_10094999 | 3300025913 | Bacteria | 2987 |
| 572 | Ga0207671_10000031 | 3300025914 | Bacteria | 247030 |
| 573 | Ga0207671_10000074 | 3300025914 | Bacteria | 156482 |
| 574 | Ga0207671_10005183 | 3300025914 | Bacteria | 12116 |
| 575 | Ga0207671_10069245 | 3300025914 | Bacteria | 2630 |
| 576 | Ga0207671_10116680 | 3300025914 | Bacteria | 2036 |
| 577 | Ga0207660_10000870 | 3300025917 | Bacteria | 19956 |
| 578 | Ga0207660_10300652 | 3300025917 | Bacteria | 1278 |
| 579 | Ga0207662_10000233 | 3300025918 | Bacteria | 25755 |
| 580 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 581 | Ga0207657_10062545 | 3300025919 | Bacteria | 3186 |
| 582 | Ga0207649_10000019 | 3300025920 | Bacteria | 212682 |
| 583 | Ga0207649_10026321 | 3300025920 | Bacteria | 3402 |
| 584 | Ga0207652_10059949 | 3300025921 | Bacteria | 3281 |
| 585 | Ga0207652_10103217 | 3300025921 | Bacteria | 2521 |
| 586 | Ga0207652_10199926 | 3300025921 | Bacteria | 1799 |
| 587 | Ga0207681_10001251 | 3300025923 | Bacteria | 16395 |
| 588 | Ga0207694_10003032 | 3300025924 | Bacteria | 13465 |
| 589 | Ga0207694_10014956 | 3300025924 | Bacteria | 5852 |
| 590 | Ga0207694_10038018 | 3300025924 | Bacteria | 3700 |
| 591 | Ga0207694_10041861 | 3300025924 | Bacteria | 3531 |
| 592 | Ga0207700_10006065 | 3300025928 | Bacteria | 7279 |
| 593 | Ga0207664_10000066 | 3300025929 | Bacteria | 109573 |
| 594 | Ga0207664_10000472 | 3300025929 | Bacteria | 28497 |
| 595 | Ga0207644_10054539 | 3300025931 | Bacteria | 2879 |
| 596 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 597 | Ga0207690_10000579 | 3300025932 | Bacteria | 23708 |
| 598 | Ga0207690_10001265 | 3300025932 | Bacteria | 15996 |
| 599 | Ga0207690_10007185 | 3300025932 | Bacteria | 6615 |
| 600 | Ga0207706_10055485 | 3300025933 | Bacteria | 3494 |
| 601 | Ga0207686_10001247 | 3300025934 | Bacteria | 14704 |
| 602 | Ga0207686_10001496 | 3300025934 | Bacteria | 13174 |
| 603 | Ga0207709_10000129 | 3300025935 | Bacteria | 111395 |
| 604 | Ga0207709_10000934 | 3300025935 | Bacteria | 21962 |
| 605 | Ga0207709_10003455 | 3300025935 | Bacteria | 9382 |
| 606 | Ga0207670_10003031 | 3300025936 | Bacteria | 8859 |
| 607 | Ga0207670_10009594 | 3300025936 | Bacteria | 5531 |
| 608 | Ga0207670_10029870 | 3300025936 | Bacteria | 3476 |
| 609 | Ga0207670_10060902 | 3300025936 | Bacteria | 2573 |
| 610 | Ga0207704_10000745 | 3300025938 | Bacteria | 14317 |
| 611 | Ga0207691_10027439 | 3300025940 | Bacteria | 5338 |
| 612 | Ga0207691_10118482 | 3300025940 | Bacteria | 2349 |
| 613 | Ga0207711_10181974 | 3300025941 | Bacteria | 1912 |
| 614 | Ga0207689_10002282 | 3300025942 | Bacteria | 17945 |
| 615 | Ga0207661_10108905 | 3300025944 | Bacteria | 2340 |
| 616 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 617 | Ga0207667_10000055 | 3300025949 | Bacteria | 223770 |
| 618 | Ga0207667_10000082 | 3300025949 | Bacteria | 157749 |
| 619 | Ga0207667_10000313 | 3300025949 | Bacteria | 67227 |
| 620 | Ga0207667_10012188 | 3300025949 | Bacteria | 9931 |
| 621 | Ga0207667_10013499 | 3300025949 | Bacteria | 9341 |
| 622 | Ga0207667_10028434 | 3300025949 | Bacteria | 6073 |
| 623 | Ga0207667_10047165 | 3300025949 | Bacteria | 4560 |
| 624 | Ga0207667_10066465 | 3300025949 | Bacteria | 3758 |
| 625 | Ga0207667_10078394 | 3300025949 | Bacteria | 3424 |
| 626 | Ga0207667_10100957 | 3300025949 | Bacteria | 2976 |
| 627 | Ga0207712_10002777 | 3300025961 | Bacteria | 11198 |
| 628 | Ga0207668_10022314 | 3300025972 | Bacteria | 4050 |
| 629 | Ga0207668_10033596 | 3300025972 | Bacteria | 3399 |
| 630 | Ga0207668_10036230 | 3300025972 | Bacteria | 3291 |
| 631 | Ga0207640_10000018 | 3300025981 | Bacteria | 193664 |
| 632 | Ga0207640_10000524 | 3300025981 | Bacteria | 23157 |
| 633 | Ga0207640_10009367 | 3300025981 | Bacteria | 5482 |
| 634 | Ga0207640_10013733 | 3300025981 | Bacteria | 4648 |
| 635 | Ga0207640_10052125 | 3300025981 | Bacteria | 2664 |
| 636 | Ga0207640_10052385 | 3300025981 | Bacteria | 2658 |
| 637 | Ga0207677_10010535 | 3300026023 | Bacteria | 5236 |
| 638 | Ga0207703_10004183 | 3300026035 | Bacteria | 11897 |
| 639 | Ga0207703_10046696 | 3300026035 | Bacteria | 3489 |
| 640 | Ga0207703_10055595 | 3300026035 | Bacteria | 3220 |
| 641 | Ga0207703_10233655 | 3300026035 | Bacteria | 1650 |
| 642 | Ga0207639_10106751 | 3300026041 | Bacteria | 2274 |
| 643 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 644 | Ga0207678_10000167 | 3300026067 | Bacteria | 55724 |
| 645 | Ga0207678_10008419 | 3300026067 | Bacteria | 9098 |
| 646 | Ga0207678_10089226 | 3300026067 | Bacteria | 2635 |
| 647 | Ga0207678_10090342 | 3300026067 | Bacteria | 2618 |
| 648 | Ga0207678_10134977 | 3300026067 | Bacteria | 2106 |
| 649 | Ga0207708_10000625 | 3300026075 | Bacteria | 27213 |
| 650 | Ga0207702_10000009 | 3300026078 | Bacteria | 305906 |
| 651 | Ga0207702_10003312 | 3300026078 | Bacteria | 14814 |
| 652 | Ga0207702_10063706 | 3300026078 | Bacteria | 3153 |
| 653 | Ga0207648_10002355 | 3300026089 | Bacteria | 20391 |
| 654 | Ga0207648_10004982 | 3300026089 | Bacteria | 13500 |
| 655 | Ga0207648_10095195 | 3300026089 | Bacteria | 2604 |
| 656 | Ga0207674_10000397 | 3300026116 | Bacteria | 56299 |
| 657 | Ga0207674_10010237 | 3300026116 | Bacteria | 10650 |
| 658 | Ga0207674_10017991 | 3300026116 | Bacteria | 7697 |
| 659 | Ga0207674_10347741 | 3300026116 | Bacteria | 1433 |
| 660 | Ga0207675_100001604 | 3300026118 | Bacteria | 22664 |
| 661 | Ga0207683_10111066 | 3300026121 | Bacteria | 2454 |
| 662 | Ga0207683_10232477 | 3300026121 | Bacteria | 1681 |
| 663 | Ga0207698_10014530 | 3300026142 | Bacteria | 5238 |
| 664 | Ga0207698_10065689 | 3300026142 | Bacteria | 2851 |
| 665 | Ga0209281_1000067 | 3300027111 | Bacteria | 284517 |
| 666 | Ga0209371_1000202 | 3300027312 | Bacteria | 85989 |
| 667 | Ga0209969_1004120 | 3300027360 | Bacteria | 2032 |
| 668 | Ga0209999_1003558 | 3300027543 | Bacteria | 2792 |
| 669 | Ga0209282_1000033 | 3300027666 | Bacteria | 141940 |
| 670 | Ga0209966_1006723 | 3300027695 | Bacteria | 2002 |
| 671 | Ga0209974_10001890 | 3300027876 | Bacteria | 7649 |
| 672 | Ga0207428_10000610 | 3300027907 | Bacteria | 42207 |
| 673 | Ga0268266_10008498 | 3300028379 | Bacteria | 9126 |
| 674 | Ga0268265_10001521 | 3300028380 | Bacteria | 19348 |
| 675 | Ga0268264_10004412 | 3300028381 | Bacteria | 12005 |
| 676 | Ga0307515_10004238 | 3300028794 | Bacteria | 29780 |
| 677 | Ga0265338_10000104 | 3300028800 | Bacteria | 156596 |
| 678 | Ga0265338_10002059 | 3300028800 | Bacteria | 31074 |
| 679 | Ga0268256_1000189 | 3300030500 | Bacteria | 72206 |
| 680 | Ga0265332_10000003 | 3300031238 | Bacteria | 482849 |
| 681 | Ga0307513_10056718 | 3300031456 | Bacteria | 4179 |
| 682 | Ga0307408_100000213 | 3300031548 | Bacteria | 61855 |
| 683 | Ga0307408_100074334 | 3300031548 | Bacteria | 2521 |
| 684 | Ga0307514_10001218 | 3300031649 | Bacteria | 34108 |
| 685 | Ga0316575_10007847 | 3300031665 | Bacteria | 3874 |
| 686 | Ga0316579_10004816 | 3300031691 | Bacteria | 5394 |
| 687 | Ga0307516_10173917 | 3300031730 | Bacteria | 1892 |
| 688 | Ga0307405_10082886 | 3300031731 | Bacteria | 2100 |
| 689 | Ga0307406_10000379 | 3300031901 | Bacteria | 25615 |
| 690 | Ga0307412_10000008 | 3300031911 | Bacteria | 461034 |
| 691 | Ga0307412_10000313 | 3300031911 | Bacteria | 30726 |
| 692 | Ga0307412_10047229 | 3300031911 | Bacteria | 2826 |
| 693 | Ga0307412_10110941 | 3300031911 | Bacteria | 1958 |
| 694 | Ga0307409_100054512 | 3300031995 | Bacteria | 3080 |
| 695 | Ga0307416_100073487 | 3300032002 | Bacteria | 2851 |
| 696 | Ga0307416_100144279 | 3300032002 | Bacteria | 2170 |
| 697 | Ga0307411_10127758 | 3300032005 | Bacteria | 1852 |
| 698 | Ga0373926_0016944 | 3300035083 | Bacteria | 2496 |
| 699 | Ga0373932_0005248 | 3300035112 | Bacteria | 3045 |
| 700 | Ga0373941_0010662 | 3300035115 | Bacteria | 2355 |
| 701 | Ga0373945_0020026 | 3300035116 | Bacteria | 2287 |
| 702 | Ga0373954_0000965 | 3300035118 | Bacteria | 11269 |
| 703 | Ga0373942_0005016 | 3300035207 | Bacteria | 3070 |
| 704 | Ga0373942_0016979 | 3300035207 | Bacteria | 1790 |
| 705 | Ga0373924_0009778 | 3300035410 | Bacteria | 3523 |
| 706 | Ga0373931_0000627 | 3300035691 | Bacteria | 14664 |
| 707 | Ga0373935_0036155 | 3300035692 | Bacteria | 3086 |
| 708 | Ga0373927_0008584 | 3300035695 | Bacteria | 6865 |
| 709 | Ga0373927_0178052 | 3300035695 | Bacteria | 1394 |
| 710 | Ga0373933_0001980 | 3300035724 | Bacteria | 11811 |
| 711 | Ga0373937_0001198 | 3300036401 | Bacteria | 21774 |
| 712 | Ga0373937_0063950 | 3300036401 | Bacteria | 3384 |
| 713 | Ga0373937_0157198 | 3300036401 | Bacteria | 2131 |
| 714 | Ga0316582_0002737 | 3300036647 | Bacteria | 8379 |
| 715 | Ga0316584_0071096 | 3300036712 | Bacteria | 2608 |
| 716 | Ga0373925_0018211 | 3300037068 | Bacteria | 5102 |
| 717 | Ga0395899_0000041 | 3300037312 | Bacteria | 255615 |
| 718 | Ga0395899_0000369 | 3300037312 | Bacteria | 54244 |
| 719 | Ga0395899_0009696 | 3300037312 | Bacteria | 7389 |
| 720 | Ga0395899_0029160 | 3300037312 | Bacteria | 4150 |
| 721 | Ga0395899_0031912 | 3300037312 | Bacteria | 3958 |
| 722 | Ga0395899_0149924 | 3300037312 | Bacteria | 1653 |
| 723 | Ga0395900_0000562 | 3300037418 | Bacteria | 51703 |
| 724 | Ga0395900_0000664 | 3300037418 | Bacteria | 45818 |
| 725 | Ga0395900_0000916 | 3300037418 | Bacteria | 38759 |
| 726 | Ga0395900_0001108 | 3300037418 | Bacteria | 34263 |
| 727 | Ga0395900_0001745 | 3300037418 | Bacteria | 25018 |
| 728 | Ga0395900_0004872 | 3300037418 | Bacteria | 14141 |
| 729 | Ga0395900_0006936 | 3300037418 | Bacteria | 11752 |
| 730 | Ga0395900_0024941 | 3300037418 | Bacteria | 6120 |
| 731 | Ga0395900_0129008 | 3300037418 | Bacteria | 2592 |
| 732 | Ga0395900_0154913 | 3300037418 | Bacteria | 2340 |
| 733 | Ga0395900_0240025 | 3300037418 | Bacteria | 1818 |
| 734 | Ga0395898_0000220 | 3300037466 | Bacteria | 146473 |
| 735 | Ga0395898_0000305 | 3300037466 | Bacteria | 116565 |
| 736 | Ga0395898_0000526 | 3300037466 | Bacteria | 73315 |
| 737 | Ga0395898_0002771 | 3300037466 | Bacteria | 20150 |
| 738 | Ga0395898_0004697 | 3300037466 | Bacteria | 14869 |
| 739 | Ga0395898_0012225 | 3300037466 | Bacteria | 8875 |
| 740 | Ga0395898_0075124 | 3300037466 | Bacteria | 3264 |
| 741 | Ga0395898_0082597 | 3300037466 | Bacteria | 3097 |
| 742 | Ga0395905_0000098 | 3300037471 | Bacteria | 145524 |
| 743 | Ga0316581_0012152 | 3300037588 | Bacteria | 2420 |
| 744 | Ga0395901_0000011 | 3300038443 | Bacteria | 400724 |
| 745 | Ga0395901_0000106 | 3300038443 | Bacteria | 114313 |
| 746 | Ga0395901_0000161 | 3300038443 | Bacteria | 87191 |
| 747 | Ga0395901_0000264 | 3300038443 | Bacteria | 65306 |
| 748 | Ga0395901_0014650 | 3300038443 | Bacteria | 7968 |
| 749 | Ga0395901_0025384 | 3300038443 | Bacteria | 6083 |
| 750 | Ga0395901_0033268 | 3300038443 | Bacteria | 5321 |
| 751 | Ga0395901_0131237 | 3300038443 | Bacteria | 2633 |
| 752 | Ga0237819_01026 | 3300038705 | Bacteria | 8382 |
| 753 | Ga0436361_0310873 | 3300039447 | Bacteria | 6772 |
| 754 | Ga0436361_0560628 | 3300039447 | Bacteria | 1444 |
| 755 | Ga0436361_0710630 | 3300039447 | Bacteria | 3523 |
| 756 | Ga0436361_0762834 | 3300039447 | Bacteria | 4551 |
| 757 | Ga0439436_0000014 | 3300041404 | Bacteria | 90241 |
| 758 | Ga0451800_1450092 | 3300041459 | Bacteria | 3263 |
| 759 | Ga0451806_187053 | 3300041462 | Bacteria | 3256 |
| 760 | Ga0451804_1026683 | 3300041463 | Bacteria | 3238 |
| 761 | Ga0451807_0623916 | 3300041486 | Bacteria | 2204 |
| 762 | Ga0451807_0695512 | 3300041486 | Bacteria | 4717 |
| 763 | Ga0451833_0182207 | 3300041491 | Bacteria | 1795 |
| 764 | Ga0451837_1319545 | 3300041494 | Bacteria | 2719 |
| 765 | Ga0439448_0000048 | 3300042005 | Bacteria | 19349 |
| 766 | Ga0439432_012194 | 3300042006 | Bacteria | 2947 |
| 767 | Ga0439432_022323 | 3300042006 | Bacteria | 2090 |
| 768 | Ga0439449_0002257 | 3300042007 | Bacteria | 7574 |
| 769 | Ga0439462_0002003 | 3300042015 | Bacteria | 4663 |
| 770 | Ga0451577_0003226 | 3300042876 | Bacteria | 18332 |
| 771 | Ga0451577_0049719 | 3300042876 | Bacteria | 3744 |
| 772 | Ga0451577_0300538 | 3300042876 | Bacteria | 1454 |
| 773 | Ga0466986_0105408 | 3300044650 | Bacteria | 1941 |
| 774 | Ga0466969_0006333 | 3300044656 | Bacteria | 6299 |
| 775 | Ga0466969_0091015 | 3300044656 | Bacteria | 1445 |
| 776 | Ga0466977_0000251 | 3300044666 | Bacteria | 15079 |
| 777 | Ga0466965_0017578 | 3300044683 | Bacteria | 3419 |
| 778 | Ga0466965_0045797 | 3300044683 | Bacteria | 2164 |
| 779 | Ga0466965_0046718 | 3300044683 | Bacteria | 2143 |
| 780 | Ga0466966_0000066 | 3300044684 | Bacteria | 69299 |
| 781 | Ga0466966_0001282 | 3300044684 | Bacteria | 16095 |
| 782 | Ga0466966_0001306 | 3300044684 | Bacteria | 15966 |
| 783 | Ga0466966_0002967 | 3300044684 | Bacteria | 11167 |
| 784 | Ga0466966_0014396 | 3300044684 | Bacteria | 5236 |
| 785 | Ga0466961_0000037 | 3300044693 | Bacteria | 80759 |
| 786 | Ga0466961_0001025 | 3300044693 | Bacteria | 17250 |
| 787 | Ga0466961_0001819 | 3300044693 | Bacteria | 13234 |
| 788 | Ga0466961_0002289 | 3300044693 | Bacteria | 11895 |
| 789 | Ga0466961_0004677 | 3300044693 | Bacteria | 8597 |
| 790 | Ga0466961_0011658 | 3300044693 | Bacteria | 5618 |
| 791 | Ga0466961_0064455 | 3300044693 | Bacteria | 2328 |
| 792 | Ga0466961_0075592 | 3300044693 | Bacteria | 2135 |
| 793 | Ga0466961_0133514 | 3300044693 | Bacteria | 1555 |
| 794 | Ga0466964_0001424 | 3300044706 | Bacteria | 8167 |
| 795 | Ga0453684_0001711 | 3300044712 | Bacteria | 59001 |
| 796 | Ga0453684_0062698 | 3300044712 | Bacteria | 4760 |
| 797 | Ga0453684_0246769 | 3300044712 | Bacteria | 2052 |
| 798 | Ga0453684_0395396 | 3300044712 | Bacteria | 1549 |
| 799 | Ga0466971_0002547 | 3300044719 | Bacteria | 7710 |
| 800 | Ga0466971_0008785 | 3300044719 | Bacteria | 4408 |
| 801 | Ga0466971_0015190 | 3300044719 | Bacteria | 3388 |
| 802 | Ga0466968_0001142 | 3300044735 | Bacteria | 9419 |
| 803 | Ga0466968_0060701 | 3300044735 | Bacteria | 1630 |
| 804 | Ga0466970_0000887 | 3300044765 | Bacteria | 14425 |
| 805 | Ga0466970_0003586 | 3300044765 | Bacteria | 7568 |
| 806 | Ga0466970_0013134 | 3300044765 | Bacteria | 4244 |
| 807 | Ga0466970_0026176 | 3300044765 | Bacteria | 3057 |
| 808 | Ga0466970_0026386 | 3300044765 | Bacteria | 3044 |
| 809 | Ga0466970_0028758 | 3300044765 | Bacteria | 2922 |
| 810 | Ga0466957_0001282 | 3300044842 | Bacteria | 13102 |
| 811 | Ga0466957_0003699 | 3300044842 | Bacteria | 8447 |
| 812 | Ga0466957_0008319 | 3300044842 | Bacteria | 5899 |
| 813 | Ga0466957_0100372 | 3300044842 | Bacteria | 1824 |
| 814 | Ga0466959_0005357 | 3300045049 | Bacteria | 8780 |
| 815 | Ga0466959_0007018 | 3300045049 | Bacteria | 7872 |
| 816 | Ga0466959_0014534 | 3300045049 | Bacteria | 5725 |
| 817 | Ga0466959_0046266 | 3300045049 | Bacteria | 3202 |
| 818 | Ga0466959_0048152 | 3300045049 | Bacteria | 3133 |
| 819 | Ga0466959_0054373 | 3300045049 | Bacteria | 2925 |
| 820 | Ga0466959_0081281 | 3300045049 | Bacteria | 2335 |
| 821 | Ga0466959_0083856 | 3300045049 | Bacteria | 2294 |
| 822 | Ga0451576_0002027 | 3300045051 | Bacteria | 31971 |
| 823 | Ga0451576_0004679 | 3300045051 | Bacteria | 17624 |
| 824 | Ga0451576_0026245 | 3300045051 | Bacteria | 6266 |
| 825 | Ga0466958_0004028 | 3300045836 | Bacteria | 7706 |
| 826 | Ga0466958_0007166 | 3300045836 | Bacteria | 6113 |
| 827 | Ga0466958_0134431 | 3300045836 | Bacteria | 1554 |
| 828 | Ga0466967_0003164 | 3300045976 | Bacteria | 10613 |
| 829 | Ga0495617_000111 | 3300046452 | Bacteria | 59710 |
| 830 | Ga0495617_001833 | 3300046452 | Bacteria | 9020 |
| 831 | Ga0495592_0013065 | 3300046454 | Bacteria | 6318 |
| 832 | Ga0495592_0013791 | 3300046454 | Bacteria | 6145 |
| 833 | Ga0495592_0022670 | 3300046454 | Bacteria | 4776 |
| 834 | Ga0495592_0057950 | 3300046454 | Bacteria | 2858 |
| 835 | Ga0495603_0001289 | 3300046455 | Bacteria | 14609 |
| 836 | Ga0495603_0001360 | 3300046455 | Bacteria | 14207 |
| 837 | Ga0495603_0008459 | 3300046455 | Bacteria | 6214 |
| 838 | Ga0495590_0001198 | 3300046457 | Bacteria | 11339 |
| 839 | Ga0495590_0005800 | 3300046457 | Bacteria | 4852 |
| 840 | Ga0495590_0017409 | 3300046457 | Bacteria | 2587 |
| 841 | Ga0495591_000725 | 3300046458 | Bacteria | 23888 |
| 842 | Ga0495629_0000060 | 3300046459 | Bacteria | 100921 |
| 843 | Ga0495629_0000293 | 3300046459 | Bacteria | 43087 |
| 844 | Ga0495629_0003084 | 3300046459 | Bacteria | 12643 |
| 845 | Ga0495629_0017918 | 3300046459 | Bacteria | 5076 |
| 846 | Ga0495629_0018305 | 3300046459 | Bacteria | 5015 |
| 847 | Ga0495629_0077372 | 3300046459 | Bacteria | 2322 |
| 848 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 849 | Ga0495638_0000194 | 3300046460 | Bacteria | 88601 |
| 850 | Ga0495638_0000213 | 3300046460 | Bacteria | 81547 |
| 851 | Ga0495638_0000233 | 3300046460 | Bacteria | 75994 |
| 852 | Ga0495638_0003136 | 3300046460 | Bacteria | 13084 |
| 853 | Ga0495641_0014068 | 3300046461 | Bacteria | 4350 |
| 854 | Ga0495651_0102892 | 3300046462 | Bacteria | 2123 |
| 855 | Ga0495653_0003467 | 3300046463 | Bacteria | 12675 |
| 856 | Ga0495653_0005778 | 3300046463 | Bacteria | 10126 |
| 857 | Ga0495653_0016113 | 3300046463 | Bacteria | 6090 |
| 858 | Ga0495653_0073499 | 3300046463 | Bacteria | 2551 |
| 859 | Ga0495653_0304932 | 3300046463 | Bacteria | 1037 |
| 860 | Ga0495650_0000202 | 3300046471 | Bacteria | 129910 |
| 861 | Ga0495650_0001534 | 3300046471 | Bacteria | 21930 |
| 862 | Ga0495650_0011836 | 3300046471 | Bacteria | 4737 |
| 863 | Ga0495580_0001266 | 3300046472 | Bacteria | 22305 |
| 864 | Ga0495580_0005292 | 3300046472 | Bacteria | 10711 |
| 865 | Ga0495580_0008660 | 3300046472 | Bacteria | 8067 |
| 866 | Ga0495580_0010730 | 3300046472 | Bacteria | 7115 |
| 867 | Ga0495580_0011714 | 3300046472 | Bacteria | 6776 |
| 868 | Ga0495580_0029784 | 3300046472 | Bacteria | 3959 |
| 869 | Ga0495580_0081955 | 3300046472 | Bacteria | 2249 |
| 870 | Ga0495580_0122362 | 3300046472 | Bacteria | 1806 |
| 871 | Ga0495582_0018162 | 3300046473 | Bacteria | 3849 |
| 872 | Ga0495605_0002472 | 3300046474 | Bacteria | 11435 |
| 873 | Ga0495605_0006472 | 3300046474 | Bacteria | 6730 |
| 874 | Ga0495605_0010487 | 3300046474 | Bacteria | 5182 |
| 875 | Ga0495605_0014637 | 3300046474 | Bacteria | 4290 |
| 876 | Ga0495639_0022457 | 3300046475 | Bacteria | 2768 |
| 877 | Ga0495662_0013598 | 3300046476 | Bacteria | 3961 |
| 878 | Ga0495664_0000037 | 3300046477 | Bacteria | 70108 |
| 879 | Ga0495664_0002112 | 3300046477 | Bacteria | 10632 |
| 880 | Ga0495585_0000001 | 3300046492 | Bacteria | 609804 |
| 881 | Ga0495585_0013436 | 3300046492 | Bacteria | 4791 |
| 882 | Ga0495596_0000377 | 3300046500 | Bacteria | 28417 |
| 883 | Ga0495596_0003512 | 3300046500 | Bacteria | 7904 |
| 884 | Ga0495596_0012343 | 3300046500 | Bacteria | 3659 |
| 885 | Ga0495607_0000207 | 3300046501 | Bacteria | 62802 |
| 886 | Ga0495607_0020058 | 3300046501 | Bacteria | 4232 |
| 887 | Ga0495607_0097329 | 3300046501 | Bacteria | 1582 |
| 888 | Ga0495583_0004094 | 3300046506 | Bacteria | 10696 |
| 889 | Ga0495583_0011411 | 3300046506 | Bacteria | 5103 |
| 890 | Ga0495583_0060148 | 3300046506 | Bacteria | 1699 |
| 891 | Ga0495583_0067470 | 3300046506 | Bacteria | 1580 |
| 892 | Ga0495606_0013496 | 3300046507 | Bacteria | 6445 |
| 893 | Ga0495606_0020990 | 3300046507 | Bacteria | 4794 |
| 894 | Ga0495606_0030227 | 3300046507 | Bacteria | 3788 |
| 895 | Ga0495606_0057067 | 3300046507 | Bacteria | 2516 |
| 896 | Ga0495608_0013992 | 3300046511 | Bacteria | 5566 |
| 897 | Ga0495608_0014412 | 3300046511 | Bacteria | 5484 |
| 898 | Ga0495610_0001239 | 3300046512 | Bacteria | 22926 |
| 899 | Ga0495610_0003199 | 3300046512 | Bacteria | 12972 |
| 900 | Ga0495610_0016416 | 3300046512 | Bacteria | 4263 |
| 901 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 902 | Ga0495616_0005323 | 3300046513 | Bacteria | 7935 |
| 903 | Ga0495616_0038609 | 3300046513 | Bacteria | 2450 |
| 904 | Ga0495618_0022475 | 3300046514 | Bacteria | 3896 |
| 905 | Ga0495620_0000543 | 3300046515 | Bacteria | 23917 |
| 906 | Ga0495620_0004657 | 3300046515 | Bacteria | 7707 |
| 907 | Ga0495620_0004864 | 3300046515 | Bacteria | 7537 |
| 908 | Ga0495628_0017213 | 3300046516 | Bacteria | 6020 |
| 909 | Ga0495628_0017598 | 3300046516 | Bacteria | 5943 |
| 910 | Ga0495628_0031750 | 3300046516 | Bacteria | 4270 |
| 911 | Ga0495628_0032413 | 3300046516 | Bacteria | 4218 |
| 912 | Ga0495628_0064539 | 3300046516 | Bacteria | 2866 |
| 913 | Ga0495630_0021089 | 3300046517 | Bacteria | 4810 |
| 914 | Ga0495630_0021345 | 3300046517 | Bacteria | 4782 |
| 915 | Ga0495630_0078420 | 3300046517 | Bacteria | 2490 |
| 916 | Ga0495631_0000162 | 3300046518 | Bacteria | 45464 |
| 917 | Ga0495631_0000178 | 3300046518 | Bacteria | 43329 |
| 918 | Ga0495632_0028520 | 3300046519 | Bacteria | 2913 |
| 919 | Ga0495632_0076308 | 3300046519 | Bacteria | 1603 |
| 920 | Ga0495637_0010613 | 3300046520 | Bacteria | 4449 |
| 921 | Ga0495648_0000083 | 3300046524 | Bacteria | 121164 |
| 922 | Ga0495648_0004219 | 3300046524 | Bacteria | 12340 |
| 923 | Ga0495648_0004279 | 3300046524 | Bacteria | 12239 |
| 924 | Ga0495648_0006831 | 3300046524 | Bacteria | 9213 |
| 925 | Ga0495666_0001031 | 3300046526 | Bacteria | 13216 |
| 926 | Ga0495666_0002120 | 3300046526 | Bacteria | 9835 |
| 927 | Ga0495666_0005456 | 3300046526 | Bacteria | 6405 |
| 928 | Ga0495666_0043671 | 3300046526 | Bacteria | 2165 |
| 929 | Ga0495666_0045532 | 3300046526 | Bacteria | 2116 |
| 930 | Ga0495642_0020554 | 3300046528 | Bacteria | 2594 |
| 931 | Ga0495642_0029585 | 3300046528 | Bacteria | 2188 |
| 932 | Ga0495652_0006254 | 3300046529 | Bacteria | 11102 |
| 933 | Ga0495652_0056816 | 3300046529 | Bacteria | 3321 |
| 934 | Ga0495654_0007716 | 3300046530 | Bacteria | 5989 |
| 935 | Ga0495665_0004316 | 3300046531 | Bacteria | 7681 |
| 936 | Ga0495665_0007236 | 3300046531 | Bacteria | 5990 |
| 937 | Ga0495665_0026691 | 3300046531 | Bacteria | 3101 |
| 938 | Ga0495640_0012094 | 3300046533 | Bacteria | 6611 |
| 939 | Ga0495640_0016641 | 3300046533 | Bacteria | 5498 |
| 940 | Ga0495640_0017401 | 3300046533 | Bacteria | 5359 |
| 941 | Ga0495640_0051427 | 3300046533 | Bacteria | 2832 |
| 942 | Ga0495640_0051890 | 3300046533 | Bacteria | 2817 |
| 943 | Ga0495586_0000599 | 3300046535 | Bacteria | 20870 |
| 944 | Ga0495586_0013939 | 3300046535 | Bacteria | 4265 |
| 945 | Ga0495586_0052758 | 3300046535 | Bacteria | 2202 |
| 946 | Ga0495587_0014914 | 3300046536 | Bacteria | 4860 |
| 947 | Ga0495609_0000905 | 3300046538 | Bacteria | 21595 |
| 948 | Ga0495609_0001698 | 3300046538 | Bacteria | 14284 |
| 949 | Ga0495597_0000446 | 3300046542 | Bacteria | 35360 |
| 950 | Ga0495597_0005687 | 3300046542 | Bacteria | 6559 |
| 951 | Ga0495597_0012031 | 3300046542 | Bacteria | 4182 |
| 952 | Ga0495645_0001629 | 3300046543 | Bacteria | 15204 |
| 953 | Ga0495645_0011409 | 3300046543 | Bacteria | 6251 |
| 954 | Ga0495645_0038518 | 3300046543 | Bacteria | 3486 |
| 955 | Ga0495645_0081136 | 3300046543 | Bacteria | 2327 |
| 956 | Ga0495645_0109253 | 3300046543 | Bacteria | 1958 |
| 957 | Ga0495645_0119406 | 3300046543 | Bacteria | 1858 |
| 958 | Ga0495622_0076098 | 3300046557 | Bacteria | 1547 |
| 959 | Ga0495622_0090880 | 3300046557 | Bacteria | 1403 |
| 960 | Ga0495633_0033170 | 3300046558 | Bacteria | 2491 |
| 961 | Ga0495667_0059602 | 3300046559 | Bacteria | 2505 |
| 962 | Ga0495668_0011617 | 3300046616 | Bacteria | 5266 |
| 963 | Ga0495634_0133825 | 3300046642 | Bacteria | 1578 |
| 964 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 965 | Ga0495611_0001164 | 3300046648 | Bacteria | 13729 |
| 966 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 967 | Ga0495625_0001424 | 3300046660 | Bacteria | 29199 |
| 968 | Ga0495625_0047787 | 3300046660 | Bacteria | 3085 |
| 969 | Ga0495635_0072251 | 3300046663 | Bacteria | 2364 |
| 970 | Ga0495635_0111910 | 3300046663 | Bacteria | 1865 |
| 971 | Ga0495661_0001053 | 3300046665 | Bacteria | 24433 |
| 972 | Ga0495661_0020112 | 3300046665 | Bacteria | 4365 |
| 973 | Ga0495657_0036580 | 3300046675 | Bacteria | 3392 |
| 974 | Ga0495599_0007027 | 3300046678 | Bacteria | 6807 |
| 975 | Ga0495599_0014004 | 3300046678 | Bacteria | 4965 |
| 976 | Ga0495599_0017978 | 3300046678 | Bacteria | 4402 |
| 977 | Ga0495623_0040503 | 3300046679 | Bacteria | 2975 |
| 978 | Ga0495623_0074231 | 3300046679 | Bacteria | 2113 |
| 979 | Ga0495646_0004989 | 3300046680 | Bacteria | 8384 |
| 980 | Ga0495646_0005973 | 3300046680 | Bacteria | 7714 |
| 981 | Ga0495646_0012055 | 3300046680 | Bacteria | 5498 |
| 982 | Ga0495646_0014953 | 3300046680 | Bacteria | 4930 |
| 983 | Ga0495646_0016450 | 3300046680 | Bacteria | 4695 |
| 984 | Ga0495658_0002184 | 3300046683 | Bacteria | 9894 |
| 985 | Ga0495658_0089631 | 3300046683 | Bacteria | 1819 |
| 986 | Ga0495669_0088224 | 3300046684 | Bacteria | 1430 |
| 987 | Ga0495613_0019153 | 3300046689 | Bacteria | 5101 |
| 988 | Ga0495624_0005054 | 3300046690 | Bacteria | 9544 |
| 989 | Ga0495624_0019642 | 3300046690 | Bacteria | 4505 |
| 990 | Ga0495624_0022859 | 3300046690 | Bacteria | 4127 |
| 991 | Ga0495624_0026366 | 3300046690 | Bacteria | 3809 |
| 992 | Ga0495624_0039331 | 3300046690 | Bacteria | 3032 |
| 993 | Ga0495624_0051628 | 3300046690 | Bacteria | 2600 |
| 994 | Ga0495624_0063927 | 3300046690 | Bacteria | 2300 |
| 995 | Ga0495670_0002966 | 3300046691 | Bacteria | 8373 |
| 996 | Ga0495670_0018062 | 3300046691 | Bacteria | 3474 |
| 997 | Ga0495671_0000723 | 3300046692 | Bacteria | 23834 |
| 998 | Ga0495671_0001770 | 3300046692 | Bacteria | 13979 |
| 999 | Ga0495649_0003681 | 3300046694 | Bacteria | 10201 |
| 1000 | Ga0495649_0016295 | 3300046694 | Bacteria | 4212 |
| 1001 | Ga0495649_0039743 | 3300046694 | Bacteria | 2579 |
| 1002 | Ga0495589_0000314 | 3300046794 | Bacteria | 38602 |
| 1003 | Ga0495589_0005460 | 3300046794 | Bacteria | 6707 |
| 1004 | Ga0495600_0005463 | 3300046809 | Bacteria | 7663 |
| 1005 | Ga0495600_0005952 | 3300046809 | Bacteria | 7380 |
| 1006 | Ga0495600_0027891 | 3300046809 | Bacteria | 3651 |
| 1007 | Ga0495600_0075733 | 3300046809 | Bacteria | 2197 |
| 1008 | Ga0495660_0000008 | 3300046810 | Bacteria | 435769 |
| 1009 | Ga0495660_0000180 | 3300046810 | Bacteria | 68501 |
| 1010 | Ga0495660_0016577 | 3300046810 | Bacteria | 4248 |
| 1011 | Ga0495581_0004067 | 3300047315 | Bacteria | 8422 |
| 1012 | Ga0495581_0016353 | 3300047315 | Bacteria | 4315 |
| 1013 | Ga0495581_0022296 | 3300047315 | Bacteria | 3669 |
| 1014 | Ga0495604_0003896 | 3300047317 | Bacteria | 11883 |
| 1015 | Ga0495604_0027657 | 3300047317 | Bacteria | 4508 |
| 1016 | Ga0495604_0078425 | 3300047317 | Bacteria | 2479 |
| 1017 | Ga0495604_0086440 | 3300047317 | Bacteria | 2338 |
| 1018 | Ga0495604_0106357 | 3300047317 | Bacteria | 2052 |
| 1019 | Ga0495636_0003528 | 3300047318 | Bacteria | 6066 |
| 1020 | Ga0495674_0004951 | 3300047319 | Bacteria | 12810 |
| 1021 | Ga0495674_0020282 | 3300047319 | Bacteria | 6156 |
| 1022 | Ga0495672_0002823 | 3300047320 | Bacteria | 15467 |
| 1023 | Ga0495672_0023096 | 3300047320 | Bacteria | 4032 |
| 1024 | Ga0495676_0004601 | 3300047321 | Bacteria | 12639 |
| 1025 | Ga0495676_0114356 | 3300047321 | Bacteria | 1974 |
| 1026 | Ga0495680_0004438 | 3300047322 | Bacteria | 13404 |
| 1027 | Ga0495680_0023501 | 3300047322 | Bacteria | 5123 |
| 1028 | Ga0495680_0035180 | 3300047322 | Bacteria | 4036 |
| 1029 | Ga0495680_0082652 | 3300047322 | Bacteria | 2423 |
| 1030 | Ga0495683_0001386 | 3300047323 | Bacteria | 16060 |
| 1031 | Ga0495683_0010882 | 3300047323 | Bacteria | 4796 |
| 1032 | Ga0495683_0013641 | 3300047323 | Bacteria | 4246 |
| 1033 | Ga0495683_0023985 | 3300047323 | Bacteria | 3133 |
| 1034 | Ga0495683_0080169 | 3300047323 | Bacteria | 1593 |
| 1035 | Ga0495687_000025 | 3300047443 | Bacteria | 310498 |
| 1036 | Ga0495687_007690 | 3300047443 | Bacteria | 6298 |
| 1037 | Ga0495675_0013400 | 3300047444 | Bacteria | 5175 |
| 1038 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 1039 | Ga0495679_000038 | 3300047446 | Bacteria | 157311 |
| 1040 | Ga0495679_001513 | 3300047446 | Bacteria | 13139 |
| 1041 | Ga0495679_013297 | 3300047446 | Bacteria | 3098 |
| 1042 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 1043 | Ga0495673_0000030 | 3300047469 | Bacteria | 468915 |
| 1044 | Ga0495673_0000232 | 3300047469 | Bacteria | 81119 |
| 1045 | Ga0495686_0000077 | 3300047472 | Bacteria | 205924 |
| 1046 | Ga0495686_0007428 | 3300047472 | Bacteria | 8221 |
| 1047 | Ga0495686_0028109 | 3300047472 | Bacteria | 3664 |
| 1048 | Ga0495686_0040502 | 3300047472 | Bacteria | 2970 |
| 1049 | Ga0495593_0010609 | 3300047673 | Bacteria | 5313 |
| 1050 | Ga0495593_0049793 | 3300047673 | Bacteria | 2221 |
| 1051 | Ga0495602_0003086 | 3300048088 | Bacteria | 17124 |
| 1052 | Ga0495602_0013165 | 3300048088 | Bacteria | 8462 |
| 1053 | Ga0495602_0065068 | 3300048088 | Bacteria | 3148 |
| 1054 | Ga0495602_0133850 | 3300048088 | Bacteria | 1972 |
| 1055 | Ga0495614_0003454 | 3300048089 | Bacteria | 7069 |
| 1056 | Ga0495614_0022447 | 3300048089 | Bacteria | 2723 |
| 1057 | Ga0495626_0029076 | 3300048091 | Bacteria | 2677 |
| 1058 | Ga0496100_0001557 | 3300048903 | Bacteria | 11277 |
| 1059 | Ga0496100_0002914 | 3300048903 | Bacteria | 8785 |
| 1060 | Ga0496100_0007357 | 3300048903 | Bacteria | 6068 |
| 1061 | Ga0496101_0000612 | 3300048904 | Bacteria | 21816 |
| 1062 | Ga0496101_0001266 | 3300048904 | Bacteria | 15116 |
| 1063 | Ga0496101_0015890 | 3300048904 | Bacteria | 5079 |
| 1064 | Ga0496101_0146682 | 3300048904 | Bacteria | 1802 |
| 1065 | Ga0496102_0000459 | 3300048905 | Bacteria | 45591 |
| 1066 | Ga0496102_0005874 | 3300048905 | Bacteria | 10443 |
| 1067 | Ga0496102_0011545 | 3300048905 | Bacteria | 7621 |
| 1068 | Ga0496102_0066635 | 3300048905 | Bacteria | 3300 |
| 1069 | Ga0496102_0107158 | 3300048905 | Bacteria | 2602 |
| 1070 | Ga0496103_0000337 | 3300048906 | Bacteria | 42834 |
| 1071 | Ga0496103_0009338 | 3300048906 | Bacteria | 5810 |
| 1072 | Ga0496104_0137350 | 3300048907 | Bacteria | 2348 |
| 1073 | Ga0496105_0017452 | 3300048908 | Bacteria | 5756 |
| 1074 | Ga0496105_0111779 | 3300048908 | Bacteria | 2254 |
| 1075 | Ga0496105_0147632 | 3300048908 | Bacteria | 1934 |
| 1076 | Ga0496106_0000019 | 3300048909 | Bacteria | 174698 |
| 1077 | Ga0496106_0001680 | 3300048909 | Bacteria | 16557 |
| 1078 | Ga0496106_0039738 | 3300048909 | Bacteria | 3523 |
| 1079 | Ga0496110_0001369 | 3300048913 | Bacteria | 17558 |
| 1080 | Ga0496111_0009674 | 3300048914 | Bacteria | 6443 |
| 1081 | Ga0496112_0006477 | 3300048915 | Bacteria | 10287 |
| 1082 | Ga0496113_0002111 | 3300048916 | Bacteria | 11463 |
| 1083 | Ga0496114_0063683 | 3300048917 | Bacteria | 3087 |
| 1084 | Ga0496115_0000337 | 3300048918 | Bacteria | 39950 |
| 1085 | Ga0496115_0000901 | 3300048918 | Bacteria | 21555 |
| 1086 | Ga0496116_0012476 | 3300048919 | Bacteria | 6942 |
| 1087 | Ga0496116_0016236 | 3300048919 | Bacteria | 5838 |
| 1088 | Ga0496116_0021645 | 3300048919 | Bacteria | 4841 |
| 1089 | Ga0496116_0031133 | 3300048919 | Bacteria | 3825 |
| 1090 | Ga0496116_0037807 | 3300048919 | Bacteria | 3361 |
| 1091 | Ga0496116_0080352 | 3300048919 | Bacteria | 2025 |
| 1092 | Ga0496117_0002293 | 3300048920 | Bacteria | 24665 |
| 1093 | Ga0496117_0004900 | 3300048920 | Bacteria | 14416 |
| 1094 | Ga0496117_0014213 | 3300048920 | Bacteria | 6876 |
| 1095 | Ga0496117_0021313 | 3300048920 | Bacteria | 5248 |
| 1096 | Ga0496117_0027009 | 3300048920 | Bacteria | 4481 |
| 1097 | Ga0496117_0028072 | 3300048920 | Bacteria | 4363 |
| 1098 | Ga0496117_0032699 | 3300048920 | Bacteria | 3948 |
| 1099 | Ga0496117_0110476 | 3300048920 | Bacteria | 1714 |
| 1100 | Ga0496118_0000420 | 3300048921 | Bacteria | 70373 |
| 1101 | Ga0496118_0002548 | 3300048921 | Bacteria | 24410 |
| 1102 | Ga0496118_0010050 | 3300048921 | Bacteria | 9430 |
| 1103 | Ga0496118_0020384 | 3300048921 | Bacteria | 5879 |
| 1104 | Ga0496118_0030492 | 3300048921 | Bacteria | 4499 |
| 1105 | Ga0496118_0031291 | 3300048921 | Bacteria | 4414 |
| 1106 | Ga0496118_0047912 | 3300048921 | Bacteria | 3307 |
| 1107 | Ga0496118_0184817 | 3300048921 | Bacteria | 1254 |
| 1108 | Ga0496119_0000058 | 3300048922 | Bacteria | 173131 |
| 1109 | Ga0496119_0019951 | 3300048922 | Bacteria | 4910 |
| 1110 | Ga0496119_0057847 | 3300048922 | Bacteria | 2340 |
| 1111 | Ga0496120_0000184 | 3300048923 | Bacteria | 106643 |
| 1112 | Ga0496120_0000335 | 3300048923 | Bacteria | 78595 |
| 1113 | Ga0496120_0014808 | 3300048923 | Bacteria | 5174 |
| 1114 | Ga0496121_0000306 | 3300048924 | Bacteria | 102245 |
| 1115 | Ga0496121_0000310 | 3300048924 | Bacteria | 101522 |
| 1116 | Ga0496121_0000431 | 3300048924 | Bacteria | 82456 |
| 1117 | Ga0496121_0001587 | 3300048924 | Bacteria | 37821 |
| 1118 | Ga0496121_0003917 | 3300048924 | Bacteria | 20644 |
| 1119 | Ga0496121_0006654 | 3300048924 | Bacteria | 14228 |
| 1120 | Ga0496121_0007409 | 3300048924 | Bacteria | 13260 |
| 1121 | Ga0496121_0032998 | 3300048924 | Bacteria | 4695 |
| 1122 | Ga0496121_0036205 | 3300048924 | Bacteria | 4402 |
| 1123 | Ga0496121_0059448 | 3300048924 | Bacteria | 3151 |
| 1124 | Ga0496121_0083972 | 3300048924 | Bacteria | 2512 |
| 1125 | Ga0496121_0088612 | 3300048924 | Bacteria | 2425 |
| 1126 | Ga0496122_0000375 | 3300048925 | Bacteria | 95681 |
| 1127 | Ga0496122_0000865 | 3300048925 | Bacteria | 57024 |
| 1128 | Ga0496122_0006359 | 3300048925 | Bacteria | 13588 |
| 1129 | Ga0496122_0007677 | 3300048925 | Bacteria | 11891 |
| 1130 | Ga0496122_0084897 | 3300048925 | Bacteria | 2187 |
| 1131 | Ga0496123_0000203 | 3300048926 | Bacteria | 121361 |
| 1132 | Ga0496123_0000267 | 3300048926 | Bacteria | 104282 |
| 1133 | Ga0496123_0001951 | 3300048926 | Bacteria | 26821 |
| 1134 | Ga0496123_0007642 | 3300048926 | Bacteria | 10117 |
| 1135 | Ga0496123_0122905 | 3300048926 | Bacteria | 1455 |
| 1136 | Ga0496124_0000046 | 3300048927 | Bacteria | 287043 |
| 1137 | Ga0496124_0014584 | 3300048927 | Bacteria | 7591 |
| 1138 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 1139 | Ga0496125_0000499 | 3300048928 | Bacteria | 68475 |
| 1140 | Ga0496125_0002855 | 3300048928 | Bacteria | 21745 |
| 1141 | Ga0496125_0020330 | 3300048928 | Bacteria | 6231 |
| 1142 | Ga0496126_0000034 | 3300048929 | Bacteria | 362440 |
| 1143 | Ga0496126_0000706 | 3300048929 | Bacteria | 60980 |
| 1144 | Ga0496126_0002194 | 3300048929 | Bacteria | 27121 |
| 1145 | Ga0496126_0002232 | 3300048929 | Bacteria | 26785 |
| 1146 | Ga0496126_0009476 | 3300048929 | Bacteria | 10333 |
| 1147 | Ga0496126_0015371 | 3300048929 | Bacteria | 7700 |
| 1148 | Ga0496126_0016049 | 3300048929 | Bacteria | 7510 |
| 1149 | Ga0496126_0028263 | 3300048929 | Bacteria | 5345 |
| 1150 | Ga0496126_0108462 | 3300048929 | Bacteria | 2421 |
| 1151 | Ga0496126_0119748 | 3300048929 | Bacteria | 2284 |
| 1152 | Ga0496126_0243371 | 3300048929 | Bacteria | 1502 |
| 1153 | Ga0495678_000023 | 3300049459 | Bacteria | 233463 |
| 1154 | Ga0495678_018904 | 3300049459 | Bacteria | 3087 |
| 1155 | Ga0495682_0005399 | 3300049460 | Bacteria | 5315 |
| 1156 | Ga0495682_0006472 | 3300049460 | Bacteria | 4731 |
| 1157 | Ga0501031_0014372 | 3300049568 | Bacteria | 5147 |
| 1158 | Ga0501032_0012518 | 3300049569 | Bacteria | 6057 |
| 1159 | Ga0501033_0002347 | 3300049570 | Bacteria | 16140 |
| 1160 | Ga0501033_0007556 | 3300049570 | Bacteria | 8457 |
| 1161 | Ga0501033_0144939 | 3300049570 | Bacteria | 1716 |
| 1162 | Ga0501034_0000268 | 3300049571 | Bacteria | 94149 |
| 1163 | Ga0501034_0014340 | 3300049571 | Bacteria | 8165 |
| 1164 | Ga0501034_0028679 | 3300049571 | Bacteria | 5663 |
| 1165 | Ga0501036_0047363 | 3300049572 | Bacteria | 3641 |
| 1166 | Ga0501036_0071739 | 3300049572 | Bacteria | 2928 |
| 1167 | Ga0501036_0174845 | 3300049572 | Bacteria | 1808 |
| 1168 | Ga0501036_0263525 | 3300049572 | Bacteria | 1443 |
| 1169 | Ga0501037_0002084 | 3300049573 | Bacteria | 14498 |
| 1170 | Ga0501038_0018830 | 3300049574 | Bacteria | 6233 |
| 1171 | Ga0501038_0218532 | 3300049574 | Bacteria | 1521 |
| 1172 | Ga0501038_0220105 | 3300049574 | Bacteria | 1515 |
| 1173 | Ga0501038_0227818 | 3300049574 | Bacteria | 1484 |
| 1174 | Ga0501039_0016403 | 3300049575 | Bacteria | 5674 |
| 1175 | Ga0501039_0058323 | 3300049575 | Bacteria | 2990 |
| 1176 | Ga0501040_0008966 | 3300049576 | Bacteria | 6506 |
| 1177 | Ga0501040_0011763 | 3300049576 | Bacteria | 5725 |
| 1178 | Ga0501040_0162859 | 3300049576 | Bacteria | 1577 |
| 1179 | Ga0501041_0138624 | 3300049577 | Bacteria | 1516 |
| 1180 | Ga0501042_0006589 | 3300049578 | Bacteria | 7553 |
| 1181 | Ga0501042_0056597 | 3300049578 | Bacteria | 2798 |
| 1182 | Ga0501043_0053884 | 3300049579 | Bacteria | 3158 |
| 1183 | Ga0501046_0076996 | 3300049580 | Bacteria | 2583 |
| 1184 | Ga0501047_0002786 | 3300049581 | Bacteria | 16597 |
| 1185 | Ga0501047_0046666 | 3300049581 | Bacteria | 4187 |
| 1186 | Ga0501047_0047030 | 3300049581 | Bacteria | 4169 |
| 1187 | Ga0501048_0102808 | 3300049582 | Bacteria | 2016 |
| 1188 | Ga0501048_0109594 | 3300049582 | Bacteria | 1949 |
| 1189 | Ga0501067_0047374 | 3300049583 | Bacteria | 2384 |
| 1190 | Ga0501070_0000201 | 3300049586 | Bacteria | 56006 |
| 1191 | Ga0501070_0010763 | 3300049586 | Bacteria | 7731 |
| 1192 | Ga0501072_0096425 | 3300049588 | Bacteria | 2350 |
| 1193 | Ga0501072_0268942 | 3300049588 | Bacteria | 1356 |
| 1194 | Ga0501075_0040394 | 3300049591 | Bacteria | 3493 |
| 1195 | Ga0501075_0073090 | 3300049591 | Bacteria | 2593 |
| 1196 | Ga0501075_0243628 | 3300049591 | Bacteria | 1370 |
| 1197 | Ga0501076_0011826 | 3300049592 | Bacteria | 6517 |
| 1198 | Ga0501076_0017868 | 3300049592 | Bacteria | 5394 |
| 1199 | Ga0501076_0104755 | 3300049592 | Bacteria | 2283 |
| 1200 | Ga0501076_0190485 | 3300049592 | Bacteria | 1673 |
| 1201 | Ga0501079_0028464 | 3300049741 | Bacteria | 4288 |
| 1202 | Ga0501080_0082829 | 3300049742 | Bacteria | 2980 |
| 1203 | Ga0501081_0001856 | 3300049743 | Bacteria | 13124 |
| 1204 | Ga0501081_0006018 | 3300049743 | Bacteria | 7853 |
| 1205 | Ga0501081_0033190 | 3300049743 | Bacteria | 3506 |
| 1206 | Ga0501035_0012600 | 3300049822 | Bacteria | 7813 |
| 1207 | Ga0501035_0037213 | 3300049822 | Bacteria | 4408 |
| 1208 | Ga0501035_0072502 | 3300049822 | Bacteria | 3048 |
| 1209 | Ga0501035_0127926 | 3300049822 | Bacteria | 2216 |
| 1210 | Ga0501044_0000076 | 3300049823 | Bacteria | 120755 |
| 1211 | Ga0501044_0002174 | 3300049823 | Bacteria | 22485 |
| 1212 | Ga0501044_0003619 | 3300049823 | Bacteria | 17388 |
| 1213 | Ga0501044_0004747 | 3300049823 | Bacteria | 15193 |
| 1214 | Ga0501044_0007876 | 3300049823 | Bacteria | 11711 |
| 1215 | Ga0501044_0014630 | 3300049823 | Bacteria | 8460 |
| 1216 | Ga0501044_0106789 | 3300049823 | Bacteria | 2811 |
| 1217 | Ga0501044_0110316 | 3300049823 | Bacteria | 2760 |
| 1218 | Ga0501045_0002662 | 3300049824 | Bacteria | 12183 |
| 1219 | Ga0501045_0102389 | 3300049824 | Bacteria | 2120 |
| 1220 | nmdc:mga03n38_24395_c1 | 3300050490 | Bacteria | 2472 |
| 1221 | nmdc:mga00v17_109959_c1 | 3300050491 | Bacteria | 1748 |
| 1222 | nmdc:mga00v17_16444_c1 | 3300050491 | Bacteria | 4169 |
| 1223 | nmdc:mga00v17_7113_c1 | 3300050491 | Bacteria | 5960 |
| 1224 | nmdc:mga0yw44_133339_c1 | 3300050492 | Bacteria | 1610 |
| 1225 | nmdc:mga0k408_173163_c1 | 3300050493 | Bacteria | 1287 |
| 1226 | nmdc:mga0k408_4449_c1 | 3300050493 | Bacteria | 7437 |
| 1227 | nmdc:mga07m45_33869_c1 | 3300050496 | Bacteria | 2838 |
| 1228 | nmdc:mga07m45_3597_c1 | 3300050496 | Bacteria | 7490 |
| 1229 | nmdc:mga07m45_76859_c1 | 3300050496 | Bacteria | 1904 |
| 1230 | nmdc:mga05p37_758_c1 | 3300050507 | Bacteria | 35839 |
| 1231 | nmdc:mga09592_1050_c1 | 3300050508 | Bacteria | 21887 |
| 1232 | nmdc:mga09592_110466_c1 | 3300050508 | Bacteria | 2359 |
| 1233 | nmdc:mga0qj67_2437_c1 | 3300050509 | Bacteria | 13248 |
| 1234 | nmdc:mga0qj67_32479_c1 | 3300050509 | Bacteria | 4071 |
| 1235 | nmdc:mga0qj67_36310_c1 | 3300050509 | Bacteria | 3855 |
| 1236 | nmdc:mga0qj67_8037_c1 | 3300050509 | Bacteria | 7804 |
| 1237 | nmdc:mga06r32_5201_c1 | 3300050510 | Bacteria | 11693 |
| 1238 | nmdc:mga08y16_166325_c1 | 3300050511 | Bacteria | 2291 |
| 1239 | nmdc:mga08y16_22033_c1 | 3300050511 | Bacteria | 6728 |
| 1240 | nmdc:mga08y16_254907_c1 | 3300050511 | Bacteria | 1813 |
| 1241 | nmdc:mga0n895_1569_c1 | 3300050512 | Bacteria | 17184 |
| 1242 | nmdc:mga0n895_2878_c1 | 3300050512 | Bacteria | 13655 |
| 1243 | nmdc:mga0n895_47507_c1 | 3300050512 | Bacteria | 4197 |
| 1244 | nmdc:mga0rr50_2095_c1 | 3300050513 | Bacteria | 11151 |
| 1245 | nmdc:mga08x19_1254_c1 | 3300050514 | Bacteria | 15744 |
| 1246 | nmdc:mga08x19_16509_c1 | 3300050514 | Bacteria | 4504 |
| 1247 | nmdc:mga08x19_16751_c1 | 3300050514 | Bacteria | 4475 |
| 1248 | nmdc:mga08x19_303_c1 | 3300050514 | Bacteria | 35609 |
| 1249 | nmdc:mga08x19_48686_c1 | 3300050514 | Bacteria | 2716 |
| 1250 | nmdc:mga0a205_147036_c1 | 3300050515 | Bacteria | 2257 |
| 1251 | nmdc:mga0a205_27603_c1 | 3300050515 | Bacteria | 5421 |
| 1252 | nmdc:mga0a205_599_c1 | 3300050515 | Bacteria | 28654 |
| 1253 | Ga0495601_0011862 | 3300053077 | Bacteria | 5225 |
| 1254 | Ga0500610_0000821 | 3300053079 | Bacteria | 9897 |
| 1255 | Ga0495619_0063625 | 3300053085 | Bacteria | 2458 |
| 1256 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 1257 | Ga0500555_000716 | 3300053103 | Bacteria | 12470 |
| 1258 | Ga0500593_000835 | 3300053117 | Bacteria | 11522 |
| 1259 | Ga0500595_001911 | 3300053119 | Bacteria | 10732 |
| 1260 | Ga0500607_001548 | 3300053121 | Bacteria | 20411 |
| 1261 | Ga0500618_000877 | 3300053125 | Bacteria | 16018 |
| 1262 | Ga0500618_001593 | 3300053125 | Bacteria | 9868 |
| 1263 | Ga0500618_005380 | 3300053125 | Bacteria | 3905 |
| 1264 | Ga0500652_079452 | 3300053131 | Bacteria | 1365 |
| 1265 | Ga0500574_005155 | 3300053141 | Bacteria | 2517 |
| 1266 | Ga0500600_0012736 | 3300053149 | Bacteria | 5107 |
| 1267 | Ga0500627_0069699 | 3300053158 | Bacteria | 1556 |
| 1268 | Ga0500633_0001927 | 3300053160 | Bacteria | 4100 |
| 1269 | Ga0500645_000704 | 3300053730 | Bacteria | 20751 |
| 1270 | Ga0501084_0144421 | 3300054114 | Bacteria | 2004 |
| 1271 | Ga0501082_0016248 | 3300060353 | Bacteria | 6407 |
| 1272 | Ga0501082_0130687 | 3300060353 | Bacteria | 2179 |
| 1273 | Ga0466962_0000994 | 3300061719 | Bacteria | 12945 |
| 1274 | Ga0466962_0008295 | 3300061719 | Bacteria | 4978 |
| 1275 | Ga0530510_0007953 | 3300061734 | Bacteria | 7398 |
| 1276 | 2501073341 | 2501025501 | Bacteria | 7768574 |
| 1277 | 2501082663 | 2501025502 | Bacteria | 9641094 |
| 1278 | 2501408403 | 2501025504 | Bacteria | 8008976 |
| 1279 | 2509132288 | 2508501125 | Bacteria | 7208311 |
| 1280 | 2510251804 | 2510065045 | Bacteria | 7761063 |
| 1281 | 2511086004 | 2510917013 | Bacteria | 9951648 |
| 1282 | 2511096138 | 2510917014 | Bacteria | 8296963 |
| 1283 | 2511103139 | 2510917015 | Bacteria | 7950052 |
| 1284 | 2511248956 | 2511231003 | Bacteria | 5606035 |
| 1285 | 2511387491 | 2511231026 | Bacteria | 5225445 |
| 1286 | 2512345227 | 2512047030 | Bacteria | 9031815 |
| 1287 | 2513563427 | 2513237083 | Bacteria | 8410967 |
| 1288 | 2513956525 | 2513237150 | Bacteria | 6553639 |
| 1289 | 2513961449 | 2513237151 | Bacteria | 6309801 |
| 1290 | 2514044194 | 2513237165 | Bacteria | 6771773 |
| 1291 | 2514050936 | 2513237166 | Bacteria | 10373764 |
| 1292 | 2515684318 | 2515154122 | Bacteria | 8609520 |
| 1293 | 2515691611 | 2515154123 | Bacteria | 6387382 |
| 1294 | 2516022437 | 2515154189 | Bacteria | 9629850 |
| 1295 | 2519458237 | 2519103095 | Bacteria | 6629912 |
| 1296 | 2521557584 | 2521172590 | Bacteria | 5047645 |
| 1297 | 2527080748 | 2526164713 | Bacteria | 6780608 |
| 1298 | 2538833115 | 2537561836 | Bacteria | 3910579 |
| 1299 | 2548501096 | 2547132374 | Bacteria | 5530232 |
| 1300 | 2550696232 | 2548876994 | Bacteria | 4904866 |
| 1301 | 2553006612 | 2551306416 | Bacteria | 6152985 |
| 1302 | 2563059230 | 2562617112 | Bacteria | 10918404 |
| 1303 | 2585294710 | 2582581311 | Bacteria | 6763856 |
| 1304 | 2597028872 | 2596583598 | Bacteria | 5251611 |
| 1305 | 2599445560 | 2599185178 | Bacteria | 5365746 |
| 1306 | 2599738098 | 2599185239 | Bacteria | 8686614 |
| 1307 | 2599742530 | 2599185240 | Bacteria | 7968121 |
| 1308 | 2599903203 | 2599185292 | Bacteria | 6290804 |
| 1309 | 2600204648 | 2599185355 | Bacteria | 7968906 |
| 1310 | 2600810828 | 2600255067 | Bacteria | 6795583 |
| 1311 | 2643831586 | 2643221562 | Bacteria | 4048635 |
| 1312 | 2643862305 | 2643221569 | Bacteria | 6064337 |
| 1313 | 2643866797 | 2643221570 | Bacteria | 5103772 |
| 1314 | 2643893955 | 2643221577 | Bacteria | 3710843 |
| 1315 | 2643980669 | 2643221594 | Bacteria | 5811388 |
| 1316 | 2643993519 | 2643221596 | Bacteria | 5006805 |
| 1317 | 2644062638 | 2643221609 | Bacteria | 6756331 |
| 1318 | 2644076348 | 2643221611 | Bacteria | 6820941 |
| 1319 | 2644122097 | 2643221621 | Bacteria | 6212786 |
| 1320 | 2644294656 | 2643221652 | Bacteria | 5140275 |
| 1321 | 2644476174 | 2643221685 | Bacteria | 3673288 |
| 1322 | 2644645810 | 2643221717 | Bacteria | 5676132 |
| 1323 | 2676741634 | 2675903129 | Bacteria | 7964495 |
| 1324 | 2713479837 | 2711768613 | Bacteria | 11048459 |
| 1325 | 2719640915 | 2718217991 | Bacteria | 7829542 |
| 1326 | 2722882785 | 2721755523 | Bacteria | 6430384 |
| 1327 | 2723876549 | 2721755763 | Bacteria | 4464185 |
| 1328 | 2735836770 | 2734482264 | Unclassified | 5014763 |
| 1329 | 2738818999 | 2738541296 | Bacteria | 7285013 |
| 1330 | 2738830845 | 2738541298 | Bacteria | 7286732 |
| 1331 | 2738872372 | 2738541306 | Bacteria | 7284992 |
| 1332 | 2739184002 | 2738543002 | Bacteria | 7284546 |
| 1333 | 2739218972 | 2738543008 | Bacteria | 7282815 |
| 1334 | 2739228686 | 2738543009 | Bacteria | 4944499 |
| 1335 | 2739244678 | 2738543012 | Bacteria | 7115078 |
| 1336 | 2739252239 | 2738543013 | Bacteria | 5618633 |
| 1337 | 2739612173 | 2739367655 | Bacteria | 4051151 |
| 1338 | 2739732001 | 2739367700 | Bacteria | 4747630 |
| 1339 | 2746088176 | 2744054900 | Bacteria | 8399525 |
| 1340 | 2746096930 | 2744054901 | Bacteria | 8397047 |
| 1341 | 2748019447 | 2747842501 | Bacteria | 5293829 |
| 1342 | 2753571040 | 2751185846 | Bacteria | 7242164 |
| 1343 | 2765570251 | 2765235838 | Bacteria | 5445269 |
| 1344 | 2792834002 | 2791355137 | Bacteria | 9654227 |
| 1345 | 2808970007 | 2808606384 | Bacteria | 8474373 |
| 1346 | 2808984390 | 2808606386 | Bacteria | 4471946 |
| 1347 | 2809005146 | 2808606390 | Bacteria | 8476311 |
| 1348 | 2809011713 | 2808606391 | Bacteria | 8308166 |
| 1349 | 2809032014 | 2808606395 | Bacteria | 6020352 |
| 1350 | 2809130744 | 2808606415 | Bacteria | 4576710 |
| 1351 | 2809149778 | 2808606419 | Bacteria | 4576925 |
| 1352 | 2816475119 | 2816332133 | Bacteria | 7249298 |
| 1353 | 2817260388 | 2816332253 | Bacteria | 6764532 |
| 1354 | 2817278076 | 2816332256 | Bacteria | 6891714 |
| 1355 | 2817455643 | 2816332286 | Bacteria | 6853759 |
| 1356 | 2819544245 | 2818991436 | Bacteria | 5376622 |
| 1357 | 2819591419 | 2818991445 | Bacteria | 4955017 |
| 1358 | 2819615276 | 2818991449 | Bacteria | 5518009 |
| 1359 | 2819623564 | 2818991450 | Bacteria | 6962147 |
| 1360 | 2819632914 | 2818991452 | Bacteria | 8442785 |
| 1361 | 2834644904 | 2834641062 | Bacteria | 5559922 |
| 1362 | 2839096804 | 2839094727 | Bacteria | 5534556 |
| 1363 | 2839138516 | 2839138175 | Bacteria | 6549354 |
| 1364 | 2842325092 | 2842324504 | Bacteria | 9364110 |
| 1365 | 2842349370 | 2842348783 | Bacteria | 9002918 |
| 1366 | 2842459888 | 2842454564 | Bacteria | 8730687 |
| 1367 | 2842719770 | 2842718218 | Bacteria | 4560148 |
| 1368 | 2842918932 | 2842918807 | Bacteria | 4289178 |
| 1369 | 2852620081 | 2852618963 | Bacteria | 4577824 |
| 1370 | 2852687714 | 2852684882 | Bacteria | 5463342 |
| 1371 | 2855734619 | 2855730933 | Bacteria | 7047938 |
| 1372 | 2855770209 | 2855767633 | Bacteria | 7049357 |
| 1373 | 2857361004 | 2857357740 | Bacteria | 9937880 |
| 1374 | 2857538493 | 2857537821 | Bacteria | 5248181 |
| 1375 | 2857546604 | 2857542790 | Bacteria | 5326616 |
| 1376 | 2858955765 | 2858950400 | Bacteria | 6783797 |
| 1377 | 2863421925 | 2863421361 | Bacteria | 7300805 |
| 1378 | 2870072133 | 2870068957 | Bacteria | 8925310 |
| 1379 | 2881414430 | 2881412998 | Bacteria | 6492157 |
| 1380 | 2883088027 | 2883087390 | Bacteria | 9532701 |
| 1381 | 2884340366 | 2884338543 | Bacteria | 4610696 |
| 1382 | 2884413860 | 2884411467 | Bacteria | 5246714 |
| 1383 | 2884812895 | 2884811622 | Bacteria | 5552861 |
| 1384 | 2884812901 | 2884811622 | Bacteria | 5552861 |
| 1385 | 2884837223 | 2884836552 | Bacteria | 5219991 |
| 1386 | 2884853514 | 2884852848 | Bacteria | 5221161 |
| 1387 | 2885266779 | 2885266251 | Bacteria | 4796748 |
| 1388 | 2885271087 | 2885270888 | Bacteria | 9831543 |
| 1389 | 2887377871 | 2887375801 | Bacteria | 5334027 |
| 1390 | 2894026031 | 2894023352 | Bacteria | 5167372 |
| 1391 | 2895397007 | 2895395659 | Bacteria | 3983269 |
| 1392 | 2895501385 | 2895498888 | Bacteria | 5283788 |
| 1393 | 2895514528 | 2895511927 | Bacteria | 6802080 |
| 1394 | 2895523990 | 2895522137 | Bacteria | 3284416 |
| 1395 | 2895527478 | 2895525241 | Bacteria | 3388457 |
| 1396 | 2896155369 | 2896154374 | Bacteria | 5221518 |
| 1397 | 2900578647 | 2900577576 | Bacteria | 5438534 |
| 1398 | 2900637816 | 2900634093 | Bacteria | 10263517 |
| 1399 | 2901312876 | 2901300506 | Bacteria | 8463898 |
| 1400 | 2902687098 | 2902682994 | Bacteria | 8951596 |
| 1401 | 2904436949 | 2904434214 | Bacteria | 6230908 |
| 1402 | 2904441706 | 2904439833 | Bacteria | 5931679 |
| 1403 | 2904463563 | 2904463128 | Bacteria | 4775606 |
| 1404 | 2904480842 | 2904479285 | Bacteria | 5073931 |
| 1405 | 2904487413 | 2904483920 | Bacteria | 7545285 |
| 1406 | 2904531372 | 2904530477 | Bacteria | 5876334 |
| 1407 | 2904566090 | 2904564687 | Bacteria | 7609577 |
| 1408 | 2904573134 | 2904571731 | Bacteria | 7608790 |
| 1409 | 2904586973 | 2904584206 | Bacteria | 6028872 |
| 1410 | 2904592994 | 2904589729 | Bacteria | 6113573 |
| 1411 | 2904603193 | 2904601388 | Bacteria | 5884906 |
| 1412 | 2904623551 | 2904615490 | Bacteria | 10047340 |
| 1413 | 2919050987 | 2919046199 | Bacteria | 5567169 |
| 1414 | 2919082044 | 2919079590 | Bacteria | 5946433 |
| 1415 | 2919405256 | 2919404418 | Bacteria | 4232372 |
| 1416 | 2919528720 | 2919527303 | Bacteria | 7718827 |
| 1417 | 2921648338 | 2921643360 | Bacteria | 11448031 |
| 1418 | 2923516281 | 2923510766 | Bacteria | 5926163 |
| 1419 | 2928062895 | 2928058823 | Bacteria | 5520022 |
| 1420 | 2928110849 | 2928108538 | Bacteria | 7360024 |
| 1421 | 2928135075 | 2928130867 | Bacteria | 5467269 |
| 1422 | 2928137593 | 2928135762 | Bacteria | 7259641 |
| 1423 | 2928159494 | 2928157003 | Bacteria | 7522202 |
| 1424 | 2928164446 | 2928163908 | Bacteria | 7561269 |
| 1425 | 2928177570 | 2928170801 | Bacteria | 8785406 |
| 1426 | 2928510229 | 2928503688 | Bacteria | 7268108 |
| 1427 | 2928538344 | 2928536128 | Bacteria | 7657547 |
| 1428 | 2928964694 | 2928963466 | Bacteria | 5165703 |
| 1429 | 2939614199 | 2939611941 | Bacteria | 3892017 |
| 1430 | 2939631547 | 2939631187 | Bacteria | 6118131 |
| 1431 | 2941481907 | |||
| 1432 | 2945937679 | 2945934425 | Bacteria | 7444609 |
| 1433 | 2974323846 | 2974320154 | Bacteria | 4571377 |
| 1434 | 2981993928 | 2981990288 | Bacteria | 7590678 |
| 1435 | 2990705603 | 2990703756 | Bacteria | 7715990 |
| 1436 | 2990712755 | 2990710928 | Bacteria | 5002431 |
| 1437 | 642427189 | 641736151 | Bacteria | 7477263 |
| 1438 | 642417817 | 641736154 | Bacteria | 7689995 |
| 1439 | 642592578 | 642555112 | Bacteria | 8676562 |
| 1440 | 642622500 | 642555113 | Bacteria | 8214658 |
| 1441 | 644748408 | 644736347 | Bacteria | 6476522 |
| 1442 | 8002395026 | 8002392321 | Bacteria | 4159911 |
| 1443 | 8003401744 | 8003400568 | Bacteria | 5535898 |
| 1444 | 8003957814 | 8003955200 | Bacteria | 8601927 |
| 1445 | 8018850359 | 8018845410 | Bacteria | 8933938 |
| 1446 | 8020808859 | 8020807995 | Bacteria | 6801506 |
| 1447 | 8020939385 | 8020938398 | Bacteria | 7472757 |
| 1448 | 8020947212 | 8020945358 | Bacteria | 8467355 |
| 1449 | 8020954391 | 8020953355 | Bacteria | 7439080 |
| 1450 | 8021122821 | 8021120328 | Bacteria | 8782274 |
| 1451 | 8039102758 | 8039098773 | Bacteria | 6602928 |
| 1452 | 8040169310 | 8040167225 | Bacteria | 6542727 |
| 1453 | 8040174987 | 8040173305 | Bacteria | 6827067 |
| 1454 | 8048749749 | 8048746797 | Bacteria | 3557226 |
| 1455 | 8055227965 | 8055225921 | Bacteria | 3341787 |
| 1456 | 8055266965 | 8055266321 | Bacteria | 7999742 |
| 1457 | 8055301719 | 8055301274 | Bacteria | 8587385 |
| 1458 | Ga0495686_0000032 | |||
| 1459 | JGI24741J21665_1000010 | |||
| 1460 | JGI24740J21852_10000304 | |||
| 1461 | JGI24740J21852_10000783 | |||
| 1462 | JGI24740J21852_10000978 | |||
| 1463 | JGI24740J21852_10003282 | |||
| 1464 | JGI24739J22299_10000112 | |||
| 1465 | JGI24739J22299_10003808 | |||
| 1466 | JGI24739J22299_10013313 | |||
| 1467 | JGI24739J22299_10025297 | |||
| 1468 | JGI24737J22298_10012110 | |||
| 1469 | JGI24737J22298_10023387 | |||
| 1470 | JGI24735J21928_10000665 | |||
| 1471 | JGI24735J21928_10000684 | |||
| 1472 | JGI24735J21928_10011596 | |||
| 1473 | JGI24735J21928_10018786 | |||
| 1474 | JGI24735J21928_10035330 | |||
| 1475 | JGI24738J21930_10001352 | |||
| 1476 | JGI25155J39150_1000126 | |||
| 1477 | JGI25155J39150_1000177 | |||
| 1478 | JGI25156J39149_1000057 | |||
| 1479 | JGI25156J39149_1000214 | |||
| 1480 | JGI25156J39149_1001009 | |||
| 1481 | JGI25156J39149_1001319 | |||
| 1482 | JGI25156J39149_1002562 | |||
| 1483 | JGI25156J39149_1002845 | |||
| 1484 | JGI25156J39149_1005837 | |||
| 1485 | JGI25156J39149_1009942 | |||
| 1486 | JGI25162J39368_1000138 | |||
| 1487 | JGI25162J39368_1000443 | |||
| 1488 | JGI25162J39368_1000786 | |||
| 1489 | JGI25162J39368_1001136 | |||
| 1490 | JGI25162J39368_1003039 | |||
| 1491 | JGI25154J39366_1000087 | |||
| 1492 | JGI25154J39366_1000206 | |||
| 1493 | JGI25154J39366_1001056 | |||
| 1494 | JGI25157J39369_1000156 | |||
| 1495 | JGI25157J39369_1000172 | |||
| 1496 | JGI25157J39369_1000441 | |||
| 1497 | JGI25157J39369_1000643 | |||
| 1498 | JGI25157J39369_1000992 | |||
| 1499 | JGI25157J39369_1002371 | |||
| 1500 | JGI25163J39215_1000278 | |||
| 1501 | JGI25164J39214_1000170 | |||
| 1502 | JGI25164J39214_1000310 | |||
| 1503 | JGI25164J39214_1000375 | |||
| 1504 | JGI25164J39214_1001368 | |||
| 1505 | JGI25164J39214_1001375 | |||
| 1506 | JGI25151J46595_10005080 | |||
| 1507 | JGI25151J46595_10011877 | |||
| 1508 | JGI25165J46597_1000105 | |||
| 1509 | JGI25165J46597_1000224 | |||
| 1510 | JGI25165J46597_1000549 | |||
| 1511 | JGI25165J46597_1000580 | |||
| 1512 | JGI25165J46597_1002481 | |||
| 1513 | JGI25165J46597_1002491 | |||
| 1514 | JGI25153J46596_10006045 | |||
| 1515 | rootH1_10022880 | |||
| 1516 | rootH2_10000174 | |||
| 1517 | rootH2_10006665 | |||
| 1518 | rootL2_10098200 | |||
| 1519 | JGI25160J50197_1000082 | |||
| 1520 | Ga0055538_1000043 | |||
| 1521 | Ga0055538_1000045 | |||
| 1522 | Ga0055538_1002105 | |||
| 1523 | Ga0055539_1000034 | |||
| 1524 | Ga0055539_1000057 | |||
| 1525 | Ga0055539_1000064 | |||
| 1526 | Ga0055533_1000071 | |||
| 1527 | Ga0055533_1000074 | |||
| 1528 | Ga0055533_1000540 | |||
| 1529 | Ga0055533_1001327 | |||
| 1530 | Ga0055532_1000002 | |||
| 1531 | Ga0055532_1000016 | |||
| 1532 | Ga0055532_1000039 | |||
| 1533 | Ga0055532_1000643 | |||
| 1534 | Ga0055532_1000713 | |||
| 1535 | Ga0055532_1000720 | |||
| 1536 | Ga0055525_1000085 | |||
| 1537 | Ga0055525_1000092 | |||
| 1538 | Ga0055525_1000192 | |||
| 1539 | Ga0055525_1000313 | |||
| 1540 | Ga0055525_1000473 | |||
| 1541 | Ga0055527_1000024 | |||
| 1542 | Ga0055527_1000041 | |||
| 1543 | Ga0055527_1000234 | |||
| 1544 | Ga0055527_1000276 | |||
| 1545 | Ga0055527_1001073 | |||
| 1546 | Ga0055535_1000028 | |||
| 1547 | Ga0055535_1000193 | |||
| 1548 | Ga0055535_1000216 | |||
| 1549 | Ga0055535_1000457 | |||
| 1550 | Ga0055535_1000502 | |||
| 1551 | Ga0055535_1001000 | |||
| 1552 | Ga0055535_1001317 | |||
| 1553 | Ga0055535_1001326 | |||
| 1554 | Ga0055535_1003753 | |||
| 1555 | Ga0055542_1000047 | |||
| 1556 | Ga0055542_1000136 | |||
| 1557 | Ga0055542_1000152 | |||
| 1558 | Ga0055542_1000179 | |||
| 1559 | Ga0055542_1000183 | |||
| 1560 | Ga0055542_1000520 | |||
| 1561 | Ga0055542_1001547 | |||
| 1562 | Ga0055542_1001665 | |||
| 1563 | Ga0055542_1003689 | |||
| 1564 | Ga0055529_1000028 | |||
| 1565 | Ga0055529_1000054 | |||
| 1566 | Ga0055529_1000189 | |||
| 1567 | Ga0055529_1000254 | |||
| 1568 | Ga0055529_1000552 | |||
| 1569 | Ga0055529_1001001 | |||
| 1570 | Ga0055526_1011699 | |||
| 1571 | Ga0055526_1017490 | |||
| 1572 | Ga0055524_1006917 | |||
| 1573 | Ga0055536_1000087 | |||
| 1574 | Ga0055534_1000910 | |||
| 1575 | Ga0055534_1001301 | |||
| 1576 | Ga0055534_1001898 | |||
| 1577 | Ga0055528_1004561 | |||
| 1578 | Ga0055541_1000044 | |||
| 1579 | Ga0055541_1000046 | |||
| 1580 | Ga0055541_1008710 | |||
| 1581 | Ga0058692_1002802 | |||
| 1582 | Ga0065165_1000250 | |||
| 1583 | Ga0065165_1000790 | |||
| 1584 | Ga0065704_10081336 | |||
| 1585 | Ga0065715_10187709 | |||
| 1586 | Ga0065707_10111924 | |||
| 1587 | Ga0070658_10071329 | |||
| 1588 | Ga0070658_10144004 | |||
| 1589 | Ga0070676_10054594 | |||
| 1590 | Ga0070683_100059687 | |||
| 1591 | Ga0070690_100001754 | |||
| 1592 | Ga0070670_100055684 | |||
| 1593 | Ga0070670_100139443 | |||
| 1594 | Ga0068869_100001435 | |||
| 1595 | Ga0070666_10046595 | |||
| 1596 | Ga0070680_100000789 | |||
| 1597 | Ga0070680_100022650 | |||
| 1598 | Ga0070680_100055318 | |||
| 1599 | Ga0070680_100173530 | |||
| 1600 | Ga0070682_100003408 | |||
| 1601 | Ga0070682_100035827 | |||
| 1602 | Ga0068868_100001331 | |||
| 1603 | Ga0070660_100000016 | |||
| 1604 | Ga0070660_100011617 | |||
| 1605 | Ga0070689_100000776 | |||
| 1606 | Ga0070689_100047885 | |||
| 1607 | Ga0070691_10029459 | |||
| 1608 | Ga0070687_100000436 | |||
| 1609 | Ga0070661_100000013 | |||
| 1610 | Ga0070661_100042504 | |||
| 1611 | Ga0070692_10000910 | |||
| 1612 | Ga0070668_100058281 | |||
| 1613 | Ga0070668_100106786 | |||
| 1614 | Ga0070669_100000706 | |||
| 1615 | Ga0070669_100068696 | |||
| 1616 | Ga0070675_100056072 | |||
| 1617 | Ga0070671_100227409 | |||
| 1618 | Ga0070673_100265129 | |||
| 1619 | Ga0070659_100000167 | |||
| 1620 | Ga0070659_100003331 | |||
| 1621 | Ga0070659_100007239 | |||
| 1622 | Ga0070659_100044058 | |||
| 1623 | Ga0070714_100000088 | |||
| 1624 | Ga0070714_100035404 | |||
| 1625 | Ga0070713_100003177 | |||
| 1626 | Ga0070710_10058408 | |||
| 1627 | Ga0070705_100001008 | |||
| 1628 | Ga0070705_100048956 | |||
| 1629 | Ga0070700_100000666 | |||
| 1630 | Ga0070694_100001273 | |||
| 1631 | Ga0070694_100009337 | |||
| 1632 | Ga0070694_100046544 | |||
| 1633 | Ga0070694_100056927 | |||
| 1634 | Ga0070694_100123354 | |||
| 1635 | Ga0070708_100061073 | |||
| 1636 | Ga0070663_100000006 | |||
| 1637 | Ga0070663_100000479 | |||
| 1638 | Ga0070663_100030317 | |||
| 1639 | Ga0070663_100033311 | |||
| 1640 | Ga0070663_100111631 | |||
| 1641 | Ga0070681_10000235 | |||
| 1642 | Ga0070681_10001320 | |||
| 1643 | Ga0070681_10003359 | |||
| 1644 | Ga0070681_10056509 | |||
| 1645 | Ga0068867_100000699 | |||
| 1646 | Ga0068867_100001386 | |||
| 1647 | Ga0070699_100002487 | |||
| 1648 | Ga0070679_100011170 | |||
| 1649 | Ga0070679_100015423 | |||
| 1650 | Ga0070679_100036570 | |||
| 1651 | Ga0070679_100105841 | |||
| 1652 | Ga0070684_100158444 | |||
| 1653 | Ga0070697_100001807 | |||
| 1654 | Ga0070697_100003810 | |||
| 1655 | Ga0068853_100132135 | |||
| 1656 | Ga0070672_100131652 | |||
| 1657 | Ga0070686_100002450 | |||
| 1658 | Ga0070686_100067700 | |||
| 1659 | Ga0070695_100000113 | |||
| 1660 | Ga0070695_100024153 | |||
| 1661 | Ga0070696_100000434 | |||
| 1662 | Ga0070696_100002179 | |||
| 1663 | Ga0070696_100002261 | |||
| 1664 | Ga0070696_100002633 | |||
| 1665 | Ga0070693_100000209 | |||
| 1666 | Ga0070693_100015359 | |||
| 1667 | Ga0070665_100002809 | |||
| 1668 | Ga0068855_100000072 | |||
| 1669 | Ga0068855_100014327 | |||
| 1670 | Ga0068855_100014631 | |||
| 1671 | Ga0068855_100015378 | |||
| 1672 | Ga0068855_100017810 | |||
| 1673 | Ga0068855_100070969 | |||
| 1674 | Ga0068855_100083657 | |||
| 1675 | Ga0068855_100100241 | |||
| 1676 | Ga0068855_100103616 | |||
| 1677 | Ga0070664_100000002 | |||
| 1678 | Ga0070664_100039941 | |||
| 1679 | Ga0068857_100000319 | |||
| 1680 | Ga0068857_100017815 | |||
| 1681 | Ga0068857_100051279 | |||
| 1682 | Ga0068857_100060592 | |||
| 1683 | Ga0068854_100000004 | |||
| 1684 | Ga0068854_100001263 | |||
| 1685 | Ga0068854_100001277 | |||
| 1686 | Ga0068854_100001665 | |||
| 1687 | Ga0068854_100009142 | |||
| 1688 | Ga0068854_100100631 | |||
| 1689 | Ga0068856_100000294 | |||
| 1690 | Ga0068856_100000652 | |||
| 1691 | Ga0068856_100038570 | |||
| 1692 | Ga0068856_100087423 | |||
| 1693 | Ga0068856_100109459 | |||
| 1694 | Ga0070702_100000240 | |||
| 1695 | Ga0068859_100004628 | |||
| 1696 | Ga0068859_100107514 | |||
| 1697 | Ga0068864_100068644 | |||
| 1698 | Ga0068861_100000550 | |||
| 1699 | Ga0068851_10069478 | |||
| 1700 | Ga0068858_100004085 | |||
| 1701 | Ga0068858_100064675 | |||
| 1702 | Ga0068858_100424330 | |||
| 1703 | Ga0068860_100004596 | |||
| 1704 | Ga0068862_100001897 | |||
| 1705 | Ga0068862_100006699 | |||
| 1706 | Ga0068862_100051032 | |||
| 1707 | Ga0081539_10000799 | |||
| 1708 | Ga0075363_100099372 | |||
| 1709 | Ga0075364_10007608 | |||
| 1710 | Ga0075364_10008631 | |||
| 1711 | Ga0075364_10011929 | |||
| 1712 | Ga0075364_10013464 | |||
| 1713 | Ga0075366_10009542 | |||
| 1714 | Ga0075366_10037583 | |||
| 1715 | Ga0097621_100011829 | |||
| 1716 | Ga0075370_10001703 | |||
| 1717 | Ga0075370_10002804 | |||
| 1718 | Ga0075370_10025086 | |||
| 1719 | Ga0068871_100000788 | |||
| 1720 | Ga0068871_100001073 | |||
| 1721 | Ga0075428_100003728 | |||
| 1722 | Ga0075430_100002931 | |||
| 1723 | Ga0075431_100269744 | |||
| 1724 | Ga0075433_10003313 | |||
| 1725 | Ga0075433_10042452 | |||
| 1726 | Ga0075434_100000004 | |||
| 1727 | Ga0075434_100001086 | |||
| 1728 | Ga0075434_100019492 | |||
| 1729 | Ga0075434_100037923 | |||
| 1730 | Ga0075429_100000051 | |||
| 1731 | Ga0068865_100001146 | |||
| 1732 | Ga0075436_100000331 | |||
| 1733 | Ga0075436_100004918 | |||
| 1734 | Ga0075436_100010269 | |||
| 1735 | Ga0075436_100047384 | |||
| 1736 | Ga0097620_100004627 | |||
| 1737 | Ga0097620_100107510 | |||
| 1738 | Ga0079104_1000277 | |||
| 1739 | Ga0099826_10000015 | |||
| 1740 | Ga0075435_100000313 | |||
| 1741 | Ga0075435_100001505 | |||
| 1742 | Ga0075435_100022664 | |||
| 1743 | Ga0105251_10000285 | |||
| 1744 | Ga0105251_10001199 | |||
| 1745 | Ga0105251_10038759 | |||
| 1746 | Ga0105244_10079081 | |||
| 1747 | Ga0105250_10007579 | |||
| 1748 | Ga0105240_10000569 | |||
| 1749 | Ga0105240_10002163 | |||
| 1750 | Ga0105240_10019895 | |||
| 1751 | Ga0105240_10021079 | |||
| 1752 | Ga0105240_10032831 | |||
| 1753 | Ga0105240_10038140 | |||
| 1754 | Ga0105240_10094721 | |||
| 1755 | Ga0105240_10206703 | |||
| 1756 | Ga0105240_10292316 | |||
| 1757 | Ga0111539_10035356 | |||
| 1758 | Ga0111539_10043746 | |||
| 1759 | Ga0105245_10002454 | |||
| 1760 | Ga0114129_10000337 | |||
| 1761 | Ga0105243_10000420 | |||
| 1762 | Ga0105243_10000915 | |||
| 1763 | Ga0105243_10005794 | |||
| 1764 | Ga0105241_10034467 | |||
| 1765 | Ga0105241_10042520 | |||
| 1766 | Ga0105242_10000945 | |||
| 1767 | Ga0105242_10008348 | |||
| 1768 | Ga0105242_10021199 | |||
| 1769 | Ga0105248_10271656 | |||
| 1770 | Ga0105237_10000007 | |||
| 1771 | Ga0105237_10000307 | |||
| 1772 | Ga0105237_10030111 | |||
| 1773 | Ga0105237_10080514 | |||
| 1774 | Ga0105238_10000318 | |||
| 1775 | Ga0105238_10014850 | |||
| 1776 | Ga0105238_10034564 | |||
| 1777 | Ga0105238_10213812 | |||
| 1778 | Ga0105238_10214663 | |||
| 1779 | Ga0105249_10000975 | |||
| 1780 | Ga0105249_10024517 | |||
| 1781 | Ga0105239_10000020 | |||
| 1782 | Ga0105239_10001532 | |||
| 1783 | Ga0105239_10033387 | |||
| 1784 | Ga0105239_10059727 | |||
| 1785 | Ga0157373_10005940 | |||
| 1786 | Ga0157373_10009391 | |||
| 1787 | Ga0157373_10035191 | |||
| 1788 | Ga0157373_10078366 | |||
| 1789 | Ga0157373_10199743 | |||
| 1790 | Ga0157371_10004477 | |||
| 1791 | Ga0157371_10007599 | |||
| 1792 | Ga0157371_10017438 | |||
| 1793 | Ga0157371_10039981 | |||
| 1794 | Ga0157370_10000371 | |||
| 1795 | Ga0157370_10007267 | |||
| 1796 | Ga0157370_10012327 | |||
| 1797 | Ga0157370_10022546 | |||
| 1798 | Ga0157370_10027521 | |||
| 1799 | Ga0157370_10035086 | |||
| 1800 | Ga0157370_10038942 | |||
| 1801 | Ga0157370_10105641 | |||
| 1802 | Ga0157370_10124192 | |||
| 1803 | Ga0157369_10000252 | |||
| 1804 | Ga0157369_10002784 | |||
| 1805 | Ga0157369_10007899 | |||
| 1806 | Ga0157369_10107132 | |||
| 1807 | Ga0157369_10168483 | |||
| 1808 | Ga0157369_10191474 | |||
| 1809 | Ga0157369_10281095 | |||
| 1810 | Ga0157374_10000345 | |||
| 1811 | Ga0157378_10000844 | |||
| 1812 | Ga0163162_10001066 | |||
| 1813 | Ga0157372_10008893 | |||
| 1814 | Ga0157372_10017693 | |||
| 1815 | Ga0157372_10181794 | |||
| 1816 | Ga0157372_10196929 | |||
| 1817 | Ga0157375_10028666 | |||
| 1818 | Ga0157375_10315464 | |||
| 1819 | Ga0182008_10004246 | |||
| 1820 | Ga0182008_10004498 | |||
| 1821 | Ga0182008_10006040 | |||
| 1822 | Ga0182008_10021058 | |||
| 1823 | Ga0182008_10042688 | |||
| 1824 | Ga0157376_10064579 | |||
| 1825 | Ga0157376_10066813 | |||
| 1826 | Ga0182006_1000162 | |||
| 1827 | Ga0182006_1000541 | |||
| 1828 | Ga0182006_1001661 | |||
| 1829 | Ga0182006_1002604 | |||
| 1830 | Ga0182006_1013148 | |||
| 1831 | Ga0182006_1049379 | |||
| 1832 | Ga0182007_10011944 | |||
| 1833 | Ga0182007_10021806 | |||
| 1834 | Ga0182005_1000322 | |||
| 1835 | Ga0182005_1000365 | |||
| 1836 | Ga0182005_1005337 | |||
| 1837 | Ga0182005_1010521 | |||
| 1838 | Ga0183362_10001 | |||
| 1839 | Ga0183368_1003 | |||
| 1840 | Ga0183361_10025 | |||
| 1841 | Ga0206351_10556100 | |||
| 1842 | Ga0206350_10021063 | |||
| 1843 | Ga0154015_1099906 | |||
| 1844 | Ga0213872_10003677 | |||
| 1845 | Ga0213872_10009907 | |||
| 1846 | Ga0224712_10012474 | |||
| 1847 | Ga0209435_100016 | |||
| 1848 | Ga0209435_100038 | |||
| 1849 | Ga0209435_100932 | |||
| 1850 | Ga0209435_105321 | |||
| 1851 | Ga0209760_101097 | |||
| 1852 | Ga0209784_100002 | |||
| 1853 | Ga0209784_100003 | |||
| 1854 | Ga0209784_100068 | |||
| 1855 | Ga0209784_100069 | |||
| 1856 | Ga0209784_100293 | |||
| 1857 | Ga0209784_100573 | |||
| 1858 | Ga0209566_100002 | |||
| 1859 | Ga0209566_100003 | |||
| 1860 | Ga0209566_100083 | |||
| 1861 | Ga0209566_100535 | |||
| 1862 | Ga0209566_100561 | |||
| 1863 | Ga0209674_100004 | |||
| 1864 | Ga0209674_100008 | |||
| 1865 | Ga0209674_100012 | |||
| 1866 | Ga0209674_100013 | |||
| 1867 | Ga0209674_100106 | |||
| 1868 | Ga0209674_100122 | |||
| 1869 | Ga0209674_100148 | |||
| 1870 | Ga0209674_100336 | |||
| 1871 | Ga0209674_100424 | |||
| 1872 | Ga0209672_100005 | |||
| 1873 | Ga0209672_100010 | |||
| 1874 | Ga0209672_100019 | |||
| 1875 | Ga0209672_100045 | |||
| 1876 | Ga0209672_100051 | |||
| 1877 | Ga0209672_100100 | |||
| 1878 | Ga0209672_100350 | |||
| 1879 | Ga0209672_100386 | |||
| 1880 | Ga0209672_100676 | |||
| 1881 | Ga0209672_101672 | |||
| 1882 | Ga0209147_100002 | |||
| 1883 | Ga0209147_100006 | |||
| 1884 | Ga0209147_100023 | |||
| 1885 | Ga0209147_100026 | |||
| 1886 | Ga0209147_100192 | |||
| 1887 | Ga0209147_100308 | |||
| 1888 | Ga0209147_104223 | |||
| 1889 | Ga0209563_100004 | |||
| 1890 | Ga0209563_100006 | |||
| 1891 | Ga0209563_100023 | |||
| 1892 | Ga0209563_100100 | |||
| 1893 | Ga0209563_101103 | |||
| 1894 | Ga0207427_100069 | |||
| 1895 | Ga0207427_100139 | |||
| 1896 | Ga0207427_100140 | |||
| 1897 | Ga0207427_100216 | |||
| 1898 | Ga0207427_100279 | |||
| 1899 | Ga0207427_101443 | |||
| 1900 | Ga0209437_100139 | |||
| 1901 | Ga0209437_100147 | |||
| 1902 | Ga0209437_100154 | |||
| 1903 | Ga0209437_100156 | |||
| 1904 | Ga0209437_100166 | |||
| 1905 | Ga0209437_100462 | |||
| 1906 | Ga0209437_100463 | |||
| 1907 | Ga0209258_100002 | |||
| 1908 | Ga0209258_100006 | |||
| 1909 | Ga0209258_100010 | |||
| 1910 | Ga0209258_100024 | |||
| 1911 | Ga0209258_100031 | |||
| 1912 | Ga0209258_100111 | |||
| 1913 | Ga0209258_100200 | |||
| 1914 | Ga0209258_100358 | |||
| 1915 | Ga0209258_100360 | |||
| 1916 | Ga0209258_100368 | |||
| 1917 | Ga0209258_100992 | |||
| 1918 | Ga0209258_101914 | |||
| 1919 | Ga0209646_1000022 | |||
| 1920 | Ga0209646_1000033 | |||
| 1921 | Ga0209646_1000093 | |||
| 1922 | Ga0209646_1001402 | |||
| 1923 | Ga0209026_1000031 | |||
| 1924 | Ga0209026_1000074 | |||
| 1925 | Ga0209026_1000099 | |||
| 1926 | Ga0209026_1000145 | |||
| 1927 | Ga0209026_1000914 | |||
| 1928 | Ga0209026_1001383 | |||
| 1929 | Ga0209026_1003446 | |||
| 1930 | Ga0209677_100003 | |||
| 1931 | Ga0209677_100013 | |||
| 1932 | Ga0209677_100061 | |||
| 1933 | Ga0209677_103892 | |||
| 1934 | Ga0209148_1000002 | |||
| 1935 | Ga0209148_1000009 | |||
| 1936 | Ga0209148_1000010 | |||
| 1937 | Ga0209148_1000012 | |||
| 1938 | Ga0209148_1000018 | |||
| 1939 | Ga0209148_1000021 | |||
| 1940 | Ga0209148_1000027 | |||
| 1941 | Ga0209148_1000045 | |||
| 1942 | Ga0209148_1000099 | |||
| 1943 | Ga0209148_1000400 | |||
| 1944 | Ga0209148_1001095 | |||
| 1945 | Ga0209759_1000045 | |||
| 1946 | Ga0209759_1000110 | |||
| 1947 | Ga0209759_1000147 | |||
| 1948 | Ga0209759_1000247 | |||
| 1949 | Ga0209759_1000248 | |||
| 1950 | Ga0209759_1000605 | |||
| 1951 | Ga0209759_1000804 | |||
| 1952 | Ga0209759_1001732 | |||
| 1953 | Ga0209759_1001830 | |||
| 1954 | Ga0209759_1003030 | |||
| 1955 | Ga0209759_1003860 | |||
| 1956 | Ga0209233_1000009 | |||
| 1957 | Ga0209233_1000083 | |||
| 1958 | Ga0209233_1000092 | |||
| 1959 | Ga0209233_1000135 | |||
| 1960 | Ga0209233_1000165 | |||
| 1961 | Ga0209233_1000191 | |||
| 1962 | Ga0209233_1000251 | |||
| 1963 | Ga0209455_1000008 | |||
| 1964 | Ga0209455_1000015 | |||
| 1965 | Ga0209455_1000021 | |||
| 1966 | Ga0209455_1000029 | |||
| 1967 | Ga0209455_1000035 | |||
| 1968 | Ga0209455_1000086 | |||
| 1969 | Ga0209455_1000213 | |||
| 1970 | Ga0209455_1000357 | |||
| 1971 | Ga0209455_1000601 | |||
| 1972 | Ga0209455_1001659 | |||
| 1973 | Ga0209455_1015391 | |||
| 1974 | Ga0209673_1000201 | |||
| 1975 | Ga0209130_1002165 | |||
| 1976 | Ga0209675_1001328 | |||
| 1977 | Ga0209675_1001337 | |||
| 1978 | Ga0209675_1018295 | |||
| 1979 | Ga0209676_1000012 | |||
| 1980 | Ga0209676_1004421 | |||
| 1981 | Ga0209025_1000003 | |||
| 1982 | Ga0209025_1000542 | |||
| 1983 | Ga0209025_1000759 | |||
| 1984 | Ga0209025_1003675 | |||
| 1985 | Ga0209564_1002863 | |||
| 1986 | Ga0209564_1004321 | |||
| 1987 | Ga0209564_1009861 | |||
| 1988 | Ga0209758_1000276 | |||
| 1989 | Ga0209758_1029993 | |||
| 1990 | Ga0209050_1001429 | |||
| 1991 | Ga0209256_1000233 | |||
| 1992 | Ga0207426_1000240 | |||
| 1993 | Ga0207696_1008775 | |||
| 1994 | Ga0207713_1002521 | |||
| 1995 | Ga0207713_1003615 | |||
| 1996 | Ga0207653_10035802 | |||
| 1997 | Ga0207692_10023211 | |||
| 1998 | Ga0207688_10063812 | |||
| 1999 | Ga0207688_10067752 | |||
| 2000 | Ga0207680_10047607 | |||
| 2001 | Ga0207647_10000967 | |||
| 2002 | Ga0207647_10001769 | |||
| 2003 | Ga0207647_10005750 | |||
| 2004 | Ga0207647_10016575 | |||
| 2005 | Ga0207647_10027795 | |||
| 2006 | Ga0207647_10030691 | |||
| 2007 | Ga0207647_10057514 | |||
| 2008 | Ga0207645_10036717 | |||
| 2009 | Ga0207645_10071922 | |||
| 2010 | Ga0207643_10012639 | |||
| 2011 | Ga0207705_10002820 | |||
| 2012 | Ga0207705_10054416 | |||
| 2013 | Ga0207705_10133484 | |||
| 2014 | Ga0207654_10081748 | |||
| 2015 | Ga0207707_10015319 | |||
| 2016 | Ga0207707_10017802 | |||
| 2017 | Ga0207707_10094667 | |||
| 2018 | Ga0207695_10000408 | |||
| 2019 | Ga0207695_10001214 | |||
| 2020 | Ga0207695_10002857 | |||
| 2021 | Ga0207695_10003147 | |||
| 2022 | Ga0207695_10004759 | |||
| 2023 | Ga0207695_10006780 | |||
| 2024 | Ga0207695_10007664 | |||
| 2025 | Ga0207695_10015832 | |||
| 2026 | Ga0207695_10024607 | |||
| 2027 | Ga0207695_10056224 | |||
| 2028 | Ga0207695_10094999 | |||
| 2029 | Ga0207671_10000031 | |||
| 2030 | Ga0207671_10000074 | |||
| 2031 | Ga0207671_10005183 | |||
| 2032 | Ga0207671_10069245 | |||
| 2033 | Ga0207671_10116680 | |||
| 2034 | Ga0207660_10000870 | |||
| 2035 | Ga0207660_10300652 | |||
| 2036 | Ga0207662_10000233 | |||
| 2037 | Ga0207657_10000001 | |||
| 2038 | Ga0207657_10062545 | |||
| 2039 | Ga0207649_10000019 | |||
| 2040 | Ga0207649_10026321 | |||
| 2041 | Ga0207652_10059949 | |||
| 2042 | Ga0207652_10103217 | |||
| 2043 | Ga0207652_10199926 | |||
| 2044 | Ga0207681_10001251 | |||
| 2045 | Ga0207694_10003032 | |||
| 2046 | Ga0207694_10014956 | |||
| 2047 | Ga0207694_10038018 | |||
| 2048 | Ga0207694_10041861 | |||
| 2049 | Ga0207700_10006065 | |||
| 2050 | Ga0207664_10000066 | |||
| 2051 | Ga0207664_10000472 | |||
| 2052 | Ga0207644_10054539 | |||
| 2053 | Ga0207690_10000006 | |||
| 2054 | Ga0207690_10000579 | |||
| 2055 | Ga0207690_10001265 | |||
| 2056 | Ga0207690_10007185 | |||
| 2057 | Ga0207706_10055485 | |||
| 2058 | Ga0207686_10001247 | |||
| 2059 | Ga0207686_10001496 | |||
| 2060 | Ga0207709_10000129 | |||
| 2061 | Ga0207709_10000934 | |||
| 2062 | Ga0207709_10003455 | |||
| 2063 | Ga0207670_10003031 | |||
| 2064 | Ga0207670_10009594 | |||
| 2065 | Ga0207670_10029870 | |||
| 2066 | Ga0207670_10060902 | |||
| 2067 | Ga0207704_10000745 | |||
| 2068 | Ga0207691_10027439 | |||
| 2069 | Ga0207691_10118482 | |||
| 2070 | Ga0207711_10181974 | |||
| 2071 | Ga0207689_10002282 | |||
| 2072 | Ga0207661_10108905 | |||
| 2073 | Ga0207679_10000001 | |||
| 2074 | Ga0207667_10000055 | |||
| 2075 | Ga0207667_10000082 | |||
| 2076 | Ga0207667_10000313 | |||
| 2077 | Ga0207667_10012188 | |||
| 2078 | Ga0207667_10013499 | |||
| 2079 | Ga0207667_10028434 | |||
| 2080 | Ga0207667_10047165 | |||
| 2081 | Ga0207667_10066465 | |||
| 2082 | Ga0207667_10078394 | |||
| 2083 | Ga0207667_10100957 | |||
| 2084 | Ga0207712_10002777 | |||
| 2085 | Ga0207668_10022314 | |||
| 2086 | Ga0207668_10033596 | |||
| 2087 | Ga0207668_10036230 | |||
| 2088 | Ga0207640_10000018 | |||
| 2089 | Ga0207640_10000524 | |||
| 2090 | Ga0207640_10009367 | |||
| 2091 | Ga0207640_10013733 | |||
| 2092 | Ga0207640_10052125 | |||
| 2093 | Ga0207640_10052385 | |||
| 2094 | Ga0207677_10010535 | |||
| 2095 | Ga0207703_10004183 | |||
| 2096 | Ga0207703_10046696 | |||
| 2097 | Ga0207703_10055595 | |||
| 2098 | Ga0207703_10233655 | |||
| 2099 | Ga0207639_10106751 | |||
| 2100 | Ga0207678_10000001 | |||
| 2101 | Ga0207678_10000167 | |||
| 2102 | Ga0207678_10008419 | |||
| 2103 | Ga0207678_10089226 | |||
| 2104 | Ga0207678_10090342 | |||
| 2105 | Ga0207678_10134977 | |||
| 2106 | Ga0207708_10000625 | |||
| 2107 | Ga0207702_10000009 | |||
| 2108 | Ga0207702_10003312 | |||
| 2109 | Ga0207702_10063706 | |||
| 2110 | Ga0207648_10002355 | |||
| 2111 | Ga0207648_10004982 | |||
| 2112 | Ga0207648_10095195 | |||
| 2113 | Ga0207674_10000397 | |||
| 2114 | Ga0207674_10010237 | |||
| 2115 | Ga0207674_10017991 | |||
| 2116 | Ga0207674_10347741 | |||
| 2117 | Ga0207675_100001604 | |||
| 2118 | Ga0207683_10111066 | |||
| 2119 | Ga0207683_10232477 | |||
| 2120 | Ga0207698_10014530 | |||
| 2121 | Ga0207698_10065689 | |||
| 2122 | Ga0209281_1000067 | |||
| 2123 | Ga0209371_1000202 | |||
| 2124 | Ga0209969_1004120 | |||
| 2125 | Ga0209999_1003558 | |||
| 2126 | Ga0209282_1000033 | |||
| 2127 | Ga0209966_1006723 | |||
| 2128 | Ga0209974_10001890 | |||
| 2129 | Ga0207428_10000610 | |||
| 2130 | Ga0268266_10008498 | |||
| 2131 | Ga0268265_10001521 | |||
| 2132 | Ga0268264_10004412 | |||
| 2133 | Ga0307515_10004238 | |||
| 2134 | Ga0265338_10000104 | |||
| 2135 | Ga0265338_10002059 | |||
| 2136 | Ga0268256_1000189 | |||
| 2137 | Ga0265332_10000003 | |||
| 2138 | Ga0307513_10056718 | |||
| 2139 | Ga0307408_100000213 | |||
| 2140 | Ga0307408_100074334 | |||
| 2141 | Ga0307514_10001218 | |||
| 2142 | Ga0316575_10007847 | |||
| 2143 | Ga0316579_10004816 | |||
| 2144 | Ga0307516_10173917 | |||
| 2145 | Ga0307405_10082886 | |||
| 2146 | Ga0307406_10000379 | |||
| 2147 | Ga0307412_10000008 | |||
| 2148 | Ga0307412_10000313 | |||
| 2149 | Ga0307412_10047229 | |||
| 2150 | Ga0307412_10110941 | |||
| 2151 | Ga0307409_100054512 | |||
| 2152 | Ga0307416_100073487 | |||
| 2153 | Ga0307416_100144279 | |||
| 2154 | Ga0307411_10127758 | |||
| 2155 | Ga0373926_0016944 | |||
| 2156 | Ga0373932_0005248 | |||
| 2157 | Ga0373941_0010662 | |||
| 2158 | Ga0373945_0020026 | |||
| 2159 | Ga0373954_0000965 | |||
| 2160 | Ga0373942_0005016 | |||
| 2161 | Ga0373942_0016979 | |||
| 2162 | Ga0373924_0009778 | |||
| 2163 | Ga0373931_0000627 | |||
| 2164 | Ga0373935_0036155 | |||
| 2165 | Ga0373927_0008584 | |||
| 2166 | Ga0373927_0178052 | |||
| 2167 | Ga0373933_0001980 | |||
| 2168 | Ga0373937_0001198 | |||
| 2169 | Ga0373937_0063950 | |||
| 2170 | Ga0373937_0157198 | |||
| 2171 | Ga0316582_0002737 | |||
| 2172 | Ga0316584_0071096 | |||
| 2173 | Ga0373925_0018211 | |||
| 2174 | Ga0395899_0000041 | |||
| 2175 | Ga0395899_0000369 | |||
| 2176 | Ga0395899_0009696 | |||
| 2177 | Ga0395899_0029160 | |||
| 2178 | Ga0395899_0031912 | |||
| 2179 | Ga0395899_0149924 | |||
| 2180 | Ga0395900_0000562 | |||
| 2181 | Ga0395900_0000664 | |||
| 2182 | Ga0395900_0000916 | |||
| 2183 | Ga0395900_0001108 | |||
| 2184 | Ga0395900_0001745 | |||
| 2185 | Ga0395900_0004872 | |||
| 2186 | Ga0395900_0006936 | |||
| 2187 | Ga0395900_0024941 | |||
| 2188 | Ga0395900_0129008 | |||
| 2189 | Ga0395900_0154913 | |||
| 2190 | Ga0395900_0240025 | |||
| 2191 | Ga0395898_0000220 | |||
| 2192 | Ga0395898_0000305 | |||
| 2193 | Ga0395898_0000526 | |||
| 2194 | Ga0395898_0002771 | |||
| 2195 | Ga0395898_0004697 | |||
| 2196 | Ga0395898_0012225 | |||
| 2197 | Ga0395898_0075124 | |||
| 2198 | Ga0395898_0082597 | |||
| 2199 | Ga0395905_0000098 | |||
| 2200 | Ga0316581_0012152 | |||
| 2201 | Ga0395901_0000011 | |||
| 2202 | Ga0395901_0000106 | |||
| 2203 | Ga0395901_0000161 | |||
| 2204 | Ga0395901_0000264 | |||
| 2205 | Ga0395901_0014650 | |||
| 2206 | Ga0395901_0025384 | |||
| 2207 | Ga0395901_0033268 | |||
| 2208 | Ga0395901_0131237 | |||
| 2209 | Ga0237819_01026 | |||
| 2210 | Ga0436361_0310873 | |||
| 2211 | Ga0436361_0560628 | |||
| 2212 | Ga0436361_0710630 | |||
| 2213 | Ga0436361_0762834 | |||
| 2214 | Ga0439436_0000014 | |||
| 2215 | Ga0451800_1450092 | |||
| 2216 | Ga0451806_187053 | |||
| 2217 | Ga0451804_1026683 | |||
| 2218 | Ga0451807_0623916 | |||
| 2219 | Ga0451807_0695512 | |||
| 2220 | Ga0451833_0182207 | |||
| 2221 | Ga0451837_1319545 | |||
| 2222 | Ga0439448_0000048 | |||
| 2223 | Ga0439432_012194 | |||
| 2224 | Ga0439432_022323 | |||
| 2225 | Ga0439449_0002257 | |||
| 2226 | Ga0439462_0002003 | |||
| 2227 | Ga0451577_0003226 | |||
| 2228 | Ga0451577_0049719 | |||
| 2229 | Ga0451577_0300538 | |||
| 2230 | Ga0466986_0105408 | |||
| 2231 | Ga0466969_0006333 | |||
| 2232 | Ga0466969_0091015 | |||
| 2233 | Ga0466977_0000251 | |||
| 2234 | Ga0466965_0017578 | |||
| 2235 | Ga0466965_0045797 | |||
| 2236 | Ga0466965_0046718 | |||
| 2237 | Ga0466966_0000066 | |||
| 2238 | Ga0466966_0001282 | |||
| 2239 | Ga0466966_0001306 | |||
| 2240 | Ga0466966_0002967 | |||
| 2241 | Ga0466966_0014396 | |||
| 2242 | Ga0466961_0000037 | |||
| 2243 | Ga0466961_0001025 | |||
| 2244 | Ga0466961_0001819 | |||
| 2245 | Ga0466961_0002289 | |||
| 2246 | Ga0466961_0004677 | |||
| 2247 | Ga0466961_0011658 | |||
| 2248 | Ga0466961_0064455 | |||
| 2249 | Ga0466961_0075592 | |||
| 2250 | Ga0466961_0133514 | |||
| 2251 | Ga0466964_0001424 | |||
| 2252 | Ga0453684_0001711 | |||
| 2253 | Ga0453684_0062698 | |||
| 2254 | Ga0453684_0246769 | |||
| 2255 | Ga0453684_0395396 | |||
| 2256 | Ga0466971_0002547 | |||
| 2257 | Ga0466971_0008785 | |||
| 2258 | Ga0466971_0015190 | |||
| 2259 | Ga0466968_0001142 | |||
| 2260 | Ga0466968_0060701 | |||
| 2261 | Ga0466970_0000887 | |||
| 2262 | Ga0466970_0003586 | |||
| 2263 | Ga0466970_0013134 | |||
| 2264 | Ga0466970_0026176 | |||
| 2265 | Ga0466970_0026386 | |||
| 2266 | Ga0466970_0028758 | |||
| 2267 | Ga0466957_0001282 | |||
| 2268 | Ga0466957_0003699 | |||
| 2269 | Ga0466957_0008319 | |||
| 2270 | Ga0466957_0100372 | |||
| 2271 | Ga0466959_0005357 | |||
| 2272 | Ga0466959_0007018 | |||
| 2273 | Ga0466959_0014534 | |||
| 2274 | Ga0466959_0046266 | |||
| 2275 | Ga0466959_0048152 | |||
| 2276 | Ga0466959_0054373 | |||
| 2277 | Ga0466959_0081281 | |||
| 2278 | Ga0466959_0083856 | |||
| 2279 | Ga0451576_0002027 | |||
| 2280 | Ga0451576_0004679 | |||
| 2281 | Ga0451576_0026245 | |||
| 2282 | Ga0466958_0004028 | |||
| 2283 | Ga0466958_0007166 | |||
| 2284 | Ga0466958_0134431 | |||
| 2285 | Ga0466967_0003164 | |||
| 2286 | Ga0495617_000111 | |||
| 2287 | Ga0495617_001833 | |||
| 2288 | Ga0495592_0013065 | |||
| 2289 | Ga0495592_0013791 | |||
| 2290 | Ga0495592_0022670 | |||
| 2291 | Ga0495592_0057950 | |||
| 2292 | Ga0495603_0001289 | |||
| 2293 | Ga0495603_0001360 | |||
| 2294 | Ga0495603_0008459 | |||
| 2295 | Ga0495590_0001198 | |||
| 2296 | Ga0495590_0005800 | |||
| 2297 | Ga0495590_0017409 | |||
| 2298 | Ga0495591_000725 | |||
| 2299 | Ga0495629_0000060 | |||
| 2300 | Ga0495629_0000293 | |||
| 2301 | Ga0495629_0003084 | |||
| 2302 | Ga0495629_0017918 | |||
| 2303 | Ga0495629_0018305 | |||
| 2304 | Ga0495629_0077372 | |||
| 2305 | Ga0495638_0000007 | |||
| 2306 | Ga0495638_0000194 | |||
| 2307 | Ga0495638_0000213 | |||
| 2308 | Ga0495638_0000233 | |||
| 2309 | Ga0495638_0003136 | |||
| 2310 | Ga0495641_0014068 | |||
| 2311 | Ga0495651_0102892 | |||
| 2312 | Ga0495653_0003467 | |||
| 2313 | Ga0495653_0005778 | |||
| 2314 | Ga0495653_0016113 | |||
| 2315 | Ga0495653_0073499 | |||
| 2316 | Ga0495653_0304932 | |||
| 2317 | Ga0495650_0000202 | |||
| 2318 | Ga0495650_0001534 | |||
| 2319 | Ga0495650_0011836 | |||
| 2320 | Ga0495580_0001266 | |||
| 2321 | Ga0495580_0005292 | |||
| 2322 | Ga0495580_0008660 | |||
| 2323 | Ga0495580_0010730 | |||
| 2324 | Ga0495580_0011714 | |||
| 2325 | Ga0495580_0029784 | |||
| 2326 | Ga0495580_0081955 | |||
| 2327 | Ga0495580_0122362 | |||
| 2328 | Ga0495582_0018162 | |||
| 2329 | Ga0495605_0002472 | |||
| 2330 | Ga0495605_0006472 | |||
| 2331 | Ga0495605_0010487 | |||
| 2332 | Ga0495605_0014637 | |||
| 2333 | Ga0495639_0022457 | |||
| 2334 | Ga0495662_0013598 | |||
| 2335 | Ga0495664_0000037 | |||
| 2336 | Ga0495664_0002112 | |||
| 2337 | Ga0495585_0000001 | |||
| 2338 | Ga0495585_0013436 | |||
| 2339 | Ga0495596_0000377 | |||
| 2340 | Ga0495596_0003512 | |||
| 2341 | Ga0495596_0012343 | |||
| 2342 | Ga0495607_0000207 | |||
| 2343 | Ga0495607_0020058 | |||
| 2344 | Ga0495607_0097329 | |||
| 2345 | Ga0495583_0004094 | |||
| 2346 | Ga0495583_0011411 | |||
| 2347 | Ga0495583_0060148 | |||
| 2348 | Ga0495583_0067470 | |||
| 2349 | Ga0495606_0013496 | |||
| 2350 | Ga0495606_0020990 | |||
| 2351 | Ga0495606_0030227 | |||
| 2352 | Ga0495606_0057067 | |||
| 2353 | Ga0495608_0013992 | |||
| 2354 | Ga0495608_0014412 | |||
| 2355 | Ga0495610_0001239 | |||
| 2356 | Ga0495610_0003199 | |||
| 2357 | Ga0495610_0016416 | |||
| 2358 | Ga0495616_0000001 | |||
| 2359 | Ga0495616_0005323 | |||
| 2360 | Ga0495616_0038609 | |||
| 2361 | Ga0495618_0022475 | |||
| 2362 | Ga0495620_0000543 | |||
| 2363 | Ga0495620_0004657 | |||
| 2364 | Ga0495620_0004864 | |||
| 2365 | Ga0495628_0017213 | |||
| 2366 | Ga0495628_0017598 | |||
| 2367 | Ga0495628_0031750 | |||
| 2368 | Ga0495628_0032413 | |||
| 2369 | Ga0495628_0064539 | |||
| 2370 | Ga0495630_0021089 | |||
| 2371 | Ga0495630_0021345 | |||
| 2372 | Ga0495630_0078420 | |||
| 2373 | Ga0495631_0000162 | |||
| 2374 | Ga0495631_0000178 | |||
| 2375 | Ga0495632_0028520 | |||
| 2376 | Ga0495632_0076308 | |||
| 2377 | Ga0495637_0010613 | |||
| 2378 | Ga0495648_0000083 | |||
| 2379 | Ga0495648_0004219 | |||
| 2380 | Ga0495648_0004279 | |||
| 2381 | Ga0495648_0006831 | |||
| 2382 | Ga0495666_0001031 | |||
| 2383 | Ga0495666_0002120 | |||
| 2384 | Ga0495666_0005456 | |||
| 2385 | Ga0495666_0043671 | |||
| 2386 | Ga0495666_0045532 | |||
| 2387 | Ga0495642_0020554 | |||
| 2388 | Ga0495642_0029585 | |||
| 2389 | Ga0495652_0006254 | |||
| 2390 | Ga0495652_0056816 | |||
| 2391 | Ga0495654_0007716 | |||
| 2392 | Ga0495665_0004316 | |||
| 2393 | Ga0495665_0007236 | |||
| 2394 | Ga0495665_0026691 | |||
| 2395 | Ga0495640_0012094 | |||
| 2396 | Ga0495640_0016641 | |||
| 2397 | Ga0495640_0017401 | |||
| 2398 | Ga0495640_0051427 | |||
| 2399 | Ga0495640_0051890 | |||
| 2400 | Ga0495586_0000599 | |||
| 2401 | Ga0495586_0013939 | |||
| 2402 | Ga0495586_0052758 | |||
| 2403 | Ga0495587_0014914 | |||
| 2404 | Ga0495609_0000905 | |||
| 2405 | Ga0495609_0001698 | |||
| 2406 | Ga0495597_0000446 | |||
| 2407 | Ga0495597_0005687 | |||
| 2408 | Ga0495597_0012031 | |||
| 2409 | Ga0495645_0001629 | |||
| 2410 | Ga0495645_0011409 | |||
| 2411 | Ga0495645_0038518 | |||
| 2412 | Ga0495645_0081136 | |||
| 2413 | Ga0495645_0109253 | |||
| 2414 | Ga0495645_0119406 | |||
| 2415 | Ga0495622_0076098 | |||
| 2416 | Ga0495622_0090880 | |||
| 2417 | Ga0495633_0033170 | |||
| 2418 | Ga0495667_0059602 | |||
| 2419 | Ga0495668_0011617 | |||
| 2420 | Ga0495634_0133825 | |||
| 2421 | Ga0495611_0000001 | |||
| 2422 | Ga0495611_0001164 | |||
| 2423 | Ga0495625_0000001 | |||
| 2424 | Ga0495625_0001424 | |||
| 2425 | Ga0495625_0047787 | |||
| 2426 | Ga0495635_0072251 | |||
| 2427 | Ga0495635_0111910 | |||
| 2428 | Ga0495661_0001053 | |||
| 2429 | Ga0495661_0020112 | |||
| 2430 | Ga0495657_0036580 | |||
| 2431 | Ga0495599_0007027 | |||
| 2432 | Ga0495599_0014004 | |||
| 2433 | Ga0495599_0017978 | |||
| 2434 | Ga0495623_0040503 | |||
| 2435 | Ga0495623_0074231 | |||
| 2436 | Ga0495646_0004989 | |||
| 2437 | Ga0495646_0005973 | |||
| 2438 | Ga0495646_0012055 | |||
| 2439 | Ga0495646_0014953 | |||
| 2440 | Ga0495646_0016450 | |||
| 2441 | Ga0495658_0002184 | |||
| 2442 | Ga0495658_0089631 | |||
| 2443 | Ga0495669_0088224 | |||
| 2444 | Ga0495613_0019153 | |||
| 2445 | Ga0495624_0005054 | |||
| 2446 | Ga0495624_0019642 | |||
| 2447 | Ga0495624_0022859 | |||
| 2448 | Ga0495624_0026366 | |||
| 2449 | Ga0495624_0039331 | |||
| 2450 | Ga0495624_0051628 | |||
| 2451 | Ga0495624_0063927 | |||
| 2452 | Ga0495670_0002966 | |||
| 2453 | Ga0495670_0018062 | |||
| 2454 | Ga0495671_0000723 | |||
| 2455 | Ga0495671_0001770 | |||
| 2456 | Ga0495649_0003681 | |||
| 2457 | Ga0495649_0016295 | |||
| 2458 | Ga0495649_0039743 | |||
| 2459 | Ga0495589_0000314 | |||
| 2460 | Ga0495589_0005460 | |||
| 2461 | Ga0495600_0005463 | |||
| 2462 | Ga0495600_0005952 | |||
| 2463 | Ga0495600_0027891 | |||
| 2464 | Ga0495600_0075733 | |||
| 2465 | Ga0495660_0000008 | |||
| 2466 | Ga0495660_0000180 | |||
| 2467 | Ga0495660_0016577 | |||
| 2468 | Ga0495581_0004067 | |||
| 2469 | Ga0495581_0016353 | |||
| 2470 | Ga0495581_0022296 | |||
| 2471 | Ga0495604_0003896 | |||
| 2472 | Ga0495604_0027657 | |||
| 2473 | Ga0495604_0078425 | |||
| 2474 | Ga0495604_0086440 | |||
| 2475 | Ga0495604_0106357 | |||
| 2476 | Ga0495636_0003528 | |||
| 2477 | Ga0495674_0004951 | |||
| 2478 | Ga0495674_0020282 | |||
| 2479 | Ga0495672_0002823 | |||
| 2480 | Ga0495672_0023096 | |||
| 2481 | Ga0495676_0004601 | |||
| 2482 | Ga0495676_0114356 | |||
| 2483 | Ga0495680_0004438 | |||
| 2484 | Ga0495680_0023501 | |||
| 2485 | Ga0495680_0035180 | |||
| 2486 | Ga0495680_0082652 | |||
| 2487 | Ga0495683_0001386 | |||
| 2488 | Ga0495683_0010882 | |||
| 2489 | Ga0495683_0013641 | |||
| 2490 | Ga0495683_0023985 | |||
| 2491 | Ga0495683_0080169 | |||
| 2492 | Ga0495687_000025 | |||
| 2493 | Ga0495687_007690 | |||
| 2494 | Ga0495675_0013400 | |||
| 2495 | Ga0495679_000001 | |||
| 2496 | Ga0495679_000038 | |||
| 2497 | Ga0495679_001513 | |||
| 2498 | Ga0495679_013297 | |||
| 2499 | Ga0495673_0000001 | |||
| 2500 | Ga0495673_0000030 | |||
| 2501 | Ga0495673_0000232 | |||
| 2502 | Ga0495686_0000077 | |||
| 2503 | Ga0495686_0007428 | |||
| 2504 | Ga0495686_0028109 | |||
| 2505 | Ga0495686_0040502 | |||
| 2506 | Ga0495593_0010609 | |||
| 2507 | Ga0495593_0049793 | |||
| 2508 | Ga0495602_0003086 | |||
| 2509 | Ga0495602_0013165 | |||
| 2510 | Ga0495602_0065068 | |||
| 2511 | Ga0495602_0133850 | |||
| 2512 | Ga0495614_0003454 | |||
| 2513 | Ga0495614_0022447 | |||
| 2514 | Ga0495626_0029076 | |||
| 2515 | Ga0496100_0001557 | |||
| 2516 | Ga0496100_0002914 | |||
| 2517 | Ga0496100_0007357 | |||
| 2518 | Ga0496101_0000612 | |||
| 2519 | Ga0496101_0001266 | |||
| 2520 | Ga0496101_0015890 | |||
| 2521 | Ga0496101_0146682 | |||
| 2522 | Ga0496102_0000459 | |||
| 2523 | Ga0496102_0005874 | |||
| 2524 | Ga0496102_0011545 | |||
| 2525 | Ga0496102_0066635 | |||
| 2526 | Ga0496102_0107158 | |||
| 2527 | Ga0496103_0000337 | |||
| 2528 | Ga0496103_0009338 | |||
| 2529 | Ga0496104_0137350 | |||
| 2530 | Ga0496105_0017452 | |||
| 2531 | Ga0496105_0111779 | |||
| 2532 | Ga0496105_0147632 | |||
| 2533 | Ga0496106_0000019 | |||
| 2534 | Ga0496106_0001680 | |||
| 2535 | Ga0496106_0039738 | |||
| 2536 | Ga0496110_0001369 | |||
| 2537 | Ga0496111_0009674 | |||
| 2538 | Ga0496112_0006477 | |||
| 2539 | Ga0496113_0002111 | |||
| 2540 | Ga0496114_0063683 | |||
| 2541 | Ga0496115_0000337 | |||
| 2542 | Ga0496115_0000901 | |||
| 2543 | Ga0496116_0012476 | |||
| 2544 | Ga0496116_0016236 | |||
| 2545 | Ga0496116_0021645 | |||
| 2546 | Ga0496116_0031133 | |||
| 2547 | Ga0496116_0037807 | |||
| 2548 | Ga0496116_0080352 | |||
| 2549 | Ga0496117_0002293 | |||
| 2550 | Ga0496117_0004900 | |||
| 2551 | Ga0496117_0014213 | |||
| 2552 | Ga0496117_0021313 | |||
| 2553 | Ga0496117_0027009 | |||
| 2554 | Ga0496117_0028072 | |||
| 2555 | Ga0496117_0032699 | |||
| 2556 | Ga0496117_0110476 | |||
| 2557 | Ga0496118_0000420 | |||
| 2558 | Ga0496118_0002548 | |||
| 2559 | Ga0496118_0010050 | |||
| 2560 | Ga0496118_0020384 | |||
| 2561 | Ga0496118_0030492 | |||
| 2562 | Ga0496118_0031291 | |||
| 2563 | Ga0496118_0047912 | |||
| 2564 | Ga0496118_0184817 | |||
| 2565 | Ga0496119_0000058 | |||
| 2566 | Ga0496119_0019951 | |||
| 2567 | Ga0496119_0057847 | |||
| 2568 | Ga0496120_0000184 | |||
| 2569 | Ga0496120_0000335 | |||
| 2570 | Ga0496120_0014808 | |||
| 2571 | Ga0496121_0000306 | |||
| 2572 | Ga0496121_0000310 | |||
| 2573 | Ga0496121_0000431 | |||
| 2574 | Ga0496121_0001587 | |||
| 2575 | Ga0496121_0003917 | |||
| 2576 | Ga0496121_0006654 | |||
| 2577 | Ga0496121_0007409 | |||
| 2578 | Ga0496121_0032998 | |||
| 2579 | Ga0496121_0036205 | |||
| 2580 | Ga0496121_0059448 | |||
| 2581 | Ga0496121_0083972 | |||
| 2582 | Ga0496121_0088612 | |||
| 2583 | Ga0496122_0000375 | |||
| 2584 | Ga0496122_0000865 | |||
| 2585 | Ga0496122_0006359 | |||
| 2586 | Ga0496122_0007677 | |||
| 2587 | Ga0496122_0084897 | |||
| 2588 | Ga0496123_0000203 | |||
| 2589 | Ga0496123_0000267 | |||
| 2590 | Ga0496123_0001951 | |||
| 2591 | Ga0496123_0007642 | |||
| 2592 | Ga0496123_0122905 | |||
| 2593 | Ga0496124_0000046 | |||
| 2594 | Ga0496124_0014584 | |||
| 2595 | Ga0496125_0000011 | |||
| 2596 | Ga0496125_0000499 | |||
| 2597 | Ga0496125_0002855 | |||
| 2598 | Ga0496125_0020330 | |||
| 2599 | Ga0496126_0000034 | |||
| 2600 | Ga0496126_0000706 | |||
| 2601 | Ga0496126_0002194 | |||
| 2602 | Ga0496126_0002232 | |||
| 2603 | Ga0496126_0009476 | |||
| 2604 | Ga0496126_0015371 | |||
| 2605 | Ga0496126_0016049 | |||
| 2606 | Ga0496126_0028263 | |||
| 2607 | Ga0496126_0108462 | |||
| 2608 | Ga0496126_0119748 | |||
| 2609 | Ga0496126_0243371 | |||
| 2610 | Ga0495678_000023 | |||
| 2611 | Ga0495678_018904 | |||
| 2612 | Ga0495682_0005399 | |||
| 2613 | Ga0495682_0006472 | |||
| 2614 | Ga0501031_0014372 | |||
| 2615 | Ga0501032_0012518 | |||
| 2616 | Ga0501033_0002347 | |||
| 2617 | Ga0501033_0007556 | |||
| 2618 | Ga0501033_0144939 | |||
| 2619 | Ga0501034_0000268 | |||
| 2620 | Ga0501034_0014340 | |||
| 2621 | Ga0501034_0028679 | |||
| 2622 | Ga0501036_0047363 | |||
| 2623 | Ga0501036_0071739 | |||
| 2624 | Ga0501036_0174845 | |||
| 2625 | Ga0501036_0263525 | |||
| 2626 | Ga0501037_0002084 | |||
| 2627 | Ga0501038_0018830 | |||
| 2628 | Ga0501038_0218532 | |||
| 2629 | Ga0501038_0220105 | |||
| 2630 | Ga0501038_0227818 | |||
| 2631 | Ga0501039_0016403 | |||
| 2632 | Ga0501039_0058323 | |||
| 2633 | Ga0501040_0008966 | |||
| 2634 | Ga0501040_0011763 | |||
| 2635 | Ga0501040_0162859 | |||
| 2636 | Ga0501041_0138624 | |||
| 2637 | Ga0501042_0006589 | |||
| 2638 | Ga0501042_0056597 | |||
| 2639 | Ga0501043_0053884 | |||
| 2640 | Ga0501046_0076996 | |||
| 2641 | Ga0501047_0002786 | |||
| 2642 | Ga0501047_0046666 | |||
| 2643 | Ga0501047_0047030 | |||
| 2644 | Ga0501048_0102808 | |||
| 2645 | Ga0501048_0109594 | |||
| 2646 | Ga0501067_0047374 | |||
| 2647 | Ga0501070_0000201 | |||
| 2648 | Ga0501070_0010763 | |||
| 2649 | Ga0501072_0096425 | |||
| 2650 | Ga0501072_0268942 | |||
| 2651 | Ga0501075_0040394 | |||
| 2652 | Ga0501075_0073090 | |||
| 2653 | Ga0501075_0243628 | |||
| 2654 | Ga0501076_0011826 | |||
| 2655 | Ga0501076_0017868 | |||
| 2656 | Ga0501076_0104755 | |||
| 2657 | Ga0501076_0190485 | |||
| 2658 | Ga0501079_0028464 | |||
| 2659 | Ga0501080_0082829 | |||
| 2660 | Ga0501081_0001856 | |||
| 2661 | Ga0501081_0006018 | |||
| 2662 | Ga0501081_0033190 | |||
| 2663 | Ga0501035_0012600 | |||
| 2664 | Ga0501035_0037213 | |||
| 2665 | Ga0501035_0072502 | |||
| 2666 | Ga0501035_0127926 | |||
| 2667 | Ga0501044_0000076 | |||
| 2668 | Ga0501044_0002174 | |||
| 2669 | Ga0501044_0003619 | |||
| 2670 | Ga0501044_0004747 | |||
| 2671 | Ga0501044_0007876 | |||
| 2672 | Ga0501044_0014630 | |||
| 2673 | Ga0501044_0106789 | |||
| 2674 | Ga0501044_0110316 | |||
| 2675 | Ga0501045_0002662 | |||
| 2676 | Ga0501045_0102389 | |||
| 2677 | nmdc:mga03n38_24395_c1 | |||
| 2678 | nmdc:mga00v17_109959_c1 | |||
| 2679 | nmdc:mga00v17_16444_c1 | |||
| 2680 | nmdc:mga00v17_7113_c1 | |||
| 2681 | nmdc:mga0yw44_133339_c1 | |||
| 2682 | nmdc:mga0k408_173163_c1 | |||
| 2683 | nmdc:mga0k408_4449_c1 | |||
| 2684 | nmdc:mga07m45_33869_c1 | |||
| 2685 | nmdc:mga07m45_3597_c1 | |||
| 2686 | nmdc:mga07m45_76859_c1 | |||
| 2687 | nmdc:mga05p37_758_c1 | |||
| 2688 | nmdc:mga09592_1050_c1 | |||
| 2689 | nmdc:mga09592_110466_c1 | |||
| 2690 | nmdc:mga0qj67_2437_c1 | |||
| 2691 | nmdc:mga0qj67_32479_c1 | |||
| 2692 | nmdc:mga0qj67_36310_c1 | |||
| 2693 | nmdc:mga0qj67_8037_c1 | |||
| 2694 | nmdc:mga06r32_5201_c1 | |||
| 2695 | nmdc:mga08y16_166325_c1 | |||
| 2696 | nmdc:mga08y16_22033_c1 | |||
| 2697 | nmdc:mga08y16_254907_c1 | |||
| 2698 | nmdc:mga0n895_1569_c1 | |||
| 2699 | nmdc:mga0n895_2878_c1 | |||
| 2700 | nmdc:mga0n895_47507_c1 | |||
| 2701 | nmdc:mga0rr50_2095_c1 | |||
| 2702 | nmdc:mga08x19_1254_c1 | |||
| 2703 | nmdc:mga08x19_16509_c1 | |||
| 2704 | nmdc:mga08x19_16751_c1 | |||
| 2705 | nmdc:mga08x19_303_c1 | |||
| 2706 | nmdc:mga08x19_48686_c1 | |||
| 2707 | nmdc:mga0a205_147036_c1 | |||
| 2708 | nmdc:mga0a205_27603_c1 | |||
| 2709 | nmdc:mga0a205_599_c1 | |||
| 2710 | Ga0495601_0011862 | |||
| 2711 | Ga0500610_0000821 | |||
| 2712 | Ga0495619_0063625 | |||
| 2713 | Ga0500643_000002 | |||
| 2714 | Ga0500555_000716 | |||
| 2715 | Ga0500593_000835 | |||
| 2716 | Ga0500595_001911 | |||
| 2717 | Ga0500607_001548 | |||
| 2718 | Ga0500618_000877 | |||
| 2719 | Ga0500618_001593 | |||
| 2720 | Ga0500618_005380 | |||
| 2721 | Ga0500652_079452 | |||
| 2722 | Ga0500574_005155 | |||
| 2723 | Ga0500600_0012736 | |||
| 2724 | Ga0500627_0069699 | |||
| 2725 | Ga0500633_0001927 | |||
| 2726 | Ga0500645_000704 | |||
| 2727 | Ga0501084_0144421 | |||
| 2728 | Ga0501082_0016248 | |||
| 2729 | Ga0501082_0130687 | |||
| 2730 | Ga0466962_0000994 | |||
| 2731 | Ga0466962_0008295 | |||
| 2732 | Ga0530510_0007953 | |||
| 2733 | 2501073341 | |||
| 2734 | 2501082663 | |||
| 2735 | 2501408403 | |||
| 2736 | 2509132288 | |||
| 2737 | 2510251804 | |||
| 2738 | 2511086004 | |||
| 2739 | 2511096138 | |||
| 2740 | 2511103139 | |||
| 2741 | 2511248956 | |||
| 2742 | 2511387491 | |||
| 2743 | 2512345227 | |||
| 2744 | 2513563427 | |||
| 2745 | 2513956525 | |||
| 2746 | 2513961449 | |||
| 2747 | 2514044194 | |||
| 2748 | 2514050936 | |||
| 2749 | 2515684318 | |||
| 2750 | 2515691611 | |||
| 2751 | 2516022437 | |||
| 2752 | 2519458237 | |||
| 2753 | 2521557584 | |||
| 2754 | 2527080748 | |||
| 2755 | 2538833115 | |||
| 2756 | 2548501096 | |||
| 2757 | 2550696232 | |||
| 2758 | 2553006612 | |||
| 2759 | 2563059230 | |||
| 2760 | 2585294710 | |||
| 2761 | 2597028872 | |||
| 2762 | 2599445560 | |||
| 2763 | 2599738098 | |||
| 2764 | 2599742530 | |||
| 2765 | 2599903203 | |||
| 2766 | 2600204648 | |||
| 2767 | 2600810828 | |||
| 2768 | 2643831586 | |||
| 2769 | 2643862305 | |||
| 2770 | 2643866797 | |||
| 2771 | 2643893955 | |||
| 2772 | 2643980669 | |||
| 2773 | 2643993519 | |||
| 2774 | 2644062638 | |||
| 2775 | 2644076348 | |||
| 2776 | 2644122097 | |||
| 2777 | 2644294656 | |||
| 2778 | 2644476174 | |||
| 2779 | 2644645810 | |||
| 2780 | 2676741634 | |||
| 2781 | 2713479837 | |||
| 2782 | 2719640915 | |||
| 2783 | 2722882785 | |||
| 2784 | 2723876549 | |||
| 2785 | 2735836770 | |||
| 2786 | 2738818999 | |||
| 2787 | 2738830845 | |||
| 2788 | 2738872372 | |||
| 2789 | 2739184002 | |||
| 2790 | 2739218972 | |||
| 2791 | 2739228686 | |||
| 2792 | 2739244678 | |||
| 2793 | 2739252239 | |||
| 2794 | 2739612173 | |||
| 2795 | 2739732001 | |||
| 2796 | 2746088176 | |||
| 2797 | 2746096930 | |||
| 2798 | 2748019447 | |||
| 2799 | 2753571040 | |||
| 2800 | 2765570251 | |||
| 2801 | 2792834002 | |||
| 2802 | 2808970007 | |||
| 2803 | 2808984390 | |||
| 2804 | 2809005146 | |||
| 2805 | 2809011713 | |||
| 2806 | 2809032014 | |||
| 2807 | 2809130744 | |||
| 2808 | 2809149778 | |||
| 2809 | 2816475119 | |||
| 2810 | 2817260388 | |||
| 2811 | 2817278076 | |||
| 2812 | 2817455643 | |||
| 2813 | 2819544245 | |||
| 2814 | 2819591419 | |||
| 2815 | 2819615276 | |||
| 2816 | 2819623564 | |||
| 2817 | 2819632914 | |||
| 2818 | 2834644904 | |||
| 2819 | 2839096804 | |||
| 2820 | 2839138516 | |||
| 2821 | 2842325092 | |||
| 2822 | 2842349370 | |||
| 2823 | 2842459888 | |||
| 2824 | 2842719770 | |||
| 2825 | 2842918932 | |||
| 2826 | 2852620081 | |||
| 2827 | 2852687714 | |||
| 2828 | 2855734619 | |||
| 2829 | 2855770209 | |||
| 2830 | 2857361004 | |||
| 2831 | 2857538493 | |||
| 2832 | 2857546604 | |||
| 2833 | 2858955765 | |||
| 2834 | 2863421925 | |||
| 2835 | 2870072133 | |||
| 2836 | 2881414430 | |||
| 2837 | 2883088027 | |||
| 2838 | 2884340366 | |||
| 2839 | 2884413860 | |||
| 2840 | 2884812895 | |||
| 2841 | 2884812901 | |||
| 2842 | 2884837223 | |||
| 2843 | 2884853514 | |||
| 2844 | 2885266779 | |||
| 2845 | 2885271087 | |||
| 2846 | 2887377871 | |||
| 2847 | 2894026031 | |||
| 2848 | 2895397007 | |||
| 2849 | 2895501385 | |||
| 2850 | 2895514528 | |||
| 2851 | 2895523990 | |||
| 2852 | 2895527478 | |||
| 2853 | 2896155369 | |||
| 2854 | 2900578647 | |||
| 2855 | 2900637816 | |||
| 2856 | 2901312876 | |||
| 2857 | 2902687098 | |||
| 2858 | 2904436949 | |||
| 2859 | 2904441706 | |||
| 2860 | 2904463563 | |||
| 2861 | 2904480842 | |||
| 2862 | 2904487413 | |||
| 2863 | 2904531372 | |||
| 2864 | 2904566090 | |||
| 2865 | 2904573134 | |||
| 2866 | 2904586973 | |||
| 2867 | 2904592994 | |||
| 2868 | 2904603193 | |||
| 2869 | 2904623551 | |||
| 2870 | 2919050987 | |||
| 2871 | 2919082044 | |||
| 2872 | 2919405256 | |||
| 2873 | 2919528720 | |||
| 2874 | 2921648338 | |||
| 2875 | 2923516281 | |||
| 2876 | 2928062895 | |||
| 2877 | 2928110849 | |||
| 2878 | 2928135075 | |||
| 2879 | 2928137593 | |||
| 2880 | 2928159494 | |||
| 2881 | 2928164446 | |||
| 2882 | 2928177570 | |||
| 2883 | 2928510229 | |||
| 2884 | 2928538344 | |||
| 2885 | 2928964694 | |||
| 2886 | 2939614199 | |||
| 2887 | 2939631547 | |||
| 2888 | 2941481907 | |||
| 2889 | 2945937679 | |||
| 2890 | 2974323846 | |||
| 2891 | 2981993928 | |||
| 2892 | 2990705603 | |||
| 2893 | 2990712755 | |||
| 2894 | 642427189 | |||
| 2895 | 642417817 | |||
| 2896 | 642592578 | |||
| 2897 | 642622500 | |||
| 2898 | 644748408 | |||
| 2899 | 8002395026 | |||
| 2900 | 8003401744 | |||
| 2901 | 8003957814 | |||
| 2902 | 8018850359 | |||
| 2903 | 8020808859 | |||
| 2904 | 8020939385 | |||
| 2905 | 8020947212 | |||
| 2906 | 8020954391 | |||
| 2907 | 8021122821 | |||
| 2908 | 8039102758 | |||
| 2909 | 8040169310 | |||
| 2910 | 8040174987 | |||
| 2911 | 8048749749 | |||
| 2912 | 8055227965 | |||
| 2913 | 8055266965 | |||
| 2914 | 8055301719 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hl7-assembly2.cif.gz_B | crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae | 0.9606 | 1 | 389 |
| 3os4-assembly1.cif.gz_A | the crystal structure of nicotinate phosphoribosyltransferase from yersinia pestis | 0.9589 | 2 | 389 |
| 4hl7-assembly2.cif.gz_B | crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae | 0.9582 | 1 | 389 |
| 1yir-assembly3.cif.gz_C | crystal structure of a nicotinate phosphoribosyltransferase | 0.9563 | 1 | 388 |
| 4hl7-assembly1.cif.gz_A | crystal structure of nicotinate phosphoribosyltransferase (target nysgr-026035) from vibrio cholerae | 0.9562 | 2 | 389 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P18133_1_400_3.20.140.10 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.9575 | 2 | 389 | 3.20.140.10 |
| af_P18133_1_400_3.20.140.10 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.9502 | 2 | 389 | 3.20.140.10 |
| 2im5B00 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.9435 | 2 | 388 | 3.20.140.10 |
| 1ybeA00 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.9335 | 2 | 389 | 3.20.140.10 |
| 4hl7A00 | Alpha Beta;Alpha-Beta Barrel;nicotinate phosphoribosyltransferase;nicotinate phosphoribosyltransferase | 0.9304 | 2 | 389 | 3.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A158K0P2-F1-model_v4 | Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) | 0.995 | 1 | 389 |
GO:0004516
GO:0005829 GO:0016757 GO:0034355 |
| AF-A0A2R7J1X4-F1-model_v4 | deleted | 0.9947 | 2 | 133 |
|
| AF-A0A5E4WZV9-F1-model_v4 | Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) | 0.9945 | 1 | 389 |
GO:0004516
GO:0005829 GO:0016757 GO:0034355 |
| AF-A0A846UPW0-F1-model_v4 | Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) | 0.9935 | 1 | 389 |
GO:0004516
GO:0005829 GO:0016757 GO:0034355 |
| AF-A0A3R8NDJ0-F1-model_v4 | Nicotinate phosphoribosyltransferase (NAPRTase) (EC 6.3.4.21) | 0.9932 | 1 | 389 |
GO:0004516
GO:0005829 GO:0016757 GO:0034355 |