F494101
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1458 | 379 | 2872 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300001977|JGI24746J21847_1000713|JGI24746J21847_10007134 |
| Length | 377 |
| Sequence | LCIVAIETSELEGGPRVTDDVRFGLEADMGILAREQGALYLQATLREGEDHEGPYIHARRLRGSLRGYFLAVSAGFAAPAGAQDTIKVAVGQIDAWANQVPTLGMKAGIFQKHGIVLDNYGTQGAGETLQAVISGSADIGIGVGTPGAMRAYAKGAPVRVLAAAYTGVQDIYWFVPASSPITSVKDISDRHTIAYSTNGSTSDSVLRALIAHYGLKAKPAQTGGPPGTFTMTMSGQIDIGWSVAPFGLKELQAKSIRVLMRGSDLPSMRNQTVRVEIVNANALKDRHDVMVRFMRAYRETLDWMYSNPLAVKYYSEHMRMPESLVELQRDEFNPKSAMNPDKLSDVDLVMQDAVAGKFLEMPLTKEQLAEFIQIPPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 100 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 101 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 102 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 103 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 110 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 223 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 238 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 244 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 260 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 261 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 262 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 263 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 376 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 379 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.58 |
| Nodule | 0 |
| Rhizoplane | 12.62 |
| Rhizosphere | 85.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000713 | 3300001977 | Bacteria | 5118 |
| 2 | JGI24746J21847_1013634 | 3300001977 | Unclassified | 1180 |
| 3 | JGI24739J22299_10002354 | 3300001989 | Bacteria | 7281 |
| 4 | JGI24739J22299_10018214 | 3300001989 | Bacteria | 2527 |
| 5 | JGI24737J22298_10000583 | 3300001990 | Bacteria | 12816 |
| 6 | JGI24737J22298_10041560 | 3300001990 | Bacteria | 1410 |
| 7 | JGI24750J21931_1000574 | 3300002070 | Bacteria | 5637 |
| 8 | JGI24745J21846_1000334 | 3300002073 | Bacteria | 4076 |
| 9 | JGI24745J21846_1008400 | 3300002073 | Bacteria | 1163 |
| 10 | JGI24738J21930_10021266 | 3300002075 | Bacteria | 1346 |
| 11 | JGI24744J21845_10000414 | 3300002077 | Bacteria | 7434 |
| 12 | JGI24744J21845_10009162 | 3300002077 | Bacteria | 2032 |
| 13 | JGI24744J21845_10013844 | 3300002077 | Bacteria | 1625 |
| 14 | JGI24034J26672_10000259 | 3300002239 | Bacteria | 6955 |
| 15 | JGI24034J26672_10000505 | 3300002239 | Bacteria | 5037 |
| 16 | JGI24034J26672_10016114 | 3300002239 | Bacteria | 1149 |
| 17 | JGI24742J22300_10000043 | 3300002244 | Bacteria | 18528 |
| 18 | JGI25405J52794_10002442 | 3300003911 | Bacteria | 3200 |
| 19 | Ga0065712_10070182 | 3300005290 | Bacteria | 6248 |
| 20 | Ga0065715_10259753 | 3300005293 | Bacteria | 1141 |
| 21 | Ga0070676_10021315 | 3300005328 | Bacteria | 3627 |
| 22 | Ga0070676_10049580 | 3300005328 | Bacteria | 2458 |
| 23 | Ga0070676_10078722 | 3300005328 | Bacteria | 1995 |
| 24 | Ga0070676_10189854 | 3300005328 | Bacteria | 1341 |
| 25 | Ga0070683_100000656 | 3300005329 | Bacteria | 25014 |
| 26 | Ga0070683_100003103 | 3300005329 | Bacteria | 13382 |
| 27 | Ga0070683_100074077 | 3300005329 | Bacteria | 3180 |
| 28 | Ga0070683_100077908 | 3300005329 | Bacteria | 3100 |
| 29 | Ga0070683_100103903 | 3300005329 | Bacteria | 2678 |
| 30 | Ga0070683_100359163 | 3300005329 | Unclassified | 1387 |
| 31 | Ga0070690_100001658 | 3300005330 | Bacteria | 11711 |
| 32 | Ga0070690_100001831 | 3300005330 | Bacteria | 11268 |
| 33 | Ga0070690_100032490 | 3300005330 | Bacteria | 3260 |
| 34 | Ga0070690_100142366 | 3300005330 | Bacteria | 1629 |
| 35 | Ga0070670_100002207 | 3300005331 | Bacteria | 15999 |
| 36 | Ga0070670_100016346 | 3300005331 | Bacteria | 6372 |
| 37 | Ga0070670_100067176 | 3300005331 | Unclassified | 3077 |
| 38 | Ga0070670_100092366 | 3300005331 | Bacteria | 2602 |
| 39 | Ga0070670_100108703 | 3300005331 | Bacteria | 2389 |
| 40 | Ga0070670_100154184 | 3300005331 | Bacteria | 1989 |
| 41 | Ga0070670_100274015 | 3300005331 | Unclassified | 1473 |
| 42 | Ga0070677_10000076 | 3300005333 | Bacteria | 31338 |
| 43 | Ga0070677_10006595 | 3300005333 | Bacteria | 3857 |
| 44 | Ga0068869_100000216 | 3300005334 | Bacteria | 29999 |
| 45 | Ga0068869_100003321 | 3300005334 | Bacteria | 9826 |
| 46 | Ga0068869_100016912 | 3300005334 | Bacteria | 4929 |
| 47 | Ga0068869_100020350 | 3300005334 | Bacteria | 4549 |
| 48 | Ga0068869_100218176 | 3300005334 | Bacteria | 1511 |
| 49 | Ga0068869_100277554 | 3300005334 | Unclassified | 1347 |
| 50 | Ga0070666_10002180 | 3300005335 | Bacteria | 11899 |
| 51 | Ga0070666_10017246 | 3300005335 | Bacteria | 4627 |
| 52 | Ga0070666_10020081 | 3300005335 | Bacteria | 4316 |
| 53 | Ga0070666_10050722 | 3300005335 | Bacteria | 2792 |
| 54 | Ga0070666_10072560 | 3300005335 | Bacteria | 2344 |
| 55 | Ga0070680_100002960 | 3300005336 | Bacteria | 12628 |
| 56 | Ga0070680_100003735 | 3300005336 | Bacteria | 11374 |
| 57 | Ga0070680_100019228 | 3300005336 | Bacteria | 5411 |
| 58 | Ga0070682_100000285 | 3300005337 | Bacteria | 36134 |
| 59 | Ga0070682_100011413 | 3300005337 | Bacteria | 5075 |
| 60 | Ga0070682_100031677 | 3300005337 | Bacteria | 3199 |
| 61 | Ga0070682_100049267 | 3300005337 | Bacteria | 2625 |
| 62 | Ga0070682_100073428 | 3300005337 | Bacteria | 2194 |
| 63 | Ga0070682_100122865 | 3300005337 | Bacteria | 1746 |
| 64 | Ga0068868_100000474 | 3300005338 | Bacteria | 26674 |
| 65 | Ga0068868_100089186 | 3300005338 | Bacteria | 2482 |
| 66 | Ga0068868_100253399 | 3300005338 | Unclassified | 1482 |
| 67 | Ga0070660_100000874 | 3300005339 | Bacteria | 20123 |
| 68 | Ga0070660_100001332 | 3300005339 | Bacteria | 16783 |
| 69 | Ga0070660_100049252 | 3300005339 | Bacteria | 3238 |
| 70 | Ga0070689_100004112 | 3300005340 | Bacteria | 9801 |
| 71 | Ga0070689_100011551 | 3300005340 | Bacteria | 6327 |
| 72 | Ga0070689_100044257 | 3300005340 | Bacteria | 3424 |
| 73 | Ga0070689_100406625 | 3300005340 | Bacteria | 1152 |
| 74 | Ga0070691_10001440 | 3300005341 | Bacteria | 10178 |
| 75 | Ga0070691_10023960 | 3300005341 | Bacteria | 2835 |
| 76 | Ga0070691_10033534 | 3300005341 | Bacteria | 2416 |
| 77 | Ga0070687_100005766 | 3300005343 | Bacteria | 5030 |
| 78 | Ga0070661_100002370 | 3300005344 | Bacteria | 12928 |
| 79 | Ga0070661_100023545 | 3300005344 | Bacteria | 4415 |
| 80 | Ga0070661_100054477 | 3300005344 | Plasmid | 2929 |
| 81 | Ga0070692_10000173 | 3300005345 | Bacteria | 16637 |
| 82 | Ga0070692_10000841 | 3300005345 | Bacteria | 10313 |
| 83 | Ga0070668_100002051 | 3300005347 | Bacteria | 14738 |
| 84 | Ga0070668_100202879 | 3300005347 | Bacteria | 1628 |
| 85 | Ga0070669_100001956 | 3300005353 | Bacteria | 14875 |
| 86 | Ga0070669_100011387 | 3300005353 | Bacteria | 6316 |
| 87 | Ga0070675_100000622 | 3300005354 | Bacteria | 24525 |
| 88 | Ga0070675_100057314 | 3300005354 | Bacteria | 3211 |
| 89 | Ga0070675_100068345 | 3300005354 | Bacteria | 2942 |
| 90 | Ga0070675_100206227 | 3300005354 | Unclassified | 1707 |
| 91 | Ga0070671_100001629 | 3300005355 | Bacteria | 16929 |
| 92 | Ga0070671_100012131 | 3300005355 | Bacteria | 6935 |
| 93 | Ga0070671_100018516 | 3300005355 | Bacteria | 5658 |
| 94 | Ga0070671_100095238 | 3300005355 | Bacteria | 2495 |
| 95 | Ga0070671_100132167 | 3300005355 | Unclassified | 2102 |
| 96 | Ga0070671_100250920 | 3300005355 | Bacteria | 1503 |
| 97 | Ga0070674_100027715 | 3300005356 | Bacteria | 3714 |
| 98 | Ga0070674_100047491 | 3300005356 | Bacteria | 2942 |
| 99 | Ga0070674_100105650 | 3300005356 | Bacteria | 2059 |
| 100 | Ga0070674_100210530 | 3300005356 | Bacteria | 1506 |
| 101 | Ga0070674_100233068 | 3300005356 | Bacteria | 1438 |
| 102 | Ga0070673_100000418 | 3300005364 | Bacteria | 22446 |
| 103 | Ga0070673_100000640 | 3300005364 | Bacteria | 19217 |
| 104 | Ga0070673_100037488 | 3300005364 | Bacteria | 3694 |
| 105 | Ga0070673_100070898 | 3300005364 | Bacteria | 2798 |
| 106 | Ga0070673_100189629 | 3300005364 | Unclassified | 1765 |
| 107 | Ga0070688_100000906 | 3300005365 | Bacteria | 14793 |
| 108 | Ga0070688_100001260 | 3300005365 | Bacteria | 12627 |
| 109 | Ga0070688_100008005 | 3300005365 | Bacteria | 5718 |
| 110 | Ga0070688_100061411 | 3300005365 | Bacteria | 2376 |
| 111 | Ga0070688_100132522 | 3300005365 | Bacteria | 1683 |
| 112 | Ga0070659_100001362 | 3300005366 | Bacteria | 17597 |
| 113 | Ga0070659_100003550 | 3300005366 | Bacteria | 11108 |
| 114 | Ga0070659_100037636 | 3300005366 | Bacteria | 3772 |
| 115 | Ga0070659_100062209 | 3300005366 | Bacteria | 2950 |
| 116 | Ga0070659_100437291 | 3300005366 | Bacteria | 1108 |
| 117 | Ga0070667_100001650 | 3300005367 | Bacteria | 19960 |
| 118 | Ga0070667_100015334 | 3300005367 | Bacteria | 6334 |
| 119 | Ga0070667_100035664 | 3300005367 | Bacteria | 4168 |
| 120 | Ga0070667_100104193 | 3300005367 | Bacteria | 2453 |
| 121 | Ga0070667_100188861 | 3300005367 | Bacteria | 1824 |
| 122 | Ga0070667_100292313 | 3300005367 | Bacteria | 1466 |
| 123 | Ga0070703_10003120 | 3300005406 | Bacteria | 4741 |
| 124 | Ga0070709_10004958 | 3300005434 | Bacteria | 7194 |
| 125 | Ga0070709_10007315 | 3300005434 | Bacteria | 6051 |
| 126 | Ga0070709_10175311 | 3300005434 | Bacteria | 1502 |
| 127 | Ga0070709_10338479 | 3300005434 | Unclassified | 1109 |
| 128 | Ga0070714_100027432 | 3300005435 | Bacteria | 4717 |
| 129 | Ga0070714_100033507 | 3300005435 | Bacteria | 4294 |
| 130 | Ga0070714_100050626 | 3300005435 | Bacteria | 3539 |
| 131 | Ga0070714_100069271 | 3300005435 | Unclassified | 3046 |
| 132 | Ga0070714_100155094 | 3300005435 | Bacteria | 2066 |
| 133 | Ga0070713_100000526 | 3300005436 | Bacteria | 24268 |
| 134 | Ga0070713_100069032 | 3300005436 | Bacteria | 2979 |
| 135 | Ga0070713_100073376 | 3300005436 | Bacteria | 2896 |
| 136 | Ga0070713_100241283 | 3300005436 | Bacteria | 1646 |
| 137 | Ga0070713_100293160 | 3300005436 | Bacteria | 1496 |
| 138 | Ga0070710_10021860 | 3300005437 | Bacteria | 3339 |
| 139 | Ga0070710_10024235 | 3300005437 | Bacteria | 3199 |
| 140 | Ga0070701_10000264 | 3300005438 | Bacteria | 17077 |
| 141 | Ga0070701_10015338 | 3300005438 | Bacteria | 3537 |
| 142 | Ga0070701_10041566 | 3300005438 | Bacteria | 2344 |
| 143 | Ga0070711_100017524 | 3300005439 | Bacteria | 4562 |
| 144 | Ga0070711_100092561 | 3300005439 | Unclassified | 2182 |
| 145 | Ga0070711_100103772 | 3300005439 | Bacteria | 2073 |
| 146 | Ga0070705_100001279 | 3300005440 | Bacteria | 13562 |
| 147 | Ga0070705_100067351 | 3300005440 | Bacteria | 2151 |
| 148 | Ga0070705_100177813 | 3300005440 | Bacteria | 1438 |
| 149 | Ga0070700_100004852 | 3300005441 | Bacteria | 7065 |
| 150 | Ga0070700_100010848 | 3300005441 | Bacteria | 5037 |
| 151 | Ga0070700_100030981 | 3300005441 | Bacteria | 3201 |
| 152 | Ga0070700_100072767 | 3300005441 | Bacteria | 2198 |
| 153 | Ga0070694_100000576 | 3300005444 | Bacteria | 20334 |
| 154 | Ga0070694_100002530 | 3300005444 | Bacteria | 10796 |
| 155 | Ga0070708_100150592 | 3300005445 | Bacteria | 2163 |
| 156 | Ga0070663_100001039 | 3300005455 | Bacteria | 15172 |
| 157 | Ga0070663_100014289 | 3300005455 | Bacteria | 5093 |
| 158 | Ga0070663_100016904 | 3300005455 | Bacteria | 4748 |
| 159 | Ga0070663_100110880 | 3300005455 | Bacteria | 2061 |
| 160 | Ga0070663_100210250 | 3300005455 | Bacteria | 1523 |
| 161 | Ga0070678_100008209 | 3300005456 | Bacteria | 6241 |
| 162 | Ga0070678_100009636 | 3300005456 | Bacteria | 5865 |
| 163 | Ga0070678_100036667 | 3300005456 | Bacteria | 3434 |
| 164 | Ga0070678_100040359 | 3300005456 | Bacteria | 3302 |
| 165 | Ga0070678_100107360 | 3300005456 | Bacteria | 2177 |
| 166 | Ga0070662_100009914 | 3300005457 | Bacteria | 6241 |
| 167 | Ga0070662_100064734 | 3300005457 | Plasmid | 2678 |
| 168 | Ga0070662_100183385 | 3300005457 | Unclassified | 1651 |
| 169 | Ga0070662_100237177 | 3300005457 | Unclassified | 1461 |
| 170 | Ga0070681_10008583 | 3300005458 | Bacteria | 10012 |
| 171 | Ga0070681_10008649 | 3300005458 | Bacteria | 9982 |
| 172 | Ga0070681_10152054 | 3300005458 | Bacteria | 2241 |
| 173 | Ga0070681_10236056 | 3300005458 | Bacteria | 1742 |
| 174 | Ga0070681_10372367 | 3300005458 | Bacteria | 1339 |
| 175 | Ga0070681_10465262 | 3300005458 | Bacteria | 1177 |
| 176 | Ga0068867_100048243 | 3300005459 | Bacteria | 3132 |
| 177 | Ga0070685_10000645 | 3300005466 | Bacteria | 19015 |
| 178 | Ga0070685_10039257 | 3300005466 | Bacteria | 2688 |
| 179 | Ga0070685_10043864 | 3300005466 | Bacteria | 2558 |
| 180 | Ga0070685_10106134 | 3300005466 | Bacteria | 1723 |
| 181 | Ga0070707_100117784 | 3300005468 | Unclassified | 2578 |
| 182 | Ga0070699_100000676 | 3300005518 | Bacteria | 31923 |
| 183 | Ga0070699_100077901 | 3300005518 | Unclassified | 2886 |
| 184 | Ga0070699_100315526 | 3300005518 | Bacteria | 1404 |
| 185 | Ga0070679_100021636 | 3300005530 | Bacteria | 6279 |
| 186 | Ga0070679_100032292 | 3300005530 | Bacteria | 5177 |
| 187 | Ga0070679_100070445 | 3300005530 | Bacteria | 3488 |
| 188 | Ga0070679_100102817 | 3300005530 | Bacteria | 2843 |
| 189 | Ga0070679_100589355 | 3300005530 | Bacteria | 1055 |
| 190 | Ga0070684_100001969 | 3300005535 | Bacteria | 15093 |
| 191 | Ga0070684_100002245 | 3300005535 | Bacteria | 14207 |
| 192 | Ga0070684_100124386 | 3300005535 | Unclassified | 2322 |
| 193 | Ga0070684_100133700 | 3300005535 | Bacteria | 2239 |
| 194 | Ga0070684_100417922 | 3300005535 | Unclassified | 1237 |
| 195 | Ga0070697_100070677 | 3300005536 | Unclassified | 2862 |
| 196 | Ga0070697_100081262 | 3300005536 | Bacteria | 2670 |
| 197 | Ga0068853_100005266 | 3300005539 | Bacteria | 10126 |
| 198 | Ga0068853_100206837 | 3300005539 | Bacteria | 1788 |
| 199 | Ga0068853_100246551 | 3300005539 | Unclassified | 1638 |
| 200 | Ga0070672_100021363 | 3300005543 | Bacteria | 4734 |
| 201 | Ga0070672_100079680 | 3300005543 | Bacteria | 2622 |
| 202 | Ga0070672_100212707 | 3300005543 | Unclassified | 1620 |
| 203 | Ga0070686_100001137 | 3300005544 | Bacteria | 15280 |
| 204 | Ga0070686_100002237 | 3300005544 | Bacteria | 10673 |
| 205 | Ga0070686_100003181 | 3300005544 | Bacteria | 8988 |
| 206 | Ga0070686_100014107 | 3300005544 | Bacteria | 4595 |
| 207 | Ga0070686_100064365 | 3300005544 | Bacteria | 2378 |
| 208 | Ga0070695_100011111 | 3300005545 | Bacteria | 5381 |
| 209 | Ga0070696_100007394 | 3300005546 | Bacteria | 7340 |
| 210 | Ga0070696_100036204 | 3300005546 | Bacteria | 3402 |
| 211 | Ga0070696_100158540 | 3300005546 | Bacteria | 1666 |
| 212 | Ga0070696_100218345 | 3300005546 | Unclassified | 1430 |
| 213 | Ga0070693_100001170 | 3300005547 | Bacteria | 11794 |
| 214 | Ga0070693_100008690 | 3300005547 | Bacteria | 5025 |
| 215 | Ga0070693_100012214 | 3300005547 | Bacteria | 4343 |
| 216 | Ga0070693_100059626 | 3300005547 | Bacteria | 2212 |
| 217 | Ga0070693_100087770 | 3300005547 | Bacteria | 1869 |
| 218 | Ga0070665_100167945 | 3300005548 | Bacteria | 2196 |
| 219 | Ga0070665_100200619 | 3300005548 | Bacteria | 1995 |
| 220 | Ga0070665_100217209 | 3300005548 | Unclassified | 1913 |
| 221 | Ga0070704_100000444 | 3300005549 | Bacteria | 19453 |
| 222 | Ga0070704_100226163 | 3300005549 | Unclassified | 1524 |
| 223 | Ga0068855_100004774 | 3300005563 | Bacteria | 16547 |
| 224 | Ga0068855_100010841 | 3300005563 | Bacteria | 11004 |
| 225 | Ga0068855_100018831 | 3300005563 | Bacteria | 8299 |
| 226 | Ga0068855_100095578 | 3300005563 | Bacteria | 3425 |
| 227 | Ga0070664_100000973 | 3300005564 | Bacteria | 22427 |
| 228 | Ga0070664_100112001 | 3300005564 | Bacteria | 2383 |
| 229 | Ga0070664_100124567 | 3300005564 | Bacteria | 2259 |
| 230 | Ga0070664_100126441 | 3300005564 | Bacteria | 2243 |
| 231 | Ga0070664_100155637 | 3300005564 | Bacteria | 2019 |
| 232 | Ga0070664_100171499 | 3300005564 | Unclassified | 1925 |
| 233 | Ga0070664_100307618 | 3300005564 | Unclassified | 1433 |
| 234 | Ga0070664_100311117 | 3300005564 | Bacteria | 1425 |
| 235 | Ga0070664_100334521 | 3300005564 | Unclassified | 1374 |
| 236 | Ga0068857_100001725 | 3300005577 | Bacteria | 17581 |
| 237 | Ga0068857_100002282 | 3300005577 | Bacteria | 15594 |
| 238 | Ga0068857_100134067 | 3300005577 | Bacteria | 2236 |
| 239 | Ga0068857_100391336 | 3300005577 | Bacteria | 1292 |
| 240 | Ga0068854_100008414 | 3300005578 | Bacteria | 6631 |
| 241 | Ga0068854_100017017 | 3300005578 | Bacteria | 4858 |
| 242 | Ga0068854_100026506 | 3300005578 | Bacteria | 3984 |
| 243 | Ga0068854_100153246 | 3300005578 | Bacteria | 1779 |
| 244 | Ga0068856_100002597 | 3300005614 | Bacteria | 18595 |
| 245 | Ga0068856_100006444 | 3300005614 | Bacteria | 11514 |
| 246 | Ga0068856_100123648 | 3300005614 | Bacteria | 2590 |
| 247 | Ga0068856_100170868 | 3300005614 | Bacteria | 2186 |
| 248 | Ga0068856_100220706 | 3300005614 | Unclassified | 1911 |
| 249 | Ga0068856_100337961 | 3300005614 | Bacteria | 1524 |
| 250 | Ga0068856_100395393 | 3300005614 | Unclassified | 1402 |
| 251 | Ga0070702_100012214 | 3300005615 | Bacteria | 4296 |
| 252 | Ga0070702_100022622 | 3300005615 | Bacteria | 3327 |
| 253 | Ga0070702_100023822 | 3300005615 | Bacteria | 3258 |
| 254 | Ga0070702_100047628 | 3300005615 | Unclassified | 2436 |
| 255 | Ga0070702_100097801 | 3300005615 | Bacteria | 1794 |
| 256 | Ga0068852_100003186 | 3300005616 | Bacteria | 11456 |
| 257 | Ga0068852_100015271 | 3300005616 | Bacteria | 5947 |
| 258 | Ga0068852_100034442 | 3300005616 | Bacteria | 4213 |
| 259 | Ga0068852_100063194 | 3300005616 | Bacteria | 3223 |
| 260 | Ga0068852_100164676 | 3300005616 | Bacteria | 2073 |
| 261 | Ga0068852_100434768 | 3300005616 | Unclassified | 1296 |
| 262 | Ga0068859_100002825 | 3300005617 | Bacteria | 17604 |
| 263 | Ga0068859_100005044 | 3300005617 | Bacteria | 13403 |
| 264 | Ga0068859_100094085 | 3300005617 | Unclassified | 3049 |
| 265 | Ga0068859_100260494 | 3300005617 | Bacteria | 1825 |
| 266 | Ga0068864_100003691 | 3300005618 | Bacteria | 12643 |
| 267 | Ga0068864_100004392 | 3300005618 | Bacteria | 11577 |
| 268 | Ga0068864_100039550 | 3300005618 | Bacteria | 4031 |
| 269 | Ga0068864_100168540 | 3300005618 | Bacteria | 1995 |
| 270 | Ga0068864_100279590 | 3300005618 | Bacteria | 1557 |
| 271 | Ga0068866_10000294 | 3300005718 | Bacteria | 23748 |
| 272 | Ga0068861_100003318 | 3300005719 | Bacteria | 10657 |
| 273 | Ga0068861_100025608 | 3300005719 | Bacteria | 4280 |
| 274 | Ga0068861_100146275 | 3300005719 | Bacteria | 1934 |
| 275 | Ga0068851_10041359 | 3300005834 | Bacteria | 2317 |
| 276 | Ga0068851_10047424 | 3300005834 | Bacteria | 2176 |
| 277 | Ga0068870_10000048 | 3300005840 | Bacteria | 37476 |
| 278 | Ga0068870_10000555 | 3300005840 | Bacteria | 14125 |
| 279 | Ga0068870_10014085 | 3300005840 | Bacteria | 3772 |
| 280 | Ga0068870_10107612 | 3300005840 | Unclassified | 1586 |
| 281 | Ga0068863_100001975 | 3300005841 | Bacteria | 20397 |
| 282 | Ga0068863_100023486 | 3300005841 | Bacteria | 5887 |
| 283 | Ga0068863_100032997 | 3300005841 | Bacteria | 4932 |
| 284 | Ga0068863_100070126 | 3300005841 | Unclassified | 3314 |
| 285 | Ga0068863_100120391 | 3300005841 | Bacteria | 2502 |
| 286 | Ga0068863_100144908 | 3300005841 | Bacteria | 2271 |
| 287 | Ga0068863_100372628 | 3300005841 | Bacteria | 1393 |
| 288 | Ga0068858_100003376 | 3300005842 | Bacteria | 15892 |
| 289 | Ga0068858_100026265 | 3300005842 | Bacteria | 5413 |
| 290 | Ga0068858_100090996 | 3300005842 | Bacteria | 2840 |
| 291 | Ga0068858_100095411 | 3300005842 | Bacteria | 2771 |
| 292 | Ga0068858_100230357 | 3300005842 | Bacteria | 1756 |
| 293 | Ga0068860_100000933 | 3300005843 | Bacteria | 32339 |
| 294 | Ga0068860_100021346 | 3300005843 | Bacteria | 6269 |
| 295 | Ga0068860_100028676 | 3300005843 | Bacteria | 5358 |
| 296 | Ga0068860_100063529 | 3300005843 | Bacteria | 3506 |
| 297 | Ga0068860_100184584 | 3300005843 | Bacteria | 2017 |
| 298 | Ga0068862_100002722 | 3300005844 | Bacteria | 15513 |
| 299 | Ga0068862_100003011 | 3300005844 | Bacteria | 14700 |
| 300 | Ga0068862_100056146 | 3300005844 | Bacteria | 3373 |
| 301 | Ga0081455_10004363 | 3300005937 | Bacteria | 15926 |
| 302 | Ga0081455_10008450 | 3300005937 | Bacteria | 10706 |
| 303 | Ga0081455_10028599 | 3300005937 | Bacteria | 5093 |
| 304 | Ga0081455_10083437 | 3300005937 | Bacteria | 2611 |
| 305 | Ga0081455_10127627 | 3300005937 | Bacteria | 1993 |
| 306 | Ga0081538_10001450 | 3300005981 | Bacteria | 24368 |
| 307 | Ga0081540_1000413 | 3300005983 | Bacteria | 42230 |
| 308 | Ga0081540_1035995 | 3300005983 | Bacteria | 2646 |
| 309 | Ga0070717_10000425 | 3300006028 | Bacteria | 27019 |
| 310 | Ga0075365_10006308 | 3300006038 | Bacteria | 6512 |
| 311 | Ga0075365_10014812 | 3300006038 | Bacteria | 4699 |
| 312 | Ga0075365_10120548 | 3300006038 | Bacteria | 1809 |
| 313 | Ga0075368_10095769 | 3300006042 | Bacteria | 1216 |
| 314 | Ga0075363_100220534 | 3300006048 | Bacteria | 1087 |
| 315 | Ga0075364_10141796 | 3300006051 | Bacteria | 1617 |
| 316 | Ga0070715_10000739 | 3300006163 | Bacteria | 8815 |
| 317 | Ga0070715_10014909 | 3300006163 | Unclassified | 2889 |
| 318 | Ga0070715_10053517 | 3300006163 | Bacteria | 1745 |
| 319 | Ga0070716_100001906 | 3300006173 | Bacteria | 9470 |
| 320 | Ga0070716_100128096 | 3300006173 | Unclassified | 1600 |
| 321 | Ga0070712_100026897 | 3300006175 | Bacteria | 3837 |
| 322 | Ga0070712_100037354 | 3300006175 | Bacteria | 3310 |
| 323 | Ga0070712_100041503 | 3300006175 | Unclassified | 3159 |
| 324 | Ga0075367_10006690 | 3300006178 | Bacteria | 5846 |
| 325 | Ga0075427_10000239 | 3300006194 | Bacteria | 5795 |
| 326 | Ga0097621_100000833 | 3300006237 | Bacteria | 21751 |
| 327 | Ga0097621_100004811 | 3300006237 | Bacteria | 9455 |
| 328 | Ga0097621_100010471 | 3300006237 | Bacteria | 6789 |
| 329 | Ga0097621_100028375 | 3300006237 | Bacteria | 4411 |
| 330 | Ga0097621_100037965 | 3300006237 | Bacteria | 3863 |
| 331 | Ga0097621_100094813 | 3300006237 | Unclassified | 2502 |
| 332 | Ga0068871_100015994 | 3300006358 | Bacteria | 5636 |
| 333 | Ga0068871_100027741 | 3300006358 | Bacteria | 4431 |
| 334 | Ga0068871_100097250 | 3300006358 | Bacteria | 2461 |
| 335 | Ga0075428_100054688 | 3300006844 | Unclassified | 4374 |
| 336 | Ga0075428_100060487 | 3300006844 | Bacteria | 4148 |
| 337 | Ga0075428_100100973 | 3300006844 | Bacteria | 3145 |
| 338 | Ga0075428_100101032 | 3300006844 | Bacteria | 3144 |
| 339 | Ga0075428_100215306 | 3300006844 | Bacteria | 2075 |
| 340 | Ga0075428_100509652 | 3300006844 | Bacteria | 1287 |
| 341 | Ga0075430_100002831 | 3300006846 | Bacteria | 14516 |
| 342 | Ga0075430_100045973 | 3300006846 | Bacteria | 3687 |
| 343 | Ga0075430_100068729 | 3300006846 | Bacteria | 2972 |
| 344 | Ga0075431_100000132 | 3300006847 | Bacteria | 49934 |
| 345 | Ga0075431_100015471 | 3300006847 | Bacteria | 7731 |
| 346 | Ga0075431_100035687 | 3300006847 | Bacteria | 5119 |
| 347 | Ga0075431_100115025 | 3300006847 | Bacteria | 2777 |
| 348 | Ga0075431_100238948 | 3300006847 | Bacteria | 1848 |
| 349 | Ga0075431_100441237 | 3300006847 | Bacteria | 1299 |
| 350 | Ga0075433_10002201 | 3300006852 | Bacteria | 14781 |
| 351 | Ga0075433_10005076 | 3300006852 | Bacteria | 10322 |
| 352 | Ga0075433_10051260 | 3300006852 | Bacteria | 3594 |
| 353 | Ga0075433_10110922 | 3300006852 | Bacteria | 2434 |
| 354 | Ga0075434_100002941 | 3300006871 | Bacteria | 15148 |
| 355 | Ga0075434_100004401 | 3300006871 | Bacteria | 12692 |
| 356 | Ga0075434_100026478 | 3300006871 | Bacteria | 5682 |
| 357 | Ga0075434_100027637 | 3300006871 | Bacteria | 5571 |
| 358 | Ga0075434_100044384 | 3300006871 | Bacteria | 4409 |
| 359 | Ga0075434_100050708 | 3300006871 | Bacteria | 4123 |
| 360 | Ga0075434_100053446 | 3300006871 | Bacteria | 4013 |
| 361 | Ga0075434_100086641 | 3300006871 | Bacteria | 3132 |
| 362 | Ga0075434_100127829 | 3300006871 | Bacteria | 2558 |
| 363 | Ga0075434_100157576 | 3300006871 | Bacteria | 2290 |
| 364 | Ga0075429_100002461 | 3300006880 | Bacteria | 15577 |
| 365 | Ga0075429_100061162 | 3300006880 | Bacteria | 3280 |
| 366 | Ga0075429_100109548 | 3300006880 | Bacteria | 2414 |
| 367 | Ga0075429_100113010 | 3300006880 | Bacteria | 2374 |
| 368 | Ga0075429_100237924 | 3300006880 | Bacteria | 1595 |
| 369 | Ga0068865_100009219 | 3300006881 | Bacteria | 6111 |
| 370 | Ga0068865_100014125 | 3300006881 | Bacteria | 5068 |
| 371 | Ga0068865_100038489 | 3300006881 | Unclassified | 3238 |
| 372 | Ga0068865_100064695 | 3300006881 | Bacteria | 2574 |
| 373 | Ga0068865_100357772 | 3300006881 | Bacteria | 1184 |
| 374 | Ga0075436_100154946 | 3300006914 | Bacteria | 1613 |
| 375 | Ga0097620_100002825 | 3300006931 | Bacteria | 17604 |
| 376 | Ga0097620_100005044 | 3300006931 | Bacteria | 13403 |
| 377 | Ga0097620_100094083 | 3300006931 | Unclassified | 3049 |
| 378 | Ga0097620_100260496 | 3300006931 | Bacteria | 1825 |
| 379 | Ga0075435_100014230 | 3300007076 | Bacteria | 5941 |
| 380 | Ga0075435_100036370 | 3300007076 | Bacteria | 3913 |
| 381 | Ga0075435_100071058 | 3300007076 | Bacteria | 2842 |
| 382 | Ga0075435_100097503 | 3300007076 | Unclassified | 2433 |
| 383 | Ga0075435_100135975 | 3300007076 | Bacteria | 2059 |
| 384 | Ga0075435_100170095 | 3300007076 | Bacteria | 1838 |
| 385 | Ga0075435_100185871 | 3300007076 | Unclassified | 1757 |
| 386 | Ga0075435_100333834 | 3300007076 | Bacteria | 1299 |
| 387 | Ga0105251_10060310 | 3300009011 | Bacteria | 1786 |
| 388 | Ga0105250_10016499 | 3300009092 | Bacteria | 3007 |
| 389 | Ga0105240_10003696 | 3300009093 | Bacteria | 23644 |
| 390 | Ga0105240_10054446 | 3300009093 | Bacteria | 5014 |
| 391 | Ga0105240_10121756 | 3300009093 | Bacteria | 3141 |
| 392 | Ga0105240_10295109 | 3300009093 | Unclassified | 1856 |
| 393 | Ga0105240_10347654 | 3300009093 | Bacteria | 1683 |
| 394 | Ga0105240_10470698 | 3300009093 | Bacteria | 1402 |
| 395 | Ga0111539_10000933 | 3300009094 | Bacteria | 38278 |
| 396 | Ga0111539_10002792 | 3300009094 | Bacteria | 23179 |
| 397 | Ga0111539_10004846 | 3300009094 | Bacteria | 17535 |
| 398 | Ga0111539_10020347 | 3300009094 | Bacteria | 8174 |
| 399 | Ga0111539_10080968 | 3300009094 | Bacteria | 3819 |
| 400 | Ga0111539_10253638 | 3300009094 | Bacteria | 2048 |
| 401 | Ga0111539_10343015 | 3300009094 | Bacteria | 1739 |
| 402 | Ga0111539_10594110 | 3300009094 | Bacteria | 1289 |
| 403 | Ga0105245_10000370 | 3300009098 | Bacteria | 41982 |
| 404 | Ga0105245_10051898 | 3300009098 | Bacteria | 3677 |
| 405 | Ga0105245_10076963 | 3300009098 | Bacteria | 3040 |
| 406 | Ga0105245_10105703 | 3300009098 | Bacteria | 2611 |
| 407 | Ga0105245_10383175 | 3300009098 | Bacteria | 1401 |
| 408 | Ga0105245_10638626 | 3300009098 | Bacteria | 1094 |
| 409 | Ga0105247_10000941 | 3300009101 | Bacteria | 21940 |
| 410 | Ga0105247_10032611 | 3300009101 | Unclassified | 3165 |
| 411 | Ga0105247_10054178 | 3300009101 | Bacteria | 2475 |
| 412 | Ga0105247_10124738 | 3300009101 | Bacteria | 1672 |
| 413 | Ga0105247_10191132 | 3300009101 | Unclassified | 1371 |
| 414 | Ga0105247_10203221 | 3300009101 | Bacteria | 1332 |
| 415 | Ga0105247_10216652 | 3300009101 | Bacteria | 1294 |
| 416 | Ga0105247_10257280 | 3300009101 | Bacteria | 1196 |
| 417 | Ga0114129_10000280 | 3300009147 | Bacteria | 58505 |
| 418 | Ga0114129_10001684 | 3300009147 | Bacteria | 30152 |
| 419 | Ga0114129_10003178 | 3300009147 | Bacteria | 23049 |
| 420 | Ga0114129_10005006 | 3300009147 | Bacteria | 18662 |
| 421 | Ga0114129_10039645 | 3300009147 | Bacteria | 6641 |
| 422 | Ga0114129_10044181 | 3300009147 | Bacteria | 6268 |
| 423 | Ga0114129_10651977 | 3300009147 | Bacteria | 1359 |
| 424 | Ga0105243_10003132 | 3300009148 | Bacteria | 13584 |
| 425 | Ga0105243_10041794 | 3300009148 | Bacteria | 3586 |
| 426 | Ga0105243_10042428 | 3300009148 | Bacteria | 3561 |
| 427 | Ga0105243_10051976 | 3300009148 | Bacteria | 3244 |
| 428 | Ga0105243_10112672 | 3300009148 | Bacteria | 2279 |
| 429 | Ga0105243_10139323 | 3300009148 | Bacteria | 2068 |
| 430 | Ga0105241_10003551 | 3300009174 | Bacteria | 11603 |
| 431 | Ga0105241_10081736 | 3300009174 | Bacteria | 2532 |
| 432 | Ga0105241_10239450 | 3300009174 | Bacteria | 1533 |
| 433 | Ga0105241_10244204 | 3300009174 | Bacteria | 1519 |
| 434 | Ga0105241_10259968 | 3300009174 | Unclassified | 1475 |
| 435 | Ga0105242_10001245 | 3300009176 | Bacteria | 20067 |
| 436 | Ga0105242_10035192 | 3300009176 | Bacteria | 4016 |
| 437 | Ga0105242_10060537 | 3300009176 | Unclassified | 3111 |
| 438 | Ga0105242_10084063 | 3300009176 | Bacteria | 2666 |
| 439 | Ga0105242_10198287 | 3300009176 | Bacteria | 1782 |
| 440 | Ga0105242_10257844 | 3300009176 | Bacteria | 1574 |
| 441 | Ga0105248_10001324 | 3300009177 | Bacteria | 27565 |
| 442 | Ga0105248_10005301 | 3300009177 | Bacteria | 14193 |
| 443 | Ga0105248_10005481 | 3300009177 | Bacteria | 13935 |
| 444 | Ga0105248_10053771 | 3300009177 | Bacteria | 4517 |
| 445 | Ga0105248_10223547 | 3300009177 | Bacteria | 2119 |
| 446 | Ga0105248_10396853 | 3300009177 | Unclassified | 1553 |
| 447 | Ga0105248_10446949 | 3300009177 | Bacteria | 1456 |
| 448 | Ga0105237_10032477 | 3300009545 | Bacteria | 5284 |
| 449 | Ga0105237_10057636 | 3300009545 | Bacteria | 3887 |
| 450 | Ga0105237_10069508 | 3300009545 | Bacteria | 3517 |
| 451 | Ga0105237_10184271 | 3300009545 | Bacteria | 2088 |
| 452 | Ga0105238_10040095 | 3300009551 | Bacteria | 4747 |
| 453 | Ga0105238_10050719 | 3300009551 | Bacteria | 4177 |
| 454 | Ga0105238_10099024 | 3300009551 | Bacteria | 2899 |
| 455 | Ga0105238_10427661 | 3300009551 | Bacteria | 1319 |
| 456 | Ga0105249_10002759 | 3300009553 | Bacteria | 15181 |
| 457 | Ga0105249_10023209 | 3300009553 | Bacteria | 5565 |
| 458 | Ga0105249_10196964 | 3300009553 | Bacteria | 1969 |
| 459 | Ga0105249_10209557 | 3300009553 | Bacteria | 1912 |
| 460 | Ga0105239_10091805 | 3300010375 | Unclassified | 3351 |
| 461 | Ga0105239_10163498 | 3300010375 | Bacteria | 2488 |
| 462 | Ga0105239_10295664 | 3300010375 | Bacteria | 1823 |
| 463 | Ga0105239_10424323 | 3300010375 | Bacteria | 1507 |
| 464 | Ga0105239_10503383 | 3300010375 | Bacteria | 1377 |
| 465 | Ga0105246_10000510 | 3300011119 | Bacteria | 21126 |
| 466 | Ga0105246_10028412 | 3300011119 | Bacteria | 3674 |
| 467 | Ga0105246_10030976 | 3300011119 | Bacteria | 3537 |
| 468 | Ga0105246_10060545 | 3300011119 | Bacteria | 2631 |
| 469 | Ga0105246_10093394 | 3300011119 | Unclassified | 2173 |
| 470 | Ga0105246_10187645 | 3300011119 | Bacteria | 1597 |
| 471 | Ga0105246_10295276 | 3300011119 | Unclassified | 1306 |
| 472 | Ga0157373_10007085 | 3300013100 | Bacteria | 8359 |
| 473 | Ga0157373_10008396 | 3300013100 | Bacteria | 7669 |
| 474 | Ga0157371_10008538 | 3300013102 | Bacteria | 8154 |
| 475 | Ga0157371_10136722 | 3300013102 | Bacteria | 1745 |
| 476 | Ga0157370_10008485 | 3300013104 | Bacteria | 11083 |
| 477 | Ga0157370_10223385 | 3300013104 | Bacteria | 1744 |
| 478 | Ga0157369_10195186 | 3300013105 | Bacteria | 2126 |
| 479 | Ga0157374_10001994 | 3300013296 | Bacteria | 17142 |
| 480 | Ga0157374_10017984 | 3300013296 | Bacteria | 6232 |
| 481 | Ga0157374_10024070 | 3300013296 | Bacteria | 5454 |
| 482 | Ga0157374_10025719 | 3300013296 | Bacteria | 5289 |
| 483 | Ga0157374_10071030 | 3300013296 | Bacteria | 3282 |
| 484 | Ga0157374_10213049 | 3300013296 | Unclassified | 1894 |
| 485 | Ga0157374_10363961 | 3300013296 | Unclassified | 1438 |
| 486 | Ga0157378_10006053 | 3300013297 | Bacteria | 10595 |
| 487 | Ga0157378_10104314 | 3300013297 | Bacteria | 2591 |
| 488 | Ga0157378_10111319 | 3300013297 | Bacteria | 2510 |
| 489 | Ga0157378_10193990 | 3300013297 | Bacteria | 1918 |
| 490 | Ga0163162_10008106 | 3300013306 | Bacteria | 10252 |
| 491 | Ga0163162_10212728 | 3300013306 | Bacteria | 2063 |
| 492 | Ga0163162_10297967 | 3300013306 | Bacteria | 1744 |
| 493 | Ga0157372_10005559 | 3300013307 | Bacteria | 13400 |
| 494 | Ga0157372_10010864 | 3300013307 | Bacteria | 9692 |
| 495 | Ga0157372_10271211 | 3300013307 | Unclassified | 1972 |
| 496 | Ga0157375_10003733 | 3300013308 | Bacteria | 13213 |
| 497 | Ga0157375_10004143 | 3300013308 | Bacteria | 12581 |
| 498 | Ga0157375_10156389 | 3300013308 | Unclassified | 2419 |
| 499 | Ga0157375_10272680 | 3300013308 | Unclassified | 1854 |
| 500 | Ga0163163_10004364 | 3300014325 | Bacteria | 12051 |
| 501 | Ga0163163_10011627 | 3300014325 | Bacteria | 7995 |
| 502 | Ga0163163_10016172 | 3300014325 | Bacteria | 6926 |
| 503 | Ga0163163_10030715 | 3300014325 | Bacteria | 5180 |
| 504 | Ga0163163_10035735 | 3300014325 | Bacteria | 4822 |
| 505 | Ga0163163_10081094 | 3300014325 | Bacteria | 3246 |
| 506 | Ga0163163_10223536 | 3300014325 | Bacteria | 1932 |
| 507 | Ga0163163_10238937 | 3300014325 | Bacteria | 1866 |
| 508 | Ga0157380_10001925 | 3300014326 | Bacteria | 13801 |
| 509 | Ga0157380_10182811 | 3300014326 | Bacteria | 1843 |
| 510 | Ga0157377_10000101 | 3300014745 | Bacteria | 60248 |
| 511 | Ga0157377_10034073 | 3300014745 | Bacteria | 2784 |
| 512 | Ga0157377_10060655 | 3300014745 | Bacteria | 2160 |
| 513 | Ga0157379_10004422 | 3300014968 | Bacteria | 12048 |
| 514 | Ga0157379_10015102 | 3300014968 | Bacteria | 6773 |
| 515 | Ga0157379_10040063 | 3300014968 | Bacteria | 4181 |
| 516 | Ga0157379_10103927 | 3300014968 | Bacteria | 2549 |
| 517 | Ga0157379_10129808 | 3300014968 | Bacteria | 2268 |
| 518 | Ga0157379_10227835 | 3300014968 | Bacteria | 1689 |
| 519 | Ga0157379_10245194 | 3300014968 | Bacteria | 1625 |
| 520 | Ga0157379_10325561 | 3300014968 | Bacteria | 1404 |
| 521 | Ga0157376_10003977 | 3300014969 | Bacteria | 10215 |
| 522 | Ga0157376_10019988 | 3300014969 | Bacteria | 5172 |
| 523 | Ga0157376_10059403 | 3300014969 | Unclassified | 3206 |
| 524 | Ga0157376_10355128 | 3300014969 | Bacteria | 1404 |
| 525 | Ga0163161_10006193 | 3300017792 | Bacteria | 8290 |
| 526 | Ga0163161_10023300 | 3300017792 | Bacteria | 4367 |
| 527 | Ga0163161_10183238 | 3300017792 | Bacteria | 1607 |
| 528 | Ga0163161_10458922 | 3300017792 | Unclassified | 1031 |
| 529 | Ga0207666_1000044 | 3300025271 | Bacteria | 24638 |
| 530 | Ga0207666_1000084 | 3300025271 | Bacteria | 15613 |
| 531 | Ga0207673_1000183 | 3300025290 | Bacteria | 6211 |
| 532 | Ga0207697_10000051 | 3300025315 | Bacteria | 47188 |
| 533 | Ga0207697_10002615 | 3300025315 | Bacteria | 9261 |
| 534 | Ga0207656_10064533 | 3300025321 | Unclassified | 1614 |
| 535 | Ga0207653_10000964 | 3300025885 | Bacteria | 9488 |
| 536 | Ga0207653_10001329 | 3300025885 | Bacteria | 8032 |
| 537 | Ga0207682_10000635 | 3300025893 | Bacteria | 16359 |
| 538 | Ga0207682_10000815 | 3300025893 | Bacteria | 14433 |
| 539 | Ga0207692_10025329 | 3300025898 | Unclassified | 2769 |
| 540 | Ga0207642_10004273 | 3300025899 | Bacteria | 4601 |
| 541 | Ga0207642_10024909 | 3300025899 | Bacteria | 2413 |
| 542 | Ga0207642_10084375 | 3300025899 | Bacteria | 1551 |
| 543 | Ga0207710_10002302 | 3300025900 | Bacteria | 8939 |
| 544 | Ga0207710_10002328 | 3300025900 | Bacteria | 8879 |
| 545 | Ga0207710_10013441 | 3300025900 | Bacteria | 3444 |
| 546 | Ga0207710_10047672 | 3300025900 | Bacteria | 1916 |
| 547 | Ga0207710_10047879 | 3300025900 | Bacteria | 1912 |
| 548 | Ga0207688_10000044 | 3300025901 | Bacteria | 43600 |
| 549 | Ga0207688_10000197 | 3300025901 | Bacteria | 26763 |
| 550 | Ga0207688_10000346 | 3300025901 | Bacteria | 21494 |
| 551 | Ga0207688_10003234 | 3300025901 | Bacteria | 8896 |
| 552 | Ga0207680_10002632 | 3300025903 | Bacteria | 8381 |
| 553 | Ga0207680_10009774 | 3300025903 | Bacteria | 4773 |
| 554 | Ga0207680_10024713 | 3300025903 | Bacteria | 3302 |
| 555 | Ga0207680_10046995 | 3300025903 | Bacteria | 2555 |
| 556 | Ga0207647_10002117 | 3300025904 | Bacteria | 15175 |
| 557 | Ga0207647_10006669 | 3300025904 | Bacteria | 8389 |
| 558 | Ga0207647_10017129 | 3300025904 | Bacteria | 4932 |
| 559 | Ga0207647_10072136 | 3300025904 | Unclassified | 2083 |
| 560 | Ga0207685_10002628 | 3300025905 | Bacteria | 4169 |
| 561 | Ga0207685_10046112 | 3300025905 | Unclassified | 1657 |
| 562 | Ga0207685_10058465 | 3300025905 | Unclassified | 1517 |
| 563 | Ga0207699_10000760 | 3300025906 | Bacteria | 15436 |
| 564 | Ga0207699_10037393 | 3300025906 | Unclassified | 2775 |
| 565 | Ga0207699_10176167 | 3300025906 | Bacteria | 1434 |
| 566 | Ga0207645_10000218 | 3300025907 | Bacteria | 47372 |
| 567 | Ga0207645_10002258 | 3300025907 | Bacteria | 15323 |
| 568 | Ga0207645_10007653 | 3300025907 | Bacteria | 7613 |
| 569 | Ga0207645_10043351 | 3300025907 | Bacteria | 2879 |
| 570 | Ga0207645_10096759 | 3300025907 | Bacteria | 1902 |
| 571 | Ga0207643_10000400 | 3300025908 | Bacteria | 28899 |
| 572 | Ga0207643_10000870 | 3300025908 | Bacteria | 18192 |
| 573 | Ga0207643_10001076 | 3300025908 | Bacteria | 16139 |
| 574 | Ga0207643_10005389 | 3300025908 | Bacteria | 6847 |
| 575 | Ga0207705_10237662 | 3300025909 | Bacteria | 1387 |
| 576 | Ga0207654_10004223 | 3300025911 | Bacteria | 7250 |
| 577 | Ga0207654_10020598 | 3300025911 | Bacteria | 3498 |
| 578 | Ga0207654_10058636 | 3300025911 | Bacteria | 2242 |
| 579 | Ga0207654_10077921 | 3300025911 | Bacteria | 1988 |
| 580 | Ga0207654_10180532 | 3300025911 | Bacteria | 1377 |
| 581 | Ga0207654_10183667 | 3300025911 | Bacteria | 1366 |
| 582 | Ga0207654_10191974 | 3300025911 | Bacteria | 1339 |
| 583 | Ga0207707_10005047 | 3300025912 | Bacteria | 11585 |
| 584 | Ga0207707_10006308 | 3300025912 | Bacteria | 10356 |
| 585 | Ga0207707_10073600 | 3300025912 | Bacteria | 2979 |
| 586 | Ga0207707_10419616 | 3300025912 | Bacteria | 1147 |
| 587 | Ga0207695_10023341 | 3300025913 | Bacteria | 6992 |
| 588 | Ga0207695_10072321 | 3300025913 | Bacteria | 3519 |
| 589 | Ga0207695_10090219 | 3300025913 | Bacteria | 3081 |
| 590 | Ga0207695_10275543 | 3300025913 | Bacteria | 1577 |
| 591 | Ga0207695_10431288 | 3300025913 | Bacteria | 1202 |
| 592 | Ga0207671_10038266 | 3300025914 | Bacteria | 3555 |
| 593 | Ga0207671_10064215 | 3300025914 | Unclassified | 2729 |
| 594 | Ga0207671_10224789 | 3300025914 | Unclassified | 1471 |
| 595 | Ga0207693_10003582 | 3300025915 | Bacteria | 13276 |
| 596 | Ga0207693_10010960 | 3300025915 | Bacteria | 7345 |
| 597 | Ga0207693_10013445 | 3300025915 | Bacteria | 6599 |
| 598 | Ga0207693_10013697 | 3300025915 | Bacteria | 6533 |
| 599 | Ga0207693_10048449 | 3300025915 | Bacteria | 3336 |
| 600 | Ga0207693_10064100 | 3300025915 | Bacteria | 2879 |
| 601 | Ga0207693_10076592 | 3300025915 | Bacteria | 2619 |
| 602 | Ga0207693_10088411 | 3300025915 | Unclassified | 2428 |
| 603 | Ga0207693_10128732 | 3300025915 | Bacteria | 1990 |
| 604 | Ga0207663_10019001 | 3300025916 | Bacteria | 3862 |
| 605 | Ga0207663_10038225 | 3300025916 | Bacteria | 2900 |
| 606 | Ga0207663_10041665 | 3300025916 | Bacteria | 2800 |
| 607 | Ga0207663_10050950 | 3300025916 | Bacteria | 2575 |
| 608 | Ga0207663_10083386 | 3300025916 | Bacteria | 2100 |
| 609 | Ga0207663_10273245 | 3300025916 | Bacteria | 1252 |
| 610 | Ga0207660_10000571 | 3300025917 | Bacteria | 24778 |
| 611 | Ga0207660_10005879 | 3300025917 | Bacteria | 7967 |
| 612 | Ga0207660_10028355 | 3300025917 | Bacteria | 3829 |
| 613 | Ga0207660_10091758 | 3300025917 | Bacteria | 2253 |
| 614 | Ga0207660_10438880 | 3300025917 | Bacteria | 1055 |
| 615 | Ga0207662_10000100 | 3300025918 | Bacteria | 40845 |
| 616 | Ga0207662_10000677 | 3300025918 | Bacteria | 15501 |
| 617 | Ga0207662_10002523 | 3300025918 | Bacteria | 9215 |
| 618 | Ga0207662_10008813 | 3300025918 | Bacteria | 5536 |
| 619 | Ga0207662_10196108 | 3300025918 | Bacteria | 1305 |
| 620 | Ga0207657_10002107 | 3300025919 | Bacteria | 21516 |
| 621 | Ga0207657_10004436 | 3300025919 | Bacteria | 14848 |
| 622 | Ga0207657_10038965 | 3300025919 | Bacteria | 4225 |
| 623 | Ga0207657_10040555 | 3300025919 | Bacteria | 4124 |
| 624 | Ga0207657_10042518 | 3300025919 | Bacteria | 4008 |
| 625 | Ga0207657_10183166 | 3300025919 | Unclassified | 1692 |
| 626 | Ga0207649_10000310 | 3300025920 | Bacteria | 37179 |
| 627 | Ga0207649_10059114 | 3300025920 | Bacteria | 2404 |
| 628 | Ga0207649_10354882 | 3300025920 | Bacteria | 1086 |
| 629 | Ga0207652_10005950 | 3300025921 | Bacteria | 9867 |
| 630 | Ga0207652_10017065 | 3300025921 | Bacteria | 5938 |
| 631 | Ga0207652_10063415 | 3300025921 | Bacteria | 3196 |
| 632 | Ga0207652_10065747 | 3300025921 | Bacteria | 3141 |
| 633 | Ga0207652_10149260 | 3300025921 | Bacteria | 2092 |
| 634 | Ga0207646_10058492 | 3300025922 | Bacteria | 3443 |
| 635 | Ga0207646_10449813 | 3300025922 | Bacteria | 1162 |
| 636 | Ga0207681_10000803 | 3300025923 | Bacteria | 20696 |
| 637 | Ga0207681_10014449 | 3300025923 | Bacteria | 4907 |
| 638 | Ga0207694_10050279 | 3300025924 | Bacteria | 3228 |
| 639 | Ga0207694_10060883 | 3300025924 | Bacteria | 2938 |
| 640 | Ga0207694_10373693 | 3300025924 | Bacteria | 1182 |
| 641 | Ga0207650_10005586 | 3300025925 | Bacteria | 8589 |
| 642 | Ga0207650_10022154 | 3300025925 | Bacteria | 4497 |
| 643 | Ga0207650_10040740 | 3300025925 | Bacteria | 3401 |
| 644 | Ga0207650_10042885 | 3300025925 | Unclassified | 3319 |
| 645 | Ga0207650_10050106 | 3300025925 | Unclassified | 3086 |
| 646 | Ga0207650_10110410 | 3300025925 | Bacteria | 2128 |
| 647 | Ga0207650_10203227 | 3300025925 | Bacteria | 1588 |
| 648 | Ga0207659_10000040 | 3300025926 | Bacteria | 91375 |
| 649 | Ga0207659_10010644 | 3300025926 | Bacteria | 5784 |
| 650 | Ga0207659_10278066 | 3300025926 | Unclassified | 1368 |
| 651 | Ga0207687_10001077 | 3300025927 | Bacteria | 18525 |
| 652 | Ga0207687_10038537 | 3300025927 | Bacteria | 3267 |
| 653 | Ga0207687_10040562 | 3300025927 | Bacteria | 3192 |
| 654 | Ga0207687_10051128 | 3300025927 | Bacteria | 2879 |
| 655 | Ga0207687_10111076 | 3300025927 | Unclassified | 2034 |
| 656 | Ga0207687_10231836 | 3300025927 | Unclassified | 1459 |
| 657 | Ga0207700_10000797 | 3300025928 | Bacteria | 18209 |
| 658 | Ga0207700_10007214 | 3300025928 | Bacteria | 6778 |
| 659 | Ga0207700_10018216 | 3300025928 | Bacteria | 4713 |
| 660 | Ga0207700_10211012 | 3300025928 | Bacteria | 1642 |
| 661 | Ga0207664_10013394 | 3300025929 | Bacteria | 5884 |
| 662 | Ga0207664_10076626 | 3300025929 | Bacteria | 2707 |
| 663 | Ga0207664_10097727 | 3300025929 | Unclassified | 2420 |
| 664 | Ga0207664_10144815 | 3300025929 | Bacteria | 2014 |
| 665 | Ga0207664_10460634 | 3300025929 | Unclassified | 1135 |
| 666 | Ga0207644_10020275 | 3300025931 | Bacteria | 4519 |
| 667 | Ga0207644_10032566 | 3300025931 | Unclassified | 3637 |
| 668 | Ga0207644_10054704 | 3300025931 | Bacteria | 2875 |
| 669 | Ga0207644_10113443 | 3300025931 | Bacteria | 2052 |
| 670 | Ga0207644_10164013 | 3300025931 | Bacteria | 1729 |
| 671 | Ga0207690_10000277 | 3300025932 | Bacteria | 36311 |
| 672 | Ga0207706_10003292 | 3300025933 | Bacteria | 15468 |
| 673 | Ga0207706_10007125 | 3300025933 | Bacteria | 10350 |
| 674 | Ga0207706_10048791 | 3300025933 | Bacteria | 3744 |
| 675 | Ga0207706_10074280 | 3300025933 | Bacteria | 2990 |
| 676 | Ga0207706_10095177 | 3300025933 | Bacteria | 2620 |
| 677 | Ga0207706_10152305 | 3300025933 | Bacteria | 2034 |
| 678 | Ga0207706_10155882 | 3300025933 | Unclassified | 2008 |
| 679 | Ga0207686_10001074 | 3300025934 | Bacteria | 16034 |
| 680 | Ga0207686_10007975 | 3300025934 | Bacteria | 5710 |
| 681 | Ga0207686_10028342 | 3300025934 | Unclassified | 3291 |
| 682 | Ga0207686_10064279 | 3300025934 | Bacteria | 2336 |
| 683 | Ga0207686_10095353 | 3300025934 | Bacteria | 1974 |
| 684 | Ga0207686_10110287 | 3300025934 | Bacteria | 1854 |
| 685 | Ga0207686_10206335 | 3300025934 | Unclassified | 1410 |
| 686 | Ga0207709_10003933 | 3300025935 | Bacteria | 8677 |
| 687 | Ga0207709_10020822 | 3300025935 | Bacteria | 3704 |
| 688 | Ga0207709_10036589 | 3300025935 | Bacteria | 2910 |
| 689 | Ga0207670_10000977 | 3300025936 | Bacteria | 15087 |
| 690 | Ga0207670_10028475 | 3300025936 | Bacteria | 3547 |
| 691 | Ga0207670_10224640 | 3300025936 | Bacteria | 1439 |
| 692 | Ga0207669_10000347 | 3300025937 | Bacteria | 21120 |
| 693 | Ga0207669_10046437 | 3300025937 | Bacteria | 2566 |
| 694 | Ga0207669_10242318 | 3300025937 | Bacteria | 1337 |
| 695 | Ga0207704_10000624 | 3300025938 | Bacteria | 15670 |
| 696 | Ga0207704_10011417 | 3300025938 | Bacteria | 4373 |
| 697 | Ga0207704_10050233 | 3300025938 | Bacteria | 2514 |
| 698 | Ga0207704_10103788 | 3300025938 | Unclassified | 1902 |
| 699 | Ga0207665_10002407 | 3300025939 | Bacteria | 12653 |
| 700 | Ga0207665_10013442 | 3300025939 | Bacteria | 5382 |
| 701 | Ga0207665_10040630 | 3300025939 | Bacteria | 3104 |
| 702 | Ga0207691_10000940 | 3300025940 | Bacteria | 28841 |
| 703 | Ga0207691_10002224 | 3300025940 | Bacteria | 18973 |
| 704 | Ga0207691_10003147 | 3300025940 | Bacteria | 16133 |
| 705 | Ga0207691_10027700 | 3300025940 | Bacteria | 5311 |
| 706 | Ga0207691_10315431 | 3300025940 | Bacteria | 1341 |
| 707 | Ga0207711_10003275 | 3300025941 | Bacteria | 14083 |
| 708 | Ga0207711_10014033 | 3300025941 | Bacteria | 6656 |
| 709 | Ga0207711_10016938 | 3300025941 | Bacteria | 6052 |
| 710 | Ga0207711_10023511 | 3300025941 | Bacteria | 5158 |
| 711 | Ga0207711_10094257 | 3300025941 | Unclassified | 2638 |
| 712 | Ga0207711_10166756 | 3300025941 | Bacteria | 1996 |
| 713 | Ga0207689_10000514 | 3300025942 | Bacteria | 36737 |
| 714 | Ga0207689_10002387 | 3300025942 | Bacteria | 17532 |
| 715 | Ga0207689_10012049 | 3300025942 | Bacteria | 7409 |
| 716 | Ga0207689_10047365 | 3300025942 | Bacteria | 3550 |
| 717 | Ga0207689_10165614 | 3300025942 | Bacteria | 1821 |
| 718 | Ga0207689_10254067 | 3300025942 | Bacteria | 1454 |
| 719 | Ga0207661_10000191 | 3300025944 | Bacteria | 39865 |
| 720 | Ga0207661_10089799 | 3300025944 | Unclassified | 2557 |
| 721 | Ga0207679_10000099 | 3300025945 | Bacteria | 74047 |
| 722 | Ga0207679_10001868 | 3300025945 | Bacteria | 13091 |
| 723 | Ga0207679_10075118 | 3300025945 | Plasmid | 2563 |
| 724 | Ga0207679_10203207 | 3300025945 | Bacteria | 1656 |
| 725 | Ga0207679_10393891 | 3300025945 | Bacteria | 1217 |
| 726 | Ga0207667_10014048 | 3300025949 | Bacteria | 9140 |
| 727 | Ga0207667_10054765 | 3300025949 | Bacteria | 4195 |
| 728 | Ga0207667_10060608 | 3300025949 | Bacteria | 3960 |
| 729 | Ga0207667_10139859 | 3300025949 | Bacteria | 2493 |
| 730 | Ga0207651_10000202 | 3300025960 | Bacteria | 26070 |
| 731 | Ga0207651_10035179 | 3300025960 | Bacteria | 3253 |
| 732 | Ga0207651_10050584 | 3300025960 | Bacteria | 2822 |
| 733 | Ga0207651_10177174 | 3300025960 | Bacteria | 1687 |
| 734 | Ga0207712_10001297 | 3300025961 | Bacteria | 17122 |
| 735 | Ga0207712_10004060 | 3300025961 | Bacteria | 9243 |
| 736 | Ga0207712_10038043 | 3300025961 | Bacteria | 3288 |
| 737 | Ga0207712_10111375 | 3300025961 | Unclassified | 2054 |
| 738 | Ga0207712_10310894 | 3300025961 | Bacteria | 1297 |
| 739 | Ga0207668_10001518 | 3300025972 | Bacteria | 13565 |
| 740 | Ga0207668_10003969 | 3300025972 | Bacteria | 8715 |
| 741 | Ga0207668_10047240 | 3300025972 | Bacteria | 2946 |
| 742 | Ga0207668_10060574 | 3300025972 | Bacteria | 2657 |
| 743 | Ga0207668_10187902 | 3300025972 | Bacteria | 1635 |
| 744 | Ga0207640_10000425 | 3300025981 | Bacteria | 26102 |
| 745 | Ga0207640_10105205 | 3300025981 | Bacteria | 1988 |
| 746 | Ga0207658_10003433 | 3300025986 | Bacteria | 11216 |
| 747 | Ga0207658_10015942 | 3300025986 | Bacteria | 5161 |
| 748 | Ga0207658_10217708 | 3300025986 | Bacteria | 1604 |
| 749 | Ga0207658_10296336 | 3300025986 | Unclassified | 1392 |
| 750 | Ga0207677_10000495 | 3300026023 | Bacteria | 25594 |
| 751 | Ga0207677_10053257 | 3300026023 | Bacteria | 2753 |
| 752 | Ga0207703_10003491 | 3300026035 | Bacteria | 13158 |
| 753 | Ga0207703_10030257 | 3300026035 | Bacteria | 4278 |
| 754 | Ga0207703_10036654 | 3300026035 | Bacteria | 3904 |
| 755 | Ga0207703_10045294 | 3300026035 | Bacteria | 3538 |
| 756 | Ga0207703_10050838 | 3300026035 | Bacteria | 3356 |
| 757 | Ga0207703_10081190 | 3300026035 | Bacteria | 2702 |
| 758 | Ga0207639_10043894 | 3300026041 | Bacteria | 3359 |
| 759 | Ga0207639_10052294 | 3300026041 | Bacteria | 3112 |
| 760 | Ga0207639_10081399 | 3300026041 | Bacteria | 2564 |
| 761 | Ga0207678_10002254 | 3300026067 | Bacteria | 17463 |
| 762 | Ga0207678_10005396 | 3300026067 | Bacteria | 11454 |
| 763 | Ga0207678_10017170 | 3300026067 | Bacteria | 6353 |
| 764 | Ga0207678_10038688 | 3300026067 | Bacteria | 4143 |
| 765 | Ga0207678_10189769 | 3300026067 | Bacteria | 1756 |
| 766 | Ga0207678_10233462 | 3300026067 | Bacteria | 1575 |
| 767 | Ga0207708_10000602 | 3300026075 | Bacteria | 27734 |
| 768 | Ga0207708_10000636 | 3300026075 | Bacteria | 26970 |
| 769 | Ga0207708_10001067 | 3300026075 | Bacteria | 20564 |
| 770 | Ga0207708_10002106 | 3300026075 | Bacteria | 14656 |
| 771 | Ga0207702_10012003 | 3300026078 | Bacteria | 7203 |
| 772 | Ga0207702_10032777 | 3300026078 | Bacteria | 4336 |
| 773 | Ga0207702_10064691 | 3300026078 | Bacteria | 3130 |
| 774 | Ga0207702_10098210 | 3300026078 | Bacteria | 2579 |
| 775 | Ga0207702_10225900 | 3300026078 | Bacteria | 1747 |
| 776 | Ga0207702_10230426 | 3300026078 | Unclassified | 1731 |
| 777 | Ga0207641_10000246 | 3300026088 | Bacteria | 70235 |
| 778 | Ga0207641_10017711 | 3300026088 | Bacteria | 5836 |
| 779 | Ga0207641_10047921 | 3300026088 | Bacteria | 3605 |
| 780 | Ga0207641_10066361 | 3300026088 | Bacteria | 3088 |
| 781 | Ga0207641_10175259 | 3300026088 | Bacteria | 1960 |
| 782 | Ga0207641_10349243 | 3300026088 | Bacteria | 1409 |
| 783 | Ga0207641_10370072 | 3300026088 | Bacteria | 1370 |
| 784 | Ga0207648_10000575 | 3300026089 | Bacteria | 41197 |
| 785 | Ga0207648_10004636 | 3300026089 | Bacteria | 14075 |
| 786 | Ga0207648_10007651 | 3300026089 | Bacteria | 10576 |
| 787 | Ga0207648_10009899 | 3300026089 | Bacteria | 9087 |
| 788 | Ga0207676_10002628 | 3300026095 | Bacteria | 12800 |
| 789 | Ga0207676_10042856 | 3300026095 | Bacteria | 3481 |
| 790 | Ga0207676_10139934 | 3300026095 | Bacteria | 2070 |
| 791 | Ga0207676_10167958 | 3300026095 | Bacteria | 1908 |
| 792 | Ga0207674_10002439 | 3300026116 | Bacteria | 23481 |
| 793 | Ga0207674_10003170 | 3300026116 | Bacteria | 20247 |
| 794 | Ga0207674_10163778 | 3300026116 | Bacteria | 2178 |
| 795 | Ga0207675_100002589 | 3300026118 | Bacteria | 17916 |
| 796 | Ga0207675_100002803 | 3300026118 | Bacteria | 17126 |
| 797 | Ga0207675_100004434 | 3300026118 | Bacteria | 13568 |
| 798 | Ga0207683_10002498 | 3300026121 | Bacteria | 16043 |
| 799 | Ga0207683_10004946 | 3300026121 | Bacteria | 11465 |
| 800 | Ga0207683_10016507 | 3300026121 | Bacteria | 6285 |
| 801 | Ga0207683_10022331 | 3300026121 | Bacteria | 5430 |
| 802 | Ga0207683_10083734 | 3300026121 | Unclassified | 2834 |
| 803 | Ga0207683_10083994 | 3300026121 | Bacteria | 2830 |
| 804 | Ga0207698_10004542 | 3300026142 | Bacteria | 8472 |
| 805 | Ga0207698_10029601 | 3300026142 | Bacteria | 3925 |
| 806 | Ga0207698_10072912 | 3300026142 | Bacteria | 2731 |
| 807 | Ga0207698_10110705 | 3300026142 | Bacteria | 2301 |
| 808 | Ga0209973_1008503 | 3300027252 | Bacteria | 1173 |
| 809 | Ga0210002_1000370 | 3300027617 | Bacteria | 6107 |
| 810 | Ga0210002_1017154 | 3300027617 | Bacteria | 1150 |
| 811 | Ga0209966_1001412 | 3300027695 | Bacteria | 4186 |
| 812 | Ga0209998_10000754 | 3300027717 | Bacteria | 8475 |
| 813 | Ga0209998_10006767 | 3300027717 | Bacteria | 2377 |
| 814 | Ga0209974_10000697 | 3300027876 | Bacteria | 11450 |
| 815 | Ga0209974_10000776 | 3300027876 | Bacteria | 10871 |
| 816 | Ga0209974_10021914 | 3300027876 | Bacteria | 2115 |
| 817 | Ga0207428_10000114 | 3300027907 | Bacteria | 109533 |
| 818 | Ga0207428_10000736 | 3300027907 | Bacteria | 37641 |
| 819 | Ga0207428_10003035 | 3300027907 | Bacteria | 16519 |
| 820 | Ga0207428_10022508 | 3300027907 | Bacteria | 5317 |
| 821 | Ga0207428_10053222 | 3300027907 | Bacteria | 3228 |
| 822 | Ga0207428_10170899 | 3300027907 | Unclassified | 1646 |
| 823 | Ga0268266_10010491 | 3300028379 | Bacteria | 8097 |
| 824 | Ga0268266_10011314 | 3300028379 | Bacteria | 7766 |
| 825 | Ga0268266_10291610 | 3300028379 | Unclassified | 1519 |
| 826 | Ga0268266_10310139 | 3300028379 | Bacteria | 1474 |
| 827 | Ga0268265_10001326 | 3300028380 | Bacteria | 21194 |
| 828 | Ga0268264_10001756 | 3300028381 | Bacteria | 19870 |
| 829 | Ga0268264_10055713 | 3300028381 | Bacteria | 3304 |
| 830 | Ga0268264_10075492 | 3300028381 | Bacteria | 2866 |
| 831 | Ga0268264_10158476 | 3300028381 | Bacteria | 2036 |
| 832 | Ga0268264_10258764 | 3300028381 | Bacteria | 1620 |
| 833 | Ga0265316_10242379 | 3300031344 | Bacteria | 1325 |
| 834 | Ga0265313_10106101 | 3300031595 | Bacteria | 1240 |
| 835 | Ga0265314_10020384 | 3300031711 | Bacteria | 5118 |
| 836 | Ga0373948_0006733 | 3300034817 | Bacteria | 1911 |
| 837 | Ga0373948_0009864 | 3300034817 | Bacteria | 1656 |
| 838 | Ga0373950_0011829 | 3300034818 | Bacteria | 1432 |
| 839 | Ga0373950_0013207 | 3300034818 | Bacteria | 1374 |
| 840 | Ga0373958_0018799 | 3300034819 | Bacteria | 1256 |
| 841 | Ga0373959_0007572 | 3300034820 | Bacteria | 1828 |
| 842 | Ga0373959_0016796 | 3300034820 | Bacteria | 1361 |
| 843 | Ga0373959_0041169 | 3300034820 | Bacteria | 969 |
| 844 | Ga0373938_0001319 | 3300034957 | Bacteria | 3988 |
| 845 | Ga0373938_0003528 | 3300034957 | Bacteria | 2569 |
| 846 | Ga0373926_0057044 | 3300035083 | Bacteria | 1418 |
| 847 | Ga0373929_0000610 | 3300035085 | Bacteria | 6908 |
| 848 | Ga0373934_0003180 | 3300035086 | Bacteria | 6001 |
| 849 | Ga0373944_0000935 | 3300035089 | Bacteria | 7241 |
| 850 | Ga0373949_0004952 | 3300035090 | Bacteria | 3006 |
| 851 | Ga0373949_0020344 | 3300035090 | Bacteria | 1518 |
| 852 | Ga0373949_0023302 | 3300035090 | Bacteria | 1432 |
| 853 | Ga0373951_0002481 | 3300035091 | Bacteria | 4648 |
| 854 | Ga0373951_0031210 | 3300035091 | Bacteria | 1256 |
| 855 | Ga0373951_0034107 | 3300035091 | Bacteria | 1208 |
| 856 | Ga0373952_0002203 | 3300035092 | Bacteria | 3509 |
| 857 | Ga0373952_0004061 | 3300035092 | Bacteria | 2644 |
| 858 | Ga0373952_0004766 | 3300035092 | Bacteria | 2468 |
| 859 | Ga0373952_0010320 | 3300035092 | Bacteria | 1803 |
| 860 | Ga0373923_0002833 | 3300035111 | Bacteria | 5432 |
| 861 | Ga0373932_0001277 | 3300035112 | Bacteria | 7136 |
| 862 | Ga0373932_0002476 | 3300035112 | Unclassified | 4659 |
| 863 | Ga0373932_0003953 | 3300035112 | Bacteria | 3531 |
| 864 | Ga0373936_0015396 | 3300035113 | Bacteria | 2931 |
| 865 | Ga0373936_0035356 | 3300035113 | Bacteria | 1989 |
| 866 | Ga0373939_0000468 | 3300035114 | Bacteria | 10226 |
| 867 | Ga0373939_0002068 | 3300035114 | Bacteria | 4786 |
| 868 | Ga0373939_0007403 | 3300035114 | Bacteria | 2666 |
| 869 | Ga0373939_0010870 | 3300035114 | Bacteria | 2287 |
| 870 | Ga0373941_0002202 | 3300035115 | Bacteria | 4259 |
| 871 | Ga0373941_0008826 | 3300035115 | Bacteria | 2520 |
| 872 | Ga0373945_0026621 | 3300035116 | Bacteria | 2015 |
| 873 | Ga0373945_0029517 | 3300035116 | Unclassified | 1928 |
| 874 | Ga0373953_0001292 | 3300035117 | Bacteria | 7178 |
| 875 | Ga0373953_0002191 | 3300035117 | Bacteria | 5851 |
| 876 | Ga0373954_0003589 | 3300035118 | Bacteria | 6597 |
| 877 | Ga0373954_0011165 | 3300035118 | Bacteria | 3976 |
| 878 | Ga0373954_0158873 | 3300035118 | Unclassified | 1105 |
| 879 | Ga0373956_0008912 | 3300035119 | Bacteria | 4066 |
| 880 | Ga0373957_0009377 | 3300035120 | Bacteria | 3202 |
| 881 | Ga0373957_0016179 | 3300035120 | Bacteria | 2579 |
| 882 | Ga0373960_0000452 | 3300035121 | Bacteria | 8081 |
| 883 | Ga0373943_0001197 | 3300035170 | Bacteria | 11598 |
| 884 | Ga0373943_0011130 | 3300035170 | Bacteria | 4044 |
| 885 | Ga0373946_0005850 | 3300035171 | Bacteria | 4453 |
| 886 | Ga0373946_0010839 | 3300035171 | Unclassified | 3386 |
| 887 | Ga0373946_0012003 | 3300035171 | Bacteria | 3238 |
| 888 | Ga0373946_0015351 | 3300035171 | Bacteria | 2903 |
| 889 | Ga0373946_0021449 | 3300035171 | Bacteria | 2505 |
| 890 | Ga0373946_0029291 | 3300035171 | Bacteria | 2190 |
| 891 | Ga0373955_0004054 | 3300035172 | Bacteria | 6461 |
| 892 | Ga0373955_0024756 | 3300035172 | Unclassified | 3073 |
| 893 | Ga0373955_0025589 | 3300035172 | Bacteria | 3033 |
| 894 | Ga0373942_0007530 | 3300035207 | Plasmid | 2527 |
| 895 | Ga0373961_0005726 | 3300035241 | Plasmid | 2984 |
| 896 | Ga0373961_0008407 | 3300035241 | Bacteria | 2509 |
| 897 | Ga0373962_0000361 | 3300035242 | Bacteria | 9978 |
| 898 | Ga0373962_0001735 | 3300035242 | Bacteria | 5188 |
| 899 | Ga0373962_0009557 | 3300035242 | Bacteria | 2405 |
| 900 | Ga0373924_0001111 | 3300035410 | Bacteria | 8611 |
| 901 | Ga0373924_0027816 | 3300035410 | Bacteria | 2250 |
| 902 | Ga0373931_0002564 | 3300035691 | Bacteria | 8087 |
| 903 | Ga0373931_0011637 | 3300035691 | Bacteria | 4250 |
| 904 | Ga0373931_0060942 | 3300035691 | Bacteria | 2033 |
| 905 | Ga0373931_0066208 | 3300035691 | Bacteria | 1960 |
| 906 | Ga0373931_0118904 | 3300035691 | Bacteria | 1508 |
| 907 | Ga0373935_0000031 | 3300035692 | Bacteria | 55218 |
| 908 | Ga0373935_0025316 | 3300035692 | Plasmid | 3657 |
| 909 | Ga0373935_0030558 | 3300035692 | Bacteria | 3339 |
| 910 | Ga0373935_0073887 | 3300035692 | Bacteria | 2203 |
| 911 | Ga0373927_0007930 | 3300035695 | Bacteria | 7170 |
| 912 | Ga0373927_0011771 | 3300035695 | Bacteria | 5825 |
| 913 | Ga0373927_0067477 | 3300035695 | Bacteria | 2314 |
| 914 | Ga0373927_0083378 | 3300035695 | Unclassified | 2072 |
| 915 | Ga0373927_0098526 | 3300035695 | Unclassified | 1900 |
| 916 | Ga0373933_0005826 | 3300035724 | Bacteria | 6704 |
| 917 | Ga0373933_0027473 | 3300035724 | Bacteria | 3277 |
| 918 | Ga0373933_0028344 | 3300035724 | Bacteria | 3230 |
| 919 | Ga0373933_0038755 | 3300035724 | Unclassified | 2801 |
| 920 | Ga0373947_0000337 | 3300035725 | Bacteria | 26475 |
| 921 | Ga0373947_0002335 | 3300035725 | Bacteria | 11471 |
| 922 | Ga0373947_0018603 | 3300035725 | Bacteria | 4000 |
| 923 | Ga0373947_0037682 | 3300035725 | Bacteria | 2870 |
| 924 | Ga0373947_0112565 | 3300035725 | Bacteria | 1721 |
| 925 | Ga0373937_0001998 | 3300036401 | Bacteria | 17053 |
| 926 | Ga0373937_0003071 | 3300036401 | Bacteria | 13963 |
| 927 | Ga0373937_0003498 | 3300036401 | Bacteria | 13203 |
| 928 | Ga0373937_0077081 | 3300036401 | Bacteria | 3080 |
| 929 | Ga0373925_0000047 | 3300037068 | Bacteria | 130221 |
| 930 | Ga0373925_0005753 | 3300037068 | Bacteria | 9215 |
| 931 | Ga0373925_0010508 | 3300037068 | Bacteria | 6715 |
| 932 | Ga0373925_0017707 | 3300037068 | Bacteria | 5168 |
| 933 | Ga0373925_0079176 | 3300037068 | Bacteria | 2496 |
| 934 | Ga0373925_0093163 | 3300037068 | Unclassified | 2305 |
| 935 | Ga0395900_0319016 | 3300037418 | Bacteria | 1535 |
| 936 | Ga0395898_0060592 | 3300037466 | Bacteria | 3678 |
| 937 | Ga0436361_0333066 | 3300039447 | Bacteria | 6240 |
| 938 | Ga0439450_025453 | 3300042008 | Unclassified | 1297 |
| 939 | Ga0439460_0028405 | 3300042461 | Bacteria | 1578 |
| 940 | Ga0451576_0335448 | 3300045051 | Archaea | 1583 |
| 941 | Ga0495617_021029 | 3300046452 | Bacteria | 2205 |
| 942 | Ga0495592_0000323 | 3300046454 | Bacteria | 39878 |
| 943 | Ga0495592_0008480 | 3300046454 | Bacteria | 7713 |
| 944 | Ga0495592_0090327 | 3300046454 | Bacteria | 2198 |
| 945 | Ga0495603_0001898 | 3300046455 | Bacteria | 12338 |
| 946 | Ga0495603_0012206 | 3300046455 | Bacteria | 5203 |
| 947 | Ga0495603_0014063 | 3300046455 | Bacteria | 4840 |
| 948 | Ga0495629_0000702 | 3300046459 | Bacteria | 27126 |
| 949 | Ga0495629_0002648 | 3300046459 | Bacteria | 13722 |
| 950 | Ga0495629_0004812 | 3300046459 | Bacteria | 10127 |
| 951 | Ga0495629_0047533 | 3300046459 | Bacteria | 3010 |
| 952 | Ga0495629_0257027 | 3300046459 | Bacteria | 1201 |
| 953 | Ga0495638_0022247 | 3300046460 | Bacteria | 4163 |
| 954 | Ga0495641_0045936 | 3300046461 | Bacteria | 2009 |
| 955 | Ga0495641_0054933 | 3300046461 | Unclassified | 1809 |
| 956 | Ga0495641_0063745 | 3300046461 | Bacteria | 1660 |
| 957 | Ga0495651_0000168 | 3300046462 | Bacteria | 48211 |
| 958 | Ga0495651_0003967 | 3300046462 | Bacteria | 11315 |
| 959 | Ga0495651_0012590 | 3300046462 | Bacteria | 6527 |
| 960 | Ga0495651_0034589 | 3300046462 | Bacteria | 3938 |
| 961 | Ga0495651_0183700 | 3300046462 | Bacteria | 1478 |
| 962 | Ga0495653_0000027 | 3300046463 | Bacteria | 154096 |
| 963 | Ga0495653_0002433 | 3300046463 | Bacteria | 14806 |
| 964 | Ga0495653_0008661 | 3300046463 | Bacteria | 8340 |
| 965 | Ga0495653_0033947 | 3300046463 | Bacteria | 4039 |
| 966 | Ga0495580_0136092 | 3300046472 | Unclassified | 1703 |
| 967 | Ga0495580_0175582 | 3300046472 | Bacteria | 1480 |
| 968 | Ga0495582_0000474 | 3300046473 | Bacteria | 22052 |
| 969 | Ga0495582_0002635 | 3300046473 | Bacteria | 9999 |
| 970 | Ga0495582_0025361 | 3300046473 | Bacteria | 3247 |
| 971 | Ga0495605_0039794 | 3300046474 | Bacteria | 2353 |
| 972 | Ga0495639_0004100 | 3300046475 | Bacteria | 6240 |
| 973 | Ga0495639_0028580 | 3300046475 | Bacteria | 2471 |
| 974 | Ga0495662_0001316 | 3300046476 | Bacteria | 12297 |
| 975 | Ga0495662_0016190 | 3300046476 | Bacteria | 3615 |
| 976 | Ga0495662_0043342 | 3300046476 | Bacteria | 2172 |
| 977 | Ga0495662_0057181 | 3300046476 | Bacteria | 1884 |
| 978 | Ga0495662_0058970 | 3300046476 | Bacteria | 1854 |
| 979 | Ga0495662_0128917 | 3300046476 | Bacteria | 1243 |
| 980 | Ga0495664_0000021 | 3300046477 | Bacteria | 145551 |
| 981 | Ga0495664_0000711 | 3300046477 | Bacteria | 16919 |
| 982 | Ga0495664_0000935 | 3300046477 | Bacteria | 15082 |
| 983 | Ga0495664_0003490 | 3300046477 | Bacteria | 8561 |
| 984 | Ga0495664_0027844 | 3300046477 | Bacteria | 3297 |
| 985 | Ga0495664_0049247 | 3300046477 | Bacteria | 2501 |
| 986 | Ga0495584_0015280 | 3300046491 | Bacteria | 3911 |
| 987 | Ga0495584_0056389 | 3300046491 | Bacteria | 1977 |
| 988 | Ga0495584_0155704 | 3300046491 | Bacteria | 1161 |
| 989 | Ga0495585_0016608 | 3300046492 | Bacteria | 4265 |
| 990 | Ga0495585_0018040 | 3300046492 | Bacteria | 4072 |
| 991 | Ga0495585_0060278 | 3300046492 | Bacteria | 2089 |
| 992 | Ga0495585_0129065 | 3300046492 | Bacteria | 1332 |
| 993 | Ga0495594_0016308 | 3300046499 | Bacteria | 3913 |
| 994 | Ga0495594_0054286 | 3300046499 | Bacteria | 2208 |
| 995 | Ga0495594_0094064 | 3300046499 | Bacteria | 1681 |
| 996 | Ga0495594_0173263 | 3300046499 | Bacteria | 1227 |
| 997 | Ga0495607_0168045 | 3300046501 | Bacteria | 1109 |
| 998 | Ga0495608_0000020 | 3300046511 | Bacteria | 169036 |
| 999 | Ga0495608_0006100 | 3300046511 | Bacteria | 8550 |
| 1000 | Ga0495608_0013077 | 3300046511 | Bacteria | 5759 |
| 1001 | Ga0495608_0034751 | 3300046511 | Bacteria | 3402 |
| 1002 | Ga0495608_0067176 | 3300046511 | Unclassified | 2346 |
| 1003 | Ga0495618_0000117 | 3300046514 | Bacteria | 58104 |
| 1004 | Ga0495618_0006438 | 3300046514 | Bacteria | 7130 |
| 1005 | Ga0495618_0048829 | 3300046514 | Bacteria | 2672 |
| 1006 | Ga0495618_0121698 | 3300046514 | Unclassified | 1671 |
| 1007 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 1008 | Ga0495628_0011629 | 3300046516 | Bacteria | 7439 |
| 1009 | Ga0495628_0015728 | 3300046516 | Bacteria | 6316 |
| 1010 | Ga0495628_0032685 | 3300046516 | Bacteria | 4198 |
| 1011 | Ga0495630_0016774 | 3300046517 | Bacteria | 5359 |
| 1012 | Ga0495630_0177353 | 3300046517 | Unclassified | 1624 |
| 1013 | Ga0495630_0199135 | 3300046517 | Unclassified | 1528 |
| 1014 | Ga0495630_0290822 | 3300046517 | Bacteria | 1248 |
| 1015 | Ga0495630_0380009 | 3300046517 | Unclassified | 1082 |
| 1016 | Ga0495637_0023766 | 3300046520 | Bacteria | 2778 |
| 1017 | Ga0495644_0026102 | 3300046523 | Bacteria | 2217 |
| 1018 | Ga0495644_0066531 | 3300046523 | Bacteria | 1354 |
| 1019 | Ga0495644_0089890 | 3300046523 | Bacteria | 1159 |
| 1020 | Ga0495666_0003661 | 3300046526 | Bacteria | 7760 |
| 1021 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 1022 | Ga0495652_0003397 | 3300046529 | Bacteria | 15737 |
| 1023 | Ga0495652_0013212 | 3300046529 | Bacteria | 7433 |
| 1024 | Ga0495652_0039522 | 3300046529 | Bacteria | 4079 |
| 1025 | Ga0495652_0065876 | 3300046529 | Bacteria | 3043 |
| 1026 | Ga0495652_0110539 | 3300046529 | Unclassified | 2210 |
| 1027 | Ga0495654_0067503 | 3300046530 | Unclassified | 1703 |
| 1028 | Ga0495640_0000035 | 3300046533 | Bacteria | 73471 |
| 1029 | Ga0495640_0007191 | 3300046533 | Bacteria | 8763 |
| 1030 | Ga0495640_0025502 | 3300046533 | Bacteria | 4286 |
| 1031 | Ga0495640_0088104 | 3300046533 | Bacteria | 2052 |
| 1032 | Ga0495640_0195327 | 3300046533 | Bacteria | 1285 |
| 1033 | Ga0495640_0264897 | 3300046533 | Bacteria | 1073 |
| 1034 | Ga0495586_0023861 | 3300046535 | Bacteria | 3266 |
| 1035 | Ga0495587_0000017 | 3300046536 | Bacteria | 172923 |
| 1036 | Ga0495587_0001485 | 3300046536 | Bacteria | 15621 |
| 1037 | Ga0495587_0007045 | 3300046536 | Bacteria | 7299 |
| 1038 | Ga0495587_0027867 | 3300046536 | Bacteria | 3439 |
| 1039 | Ga0495645_0000014 | 3300046543 | Bacteria | 172712 |
| 1040 | Ga0495645_0001772 | 3300046543 | Bacteria | 14693 |
| 1041 | Ga0495645_0005456 | 3300046543 | Bacteria | 8732 |
| 1042 | Ga0495645_0006715 | 3300046543 | Bacteria | 7994 |
| 1043 | Ga0495622_0122301 | 3300046557 | Bacteria | 1188 |
| 1044 | Ga0495633_0014822 | 3300046558 | Bacteria | 4060 |
| 1045 | Ga0495667_0000031 | 3300046559 | Bacteria | 147377 |
| 1046 | Ga0495667_0000946 | 3300046559 | Bacteria | 18764 |
| 1047 | Ga0495667_0001192 | 3300046559 | Bacteria | 16979 |
| 1048 | Ga0495667_0028745 | 3300046559 | Bacteria | 3744 |
| 1049 | Ga0495656_0000732 | 3300046615 | Bacteria | 10619 |
| 1050 | Ga0495656_0022605 | 3300046615 | Bacteria | 2465 |
| 1051 | Ga0495656_0032351 | 3300046615 | Unclassified | 2127 |
| 1052 | Ga0495656_0114226 | 3300046615 | Bacteria | 1267 |
| 1053 | Ga0495634_0000006 | 3300046642 | Bacteria | 172775 |
| 1054 | Ga0495634_0081048 | 3300046642 | Bacteria | 2123 |
| 1055 | Ga0495611_0004409 | 3300046648 | Bacteria | 6091 |
| 1056 | Ga0495611_0138392 | 3300046648 | Unclassified | 1137 |
| 1057 | Ga0495635_0000030 | 3300046663 | Bacteria | 117651 |
| 1058 | Ga0495635_0005492 | 3300046663 | Bacteria | 8815 |
| 1059 | Ga0495635_0065331 | 3300046663 | Bacteria | 2496 |
| 1060 | Ga0495659_0003385 | 3300046664 | Bacteria | 5106 |
| 1061 | Ga0495588_0017873 | 3300046674 | Bacteria | 3451 |
| 1062 | Ga0495588_0082164 | 3300046674 | Bacteria | 1682 |
| 1063 | Ga0495588_0087559 | 3300046674 | Bacteria | 1629 |
| 1064 | Ga0495588_0096485 | 3300046674 | Bacteria | 1551 |
| 1065 | Ga0495657_0001166 | 3300046675 | Bacteria | 23015 |
| 1066 | Ga0495657_0009684 | 3300046675 | Bacteria | 7289 |
| 1067 | Ga0495657_0010489 | 3300046675 | Bacteria | 6971 |
| 1068 | Ga0495657_0014123 | 3300046675 | Bacteria | 5869 |
| 1069 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 1070 | Ga0495599_0004625 | 3300046678 | Bacteria | 8152 |
| 1071 | Ga0495599_0046992 | 3300046678 | Bacteria | 2705 |
| 1072 | Ga0495599_0061804 | 3300046678 | Bacteria | 2340 |
| 1073 | Ga0495599_0134932 | 3300046678 | Bacteria | 1532 |
| 1074 | Ga0495623_0000035 | 3300046679 | Bacteria | 83487 |
| 1075 | Ga0495623_0007498 | 3300046679 | Bacteria | 7083 |
| 1076 | Ga0495623_0009450 | 3300046679 | Bacteria | 6331 |
| 1077 | Ga0495646_0000018 | 3300046680 | Bacteria | 121135 |
| 1078 | Ga0495646_0000846 | 3300046680 | Bacteria | 17305 |
| 1079 | Ga0495646_0008509 | 3300046680 | Bacteria | 6517 |
| 1080 | Ga0495646_0020336 | 3300046680 | Bacteria | 4199 |
| 1081 | Ga0495647_0003820 | 3300046681 | Bacteria | 4849 |
| 1082 | Ga0495647_0019115 | 3300046681 | Bacteria | 2447 |
| 1083 | Ga0495647_0040526 | 3300046681 | Unclassified | 1770 |
| 1084 | Ga0495647_0162747 | 3300046681 | Bacteria | 962 |
| 1085 | Ga0495658_0000168 | 3300046683 | Bacteria | 37055 |
| 1086 | Ga0495658_0000231 | 3300046683 | Bacteria | 31949 |
| 1087 | Ga0495658_0003159 | 3300046683 | Bacteria | 8212 |
| 1088 | Ga0495658_0014023 | 3300046683 | Bacteria | 4086 |
| 1089 | Ga0495613_0013624 | 3300046689 | Bacteria | 6034 |
| 1090 | Ga0495613_0042797 | 3300046689 | Bacteria | 3350 |
| 1091 | Ga0495613_0046388 | 3300046689 | Bacteria | 3213 |
| 1092 | Ga0495613_0150435 | 3300046689 | Bacteria | 1660 |
| 1093 | Ga0495613_0233938 | 3300046689 | Bacteria | 1286 |
| 1094 | Ga0495624_0046464 | 3300046690 | Bacteria | 2760 |
| 1095 | Ga0495624_0170606 | 3300046690 | Bacteria | 1327 |
| 1096 | Ga0495670_0000601 | 3300046691 | Bacteria | 17188 |
| 1097 | Ga0495670_0047763 | 3300046691 | Bacteria | 2140 |
| 1098 | Ga0495671_0066171 | 3300046692 | Bacteria | 1779 |
| 1099 | Ga0495589_0162166 | 3300046794 | Unclassified | 1065 |
| 1100 | Ga0495600_0000048 | 3300046809 | Bacteria | 70636 |
| 1101 | Ga0495600_0003843 | 3300046809 | Bacteria | 8907 |
| 1102 | Ga0495600_0006717 | 3300046809 | Bacteria | 7013 |
| 1103 | Ga0495600_0012550 | 3300046809 | Bacteria | 5301 |
| 1104 | Ga0495600_0222770 | 3300046809 | Bacteria | 1206 |
| 1105 | Ga0495581_0034318 | 3300047315 | Bacteria | 2935 |
| 1106 | Ga0495581_0069521 | 3300047315 | Bacteria | 2036 |
| 1107 | Ga0495581_0101634 | 3300047315 | Bacteria | 1670 |
| 1108 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 1109 | Ga0495604_0002660 | 3300047317 | Bacteria | 14340 |
| 1110 | Ga0495604_0004228 | 3300047317 | Bacteria | 11364 |
| 1111 | Ga0495604_0005155 | 3300047317 | Bacteria | 10348 |
| 1112 | Ga0495604_0041610 | 3300047317 | Bacteria | 3604 |
| 1113 | Ga0495636_0033684 | 3300047318 | Bacteria | 2106 |
| 1114 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 1115 | Ga0495674_0014368 | 3300047319 | Bacteria | 7413 |
| 1116 | Ga0495674_0020533 | 3300047319 | Bacteria | 6113 |
| 1117 | Ga0495674_0028883 | 3300047319 | Bacteria | 5052 |
| 1118 | Ga0495674_0137046 | 3300047319 | Bacteria | 2059 |
| 1119 | Ga0495674_0203553 | 3300047319 | Unclassified | 1641 |
| 1120 | Ga0495674_0238525 | 3300047319 | Bacteria | 1499 |
| 1121 | Ga0495676_0021831 | 3300047321 | Bacteria | 5582 |
| 1122 | Ga0495676_0031573 | 3300047321 | Bacteria | 4477 |
| 1123 | Ga0495676_0074030 | 3300047321 | Bacteria | 2609 |
| 1124 | Ga0495676_0154727 | 3300047321 | Bacteria | 1628 |
| 1125 | Ga0495680_0000308 | 3300047322 | Bacteria | 54837 |
| 1126 | Ga0495680_0019585 | 3300047322 | Bacteria | 5709 |
| 1127 | Ga0495680_0025167 | 3300047322 | Bacteria | 4930 |
| 1128 | Ga0495680_0029834 | 3300047322 | Bacteria | 4461 |
| 1129 | Ga0495680_0035461 | 3300047322 | Bacteria | 4018 |
| 1130 | Ga0495680_0054148 | 3300047322 | Bacteria | 3117 |
| 1131 | Ga0495680_0116059 | 3300047322 | Bacteria | 1980 |
| 1132 | Ga0495675_0000042 | 3300047444 | Bacteria | 85603 |
| 1133 | Ga0495675_0000984 | 3300047444 | Bacteria | 17289 |
| 1134 | Ga0495675_0003357 | 3300047444 | Bacteria | 9639 |
| 1135 | Ga0495679_049097 | 3300047446 | Bacteria | 1274 |
| 1136 | Ga0495684_0000009 | 3300047471 | Bacteria | 199436 |
| 1137 | Ga0495684_0002180 | 3300047471 | Bacteria | 15670 |
| 1138 | Ga0495684_0076836 | 3300047471 | Bacteria | 2536 |
| 1139 | Ga0495684_0113637 | 3300047471 | Bacteria | 2042 |
| 1140 | Ga0495684_0131576 | 3300047471 | Bacteria | 1879 |
| 1141 | Ga0495593_0000445 | 3300047673 | Bacteria | 23167 |
| 1142 | Ga0495593_0001477 | 3300047673 | Bacteria | 13808 |
| 1143 | Ga0495593_0012315 | 3300047673 | Bacteria | 4887 |
| 1144 | Ga0495593_0105960 | 3300047673 | Bacteria | 1438 |
| 1145 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 1146 | Ga0495602_0000726 | 3300048088 | Bacteria | 31111 |
| 1147 | Ga0495602_0003678 | 3300048088 | Bacteria | 15899 |
| 1148 | Ga0495602_0004917 | 3300048088 | Bacteria | 13994 |
| 1149 | Ga0495602_0166674 | 3300048088 | Bacteria | 1714 |
| 1150 | Ga0495614_0030980 | 3300048089 | Bacteria | 2303 |
| 1151 | Ga0495626_0084077 | 3300048091 | Bacteria | 1409 |
| 1152 | Ga0496100_0000599 | 3300048903 | Bacteria | 17022 |
| 1153 | Ga0496100_0003283 | 3300048903 | Bacteria | 8408 |
| 1154 | Ga0496100_0005815 | 3300048903 | Bacteria | 6671 |
| 1155 | Ga0496100_0008105 | 3300048903 | Bacteria | 5845 |
| 1156 | Ga0496100_0026697 | 3300048903 | Unclassified | 3543 |
| 1157 | Ga0496100_0061669 | 3300048903 | Bacteria | 2471 |
| 1158 | Ga0496100_0062049 | 3300048903 | Unclassified | 2465 |
| 1159 | Ga0496100_0144982 | 3300048903 | Bacteria | 1687 |
| 1160 | Ga0496100_0212672 | 3300048903 | Bacteria | 1415 |
| 1161 | Ga0496100_0401854 | 3300048903 | Unclassified | 1043 |
| 1162 | Ga0496101_0000494 | 3300048904 | Bacteria | 24861 |
| 1163 | Ga0496101_0002343 | 3300048904 | Bacteria | 11621 |
| 1164 | Ga0496101_0013487 | 3300048904 | Bacteria | 5476 |
| 1165 | Ga0496101_0037429 | 3300048904 | Bacteria | 3441 |
| 1166 | Ga0496101_0095690 | 3300048904 | Bacteria | 2215 |
| 1167 | Ga0496101_0104848 | 3300048904 | Bacteria | 2121 |
| 1168 | Ga0496101_0107685 | 3300048904 | Bacteria | 2094 |
| 1169 | Ga0496101_0185310 | 3300048904 | Unclassified | 1604 |
| 1170 | Ga0496102_0002665 | 3300048905 | Bacteria | 15185 |
| 1171 | Ga0496102_0005771 | 3300048905 | Bacteria | 10526 |
| 1172 | Ga0496102_0014709 | 3300048905 | Bacteria | 6802 |
| 1173 | Ga0496102_0026451 | 3300048905 | Bacteria | 5175 |
| 1174 | Ga0496102_0027089 | 3300048905 | Bacteria | 5118 |
| 1175 | Ga0496102_0046269 | 3300048905 | Bacteria | 3951 |
| 1176 | Ga0496102_0071116 | 3300048905 | Bacteria | 3194 |
| 1177 | Ga0496102_0074250 | 3300048905 | Unclassified | 3125 |
| 1178 | Ga0496102_0103298 | 3300048905 | Bacteria | 2650 |
| 1179 | Ga0496102_0125803 | 3300048905 | Bacteria | 2396 |
| 1180 | Ga0496102_0356341 | 3300048905 | Unclassified | 1377 |
| 1181 | Ga0496102_0457216 | 3300048905 | Unclassified | 1197 |
| 1182 | Ga0496103_0006275 | 3300048906 | Bacteria | 7107 |
| 1183 | Ga0496103_0009094 | 3300048906 | Bacteria | 5883 |
| 1184 | Ga0496103_0009658 | 3300048906 | Bacteria | 5712 |
| 1185 | Ga0496103_0021457 | 3300048906 | Bacteria | 3885 |
| 1186 | Ga0496103_0166655 | 3300048906 | Unclassified | 1413 |
| 1187 | Ga0496103_0241784 | 3300048906 | Unclassified | 1161 |
| 1188 | Ga0496103_0254724 | 3300048906 | Bacteria | 1129 |
| 1189 | Ga0496104_0000618 | 3300048907 | Bacteria | 30466 |
| 1190 | Ga0496104_0005842 | 3300048907 | Bacteria | 10776 |
| 1191 | Ga0496104_0006701 | 3300048907 | Bacteria | 10136 |
| 1192 | Ga0496104_0007286 | 3300048907 | Bacteria | 9761 |
| 1193 | Ga0496104_0010629 | 3300048907 | Bacteria | 8224 |
| 1194 | Ga0496104_0017209 | 3300048907 | Bacteria | 6576 |
| 1195 | Ga0496104_0018794 | 3300048907 | Bacteria | 6311 |
| 1196 | Ga0496104_0021878 | 3300048907 | Bacteria | 5873 |
| 1197 | Ga0496104_0075236 | 3300048907 | Bacteria | 3215 |
| 1198 | Ga0496104_0175385 | 3300048907 | Bacteria | 2054 |
| 1199 | Ga0496104_0199614 | 3300048907 | Bacteria | 1912 |
| 1200 | Ga0496104_0335214 | 3300048907 | Bacteria | 1425 |
| 1201 | Ga0496104_0359845 | 3300048907 | Unclassified | 1367 |
| 1202 | Ga0496105_0001329 | 3300048908 | Bacteria | 17318 |
| 1203 | Ga0496105_0001514 | 3300048908 | Bacteria | 16426 |
| 1204 | Ga0496105_0012808 | 3300048908 | Bacteria | 6647 |
| 1205 | Ga0496105_0041920 | 3300048908 | Bacteria | 3772 |
| 1206 | Ga0496105_0054824 | 3300048908 | Bacteria | 3291 |
| 1207 | Ga0496105_0057469 | 3300048908 | Bacteria | 3212 |
| 1208 | Ga0496105_0068472 | 3300048908 | Unclassified | 2932 |
| 1209 | Ga0496105_0083459 | 3300048908 | Bacteria | 2638 |
| 1210 | Ga0496105_0084080 | 3300048908 | Bacteria | 2628 |
| 1211 | Ga0496105_0085055 | 3300048908 | Bacteria | 2613 |
| 1212 | Ga0496105_0085063 | 3300048908 | Bacteria | 2613 |
| 1213 | Ga0496105_0098135 | 3300048908 | Bacteria | 2419 |
| 1214 | Ga0496106_0002551 | 3300048909 | Bacteria | 13535 |
| 1215 | Ga0496106_0006010 | 3300048909 | Bacteria | 8977 |
| 1216 | Ga0496106_0016780 | 3300048909 | Bacteria | 5418 |
| 1217 | Ga0496106_0022101 | 3300048909 | Bacteria | 4725 |
| 1218 | Ga0496106_0028569 | 3300048909 | Bacteria | 4154 |
| 1219 | Ga0496106_0049401 | 3300048909 | Bacteria | 3168 |
| 1220 | Ga0496106_0050141 | 3300048909 | Unclassified | 3145 |
| 1221 | Ga0496106_0058443 | 3300048909 | Bacteria | 2919 |
| 1222 | Ga0496106_0110102 | 3300048909 | Bacteria | 2143 |
| 1223 | Ga0496106_0172970 | 3300048909 | Bacteria | 1712 |
| 1224 | Ga0496106_0255857 | 3300048909 | Bacteria | 1401 |
| 1225 | Ga0496107_0001078 | 3300048910 | Bacteria | 16394 |
| 1226 | Ga0496107_0005515 | 3300048910 | Bacteria | 8658 |
| 1227 | Ga0496107_0021706 | 3300048910 | Bacteria | 4536 |
| 1228 | Ga0496107_0022948 | 3300048910 | Bacteria | 4411 |
| 1229 | Ga0496107_0026904 | 3300048910 | Bacteria | 4082 |
| 1230 | Ga0496107_0031123 | 3300048910 | Bacteria | 3805 |
| 1231 | Ga0496107_0041649 | 3300048910 | Bacteria | 3298 |
| 1232 | Ga0496107_0073940 | 3300048910 | Unclassified | 2479 |
| 1233 | Ga0496107_0100771 | 3300048910 | Unclassified | 2117 |
| 1234 | Ga0496107_0155953 | 3300048910 | Unclassified | 1690 |
| 1235 | Ga0496107_0165529 | 3300048910 | Unclassified | 1639 |
| 1236 | Ga0496107_0177324 | 3300048910 | Bacteria | 1582 |
| 1237 | Ga0496108_0000544 | 3300048911 | Bacteria | 29516 |
| 1238 | Ga0496108_0000598 | 3300048911 | Bacteria | 28277 |
| 1239 | Ga0496108_0027147 | 3300048911 | Bacteria | 4724 |
| 1240 | Ga0496108_0032337 | 3300048911 | Bacteria | 4346 |
| 1241 | Ga0496108_0060277 | 3300048911 | Bacteria | 3193 |
| 1242 | Ga0496108_0063838 | 3300048911 | Bacteria | 3101 |
| 1243 | Ga0496108_0066773 | 3300048911 | Unclassified | 3034 |
| 1244 | Ga0496108_0068441 | 3300048911 | Bacteria | 2996 |
| 1245 | Ga0496108_0109944 | 3300048911 | Bacteria | 2356 |
| 1246 | Ga0496108_0189298 | 3300048911 | Bacteria | 1783 |
| 1247 | Ga0496108_0226093 | 3300048911 | Unclassified | 1626 |
| 1248 | Ga0496108_0236888 | 3300048911 | Bacteria | 1587 |
| 1249 | Ga0496109_0000150 | 3300048912 | Bacteria | 68777 |
| 1250 | Ga0496109_0003416 | 3300048912 | Bacteria | 13286 |
| 1251 | Ga0496109_0006280 | 3300048912 | Bacteria | 9999 |
| 1252 | Ga0496109_0006399 | 3300048912 | Bacteria | 9914 |
| 1253 | Ga0496109_0066010 | 3300048912 | Bacteria | 3312 |
| 1254 | Ga0496109_0069270 | 3300048912 | Bacteria | 3235 |
| 1255 | Ga0496109_0081926 | 3300048912 | Bacteria | 2973 |
| 1256 | Ga0496109_0116423 | 3300048912 | Bacteria | 2487 |
| 1257 | Ga0496109_0167301 | 3300048912 | Bacteria | 2062 |
| 1258 | Ga0496109_0174999 | 3300048912 | Bacteria | 2014 |
| 1259 | Ga0496109_0206190 | 3300048912 | Unclassified | 1848 |
| 1260 | Ga0496110_0001581 | 3300048913 | Bacteria | 16633 |
| 1261 | Ga0496110_0009968 | 3300048913 | Bacteria | 7707 |
| 1262 | Ga0496110_0028016 | 3300048913 | Unclassified | 4834 |
| 1263 | Ga0496110_0064235 | 3300048913 | Bacteria | 3243 |
| 1264 | Ga0496110_0085429 | 3300048913 | Unclassified | 2816 |
| 1265 | Ga0496110_0151650 | 3300048913 | Bacteria | 2099 |
| 1266 | Ga0496110_0210835 | 3300048913 | Bacteria | 1766 |
| 1267 | Ga0496110_0236479 | 3300048913 | Bacteria | 1662 |
| 1268 | Ga0496110_0338151 | 3300048913 | Bacteria | 1371 |
| 1269 | Ga0496110_0366927 | 3300048913 | Unclassified | 1312 |
| 1270 | Ga0496110_0373892 | 3300048913 | Bacteria | 1298 |
| 1271 | Ga0496110_0396880 | 3300048913 | Unclassified | 1257 |
| 1272 | Ga0496111_0002315 | 3300048914 | Bacteria | 11464 |
| 1273 | Ga0496111_0021159 | 3300048914 | Bacteria | 4538 |
| 1274 | Ga0496111_0025046 | 3300048914 | Unclassified | 4208 |
| 1275 | Ga0496111_0049774 | 3300048914 | Bacteria | 3021 |
| 1276 | Ga0496111_0073266 | 3300048914 | Bacteria | 2494 |
| 1277 | Ga0496111_0183135 | 3300048914 | Bacteria | 1557 |
| 1278 | Ga0496111_0197599 | 3300048914 | Bacteria | 1495 |
| 1279 | Ga0496111_0253789 | 3300048914 | Unclassified | 1305 |
| 1280 | Ga0496111_0302870 | 3300048914 | Bacteria | 1185 |
| 1281 | Ga0496111_0358903 | 3300048914 | Bacteria | 1079 |
| 1282 | Ga0496112_0000515 | 3300048915 | Bacteria | 26277 |
| 1283 | Ga0496112_0001706 | 3300048915 | Bacteria | 17153 |
| 1284 | Ga0496112_0003199 | 3300048915 | Bacteria | 13476 |
| 1285 | Ga0496112_0036954 | 3300048915 | Bacteria | 4765 |
| 1286 | Ga0496112_0050373 | 3300048915 | Bacteria | 4083 |
| 1287 | Ga0496112_0071356 | 3300048915 | Bacteria | 3432 |
| 1288 | Ga0496112_0120239 | 3300048915 | Bacteria | 2596 |
| 1289 | Ga0496112_0431203 | 3300048915 | Bacteria | 1256 |
| 1290 | Ga0496112_0500538 | 3300048915 | Unclassified | 1150 |
| 1291 | Ga0496113_0000577 | 3300048916 | Bacteria | 18288 |
| 1292 | Ga0496113_0001438 | 3300048916 | Bacteria | 13225 |
| 1293 | Ga0496113_0003250 | 3300048916 | Bacteria | 9693 |
| 1294 | Ga0496113_0009913 | 3300048916 | Bacteria | 6278 |
| 1295 | Ga0496113_0022684 | 3300048916 | Bacteria | 4444 |
| 1296 | Ga0496113_0063905 | 3300048916 | Bacteria | 2782 |
| 1297 | Ga0496113_0085636 | 3300048916 | Bacteria | 2421 |
| 1298 | Ga0496113_0085659 | 3300048916 | Bacteria | 2420 |
| 1299 | Ga0496113_0105549 | 3300048916 | Unclassified | 2187 |
| 1300 | Ga0496113_0167236 | 3300048916 | Unclassified | 1740 |
| 1301 | Ga0496113_0242507 | 3300048916 | Bacteria | 1438 |
| 1302 | Ga0496113_0279346 | 3300048916 | Bacteria | 1335 |
| 1303 | Ga0496114_0003461 | 3300048917 | Bacteria | 12111 |
| 1304 | Ga0496114_0010616 | 3300048917 | Bacteria | 7326 |
| 1305 | Ga0496114_0012460 | 3300048917 | Bacteria | 6807 |
| 1306 | Ga0496114_0025198 | 3300048917 | Bacteria | 4860 |
| 1307 | Ga0496114_0026844 | 3300048917 | Bacteria | 4717 |
| 1308 | Ga0496114_0046341 | 3300048917 | Bacteria | 3613 |
| 1309 | Ga0496114_0064502 | 3300048917 | Bacteria | 3067 |
| 1310 | Ga0496114_0072370 | 3300048917 | Bacteria | 2899 |
| 1311 | Ga0496114_0089487 | 3300048917 | Bacteria | 2612 |
| 1312 | Ga0496114_0253877 | 3300048917 | Unclassified | 1547 |
| 1313 | Ga0496115_0024212 | 3300048918 | Bacteria | 4716 |
| 1314 | Ga0496115_0025295 | 3300048918 | Bacteria | 4621 |
| 1315 | Ga0496115_0033491 | 3300048918 | Bacteria | 4056 |
| 1316 | Ga0496115_0035592 | 3300048918 | Bacteria | 3940 |
| 1317 | Ga0496115_0046670 | 3300048918 | Bacteria | 3463 |
| 1318 | Ga0496115_0075254 | 3300048918 | Bacteria | 2742 |
| 1319 | Ga0496115_0107490 | 3300048918 | Bacteria | 2290 |
| 1320 | Ga0496115_0120646 | 3300048918 | Bacteria | 2157 |
| 1321 | Ga0496115_0128066 | 3300048918 | Unclassified | 2092 |
| 1322 | Ga0496115_0138828 | 3300048918 | Bacteria | 2005 |
| 1323 | Ga0501032_0151203 | 3300049569 | Bacteria | 1526 |
| 1324 | Ga0501034_0052553 | 3300049571 | Bacteria | 4104 |
| 1325 | Ga0501034_0393036 | 3300049571 | Bacteria | 1310 |
| 1326 | Ga0501036_0340069 | 3300049572 | Bacteria | 1253 |
| 1327 | Ga0501038_0070854 | 3300049574 | Bacteria | 2958 |
| 1328 | Ga0501038_0271706 | 3300049574 | Bacteria | 1336 |
| 1329 | Ga0501038_0299769 | 3300049574 | Bacteria | 1262 |
| 1330 | Ga0501039_0221986 | 3300049575 | Bacteria | 1486 |
| 1331 | Ga0501039_0382003 | 3300049575 | Bacteria | 1106 |
| 1332 | Ga0501070_0311084 | 3300049586 | Bacteria | 1282 |
| 1333 | Ga0501070_0358284 | 3300049586 | Bacteria | 1183 |
| 1334 | Ga0501076_0244189 | 3300049592 | Bacteria | 1469 |
| 1335 | Ga0501076_0376161 | 3300049592 | Bacteria | 1167 |
| 1336 | Ga0501080_0432932 | 3300049742 | Bacteria | 1181 |
| 1337 | Ga0501035_0005615 | 3300049822 | Bacteria | 11843 |
| 1338 | Ga0501035_0207879 | 3300049822 | Bacteria | 1676 |
| 1339 | Ga0501044_0222297 | 3300049823 | Bacteria | 1839 |
| 1340 | nmdc:mga03683_49041_c1 | 3300050489 | Bacteria | 1756 |
| 1341 | nmdc:mga03n38_104006_c1 | 3300050490 | Unclassified | 1373 |
| 1342 | nmdc:mga0yw44_135_c1 | 3300050492 | Bacteria | 25348 |
| 1343 | nmdc:mga0yw44_201881_c1 | 3300050492 | Bacteria | 1313 |
| 1344 | nmdc:mga0yw44_2239_c1 | 3300050492 | Bacteria | 6480 |
| 1345 | nmdc:mga0yw44_37082_c1 | 3300050492 | Bacteria | 2877 |
| 1346 | nmdc:mga0yw44_4842_c1 | 3300050492 | Bacteria | 6255 |
| 1347 | nmdc:mga0yw44_72845_c1 | 3300050492 | Unclassified | 2136 |
| 1348 | nmdc:mga06z11_10880_c1 | 3300050494 | Bacteria | 3897 |
| 1349 | nmdc:mga05p37_211446_c1 | 3300050507 | Bacteria | 2344 |
| 1350 | nmdc:mga05p37_223_c1 | 3300050507 | Bacteria | 57418 |
| 1351 | nmdc:mga05p37_22429_c1 | 3300050507 | Bacteria | 7657 |
| 1352 | nmdc:mga05p37_249786_c1 | 3300050507 | Bacteria | 2128 |
| 1353 | nmdc:mga05p37_304502_c1 | 3300050507 | Bacteria | 1892 |
| 1354 | nmdc:mga05p37_30735_c1 | 3300050507 | Bacteria | 2944 |
| 1355 | nmdc:mga05p37_504119_c1 | 3300050507 | Bacteria | 1388 |
| 1356 | nmdc:mga05p37_56_c3 | 3300050507 | Bacteria | 77819 |
| 1357 | nmdc:mga09592_1434_c1 | 3300050508 | Bacteria | 19112 |
| 1358 | nmdc:mga09592_47744_c1 | 3300050508 | Bacteria | 3609 |
| 1359 | nmdc:mga09592_70675_c1 | 3300050508 | Bacteria | 2962 |
| 1360 | nmdc:mga09592_75131_c1 | 3300050508 | Bacteria | 2872 |
| 1361 | nmdc:mga0qj67_103172_c1 | 3300050509 | Bacteria | 2300 |
| 1362 | nmdc:mga0qj67_26868_c1 | 3300050509 | Bacteria | 4458 |
| 1363 | nmdc:mga0qj67_29779_c1 | 3300050509 | Bacteria | 4242 |
| 1364 | nmdc:mga0qj67_39546_c1 | 3300050509 | Bacteria | 3704 |
| 1365 | nmdc:mga06r32_155489_c1 | 3300050510 | Bacteria | 2268 |
| 1366 | nmdc:mga06r32_186_c1 | 3300050510 | Bacteria | 49161 |
| 1367 | nmdc:mga06r32_43726_c1 | 3300050510 | Bacteria | 4263 |
| 1368 | nmdc:mga06r32_806_c1 | 3300050510 | Bacteria | 27804 |
| 1369 | nmdc:mga08y16_1035_c1 | 3300050511 | Bacteria | 27236 |
| 1370 | nmdc:mga08y16_176415_c1 | 3300050511 | Bacteria | 2219 |
| 1371 | nmdc:mga08y16_206_c1 | 3300050511 | Bacteria | 46039 |
| 1372 | nmdc:mga08y16_3000_c1 | 3300050511 | Bacteria | 17414 |
| 1373 | nmdc:mga08y16_363748_c1 | 3300050511 | Unclassified | 1485 |
| 1374 | nmdc:mga08y16_412252_c1 | 3300050511 | Bacteria | 1382 |
| 1375 | nmdc:mga08y16_89854_c1 | 3300050511 | Bacteria | 3201 |
| 1376 | nmdc:mga0n895_11211_c1 | 3300050512 | Bacteria | 7983 |
| 1377 | nmdc:mga0n895_22286_c1 | 3300050512 | Bacteria | 5938 |
| 1378 | nmdc:mga0n895_2402_c1 | 3300050512 | Bacteria | 14597 |
| 1379 | nmdc:mga0n895_30334_c1 | 3300050512 | Bacteria | 5167 |
| 1380 | nmdc:mga0n895_34308_c1 | 3300050512 | Bacteria | 4883 |
| 1381 | nmdc:mga0n895_36077_c1 | 3300050512 | Bacteria | 4772 |
| 1382 | nmdc:mga0n895_65248_c1 | 3300050512 | Bacteria | 3603 |
| 1383 | nmdc:mga0n895_71650_c1 | 3300050512 | Bacteria | 3437 |
| 1384 | nmdc:mga0n895_85077_c1 | 3300050512 | Unclassified | 3156 |
| 1385 | nmdc:mga0rr50_120507_c1 | 3300050513 | Bacteria | 2088 |
| 1386 | nmdc:mga0rr50_123644_c1 | 3300050513 | Bacteria | 2063 |
| 1387 | nmdc:mga0rr50_15932_c1 | 3300050513 | Bacteria | 4976 |
| 1388 | nmdc:mga0rr50_17917_c1 | 3300050513 | Bacteria | 4743 |
| 1389 | nmdc:mga0rr50_202887_c1 | 3300050513 | Unclassified | 1630 |
| 1390 | nmdc:mga0rr50_26806_c1 | 3300050513 | Plasmid | 4028 |
| 1391 | nmdc:mga0rr50_59473_c1 | 3300050513 | Bacteria | 2869 |
| 1392 | nmdc:mga08x19_201298_c1 | 3300050514 | Bacteria | 1365 |
| 1393 | nmdc:mga08x19_59979_c1 | 3300050514 | Bacteria | 2464 |
| 1394 | nmdc:mga0a205_13046_c1 | 3300050515 | Bacteria | 7716 |
| 1395 | nmdc:mga0a205_16008_c1 | 3300050515 | Bacteria | 7018 |
| 1396 | nmdc:mga0a205_1905_c1 | 3300050515 | Bacteria | 18117 |
| 1397 | nmdc:mga0a205_80_c1 | 3300050515 | Bacteria | 53083 |
| 1398 | Ga0495601_0000020 | 3300053077 | Bacteria | 160011 |
| 1399 | Ga0495601_0000102 | 3300053077 | Bacteria | 46420 |
| 1400 | Ga0495601_0000232 | 3300053077 | Bacteria | 29854 |
| 1401 | Ga0495601_0005229 | 3300053077 | Bacteria | 7550 |
| 1402 | Ga0495601_0006091 | 3300053077 | Bacteria | 7036 |
| 1403 | Ga0495601_0014874 | 3300053077 | Bacteria | 4697 |
| 1404 | Ga0495601_0048049 | 3300053077 | Bacteria | 2687 |
| 1405 | Ga0495612_0000020 | 3300053078 | Bacteria | 137759 |
| 1406 | Ga0495612_0001651 | 3300053078 | Bacteria | 9178 |
| 1407 | Ga0495612_0006808 | 3300053078 | Bacteria | 4680 |
| 1408 | Ga0495612_0006943 | 3300053078 | Bacteria | 4633 |
| 1409 | Ga0495612_0013576 | 3300053078 | Bacteria | 3280 |
| 1410 | Ga0495612_0023473 | 3300053078 | Bacteria | 2475 |
| 1411 | Ga0495655_0001142 | 3300053083 | Bacteria | 4096 |
| 1412 | Ga0495655_0006026 | 3300053083 | Unclassified | 2179 |
| 1413 | Ga0495655_0017111 | 3300053083 | Unclassified | 1573 |
| 1414 | Ga0495595_0000047 | 3300053084 | Bacteria | 62097 |
| 1415 | Ga0495595_0000284 | 3300053084 | Bacteria | 19932 |
| 1416 | Ga0495595_0001961 | 3300053084 | Bacteria | 7990 |
| 1417 | Ga0495595_0004403 | 3300053084 | Bacteria | 5666 |
| 1418 | Ga0495595_0032080 | 3300053084 | Unclassified | 2364 |
| 1419 | Ga0495595_0034012 | 3300053084 | Bacteria | 2303 |
| 1420 | Ga0495619_0000011 | 3300053085 | Bacteria | 287128 |
| 1421 | Ga0495619_0000092 | 3300053085 | Bacteria | 69233 |
| 1422 | Ga0495619_0000145 | 3300053085 | Bacteria | 52248 |
| 1423 | Ga0495619_0000341 | 3300053085 | Bacteria | 32535 |
| 1424 | Ga0495619_0001312 | 3300053085 | Bacteria | 16329 |
| 1425 | Ga0495619_0004545 | 3300053085 | Bacteria | 8860 |
| 1426 | Ga0495619_0005415 | 3300053085 | Bacteria | 8084 |
| 1427 | Ga0495619_0016154 | 3300053085 | Bacteria | 4725 |
| 1428 | Ga0495619_0026304 | 3300053085 | Bacteria | 3742 |
| 1429 | Ga0495619_0045010 | 3300053085 | Bacteria | 2898 |
| 1430 | Ga0500643_001354 | 3300053087 | Bacteria | 14257 |
| 1431 | Ga0500593_002357 | 3300053117 | Bacteria | 6926 |
| 1432 | Ga0500595_000029 | 3300053119 | Bacteria | 122318 |
| 1433 | Ga0500595_017223 | 3300053119 | Bacteria | 2672 |
| 1434 | Ga0500652_000086 | 3300053131 | Bacteria | 38984 |
| 1435 | Ga0500636_0023610 | 3300053177 | Bacteria | 3635 |
| 1436 | Ga0501084_0203268 | 3300054114 | Bacteria | 1672 |
| 1437 | JGI24746J21847_1000713 | |||
| 1438 | JGI24746J21847_1013634 | |||
| 1439 | JGI24739J22299_10002354 | |||
| 1440 | JGI24739J22299_10018214 | |||
| 1441 | JGI24737J22298_10000583 | |||
| 1442 | JGI24737J22298_10041560 | |||
| 1443 | JGI24750J21931_1000574 | |||
| 1444 | JGI24745J21846_1000334 | |||
| 1445 | JGI24745J21846_1008400 | |||
| 1446 | JGI24738J21930_10021266 | |||
| 1447 | JGI24744J21845_10000414 | |||
| 1448 | JGI24744J21845_10009162 | |||
| 1449 | JGI24744J21845_10013844 | |||
| 1450 | JGI24034J26672_10000259 | |||
| 1451 | JGI24034J26672_10000505 | |||
| 1452 | JGI24034J26672_10016114 | |||
| 1453 | JGI24742J22300_10000043 | |||
| 1454 | JGI25405J52794_10002442 | |||
| 1455 | Ga0065712_10070182 | |||
| 1456 | Ga0065715_10259753 | |||
| 1457 | Ga0070676_10021315 | |||
| 1458 | Ga0070676_10049580 | |||
| 1459 | Ga0070676_10078722 | |||
| 1460 | Ga0070676_10189854 | |||
| 1461 | Ga0070683_100000656 | |||
| 1462 | Ga0070683_100003103 | |||
| 1463 | Ga0070683_100074077 | |||
| 1464 | Ga0070683_100077908 | |||
| 1465 | Ga0070683_100103903 | |||
| 1466 | Ga0070683_100359163 | |||
| 1467 | Ga0070690_100001658 | |||
| 1468 | Ga0070690_100001831 | |||
| 1469 | Ga0070690_100032490 | |||
| 1470 | Ga0070690_100142366 | |||
| 1471 | Ga0070670_100002207 | |||
| 1472 | Ga0070670_100016346 | |||
| 1473 | Ga0070670_100067176 | |||
| 1474 | Ga0070670_100092366 | |||
| 1475 | Ga0070670_100108703 | |||
| 1476 | Ga0070670_100154184 | |||
| 1477 | Ga0070670_100274015 | |||
| 1478 | Ga0070677_10000076 | |||
| 1479 | Ga0070677_10006595 | |||
| 1480 | Ga0068869_100000216 | |||
| 1481 | Ga0068869_100003321 | |||
| 1482 | Ga0068869_100016912 | |||
| 1483 | Ga0068869_100020350 | |||
| 1484 | Ga0068869_100218176 | |||
| 1485 | Ga0068869_100277554 | |||
| 1486 | Ga0070666_10002180 | |||
| 1487 | Ga0070666_10017246 | |||
| 1488 | Ga0070666_10020081 | |||
| 1489 | Ga0070666_10050722 | |||
| 1490 | Ga0070666_10072560 | |||
| 1491 | Ga0070680_100002960 | |||
| 1492 | Ga0070680_100003735 | |||
| 1493 | Ga0070680_100019228 | |||
| 1494 | Ga0070682_100000285 | |||
| 1495 | Ga0070682_100011413 | |||
| 1496 | Ga0070682_100031677 | |||
| 1497 | Ga0070682_100049267 | |||
| 1498 | Ga0070682_100073428 | |||
| 1499 | Ga0070682_100122865 | |||
| 1500 | Ga0068868_100000474 | |||
| 1501 | Ga0068868_100089186 | |||
| 1502 | Ga0068868_100253399 | |||
| 1503 | Ga0070660_100000874 | |||
| 1504 | Ga0070660_100001332 | |||
| 1505 | Ga0070660_100049252 | |||
| 1506 | Ga0070689_100004112 | |||
| 1507 | Ga0070689_100011551 | |||
| 1508 | Ga0070689_100044257 | |||
| 1509 | Ga0070689_100406625 | |||
| 1510 | Ga0070691_10001440 | |||
| 1511 | Ga0070691_10023960 | |||
| 1512 | Ga0070691_10033534 | |||
| 1513 | Ga0070687_100005766 | |||
| 1514 | Ga0070661_100002370 | |||
| 1515 | Ga0070661_100023545 | |||
| 1516 | Ga0070661_100054477 | |||
| 1517 | Ga0070692_10000173 | |||
| 1518 | Ga0070692_10000841 | |||
| 1519 | Ga0070668_100002051 | |||
| 1520 | Ga0070668_100202879 | |||
| 1521 | Ga0070669_100001956 | |||
| 1522 | Ga0070669_100011387 | |||
| 1523 | Ga0070675_100000622 | |||
| 1524 | Ga0070675_100057314 | |||
| 1525 | Ga0070675_100068345 | |||
| 1526 | Ga0070675_100206227 | |||
| 1527 | Ga0070671_100001629 | |||
| 1528 | Ga0070671_100012131 | |||
| 1529 | Ga0070671_100018516 | |||
| 1530 | Ga0070671_100095238 | |||
| 1531 | Ga0070671_100132167 | |||
| 1532 | Ga0070671_100250920 | |||
| 1533 | Ga0070674_100027715 | |||
| 1534 | Ga0070674_100047491 | |||
| 1535 | Ga0070674_100105650 | |||
| 1536 | Ga0070674_100210530 | |||
| 1537 | Ga0070674_100233068 | |||
| 1538 | Ga0070673_100000418 | |||
| 1539 | Ga0070673_100000640 | |||
| 1540 | Ga0070673_100037488 | |||
| 1541 | Ga0070673_100070898 | |||
| 1542 | Ga0070673_100189629 | |||
| 1543 | Ga0070688_100000906 | |||
| 1544 | Ga0070688_100001260 | |||
| 1545 | Ga0070688_100008005 | |||
| 1546 | Ga0070688_100061411 | |||
| 1547 | Ga0070688_100132522 | |||
| 1548 | Ga0070659_100001362 | |||
| 1549 | Ga0070659_100003550 | |||
| 1550 | Ga0070659_100037636 | |||
| 1551 | Ga0070659_100062209 | |||
| 1552 | Ga0070659_100437291 | |||
| 1553 | Ga0070667_100001650 | |||
| 1554 | Ga0070667_100015334 | |||
| 1555 | Ga0070667_100035664 | |||
| 1556 | Ga0070667_100104193 | |||
| 1557 | Ga0070667_100188861 | |||
| 1558 | Ga0070667_100292313 | |||
| 1559 | Ga0070703_10003120 | |||
| 1560 | Ga0070709_10004958 | |||
| 1561 | Ga0070709_10007315 | |||
| 1562 | Ga0070709_10175311 | |||
| 1563 | Ga0070709_10338479 | |||
| 1564 | Ga0070714_100027432 | |||
| 1565 | Ga0070714_100033507 | |||
| 1566 | Ga0070714_100050626 | |||
| 1567 | Ga0070714_100069271 | |||
| 1568 | Ga0070714_100155094 | |||
| 1569 | Ga0070713_100000526 | |||
| 1570 | Ga0070713_100069032 | |||
| 1571 | Ga0070713_100073376 | |||
| 1572 | Ga0070713_100241283 | |||
| 1573 | Ga0070713_100293160 | |||
| 1574 | Ga0070710_10021860 | |||
| 1575 | Ga0070710_10024235 | |||
| 1576 | Ga0070701_10000264 | |||
| 1577 | Ga0070701_10015338 | |||
| 1578 | Ga0070701_10041566 | |||
| 1579 | Ga0070711_100017524 | |||
| 1580 | Ga0070711_100092561 | |||
| 1581 | Ga0070711_100103772 | |||
| 1582 | Ga0070705_100001279 | |||
| 1583 | Ga0070705_100067351 | |||
| 1584 | Ga0070705_100177813 | |||
| 1585 | Ga0070700_100004852 | |||
| 1586 | Ga0070700_100010848 | |||
| 1587 | Ga0070700_100030981 | |||
| 1588 | Ga0070700_100072767 | |||
| 1589 | Ga0070694_100000576 | |||
| 1590 | Ga0070694_100002530 | |||
| 1591 | Ga0070708_100150592 | |||
| 1592 | Ga0070663_100001039 | |||
| 1593 | Ga0070663_100014289 | |||
| 1594 | Ga0070663_100016904 | |||
| 1595 | Ga0070663_100110880 | |||
| 1596 | Ga0070663_100210250 | |||
| 1597 | Ga0070678_100008209 | |||
| 1598 | Ga0070678_100009636 | |||
| 1599 | Ga0070678_100036667 | |||
| 1600 | Ga0070678_100040359 | |||
| 1601 | Ga0070678_100107360 | |||
| 1602 | Ga0070662_100009914 | |||
| 1603 | Ga0070662_100064734 | |||
| 1604 | Ga0070662_100183385 | |||
| 1605 | Ga0070662_100237177 | |||
| 1606 | Ga0070681_10008583 | |||
| 1607 | Ga0070681_10008649 | |||
| 1608 | Ga0070681_10152054 | |||
| 1609 | Ga0070681_10236056 | |||
| 1610 | Ga0070681_10372367 | |||
| 1611 | Ga0070681_10465262 | |||
| 1612 | Ga0068867_100048243 | |||
| 1613 | Ga0070685_10000645 | |||
| 1614 | Ga0070685_10039257 | |||
| 1615 | Ga0070685_10043864 | |||
| 1616 | Ga0070685_10106134 | |||
| 1617 | Ga0070707_100117784 | |||
| 1618 | Ga0070699_100000676 | |||
| 1619 | Ga0070699_100077901 | |||
| 1620 | Ga0070699_100315526 | |||
| 1621 | Ga0070679_100021636 | |||
| 1622 | Ga0070679_100032292 | |||
| 1623 | Ga0070679_100070445 | |||
| 1624 | Ga0070679_100102817 | |||
| 1625 | Ga0070679_100589355 | |||
| 1626 | Ga0070684_100001969 | |||
| 1627 | Ga0070684_100002245 | |||
| 1628 | Ga0070684_100124386 | |||
| 1629 | Ga0070684_100133700 | |||
| 1630 | Ga0070684_100417922 | |||
| 1631 | Ga0070697_100070677 | |||
| 1632 | Ga0070697_100081262 | |||
| 1633 | Ga0068853_100005266 | |||
| 1634 | Ga0068853_100206837 | |||
| 1635 | Ga0068853_100246551 | |||
| 1636 | Ga0070672_100021363 | |||
| 1637 | Ga0070672_100079680 | |||
| 1638 | Ga0070672_100212707 | |||
| 1639 | Ga0070686_100001137 | |||
| 1640 | Ga0070686_100002237 | |||
| 1641 | Ga0070686_100003181 | |||
| 1642 | Ga0070686_100014107 | |||
| 1643 | Ga0070686_100064365 | |||
| 1644 | Ga0070695_100011111 | |||
| 1645 | Ga0070696_100007394 | |||
| 1646 | Ga0070696_100036204 | |||
| 1647 | Ga0070696_100158540 | |||
| 1648 | Ga0070696_100218345 | |||
| 1649 | Ga0070693_100001170 | |||
| 1650 | Ga0070693_100008690 | |||
| 1651 | Ga0070693_100012214 | |||
| 1652 | Ga0070693_100059626 | |||
| 1653 | Ga0070693_100087770 | |||
| 1654 | Ga0070665_100167945 | |||
| 1655 | Ga0070665_100200619 | |||
| 1656 | Ga0070665_100217209 | |||
| 1657 | Ga0070704_100000444 | |||
| 1658 | Ga0070704_100226163 | |||
| 1659 | Ga0068855_100004774 | |||
| 1660 | Ga0068855_100010841 | |||
| 1661 | Ga0068855_100018831 | |||
| 1662 | Ga0068855_100095578 | |||
| 1663 | Ga0070664_100000973 | |||
| 1664 | Ga0070664_100112001 | |||
| 1665 | Ga0070664_100124567 | |||
| 1666 | Ga0070664_100126441 | |||
| 1667 | Ga0070664_100155637 | |||
| 1668 | Ga0070664_100171499 | |||
| 1669 | Ga0070664_100307618 | |||
| 1670 | Ga0070664_100311117 | |||
| 1671 | Ga0070664_100334521 | |||
| 1672 | Ga0068857_100001725 | |||
| 1673 | Ga0068857_100002282 | |||
| 1674 | Ga0068857_100134067 | |||
| 1675 | Ga0068857_100391336 | |||
| 1676 | Ga0068854_100008414 | |||
| 1677 | Ga0068854_100017017 | |||
| 1678 | Ga0068854_100026506 | |||
| 1679 | Ga0068854_100153246 | |||
| 1680 | Ga0068856_100002597 | |||
| 1681 | Ga0068856_100006444 | |||
| 1682 | Ga0068856_100123648 | |||
| 1683 | Ga0068856_100170868 | |||
| 1684 | Ga0068856_100220706 | |||
| 1685 | Ga0068856_100337961 | |||
| 1686 | Ga0068856_100395393 | |||
| 1687 | Ga0070702_100012214 | |||
| 1688 | Ga0070702_100022622 | |||
| 1689 | Ga0070702_100023822 | |||
| 1690 | Ga0070702_100047628 | |||
| 1691 | Ga0070702_100097801 | |||
| 1692 | Ga0068852_100003186 | |||
| 1693 | Ga0068852_100015271 | |||
| 1694 | Ga0068852_100034442 | |||
| 1695 | Ga0068852_100063194 | |||
| 1696 | Ga0068852_100164676 | |||
| 1697 | Ga0068852_100434768 | |||
| 1698 | Ga0068859_100002825 | |||
| 1699 | Ga0068859_100005044 | |||
| 1700 | Ga0068859_100094085 | |||
| 1701 | Ga0068859_100260494 | |||
| 1702 | Ga0068864_100003691 | |||
| 1703 | Ga0068864_100004392 | |||
| 1704 | Ga0068864_100039550 | |||
| 1705 | Ga0068864_100168540 | |||
| 1706 | Ga0068864_100279590 | |||
| 1707 | Ga0068866_10000294 | |||
| 1708 | Ga0068861_100003318 | |||
| 1709 | Ga0068861_100025608 | |||
| 1710 | Ga0068861_100146275 | |||
| 1711 | Ga0068851_10041359 | |||
| 1712 | Ga0068851_10047424 | |||
| 1713 | Ga0068870_10000048 | |||
| 1714 | Ga0068870_10000555 | |||
| 1715 | Ga0068870_10014085 | |||
| 1716 | Ga0068870_10107612 | |||
| 1717 | Ga0068863_100001975 | |||
| 1718 | Ga0068863_100023486 | |||
| 1719 | Ga0068863_100032997 | |||
| 1720 | Ga0068863_100070126 | |||
| 1721 | Ga0068863_100120391 | |||
| 1722 | Ga0068863_100144908 | |||
| 1723 | Ga0068863_100372628 | |||
| 1724 | Ga0068858_100003376 | |||
| 1725 | Ga0068858_100026265 | |||
| 1726 | Ga0068858_100090996 | |||
| 1727 | Ga0068858_100095411 | |||
| 1728 | Ga0068858_100230357 | |||
| 1729 | Ga0068860_100000933 | |||
| 1730 | Ga0068860_100021346 | |||
| 1731 | Ga0068860_100028676 | |||
| 1732 | Ga0068860_100063529 | |||
| 1733 | Ga0068860_100184584 | |||
| 1734 | Ga0068862_100002722 | |||
| 1735 | Ga0068862_100003011 | |||
| 1736 | Ga0068862_100056146 | |||
| 1737 | Ga0081455_10004363 | |||
| 1738 | Ga0081455_10008450 | |||
| 1739 | Ga0081455_10028599 | |||
| 1740 | Ga0081455_10083437 | |||
| 1741 | Ga0081455_10127627 | |||
| 1742 | Ga0081538_10001450 | |||
| 1743 | Ga0081540_1000413 | |||
| 1744 | Ga0081540_1035995 | |||
| 1745 | Ga0070717_10000425 | |||
| 1746 | Ga0075365_10006308 | |||
| 1747 | Ga0075365_10014812 | |||
| 1748 | Ga0075365_10120548 | |||
| 1749 | Ga0075368_10095769 | |||
| 1750 | Ga0075363_100220534 | |||
| 1751 | Ga0075364_10141796 | |||
| 1752 | Ga0070715_10000739 | |||
| 1753 | Ga0070715_10014909 | |||
| 1754 | Ga0070715_10053517 | |||
| 1755 | Ga0070716_100001906 | |||
| 1756 | Ga0070716_100128096 | |||
| 1757 | Ga0070712_100026897 | |||
| 1758 | Ga0070712_100037354 | |||
| 1759 | Ga0070712_100041503 | |||
| 1760 | Ga0075367_10006690 | |||
| 1761 | Ga0075427_10000239 | |||
| 1762 | Ga0097621_100000833 | |||
| 1763 | Ga0097621_100004811 | |||
| 1764 | Ga0097621_100010471 | |||
| 1765 | Ga0097621_100028375 | |||
| 1766 | Ga0097621_100037965 | |||
| 1767 | Ga0097621_100094813 | |||
| 1768 | Ga0068871_100015994 | |||
| 1769 | Ga0068871_100027741 | |||
| 1770 | Ga0068871_100097250 | |||
| 1771 | Ga0075428_100054688 | |||
| 1772 | Ga0075428_100060487 | |||
| 1773 | Ga0075428_100100973 | |||
| 1774 | Ga0075428_100101032 | |||
| 1775 | Ga0075428_100215306 | |||
| 1776 | Ga0075428_100509652 | |||
| 1777 | Ga0075430_100002831 | |||
| 1778 | Ga0075430_100045973 | |||
| 1779 | Ga0075430_100068729 | |||
| 1780 | Ga0075431_100000132 | |||
| 1781 | Ga0075431_100015471 | |||
| 1782 | Ga0075431_100035687 | |||
| 1783 | Ga0075431_100115025 | |||
| 1784 | Ga0075431_100238948 | |||
| 1785 | Ga0075431_100441237 | |||
| 1786 | Ga0075433_10002201 | |||
| 1787 | Ga0075433_10005076 | |||
| 1788 | Ga0075433_10051260 | |||
| 1789 | Ga0075433_10110922 | |||
| 1790 | Ga0075434_100002941 | |||
| 1791 | Ga0075434_100004401 | |||
| 1792 | Ga0075434_100026478 | |||
| 1793 | Ga0075434_100027637 | |||
| 1794 | Ga0075434_100044384 | |||
| 1795 | Ga0075434_100050708 | |||
| 1796 | Ga0075434_100053446 | |||
| 1797 | Ga0075434_100086641 | |||
| 1798 | Ga0075434_100127829 | |||
| 1799 | Ga0075434_100157576 | |||
| 1800 | Ga0075429_100002461 | |||
| 1801 | Ga0075429_100061162 | |||
| 1802 | Ga0075429_100109548 | |||
| 1803 | Ga0075429_100113010 | |||
| 1804 | Ga0075429_100237924 | |||
| 1805 | Ga0068865_100009219 | |||
| 1806 | Ga0068865_100014125 | |||
| 1807 | Ga0068865_100038489 | |||
| 1808 | Ga0068865_100064695 | |||
| 1809 | Ga0068865_100357772 | |||
| 1810 | Ga0075436_100154946 | |||
| 1811 | Ga0097620_100002825 | |||
| 1812 | Ga0097620_100005044 | |||
| 1813 | Ga0097620_100094083 | |||
| 1814 | Ga0097620_100260496 | |||
| 1815 | Ga0075435_100014230 | |||
| 1816 | Ga0075435_100036370 | |||
| 1817 | Ga0075435_100071058 | |||
| 1818 | Ga0075435_100097503 | |||
| 1819 | Ga0075435_100135975 | |||
| 1820 | Ga0075435_100170095 | |||
| 1821 | Ga0075435_100185871 | |||
| 1822 | Ga0075435_100333834 | |||
| 1823 | Ga0105251_10060310 | |||
| 1824 | Ga0105250_10016499 | |||
| 1825 | Ga0105240_10003696 | |||
| 1826 | Ga0105240_10054446 | |||
| 1827 | Ga0105240_10121756 | |||
| 1828 | Ga0105240_10295109 | |||
| 1829 | Ga0105240_10347654 | |||
| 1830 | Ga0105240_10470698 | |||
| 1831 | Ga0111539_10000933 | |||
| 1832 | Ga0111539_10002792 | |||
| 1833 | Ga0111539_10004846 | |||
| 1834 | Ga0111539_10020347 | |||
| 1835 | Ga0111539_10080968 | |||
| 1836 | Ga0111539_10253638 | |||
| 1837 | Ga0111539_10343015 | |||
| 1838 | Ga0111539_10594110 | |||
| 1839 | Ga0105245_10000370 | |||
| 1840 | Ga0105245_10051898 | |||
| 1841 | Ga0105245_10076963 | |||
| 1842 | Ga0105245_10105703 | |||
| 1843 | Ga0105245_10383175 | |||
| 1844 | Ga0105245_10638626 | |||
| 1845 | Ga0105247_10000941 | |||
| 1846 | Ga0105247_10032611 | |||
| 1847 | Ga0105247_10054178 | |||
| 1848 | Ga0105247_10124738 | |||
| 1849 | Ga0105247_10191132 | |||
| 1850 | Ga0105247_10203221 | |||
| 1851 | Ga0105247_10216652 | |||
| 1852 | Ga0105247_10257280 | |||
| 1853 | Ga0114129_10000280 | |||
| 1854 | Ga0114129_10001684 | |||
| 1855 | Ga0114129_10003178 | |||
| 1856 | Ga0114129_10005006 | |||
| 1857 | Ga0114129_10039645 | |||
| 1858 | Ga0114129_10044181 | |||
| 1859 | Ga0114129_10651977 | |||
| 1860 | Ga0105243_10003132 | |||
| 1861 | Ga0105243_10041794 | |||
| 1862 | Ga0105243_10042428 | |||
| 1863 | Ga0105243_10051976 | |||
| 1864 | Ga0105243_10112672 | |||
| 1865 | Ga0105243_10139323 | |||
| 1866 | Ga0105241_10003551 | |||
| 1867 | Ga0105241_10081736 | |||
| 1868 | Ga0105241_10239450 | |||
| 1869 | Ga0105241_10244204 | |||
| 1870 | Ga0105241_10259968 | |||
| 1871 | Ga0105242_10001245 | |||
| 1872 | Ga0105242_10035192 | |||
| 1873 | Ga0105242_10060537 | |||
| 1874 | Ga0105242_10084063 | |||
| 1875 | Ga0105242_10198287 | |||
| 1876 | Ga0105242_10257844 | |||
| 1877 | Ga0105248_10001324 | |||
| 1878 | Ga0105248_10005301 | |||
| 1879 | Ga0105248_10005481 | |||
| 1880 | Ga0105248_10053771 | |||
| 1881 | Ga0105248_10223547 | |||
| 1882 | Ga0105248_10396853 | |||
| 1883 | Ga0105248_10446949 | |||
| 1884 | Ga0105237_10032477 | |||
| 1885 | Ga0105237_10057636 | |||
| 1886 | Ga0105237_10069508 | |||
| 1887 | Ga0105237_10184271 | |||
| 1888 | Ga0105238_10040095 | |||
| 1889 | Ga0105238_10050719 | |||
| 1890 | Ga0105238_10099024 | |||
| 1891 | Ga0105238_10427661 | |||
| 1892 | Ga0105249_10002759 | |||
| 1893 | Ga0105249_10023209 | |||
| 1894 | Ga0105249_10196964 | |||
| 1895 | Ga0105249_10209557 | |||
| 1896 | Ga0105239_10091805 | |||
| 1897 | Ga0105239_10163498 | |||
| 1898 | Ga0105239_10295664 | |||
| 1899 | Ga0105239_10424323 | |||
| 1900 | Ga0105239_10503383 | |||
| 1901 | Ga0105246_10000510 | |||
| 1902 | Ga0105246_10028412 | |||
| 1903 | Ga0105246_10030976 | |||
| 1904 | Ga0105246_10060545 | |||
| 1905 | Ga0105246_10093394 | |||
| 1906 | Ga0105246_10187645 | |||
| 1907 | Ga0105246_10295276 | |||
| 1908 | Ga0157373_10007085 | |||
| 1909 | Ga0157373_10008396 | |||
| 1910 | Ga0157371_10008538 | |||
| 1911 | Ga0157371_10136722 | |||
| 1912 | Ga0157370_10008485 | |||
| 1913 | Ga0157370_10223385 | |||
| 1914 | Ga0157369_10195186 | |||
| 1915 | Ga0157374_10001994 | |||
| 1916 | Ga0157374_10017984 | |||
| 1917 | Ga0157374_10024070 | |||
| 1918 | Ga0157374_10025719 | |||
| 1919 | Ga0157374_10071030 | |||
| 1920 | Ga0157374_10213049 | |||
| 1921 | Ga0157374_10363961 | |||
| 1922 | Ga0157378_10006053 | |||
| 1923 | Ga0157378_10104314 | |||
| 1924 | Ga0157378_10111319 | |||
| 1925 | Ga0157378_10193990 | |||
| 1926 | Ga0163162_10008106 | |||
| 1927 | Ga0163162_10212728 | |||
| 1928 | Ga0163162_10297967 | |||
| 1929 | Ga0157372_10005559 | |||
| 1930 | Ga0157372_10010864 | |||
| 1931 | Ga0157372_10271211 | |||
| 1932 | Ga0157375_10003733 | |||
| 1933 | Ga0157375_10004143 | |||
| 1934 | Ga0157375_10156389 | |||
| 1935 | Ga0157375_10272680 | |||
| 1936 | Ga0163163_10004364 | |||
| 1937 | Ga0163163_10011627 | |||
| 1938 | Ga0163163_10016172 | |||
| 1939 | Ga0163163_10030715 | |||
| 1940 | Ga0163163_10035735 | |||
| 1941 | Ga0163163_10081094 | |||
| 1942 | Ga0163163_10223536 | |||
| 1943 | Ga0163163_10238937 | |||
| 1944 | Ga0157380_10001925 | |||
| 1945 | Ga0157380_10182811 | |||
| 1946 | Ga0157377_10000101 | |||
| 1947 | Ga0157377_10034073 | |||
| 1948 | Ga0157377_10060655 | |||
| 1949 | Ga0157379_10004422 | |||
| 1950 | Ga0157379_10015102 | |||
| 1951 | Ga0157379_10040063 | |||
| 1952 | Ga0157379_10103927 | |||
| 1953 | Ga0157379_10129808 | |||
| 1954 | Ga0157379_10227835 | |||
| 1955 | Ga0157379_10245194 | |||
| 1956 | Ga0157379_10325561 | |||
| 1957 | Ga0157376_10003977 | |||
| 1958 | Ga0157376_10019988 | |||
| 1959 | Ga0157376_10059403 | |||
| 1960 | Ga0157376_10355128 | |||
| 1961 | Ga0163161_10006193 | |||
| 1962 | Ga0163161_10023300 | |||
| 1963 | Ga0163161_10183238 | |||
| 1964 | Ga0163161_10458922 | |||
| 1965 | Ga0207666_1000044 | |||
| 1966 | Ga0207666_1000084 | |||
| 1967 | Ga0207673_1000183 | |||
| 1968 | Ga0207697_10000051 | |||
| 1969 | Ga0207697_10002615 | |||
| 1970 | Ga0207656_10064533 | |||
| 1971 | Ga0207653_10000964 | |||
| 1972 | Ga0207653_10001329 | |||
| 1973 | Ga0207682_10000635 | |||
| 1974 | Ga0207682_10000815 | |||
| 1975 | Ga0207692_10025329 | |||
| 1976 | Ga0207642_10004273 | |||
| 1977 | Ga0207642_10024909 | |||
| 1978 | Ga0207642_10084375 | |||
| 1979 | Ga0207710_10002302 | |||
| 1980 | Ga0207710_10002328 | |||
| 1981 | Ga0207710_10013441 | |||
| 1982 | Ga0207710_10047672 | |||
| 1983 | Ga0207710_10047879 | |||
| 1984 | Ga0207688_10000044 | |||
| 1985 | Ga0207688_10000197 | |||
| 1986 | Ga0207688_10000346 | |||
| 1987 | Ga0207688_10003234 | |||
| 1988 | Ga0207680_10002632 | |||
| 1989 | Ga0207680_10009774 | |||
| 1990 | Ga0207680_10024713 | |||
| 1991 | Ga0207680_10046995 | |||
| 1992 | Ga0207647_10002117 | |||
| 1993 | Ga0207647_10006669 | |||
| 1994 | Ga0207647_10017129 | |||
| 1995 | Ga0207647_10072136 | |||
| 1996 | Ga0207685_10002628 | |||
| 1997 | Ga0207685_10046112 | |||
| 1998 | Ga0207685_10058465 | |||
| 1999 | Ga0207699_10000760 | |||
| 2000 | Ga0207699_10037393 | |||
| 2001 | Ga0207699_10176167 | |||
| 2002 | Ga0207645_10000218 | |||
| 2003 | Ga0207645_10002258 | |||
| 2004 | Ga0207645_10007653 | |||
| 2005 | Ga0207645_10043351 | |||
| 2006 | Ga0207645_10096759 | |||
| 2007 | Ga0207643_10000400 | |||
| 2008 | Ga0207643_10000870 | |||
| 2009 | Ga0207643_10001076 | |||
| 2010 | Ga0207643_10005389 | |||
| 2011 | Ga0207705_10237662 | |||
| 2012 | Ga0207654_10004223 | |||
| 2013 | Ga0207654_10020598 | |||
| 2014 | Ga0207654_10058636 | |||
| 2015 | Ga0207654_10077921 | |||
| 2016 | Ga0207654_10180532 | |||
| 2017 | Ga0207654_10183667 | |||
| 2018 | Ga0207654_10191974 | |||
| 2019 | Ga0207707_10005047 | |||
| 2020 | Ga0207707_10006308 | |||
| 2021 | Ga0207707_10073600 | |||
| 2022 | Ga0207707_10419616 | |||
| 2023 | Ga0207695_10023341 | |||
| 2024 | Ga0207695_10072321 | |||
| 2025 | Ga0207695_10090219 | |||
| 2026 | Ga0207695_10275543 | |||
| 2027 | Ga0207695_10431288 | |||
| 2028 | Ga0207671_10038266 | |||
| 2029 | Ga0207671_10064215 | |||
| 2030 | Ga0207671_10224789 | |||
| 2031 | Ga0207693_10003582 | |||
| 2032 | Ga0207693_10010960 | |||
| 2033 | Ga0207693_10013445 | |||
| 2034 | Ga0207693_10013697 | |||
| 2035 | Ga0207693_10048449 | |||
| 2036 | Ga0207693_10064100 | |||
| 2037 | Ga0207693_10076592 | |||
| 2038 | Ga0207693_10088411 | |||
| 2039 | Ga0207693_10128732 | |||
| 2040 | Ga0207663_10019001 | |||
| 2041 | Ga0207663_10038225 | |||
| 2042 | Ga0207663_10041665 | |||
| 2043 | Ga0207663_10050950 | |||
| 2044 | Ga0207663_10083386 | |||
| 2045 | Ga0207663_10273245 | |||
| 2046 | Ga0207660_10000571 | |||
| 2047 | Ga0207660_10005879 | |||
| 2048 | Ga0207660_10028355 | |||
| 2049 | Ga0207660_10091758 | |||
| 2050 | Ga0207660_10438880 | |||
| 2051 | Ga0207662_10000100 | |||
| 2052 | Ga0207662_10000677 | |||
| 2053 | Ga0207662_10002523 | |||
| 2054 | Ga0207662_10008813 | |||
| 2055 | Ga0207662_10196108 | |||
| 2056 | Ga0207657_10002107 | |||
| 2057 | Ga0207657_10004436 | |||
| 2058 | Ga0207657_10038965 | |||
| 2059 | Ga0207657_10040555 | |||
| 2060 | Ga0207657_10042518 | |||
| 2061 | Ga0207657_10183166 | |||
| 2062 | Ga0207649_10000310 | |||
| 2063 | Ga0207649_10059114 | |||
| 2064 | Ga0207649_10354882 | |||
| 2065 | Ga0207652_10005950 | |||
| 2066 | Ga0207652_10017065 | |||
| 2067 | Ga0207652_10063415 | |||
| 2068 | Ga0207652_10065747 | |||
| 2069 | Ga0207652_10149260 | |||
| 2070 | Ga0207646_10058492 | |||
| 2071 | Ga0207646_10449813 | |||
| 2072 | Ga0207681_10000803 | |||
| 2073 | Ga0207681_10014449 | |||
| 2074 | Ga0207694_10050279 | |||
| 2075 | Ga0207694_10060883 | |||
| 2076 | Ga0207694_10373693 | |||
| 2077 | Ga0207650_10005586 | |||
| 2078 | Ga0207650_10022154 | |||
| 2079 | Ga0207650_10040740 | |||
| 2080 | Ga0207650_10042885 | |||
| 2081 | Ga0207650_10050106 | |||
| 2082 | Ga0207650_10110410 | |||
| 2083 | Ga0207650_10203227 | |||
| 2084 | Ga0207659_10000040 | |||
| 2085 | Ga0207659_10010644 | |||
| 2086 | Ga0207659_10278066 | |||
| 2087 | Ga0207687_10001077 | |||
| 2088 | Ga0207687_10038537 | |||
| 2089 | Ga0207687_10040562 | |||
| 2090 | Ga0207687_10051128 | |||
| 2091 | Ga0207687_10111076 | |||
| 2092 | Ga0207687_10231836 | |||
| 2093 | Ga0207700_10000797 | |||
| 2094 | Ga0207700_10007214 | |||
| 2095 | Ga0207700_10018216 | |||
| 2096 | Ga0207700_10211012 | |||
| 2097 | Ga0207664_10013394 | |||
| 2098 | Ga0207664_10076626 | |||
| 2099 | Ga0207664_10097727 | |||
| 2100 | Ga0207664_10144815 | |||
| 2101 | Ga0207664_10460634 | |||
| 2102 | Ga0207644_10020275 | |||
| 2103 | Ga0207644_10032566 | |||
| 2104 | Ga0207644_10054704 | |||
| 2105 | Ga0207644_10113443 | |||
| 2106 | Ga0207644_10164013 | |||
| 2107 | Ga0207690_10000277 | |||
| 2108 | Ga0207706_10003292 | |||
| 2109 | Ga0207706_10007125 | |||
| 2110 | Ga0207706_10048791 | |||
| 2111 | Ga0207706_10074280 | |||
| 2112 | Ga0207706_10095177 | |||
| 2113 | Ga0207706_10152305 | |||
| 2114 | Ga0207706_10155882 | |||
| 2115 | Ga0207686_10001074 | |||
| 2116 | Ga0207686_10007975 | |||
| 2117 | Ga0207686_10028342 | |||
| 2118 | Ga0207686_10064279 | |||
| 2119 | Ga0207686_10095353 | |||
| 2120 | Ga0207686_10110287 | |||
| 2121 | Ga0207686_10206335 | |||
| 2122 | Ga0207709_10003933 | |||
| 2123 | Ga0207709_10020822 | |||
| 2124 | Ga0207709_10036589 | |||
| 2125 | Ga0207670_10000977 | |||
| 2126 | Ga0207670_10028475 | |||
| 2127 | Ga0207670_10224640 | |||
| 2128 | Ga0207669_10000347 | |||
| 2129 | Ga0207669_10046437 | |||
| 2130 | Ga0207669_10242318 | |||
| 2131 | Ga0207704_10000624 | |||
| 2132 | Ga0207704_10011417 | |||
| 2133 | Ga0207704_10050233 | |||
| 2134 | Ga0207704_10103788 | |||
| 2135 | Ga0207665_10002407 | |||
| 2136 | Ga0207665_10013442 | |||
| 2137 | Ga0207665_10040630 | |||
| 2138 | Ga0207691_10000940 | |||
| 2139 | Ga0207691_10002224 | |||
| 2140 | Ga0207691_10003147 | |||
| 2141 | Ga0207691_10027700 | |||
| 2142 | Ga0207691_10315431 | |||
| 2143 | Ga0207711_10003275 | |||
| 2144 | Ga0207711_10014033 | |||
| 2145 | Ga0207711_10016938 | |||
| 2146 | Ga0207711_10023511 | |||
| 2147 | Ga0207711_10094257 | |||
| 2148 | Ga0207711_10166756 | |||
| 2149 | Ga0207689_10000514 | |||
| 2150 | Ga0207689_10002387 | |||
| 2151 | Ga0207689_10012049 | |||
| 2152 | Ga0207689_10047365 | |||
| 2153 | Ga0207689_10165614 | |||
| 2154 | Ga0207689_10254067 | |||
| 2155 | Ga0207661_10000191 | |||
| 2156 | Ga0207661_10089799 | |||
| 2157 | Ga0207679_10000099 | |||
| 2158 | Ga0207679_10001868 | |||
| 2159 | Ga0207679_10075118 | |||
| 2160 | Ga0207679_10203207 | |||
| 2161 | Ga0207679_10393891 | |||
| 2162 | Ga0207667_10014048 | |||
| 2163 | Ga0207667_10054765 | |||
| 2164 | Ga0207667_10060608 | |||
| 2165 | Ga0207667_10139859 | |||
| 2166 | Ga0207651_10000202 | |||
| 2167 | Ga0207651_10035179 | |||
| 2168 | Ga0207651_10050584 | |||
| 2169 | Ga0207651_10177174 | |||
| 2170 | Ga0207712_10001297 | |||
| 2171 | Ga0207712_10004060 | |||
| 2172 | Ga0207712_10038043 | |||
| 2173 | Ga0207712_10111375 | |||
| 2174 | Ga0207712_10310894 | |||
| 2175 | Ga0207668_10001518 | |||
| 2176 | Ga0207668_10003969 | |||
| 2177 | Ga0207668_10047240 | |||
| 2178 | Ga0207668_10060574 | |||
| 2179 | Ga0207668_10187902 | |||
| 2180 | Ga0207640_10000425 | |||
| 2181 | Ga0207640_10105205 | |||
| 2182 | Ga0207658_10003433 | |||
| 2183 | Ga0207658_10015942 | |||
| 2184 | Ga0207658_10217708 | |||
| 2185 | Ga0207658_10296336 | |||
| 2186 | Ga0207677_10000495 | |||
| 2187 | Ga0207677_10053257 | |||
| 2188 | Ga0207703_10003491 | |||
| 2189 | Ga0207703_10030257 | |||
| 2190 | Ga0207703_10036654 | |||
| 2191 | Ga0207703_10045294 | |||
| 2192 | Ga0207703_10050838 | |||
| 2193 | Ga0207703_10081190 | |||
| 2194 | Ga0207639_10043894 | |||
| 2195 | Ga0207639_10052294 | |||
| 2196 | Ga0207639_10081399 | |||
| 2197 | Ga0207678_10002254 | |||
| 2198 | Ga0207678_10005396 | |||
| 2199 | Ga0207678_10017170 | |||
| 2200 | Ga0207678_10038688 | |||
| 2201 | Ga0207678_10189769 | |||
| 2202 | Ga0207678_10233462 | |||
| 2203 | Ga0207708_10000602 | |||
| 2204 | Ga0207708_10000636 | |||
| 2205 | Ga0207708_10001067 | |||
| 2206 | Ga0207708_10002106 | |||
| 2207 | Ga0207702_10012003 | |||
| 2208 | Ga0207702_10032777 | |||
| 2209 | Ga0207702_10064691 | |||
| 2210 | Ga0207702_10098210 | |||
| 2211 | Ga0207702_10225900 | |||
| 2212 | Ga0207702_10230426 | |||
| 2213 | Ga0207641_10000246 | |||
| 2214 | Ga0207641_10017711 | |||
| 2215 | Ga0207641_10047921 | |||
| 2216 | Ga0207641_10066361 | |||
| 2217 | Ga0207641_10175259 | |||
| 2218 | Ga0207641_10349243 | |||
| 2219 | Ga0207641_10370072 | |||
| 2220 | Ga0207648_10000575 | |||
| 2221 | Ga0207648_10004636 | |||
| 2222 | Ga0207648_10007651 | |||
| 2223 | Ga0207648_10009899 | |||
| 2224 | Ga0207676_10002628 | |||
| 2225 | Ga0207676_10042856 | |||
| 2226 | Ga0207676_10139934 | |||
| 2227 | Ga0207676_10167958 | |||
| 2228 | Ga0207674_10002439 | |||
| 2229 | Ga0207674_10003170 | |||
| 2230 | Ga0207674_10163778 | |||
| 2231 | Ga0207675_100002589 | |||
| 2232 | Ga0207675_100002803 | |||
| 2233 | Ga0207675_100004434 | |||
| 2234 | Ga0207683_10002498 | |||
| 2235 | Ga0207683_10004946 | |||
| 2236 | Ga0207683_10016507 | |||
| 2237 | Ga0207683_10022331 | |||
| 2238 | Ga0207683_10083734 | |||
| 2239 | Ga0207683_10083994 | |||
| 2240 | Ga0207698_10004542 | |||
| 2241 | Ga0207698_10029601 | |||
| 2242 | Ga0207698_10072912 | |||
| 2243 | Ga0207698_10110705 | |||
| 2244 | Ga0209973_1008503 | |||
| 2245 | Ga0210002_1000370 | |||
| 2246 | Ga0210002_1017154 | |||
| 2247 | Ga0209966_1001412 | |||
| 2248 | Ga0209998_10000754 | |||
| 2249 | Ga0209998_10006767 | |||
| 2250 | Ga0209974_10000697 | |||
| 2251 | Ga0209974_10000776 | |||
| 2252 | Ga0209974_10021914 | |||
| 2253 | Ga0207428_10000114 | |||
| 2254 | Ga0207428_10000736 | |||
| 2255 | Ga0207428_10003035 | |||
| 2256 | Ga0207428_10022508 | |||
| 2257 | Ga0207428_10053222 | |||
| 2258 | Ga0207428_10170899 | |||
| 2259 | Ga0268266_10010491 | |||
| 2260 | Ga0268266_10011314 | |||
| 2261 | Ga0268266_10291610 | |||
| 2262 | Ga0268266_10310139 | |||
| 2263 | Ga0268265_10001326 | |||
| 2264 | Ga0268264_10001756 | |||
| 2265 | Ga0268264_10055713 | |||
| 2266 | Ga0268264_10075492 | |||
| 2267 | Ga0268264_10158476 | |||
| 2268 | Ga0268264_10258764 | |||
| 2269 | Ga0265316_10242379 | |||
| 2270 | Ga0265313_10106101 | |||
| 2271 | Ga0265314_10020384 | |||
| 2272 | Ga0373948_0006733 | |||
| 2273 | Ga0373948_0009864 | |||
| 2274 | Ga0373950_0011829 | |||
| 2275 | Ga0373950_0013207 | |||
| 2276 | Ga0373958_0018799 | |||
| 2277 | Ga0373959_0007572 | |||
| 2278 | Ga0373959_0016796 | |||
| 2279 | Ga0373959_0041169 | |||
| 2280 | Ga0373938_0001319 | |||
| 2281 | Ga0373938_0003528 | |||
| 2282 | Ga0373926_0057044 | |||
| 2283 | Ga0373929_0000610 | |||
| 2284 | Ga0373934_0003180 | |||
| 2285 | Ga0373944_0000935 | |||
| 2286 | Ga0373949_0004952 | |||
| 2287 | Ga0373949_0020344 | |||
| 2288 | Ga0373949_0023302 | |||
| 2289 | Ga0373951_0002481 | |||
| 2290 | Ga0373951_0031210 | |||
| 2291 | Ga0373951_0034107 | |||
| 2292 | Ga0373952_0002203 | |||
| 2293 | Ga0373952_0004061 | |||
| 2294 | Ga0373952_0004766 | |||
| 2295 | Ga0373952_0010320 | |||
| 2296 | Ga0373923_0002833 | |||
| 2297 | Ga0373932_0001277 | |||
| 2298 | Ga0373932_0002476 | |||
| 2299 | Ga0373932_0003953 | |||
| 2300 | Ga0373936_0015396 | |||
| 2301 | Ga0373936_0035356 | |||
| 2302 | Ga0373939_0000468 | |||
| 2303 | Ga0373939_0002068 | |||
| 2304 | Ga0373939_0007403 | |||
| 2305 | Ga0373939_0010870 | |||
| 2306 | Ga0373941_0002202 | |||
| 2307 | Ga0373941_0008826 | |||
| 2308 | Ga0373945_0026621 | |||
| 2309 | Ga0373945_0029517 | |||
| 2310 | Ga0373953_0001292 | |||
| 2311 | Ga0373953_0002191 | |||
| 2312 | Ga0373954_0003589 | |||
| 2313 | Ga0373954_0011165 | |||
| 2314 | Ga0373954_0158873 | |||
| 2315 | Ga0373956_0008912 | |||
| 2316 | Ga0373957_0009377 | |||
| 2317 | Ga0373957_0016179 | |||
| 2318 | Ga0373960_0000452 | |||
| 2319 | Ga0373943_0001197 | |||
| 2320 | Ga0373943_0011130 | |||
| 2321 | Ga0373946_0005850 | |||
| 2322 | Ga0373946_0010839 | |||
| 2323 | Ga0373946_0012003 | |||
| 2324 | Ga0373946_0015351 | |||
| 2325 | Ga0373946_0021449 | |||
| 2326 | Ga0373946_0029291 | |||
| 2327 | Ga0373955_0004054 | |||
| 2328 | Ga0373955_0024756 | |||
| 2329 | Ga0373955_0025589 | |||
| 2330 | Ga0373942_0007530 | |||
| 2331 | Ga0373961_0005726 | |||
| 2332 | Ga0373961_0008407 | |||
| 2333 | Ga0373962_0000361 | |||
| 2334 | Ga0373962_0001735 | |||
| 2335 | Ga0373962_0009557 | |||
| 2336 | Ga0373924_0001111 | |||
| 2337 | Ga0373924_0027816 | |||
| 2338 | Ga0373931_0002564 | |||
| 2339 | Ga0373931_0011637 | |||
| 2340 | Ga0373931_0060942 | |||
| 2341 | Ga0373931_0066208 | |||
| 2342 | Ga0373931_0118904 | |||
| 2343 | Ga0373935_0000031 | |||
| 2344 | Ga0373935_0025316 | |||
| 2345 | Ga0373935_0030558 | |||
| 2346 | Ga0373935_0073887 | |||
| 2347 | Ga0373927_0007930 | |||
| 2348 | Ga0373927_0011771 | |||
| 2349 | Ga0373927_0067477 | |||
| 2350 | Ga0373927_0083378 | |||
| 2351 | Ga0373927_0098526 | |||
| 2352 | Ga0373933_0005826 | |||
| 2353 | Ga0373933_0027473 | |||
| 2354 | Ga0373933_0028344 | |||
| 2355 | Ga0373933_0038755 | |||
| 2356 | Ga0373947_0000337 | |||
| 2357 | Ga0373947_0002335 | |||
| 2358 | Ga0373947_0018603 | |||
| 2359 | Ga0373947_0037682 | |||
| 2360 | Ga0373947_0112565 | |||
| 2361 | Ga0373937_0001998 | |||
| 2362 | Ga0373937_0003071 | |||
| 2363 | Ga0373937_0003498 | |||
| 2364 | Ga0373937_0077081 | |||
| 2365 | Ga0373925_0000047 | |||
| 2366 | Ga0373925_0005753 | |||
| 2367 | Ga0373925_0010508 | |||
| 2368 | Ga0373925_0017707 | |||
| 2369 | Ga0373925_0079176 | |||
| 2370 | Ga0373925_0093163 | |||
| 2371 | Ga0395900_0319016 | |||
| 2372 | Ga0395898_0060592 | |||
| 2373 | Ga0436361_0333066 | |||
| 2374 | Ga0439450_025453 | |||
| 2375 | Ga0439460_0028405 | |||
| 2376 | Ga0451576_0335448 | |||
| 2377 | Ga0495617_021029 | |||
| 2378 | Ga0495592_0000323 | |||
| 2379 | Ga0495592_0008480 | |||
| 2380 | Ga0495592_0090327 | |||
| 2381 | Ga0495603_0001898 | |||
| 2382 | Ga0495603_0012206 | |||
| 2383 | Ga0495603_0014063 | |||
| 2384 | Ga0495629_0000702 | |||
| 2385 | Ga0495629_0002648 | |||
| 2386 | Ga0495629_0004812 | |||
| 2387 | Ga0495629_0047533 | |||
| 2388 | Ga0495629_0257027 | |||
| 2389 | Ga0495638_0022247 | |||
| 2390 | Ga0495641_0045936 | |||
| 2391 | Ga0495641_0054933 | |||
| 2392 | Ga0495641_0063745 | |||
| 2393 | Ga0495651_0000168 | |||
| 2394 | Ga0495651_0003967 | |||
| 2395 | Ga0495651_0012590 | |||
| 2396 | Ga0495651_0034589 | |||
| 2397 | Ga0495651_0183700 | |||
| 2398 | Ga0495653_0000027 | |||
| 2399 | Ga0495653_0002433 | |||
| 2400 | Ga0495653_0008661 | |||
| 2401 | Ga0495653_0033947 | |||
| 2402 | Ga0495580_0136092 | |||
| 2403 | Ga0495580_0175582 | |||
| 2404 | Ga0495582_0000474 | |||
| 2405 | Ga0495582_0002635 | |||
| 2406 | Ga0495582_0025361 | |||
| 2407 | Ga0495605_0039794 | |||
| 2408 | Ga0495639_0004100 | |||
| 2409 | Ga0495639_0028580 | |||
| 2410 | Ga0495662_0001316 | |||
| 2411 | Ga0495662_0016190 | |||
| 2412 | Ga0495662_0043342 | |||
| 2413 | Ga0495662_0057181 | |||
| 2414 | Ga0495662_0058970 | |||
| 2415 | Ga0495662_0128917 | |||
| 2416 | Ga0495664_0000021 | |||
| 2417 | Ga0495664_0000711 | |||
| 2418 | Ga0495664_0000935 | |||
| 2419 | Ga0495664_0003490 | |||
| 2420 | Ga0495664_0027844 | |||
| 2421 | Ga0495664_0049247 | |||
| 2422 | Ga0495584_0015280 | |||
| 2423 | Ga0495584_0056389 | |||
| 2424 | Ga0495584_0155704 | |||
| 2425 | Ga0495585_0016608 | |||
| 2426 | Ga0495585_0018040 | |||
| 2427 | Ga0495585_0060278 | |||
| 2428 | Ga0495585_0129065 | |||
| 2429 | Ga0495594_0016308 | |||
| 2430 | Ga0495594_0054286 | |||
| 2431 | Ga0495594_0094064 | |||
| 2432 | Ga0495594_0173263 | |||
| 2433 | Ga0495607_0168045 | |||
| 2434 | Ga0495608_0000020 | |||
| 2435 | Ga0495608_0006100 | |||
| 2436 | Ga0495608_0013077 | |||
| 2437 | Ga0495608_0034751 | |||
| 2438 | Ga0495608_0067176 | |||
| 2439 | Ga0495618_0000117 | |||
| 2440 | Ga0495618_0006438 | |||
| 2441 | Ga0495618_0048829 | |||
| 2442 | Ga0495618_0121698 | |||
| 2443 | Ga0495628_0000005 | |||
| 2444 | Ga0495628_0011629 | |||
| 2445 | Ga0495628_0015728 | |||
| 2446 | Ga0495628_0032685 | |||
| 2447 | Ga0495630_0016774 | |||
| 2448 | Ga0495630_0177353 | |||
| 2449 | Ga0495630_0199135 | |||
| 2450 | Ga0495630_0290822 | |||
| 2451 | Ga0495630_0380009 | |||
| 2452 | Ga0495637_0023766 | |||
| 2453 | Ga0495644_0026102 | |||
| 2454 | Ga0495644_0066531 | |||
| 2455 | Ga0495644_0089890 | |||
| 2456 | Ga0495666_0003661 | |||
| 2457 | Ga0495652_0000001 | |||
| 2458 | Ga0495652_0003397 | |||
| 2459 | Ga0495652_0013212 | |||
| 2460 | Ga0495652_0039522 | |||
| 2461 | Ga0495652_0065876 | |||
| 2462 | Ga0495652_0110539 | |||
| 2463 | Ga0495654_0067503 | |||
| 2464 | Ga0495640_0000035 | |||
| 2465 | Ga0495640_0007191 | |||
| 2466 | Ga0495640_0025502 | |||
| 2467 | Ga0495640_0088104 | |||
| 2468 | Ga0495640_0195327 | |||
| 2469 | Ga0495640_0264897 | |||
| 2470 | Ga0495586_0023861 | |||
| 2471 | Ga0495587_0000017 | |||
| 2472 | Ga0495587_0001485 | |||
| 2473 | Ga0495587_0007045 | |||
| 2474 | Ga0495587_0027867 | |||
| 2475 | Ga0495645_0000014 | |||
| 2476 | Ga0495645_0001772 | |||
| 2477 | Ga0495645_0005456 | |||
| 2478 | Ga0495645_0006715 | |||
| 2479 | Ga0495622_0122301 | |||
| 2480 | Ga0495633_0014822 | |||
| 2481 | Ga0495667_0000031 | |||
| 2482 | Ga0495667_0000946 | |||
| 2483 | Ga0495667_0001192 | |||
| 2484 | Ga0495667_0028745 | |||
| 2485 | Ga0495656_0000732 | |||
| 2486 | Ga0495656_0022605 | |||
| 2487 | Ga0495656_0032351 | |||
| 2488 | Ga0495656_0114226 | |||
| 2489 | Ga0495634_0000006 | |||
| 2490 | Ga0495634_0081048 | |||
| 2491 | Ga0495611_0004409 | |||
| 2492 | Ga0495611_0138392 | |||
| 2493 | Ga0495635_0000030 | |||
| 2494 | Ga0495635_0005492 | |||
| 2495 | Ga0495635_0065331 | |||
| 2496 | Ga0495659_0003385 | |||
| 2497 | Ga0495588_0017873 | |||
| 2498 | Ga0495588_0082164 | |||
| 2499 | Ga0495588_0087559 | |||
| 2500 | Ga0495588_0096485 | |||
| 2501 | Ga0495657_0001166 | |||
| 2502 | Ga0495657_0009684 | |||
| 2503 | Ga0495657_0010489 | |||
| 2504 | Ga0495657_0014123 | |||
| 2505 | Ga0495599_0000002 | |||
| 2506 | Ga0495599_0004625 | |||
| 2507 | Ga0495599_0046992 | |||
| 2508 | Ga0495599_0061804 | |||
| 2509 | Ga0495599_0134932 | |||
| 2510 | Ga0495623_0000035 | |||
| 2511 | Ga0495623_0007498 | |||
| 2512 | Ga0495623_0009450 | |||
| 2513 | Ga0495646_0000018 | |||
| 2514 | Ga0495646_0000846 | |||
| 2515 | Ga0495646_0008509 | |||
| 2516 | Ga0495646_0020336 | |||
| 2517 | Ga0495647_0003820 | |||
| 2518 | Ga0495647_0019115 | |||
| 2519 | Ga0495647_0040526 | |||
| 2520 | Ga0495647_0162747 | |||
| 2521 | Ga0495658_0000168 | |||
| 2522 | Ga0495658_0000231 | |||
| 2523 | Ga0495658_0003159 | |||
| 2524 | Ga0495658_0014023 | |||
| 2525 | Ga0495613_0013624 | |||
| 2526 | Ga0495613_0042797 | |||
| 2527 | Ga0495613_0046388 | |||
| 2528 | Ga0495613_0150435 | |||
| 2529 | Ga0495613_0233938 | |||
| 2530 | Ga0495624_0046464 | |||
| 2531 | Ga0495624_0170606 | |||
| 2532 | Ga0495670_0000601 | |||
| 2533 | Ga0495670_0047763 | |||
| 2534 | Ga0495671_0066171 | |||
| 2535 | Ga0495589_0162166 | |||
| 2536 | Ga0495600_0000048 | |||
| 2537 | Ga0495600_0003843 | |||
| 2538 | Ga0495600_0006717 | |||
| 2539 | Ga0495600_0012550 | |||
| 2540 | Ga0495600_0222770 | |||
| 2541 | Ga0495581_0034318 | |||
| 2542 | Ga0495581_0069521 | |||
| 2543 | Ga0495581_0101634 | |||
| 2544 | Ga0495604_0000007 | |||
| 2545 | Ga0495604_0002660 | |||
| 2546 | Ga0495604_0004228 | |||
| 2547 | Ga0495604_0005155 | |||
| 2548 | Ga0495604_0041610 | |||
| 2549 | Ga0495636_0033684 | |||
| 2550 | Ga0495674_0000001 | |||
| 2551 | Ga0495674_0014368 | |||
| 2552 | Ga0495674_0020533 | |||
| 2553 | Ga0495674_0028883 | |||
| 2554 | Ga0495674_0137046 | |||
| 2555 | Ga0495674_0203553 | |||
| 2556 | Ga0495674_0238525 | |||
| 2557 | Ga0495676_0021831 | |||
| 2558 | Ga0495676_0031573 | |||
| 2559 | Ga0495676_0074030 | |||
| 2560 | Ga0495676_0154727 | |||
| 2561 | Ga0495680_0000308 | |||
| 2562 | Ga0495680_0019585 | |||
| 2563 | Ga0495680_0025167 | |||
| 2564 | Ga0495680_0029834 | |||
| 2565 | Ga0495680_0035461 | |||
| 2566 | Ga0495680_0054148 | |||
| 2567 | Ga0495680_0116059 | |||
| 2568 | Ga0495675_0000042 | |||
| 2569 | Ga0495675_0000984 | |||
| 2570 | Ga0495675_0003357 | |||
| 2571 | Ga0495679_049097 | |||
| 2572 | Ga0495684_0000009 | |||
| 2573 | Ga0495684_0002180 | |||
| 2574 | Ga0495684_0076836 | |||
| 2575 | Ga0495684_0113637 | |||
| 2576 | Ga0495684_0131576 | |||
| 2577 | Ga0495593_0000445 | |||
| 2578 | Ga0495593_0001477 | |||
| 2579 | Ga0495593_0012315 | |||
| 2580 | Ga0495593_0105960 | |||
| 2581 | Ga0495602_0000004 | |||
| 2582 | Ga0495602_0000726 | |||
| 2583 | Ga0495602_0003678 | |||
| 2584 | Ga0495602_0004917 | |||
| 2585 | Ga0495602_0166674 | |||
| 2586 | Ga0495614_0030980 | |||
| 2587 | Ga0495626_0084077 | |||
| 2588 | Ga0496100_0000599 | |||
| 2589 | Ga0496100_0003283 | |||
| 2590 | Ga0496100_0005815 | |||
| 2591 | Ga0496100_0008105 | |||
| 2592 | Ga0496100_0026697 | |||
| 2593 | Ga0496100_0061669 | |||
| 2594 | Ga0496100_0062049 | |||
| 2595 | Ga0496100_0144982 | |||
| 2596 | Ga0496100_0212672 | |||
| 2597 | Ga0496100_0401854 | |||
| 2598 | Ga0496101_0000494 | |||
| 2599 | Ga0496101_0002343 | |||
| 2600 | Ga0496101_0013487 | |||
| 2601 | Ga0496101_0037429 | |||
| 2602 | Ga0496101_0095690 | |||
| 2603 | Ga0496101_0104848 | |||
| 2604 | Ga0496101_0107685 | |||
| 2605 | Ga0496101_0185310 | |||
| 2606 | Ga0496102_0002665 | |||
| 2607 | Ga0496102_0005771 | |||
| 2608 | Ga0496102_0014709 | |||
| 2609 | Ga0496102_0026451 | |||
| 2610 | Ga0496102_0027089 | |||
| 2611 | Ga0496102_0046269 | |||
| 2612 | Ga0496102_0071116 | |||
| 2613 | Ga0496102_0074250 | |||
| 2614 | Ga0496102_0103298 | |||
| 2615 | Ga0496102_0125803 | |||
| 2616 | Ga0496102_0356341 | |||
| 2617 | Ga0496102_0457216 | |||
| 2618 | Ga0496103_0006275 | |||
| 2619 | Ga0496103_0009094 | |||
| 2620 | Ga0496103_0009658 | |||
| 2621 | Ga0496103_0021457 | |||
| 2622 | Ga0496103_0166655 | |||
| 2623 | Ga0496103_0241784 | |||
| 2624 | Ga0496103_0254724 | |||
| 2625 | Ga0496104_0000618 | |||
| 2626 | Ga0496104_0005842 | |||
| 2627 | Ga0496104_0006701 | |||
| 2628 | Ga0496104_0007286 | |||
| 2629 | Ga0496104_0010629 | |||
| 2630 | Ga0496104_0017209 | |||
| 2631 | Ga0496104_0018794 | |||
| 2632 | Ga0496104_0021878 | |||
| 2633 | Ga0496104_0075236 | |||
| 2634 | Ga0496104_0175385 | |||
| 2635 | Ga0496104_0199614 | |||
| 2636 | Ga0496104_0335214 | |||
| 2637 | Ga0496104_0359845 | |||
| 2638 | Ga0496105_0001329 | |||
| 2639 | Ga0496105_0001514 | |||
| 2640 | Ga0496105_0012808 | |||
| 2641 | Ga0496105_0041920 | |||
| 2642 | Ga0496105_0054824 | |||
| 2643 | Ga0496105_0057469 | |||
| 2644 | Ga0496105_0068472 | |||
| 2645 | Ga0496105_0083459 | |||
| 2646 | Ga0496105_0084080 | |||
| 2647 | Ga0496105_0085055 | |||
| 2648 | Ga0496105_0085063 | |||
| 2649 | Ga0496105_0098135 | |||
| 2650 | Ga0496106_0002551 | |||
| 2651 | Ga0496106_0006010 | |||
| 2652 | Ga0496106_0016780 | |||
| 2653 | Ga0496106_0022101 | |||
| 2654 | Ga0496106_0028569 | |||
| 2655 | Ga0496106_0049401 | |||
| 2656 | Ga0496106_0050141 | |||
| 2657 | Ga0496106_0058443 | |||
| 2658 | Ga0496106_0110102 | |||
| 2659 | Ga0496106_0172970 | |||
| 2660 | Ga0496106_0255857 | |||
| 2661 | Ga0496107_0001078 | |||
| 2662 | Ga0496107_0005515 | |||
| 2663 | Ga0496107_0021706 | |||
| 2664 | Ga0496107_0022948 | |||
| 2665 | Ga0496107_0026904 | |||
| 2666 | Ga0496107_0031123 | |||
| 2667 | Ga0496107_0041649 | |||
| 2668 | Ga0496107_0073940 | |||
| 2669 | Ga0496107_0100771 | |||
| 2670 | Ga0496107_0155953 | |||
| 2671 | Ga0496107_0165529 | |||
| 2672 | Ga0496107_0177324 | |||
| 2673 | Ga0496108_0000544 | |||
| 2674 | Ga0496108_0000598 | |||
| 2675 | Ga0496108_0027147 | |||
| 2676 | Ga0496108_0032337 | |||
| 2677 | Ga0496108_0060277 | |||
| 2678 | Ga0496108_0063838 | |||
| 2679 | Ga0496108_0066773 | |||
| 2680 | Ga0496108_0068441 | |||
| 2681 | Ga0496108_0109944 | |||
| 2682 | Ga0496108_0189298 | |||
| 2683 | Ga0496108_0226093 | |||
| 2684 | Ga0496108_0236888 | |||
| 2685 | Ga0496109_0000150 | |||
| 2686 | Ga0496109_0003416 | |||
| 2687 | Ga0496109_0006280 | |||
| 2688 | Ga0496109_0006399 | |||
| 2689 | Ga0496109_0066010 | |||
| 2690 | Ga0496109_0069270 | |||
| 2691 | Ga0496109_0081926 | |||
| 2692 | Ga0496109_0116423 | |||
| 2693 | Ga0496109_0167301 | |||
| 2694 | Ga0496109_0174999 | |||
| 2695 | Ga0496109_0206190 | |||
| 2696 | Ga0496110_0001581 | |||
| 2697 | Ga0496110_0009968 | |||
| 2698 | Ga0496110_0028016 | |||
| 2699 | Ga0496110_0064235 | |||
| 2700 | Ga0496110_0085429 | |||
| 2701 | Ga0496110_0151650 | |||
| 2702 | Ga0496110_0210835 | |||
| 2703 | Ga0496110_0236479 | |||
| 2704 | Ga0496110_0338151 | |||
| 2705 | Ga0496110_0366927 | |||
| 2706 | Ga0496110_0373892 | |||
| 2707 | Ga0496110_0396880 | |||
| 2708 | Ga0496111_0002315 | |||
| 2709 | Ga0496111_0021159 | |||
| 2710 | Ga0496111_0025046 | |||
| 2711 | Ga0496111_0049774 | |||
| 2712 | Ga0496111_0073266 | |||
| 2713 | Ga0496111_0183135 | |||
| 2714 | Ga0496111_0197599 | |||
| 2715 | Ga0496111_0253789 | |||
| 2716 | Ga0496111_0302870 | |||
| 2717 | Ga0496111_0358903 | |||
| 2718 | Ga0496112_0000515 | |||
| 2719 | Ga0496112_0001706 | |||
| 2720 | Ga0496112_0003199 | |||
| 2721 | Ga0496112_0036954 | |||
| 2722 | Ga0496112_0050373 | |||
| 2723 | Ga0496112_0071356 | |||
| 2724 | Ga0496112_0120239 | |||
| 2725 | Ga0496112_0431203 | |||
| 2726 | Ga0496112_0500538 | |||
| 2727 | Ga0496113_0000577 | |||
| 2728 | Ga0496113_0001438 | |||
| 2729 | Ga0496113_0003250 | |||
| 2730 | Ga0496113_0009913 | |||
| 2731 | Ga0496113_0022684 | |||
| 2732 | Ga0496113_0063905 | |||
| 2733 | Ga0496113_0085636 | |||
| 2734 | Ga0496113_0085659 | |||
| 2735 | Ga0496113_0105549 | |||
| 2736 | Ga0496113_0167236 | |||
| 2737 | Ga0496113_0242507 | |||
| 2738 | Ga0496113_0279346 | |||
| 2739 | Ga0496114_0003461 | |||
| 2740 | Ga0496114_0010616 | |||
| 2741 | Ga0496114_0012460 | |||
| 2742 | Ga0496114_0025198 | |||
| 2743 | Ga0496114_0026844 | |||
| 2744 | Ga0496114_0046341 | |||
| 2745 | Ga0496114_0064502 | |||
| 2746 | Ga0496114_0072370 | |||
| 2747 | Ga0496114_0089487 | |||
| 2748 | Ga0496114_0253877 | |||
| 2749 | Ga0496115_0024212 | |||
| 2750 | Ga0496115_0025295 | |||
| 2751 | Ga0496115_0033491 | |||
| 2752 | Ga0496115_0035592 | |||
| 2753 | Ga0496115_0046670 | |||
| 2754 | Ga0496115_0075254 | |||
| 2755 | Ga0496115_0107490 | |||
| 2756 | Ga0496115_0120646 | |||
| 2757 | Ga0496115_0128066 | |||
| 2758 | Ga0496115_0138828 | |||
| 2759 | Ga0501032_0151203 | |||
| 2760 | Ga0501034_0052553 | |||
| 2761 | Ga0501034_0393036 | |||
| 2762 | Ga0501036_0340069 | |||
| 2763 | Ga0501038_0070854 | |||
| 2764 | Ga0501038_0271706 | |||
| 2765 | Ga0501038_0299769 | |||
| 2766 | Ga0501039_0221986 | |||
| 2767 | Ga0501039_0382003 | |||
| 2768 | Ga0501070_0311084 | |||
| 2769 | Ga0501070_0358284 | |||
| 2770 | Ga0501076_0244189 | |||
| 2771 | Ga0501076_0376161 | |||
| 2772 | Ga0501080_0432932 | |||
| 2773 | Ga0501035_0005615 | |||
| 2774 | Ga0501035_0207879 | |||
| 2775 | Ga0501044_0222297 | |||
| 2776 | nmdc:mga03683_49041_c1 | |||
| 2777 | nmdc:mga03n38_104006_c1 | |||
| 2778 | nmdc:mga0yw44_135_c1 | |||
| 2779 | nmdc:mga0yw44_201881_c1 | |||
| 2780 | nmdc:mga0yw44_2239_c1 | |||
| 2781 | nmdc:mga0yw44_37082_c1 | |||
| 2782 | nmdc:mga0yw44_4842_c1 | |||
| 2783 | nmdc:mga0yw44_72845_c1 | |||
| 2784 | nmdc:mga06z11_10880_c1 | |||
| 2785 | nmdc:mga05p37_211446_c1 | |||
| 2786 | nmdc:mga05p37_223_c1 | |||
| 2787 | nmdc:mga05p37_22429_c1 | |||
| 2788 | nmdc:mga05p37_249786_c1 | |||
| 2789 | nmdc:mga05p37_304502_c1 | |||
| 2790 | nmdc:mga05p37_30735_c1 | |||
| 2791 | nmdc:mga05p37_504119_c1 | |||
| 2792 | nmdc:mga05p37_56_c3 | |||
| 2793 | nmdc:mga09592_1434_c1 | |||
| 2794 | nmdc:mga09592_47744_c1 | |||
| 2795 | nmdc:mga09592_70675_c1 | |||
| 2796 | nmdc:mga09592_75131_c1 | |||
| 2797 | nmdc:mga0qj67_103172_c1 | |||
| 2798 | nmdc:mga0qj67_26868_c1 | |||
| 2799 | nmdc:mga0qj67_29779_c1 | |||
| 2800 | nmdc:mga0qj67_39546_c1 | |||
| 2801 | nmdc:mga06r32_155489_c1 | |||
| 2802 | nmdc:mga06r32_186_c1 | |||
| 2803 | nmdc:mga06r32_43726_c1 | |||
| 2804 | nmdc:mga06r32_806_c1 | |||
| 2805 | nmdc:mga08y16_1035_c1 | |||
| 2806 | nmdc:mga08y16_176415_c1 | |||
| 2807 | nmdc:mga08y16_206_c1 | |||
| 2808 | nmdc:mga08y16_3000_c1 | |||
| 2809 | nmdc:mga08y16_363748_c1 | |||
| 2810 | nmdc:mga08y16_412252_c1 | |||
| 2811 | nmdc:mga08y16_89854_c1 | |||
| 2812 | nmdc:mga0n895_11211_c1 | |||
| 2813 | nmdc:mga0n895_22286_c1 | |||
| 2814 | nmdc:mga0n895_2402_c1 | |||
| 2815 | nmdc:mga0n895_30334_c1 | |||
| 2816 | nmdc:mga0n895_34308_c1 | |||
| 2817 | nmdc:mga0n895_36077_c1 | |||
| 2818 | nmdc:mga0n895_65248_c1 | |||
| 2819 | nmdc:mga0n895_71650_c1 | |||
| 2820 | nmdc:mga0n895_85077_c1 | |||
| 2821 | nmdc:mga0rr50_120507_c1 | |||
| 2822 | nmdc:mga0rr50_123644_c1 | |||
| 2823 | nmdc:mga0rr50_15932_c1 | |||
| 2824 | nmdc:mga0rr50_17917_c1 | |||
| 2825 | nmdc:mga0rr50_202887_c1 | |||
| 2826 | nmdc:mga0rr50_26806_c1 | |||
| 2827 | nmdc:mga0rr50_59473_c1 | |||
| 2828 | nmdc:mga08x19_201298_c1 | |||
| 2829 | nmdc:mga08x19_59979_c1 | |||
| 2830 | nmdc:mga0a205_13046_c1 | |||
| 2831 | nmdc:mga0a205_16008_c1 | |||
| 2832 | nmdc:mga0a205_1905_c1 | |||
| 2833 | nmdc:mga0a205_80_c1 | |||
| 2834 | Ga0495601_0000020 | |||
| 2835 | Ga0495601_0000102 | |||
| 2836 | Ga0495601_0000232 | |||
| 2837 | Ga0495601_0005229 | |||
| 2838 | Ga0495601_0006091 | |||
| 2839 | Ga0495601_0014874 | |||
| 2840 | Ga0495601_0048049 | |||
| 2841 | Ga0495612_0000020 | |||
| 2842 | Ga0495612_0001651 | |||
| 2843 | Ga0495612_0006808 | |||
| 2844 | Ga0495612_0006943 | |||
| 2845 | Ga0495612_0013576 | |||
| 2846 | Ga0495612_0023473 | |||
| 2847 | Ga0495655_0001142 | |||
| 2848 | Ga0495655_0006026 | |||
| 2849 | Ga0495655_0017111 | |||
| 2850 | Ga0495595_0000047 | |||
| 2851 | Ga0495595_0000284 | |||
| 2852 | Ga0495595_0001961 | |||
| 2853 | Ga0495595_0004403 | |||
| 2854 | Ga0495595_0032080 | |||
| 2855 | Ga0495595_0034012 | |||
| 2856 | Ga0495619_0000011 | |||
| 2857 | Ga0495619_0000092 | |||
| 2858 | Ga0495619_0000145 | |||
| 2859 | Ga0495619_0000341 | |||
| 2860 | Ga0495619_0001312 | |||
| 2861 | Ga0495619_0004545 | |||
| 2862 | Ga0495619_0005415 | |||
| 2863 | Ga0495619_0016154 | |||
| 2864 | Ga0495619_0026304 | |||
| 2865 | Ga0495619_0045010 | |||
| 2866 | Ga0500643_001354 | |||
| 2867 | Ga0500593_002357 | |||
| 2868 | Ga0500595_000029 | |||
| 2869 | Ga0500595_017223 | |||
| 2870 | Ga0500652_000086 | |||
| 2871 | Ga0500636_0023610 | |||
| 2872 | Ga0501084_0203268 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2x26-assembly2.cif.gz_B | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.8094 | 84 | 372 |
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.8015 | 85 | 375 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.7965 | 83 | 374 |
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.7864 | 85 | 375 |
| 2x26-assembly2.cif.gz_B | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.7846 | 84 | 372 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8206 | 171 | 259 | 3.40.190.10 |
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8065 | 168 | 265 | 3.40.190.10 |
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7858 | 168 | 265 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7819 | 171 | 258 | 3.40.190.10 |
| 4kqpA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.766 | 170 | 260 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521YL89-F1-model_v4 | ABC transporter substrate-binding protein | 0.9408 | 76 | 377 |
|
| AF-A0A561QAR1-F1-model_v4 | NitT/TauT family transport system substrate-binding protein | 0.9381 | 76 | 377 |
GO:0042918
|
| AF-A0A537N981-F1-model_v4 | ABC transporter substrate-binding protein | 0.9372 | 76 | 377 |
|
| AF-A0A537N981-F1-model_v4 | ABC transporter substrate-binding protein | 0.9196 | 76 | 377 |
|
| AF-A0A1Q7BRX8-F1-model_v4 | SsuA/THI5-like domain-containing protein | 0.9176 | 76 | 377 |
|