F494101

General Info

Members Datasets Scaffolds Average Seq Length
1458 379 2872 322

Family's Representative Sequence

Representative Sequence 3300001977|JGI24746J21847_1000713|JGI24746J21847_10007134
Length 377
Sequence LCIVAIETSELEGGPRVTDDVRFGLEADMGILAREQGALYLQATLREGEDHEGPYIHARRLRGSLRGYFLAVSAGFAAPAGAQDTIKVAVGQIDAWANQVPTLGMKAGIFQKHGIVLDNYGTQGAGETLQAVISGSADIGIGVGTPGAMRAYAKGAPVRVLAAAYTGVQDIYWFVPASSPITSVKDISDRHTIAYSTNGSTSDSVLRALIAHYGLKAKPAQTGGPPGTFTMTMSGQIDIGWSVAPFGLKELQAKSIRVLMRGSDLPSMRNQTVRVEIVNANALKDRHDVMVRFMRAYRETLDWMYSNPLAVKYYSEHMRMPESLVELQRDEFNPKSAMNPDKLSDVDLVMQDAVAGKFLEMPLTKEQLAEFIQIPPR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
110 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
224 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
238 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
239 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
240 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
244 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
245 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
248 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
251 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
260 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
263 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
269 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
270 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
376 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 12.62
Rhizosphere 85.8
Stem 0
Stem Tuber 0
Unclassified 10.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000713 3300001977 Bacteria 5118
2 JGI24746J21847_1013634 3300001977 Unclassified 1180
3 JGI24739J22299_10002354 3300001989 Bacteria 7281
4 JGI24739J22299_10018214 3300001989 Bacteria 2527
5 JGI24737J22298_10000583 3300001990 Bacteria 12816
6 JGI24737J22298_10041560 3300001990 Bacteria 1410
7 JGI24750J21931_1000574 3300002070 Bacteria 5637
8 JGI24745J21846_1000334 3300002073 Bacteria 4076
9 JGI24745J21846_1008400 3300002073 Bacteria 1163
10 JGI24738J21930_10021266 3300002075 Bacteria 1346
11 JGI24744J21845_10000414 3300002077 Bacteria 7434
12 JGI24744J21845_10009162 3300002077 Bacteria 2032
13 JGI24744J21845_10013844 3300002077 Bacteria 1625
14 JGI24034J26672_10000259 3300002239 Bacteria 6955
15 JGI24034J26672_10000505 3300002239 Bacteria 5037
16 JGI24034J26672_10016114 3300002239 Bacteria 1149
17 JGI24742J22300_10000043 3300002244 Bacteria 18528
18 JGI25405J52794_10002442 3300003911 Bacteria 3200
19 Ga0065712_10070182 3300005290 Bacteria 6248
20 Ga0065715_10259753 3300005293 Bacteria 1141
21 Ga0070676_10021315 3300005328 Bacteria 3627
22 Ga0070676_10049580 3300005328 Bacteria 2458
23 Ga0070676_10078722 3300005328 Bacteria 1995
24 Ga0070676_10189854 3300005328 Bacteria 1341
25 Ga0070683_100000656 3300005329 Bacteria 25014
26 Ga0070683_100003103 3300005329 Bacteria 13382
27 Ga0070683_100074077 3300005329 Bacteria 3180
28 Ga0070683_100077908 3300005329 Bacteria 3100
29 Ga0070683_100103903 3300005329 Bacteria 2678
30 Ga0070683_100359163 3300005329 Unclassified 1387
31 Ga0070690_100001658 3300005330 Bacteria 11711
32 Ga0070690_100001831 3300005330 Bacteria 11268
33 Ga0070690_100032490 3300005330 Bacteria 3260
34 Ga0070690_100142366 3300005330 Bacteria 1629
35 Ga0070670_100002207 3300005331 Bacteria 15999
36 Ga0070670_100016346 3300005331 Bacteria 6372
37 Ga0070670_100067176 3300005331 Unclassified 3077
38 Ga0070670_100092366 3300005331 Bacteria 2602
39 Ga0070670_100108703 3300005331 Bacteria 2389
40 Ga0070670_100154184 3300005331 Bacteria 1989
41 Ga0070670_100274015 3300005331 Unclassified 1473
42 Ga0070677_10000076 3300005333 Bacteria 31338
43 Ga0070677_10006595 3300005333 Bacteria 3857
44 Ga0068869_100000216 3300005334 Bacteria 29999
45 Ga0068869_100003321 3300005334 Bacteria 9826
46 Ga0068869_100016912 3300005334 Bacteria 4929
47 Ga0068869_100020350 3300005334 Bacteria 4549
48 Ga0068869_100218176 3300005334 Bacteria 1511
49 Ga0068869_100277554 3300005334 Unclassified 1347
50 Ga0070666_10002180 3300005335 Bacteria 11899
51 Ga0070666_10017246 3300005335 Bacteria 4627
52 Ga0070666_10020081 3300005335 Bacteria 4316
53 Ga0070666_10050722 3300005335 Bacteria 2792
54 Ga0070666_10072560 3300005335 Bacteria 2344
55 Ga0070680_100002960 3300005336 Bacteria 12628
56 Ga0070680_100003735 3300005336 Bacteria 11374
57 Ga0070680_100019228 3300005336 Bacteria 5411
58 Ga0070682_100000285 3300005337 Bacteria 36134
59 Ga0070682_100011413 3300005337 Bacteria 5075
60 Ga0070682_100031677 3300005337 Bacteria 3199
61 Ga0070682_100049267 3300005337 Bacteria 2625
62 Ga0070682_100073428 3300005337 Bacteria 2194
63 Ga0070682_100122865 3300005337 Bacteria 1746
64 Ga0068868_100000474 3300005338 Bacteria 26674
65 Ga0068868_100089186 3300005338 Bacteria 2482
66 Ga0068868_100253399 3300005338 Unclassified 1482
67 Ga0070660_100000874 3300005339 Bacteria 20123
68 Ga0070660_100001332 3300005339 Bacteria 16783
69 Ga0070660_100049252 3300005339 Bacteria 3238
70 Ga0070689_100004112 3300005340 Bacteria 9801
71 Ga0070689_100011551 3300005340 Bacteria 6327
72 Ga0070689_100044257 3300005340 Bacteria 3424
73 Ga0070689_100406625 3300005340 Bacteria 1152
74 Ga0070691_10001440 3300005341 Bacteria 10178
75 Ga0070691_10023960 3300005341 Bacteria 2835
76 Ga0070691_10033534 3300005341 Bacteria 2416
77 Ga0070687_100005766 3300005343 Bacteria 5030
78 Ga0070661_100002370 3300005344 Bacteria 12928
79 Ga0070661_100023545 3300005344 Bacteria 4415
80 Ga0070661_100054477 3300005344 Plasmid 2929
81 Ga0070692_10000173 3300005345 Bacteria 16637
82 Ga0070692_10000841 3300005345 Bacteria 10313
83 Ga0070668_100002051 3300005347 Bacteria 14738
84 Ga0070668_100202879 3300005347 Bacteria 1628
85 Ga0070669_100001956 3300005353 Bacteria 14875
86 Ga0070669_100011387 3300005353 Bacteria 6316
87 Ga0070675_100000622 3300005354 Bacteria 24525
88 Ga0070675_100057314 3300005354 Bacteria 3211
89 Ga0070675_100068345 3300005354 Bacteria 2942
90 Ga0070675_100206227 3300005354 Unclassified 1707
91 Ga0070671_100001629 3300005355 Bacteria 16929
92 Ga0070671_100012131 3300005355 Bacteria 6935
93 Ga0070671_100018516 3300005355 Bacteria 5658
94 Ga0070671_100095238 3300005355 Bacteria 2495
95 Ga0070671_100132167 3300005355 Unclassified 2102
96 Ga0070671_100250920 3300005355 Bacteria 1503
97 Ga0070674_100027715 3300005356 Bacteria 3714
98 Ga0070674_100047491 3300005356 Bacteria 2942
99 Ga0070674_100105650 3300005356 Bacteria 2059
100 Ga0070674_100210530 3300005356 Bacteria 1506
101 Ga0070674_100233068 3300005356 Bacteria 1438
102 Ga0070673_100000418 3300005364 Bacteria 22446
103 Ga0070673_100000640 3300005364 Bacteria 19217
104 Ga0070673_100037488 3300005364 Bacteria 3694
105 Ga0070673_100070898 3300005364 Bacteria 2798
106 Ga0070673_100189629 3300005364 Unclassified 1765
107 Ga0070688_100000906 3300005365 Bacteria 14793
108 Ga0070688_100001260 3300005365 Bacteria 12627
109 Ga0070688_100008005 3300005365 Bacteria 5718
110 Ga0070688_100061411 3300005365 Bacteria 2376
111 Ga0070688_100132522 3300005365 Bacteria 1683
112 Ga0070659_100001362 3300005366 Bacteria 17597
113 Ga0070659_100003550 3300005366 Bacteria 11108
114 Ga0070659_100037636 3300005366 Bacteria 3772
115 Ga0070659_100062209 3300005366 Bacteria 2950
116 Ga0070659_100437291 3300005366 Bacteria 1108
117 Ga0070667_100001650 3300005367 Bacteria 19960
118 Ga0070667_100015334 3300005367 Bacteria 6334
119 Ga0070667_100035664 3300005367 Bacteria 4168
120 Ga0070667_100104193 3300005367 Bacteria 2453
121 Ga0070667_100188861 3300005367 Bacteria 1824
122 Ga0070667_100292313 3300005367 Bacteria 1466
123 Ga0070703_10003120 3300005406 Bacteria 4741
124 Ga0070709_10004958 3300005434 Bacteria 7194
125 Ga0070709_10007315 3300005434 Bacteria 6051
126 Ga0070709_10175311 3300005434 Bacteria 1502
127 Ga0070709_10338479 3300005434 Unclassified 1109
128 Ga0070714_100027432 3300005435 Bacteria 4717
129 Ga0070714_100033507 3300005435 Bacteria 4294
130 Ga0070714_100050626 3300005435 Bacteria 3539
131 Ga0070714_100069271 3300005435 Unclassified 3046
132 Ga0070714_100155094 3300005435 Bacteria 2066
133 Ga0070713_100000526 3300005436 Bacteria 24268
134 Ga0070713_100069032 3300005436 Bacteria 2979
135 Ga0070713_100073376 3300005436 Bacteria 2896
136 Ga0070713_100241283 3300005436 Bacteria 1646
137 Ga0070713_100293160 3300005436 Bacteria 1496
138 Ga0070710_10021860 3300005437 Bacteria 3339
139 Ga0070710_10024235 3300005437 Bacteria 3199
140 Ga0070701_10000264 3300005438 Bacteria 17077
141 Ga0070701_10015338 3300005438 Bacteria 3537
142 Ga0070701_10041566 3300005438 Bacteria 2344
143 Ga0070711_100017524 3300005439 Bacteria 4562
144 Ga0070711_100092561 3300005439 Unclassified 2182
145 Ga0070711_100103772 3300005439 Bacteria 2073
146 Ga0070705_100001279 3300005440 Bacteria 13562
147 Ga0070705_100067351 3300005440 Bacteria 2151
148 Ga0070705_100177813 3300005440 Bacteria 1438
149 Ga0070700_100004852 3300005441 Bacteria 7065
150 Ga0070700_100010848 3300005441 Bacteria 5037
151 Ga0070700_100030981 3300005441 Bacteria 3201
152 Ga0070700_100072767 3300005441 Bacteria 2198
153 Ga0070694_100000576 3300005444 Bacteria 20334
154 Ga0070694_100002530 3300005444 Bacteria 10796
155 Ga0070708_100150592 3300005445 Bacteria 2163
156 Ga0070663_100001039 3300005455 Bacteria 15172
157 Ga0070663_100014289 3300005455 Bacteria 5093
158 Ga0070663_100016904 3300005455 Bacteria 4748
159 Ga0070663_100110880 3300005455 Bacteria 2061
160 Ga0070663_100210250 3300005455 Bacteria 1523
161 Ga0070678_100008209 3300005456 Bacteria 6241
162 Ga0070678_100009636 3300005456 Bacteria 5865
163 Ga0070678_100036667 3300005456 Bacteria 3434
164 Ga0070678_100040359 3300005456 Bacteria 3302
165 Ga0070678_100107360 3300005456 Bacteria 2177
166 Ga0070662_100009914 3300005457 Bacteria 6241
167 Ga0070662_100064734 3300005457 Plasmid 2678
168 Ga0070662_100183385 3300005457 Unclassified 1651
169 Ga0070662_100237177 3300005457 Unclassified 1461
170 Ga0070681_10008583 3300005458 Bacteria 10012
171 Ga0070681_10008649 3300005458 Bacteria 9982
172 Ga0070681_10152054 3300005458 Bacteria 2241
173 Ga0070681_10236056 3300005458 Bacteria 1742
174 Ga0070681_10372367 3300005458 Bacteria 1339
175 Ga0070681_10465262 3300005458 Bacteria 1177
176 Ga0068867_100048243 3300005459 Bacteria 3132
177 Ga0070685_10000645 3300005466 Bacteria 19015
178 Ga0070685_10039257 3300005466 Bacteria 2688
179 Ga0070685_10043864 3300005466 Bacteria 2558
180 Ga0070685_10106134 3300005466 Bacteria 1723
181 Ga0070707_100117784 3300005468 Unclassified 2578
182 Ga0070699_100000676 3300005518 Bacteria 31923
183 Ga0070699_100077901 3300005518 Unclassified 2886
184 Ga0070699_100315526 3300005518 Bacteria 1404
185 Ga0070679_100021636 3300005530 Bacteria 6279
186 Ga0070679_100032292 3300005530 Bacteria 5177
187 Ga0070679_100070445 3300005530 Bacteria 3488
188 Ga0070679_100102817 3300005530 Bacteria 2843
189 Ga0070679_100589355 3300005530 Bacteria 1055
190 Ga0070684_100001969 3300005535 Bacteria 15093
191 Ga0070684_100002245 3300005535 Bacteria 14207
192 Ga0070684_100124386 3300005535 Unclassified 2322
193 Ga0070684_100133700 3300005535 Bacteria 2239
194 Ga0070684_100417922 3300005535 Unclassified 1237
195 Ga0070697_100070677 3300005536 Unclassified 2862
196 Ga0070697_100081262 3300005536 Bacteria 2670
197 Ga0068853_100005266 3300005539 Bacteria 10126
198 Ga0068853_100206837 3300005539 Bacteria 1788
199 Ga0068853_100246551 3300005539 Unclassified 1638
200 Ga0070672_100021363 3300005543 Bacteria 4734
201 Ga0070672_100079680 3300005543 Bacteria 2622
202 Ga0070672_100212707 3300005543 Unclassified 1620
203 Ga0070686_100001137 3300005544 Bacteria 15280
204 Ga0070686_100002237 3300005544 Bacteria 10673
205 Ga0070686_100003181 3300005544 Bacteria 8988
206 Ga0070686_100014107 3300005544 Bacteria 4595
207 Ga0070686_100064365 3300005544 Bacteria 2378
208 Ga0070695_100011111 3300005545 Bacteria 5381
209 Ga0070696_100007394 3300005546 Bacteria 7340
210 Ga0070696_100036204 3300005546 Bacteria 3402
211 Ga0070696_100158540 3300005546 Bacteria 1666
212 Ga0070696_100218345 3300005546 Unclassified 1430
213 Ga0070693_100001170 3300005547 Bacteria 11794
214 Ga0070693_100008690 3300005547 Bacteria 5025
215 Ga0070693_100012214 3300005547 Bacteria 4343
216 Ga0070693_100059626 3300005547 Bacteria 2212
217 Ga0070693_100087770 3300005547 Bacteria 1869
218 Ga0070665_100167945 3300005548 Bacteria 2196
219 Ga0070665_100200619 3300005548 Bacteria 1995
220 Ga0070665_100217209 3300005548 Unclassified 1913
221 Ga0070704_100000444 3300005549 Bacteria 19453
222 Ga0070704_100226163 3300005549 Unclassified 1524
223 Ga0068855_100004774 3300005563 Bacteria 16547
224 Ga0068855_100010841 3300005563 Bacteria 11004
225 Ga0068855_100018831 3300005563 Bacteria 8299
226 Ga0068855_100095578 3300005563 Bacteria 3425
227 Ga0070664_100000973 3300005564 Bacteria 22427
228 Ga0070664_100112001 3300005564 Bacteria 2383
229 Ga0070664_100124567 3300005564 Bacteria 2259
230 Ga0070664_100126441 3300005564 Bacteria 2243
231 Ga0070664_100155637 3300005564 Bacteria 2019
232 Ga0070664_100171499 3300005564 Unclassified 1925
233 Ga0070664_100307618 3300005564 Unclassified 1433
234 Ga0070664_100311117 3300005564 Bacteria 1425
235 Ga0070664_100334521 3300005564 Unclassified 1374
236 Ga0068857_100001725 3300005577 Bacteria 17581
237 Ga0068857_100002282 3300005577 Bacteria 15594
238 Ga0068857_100134067 3300005577 Bacteria 2236
239 Ga0068857_100391336 3300005577 Bacteria 1292
240 Ga0068854_100008414 3300005578 Bacteria 6631
241 Ga0068854_100017017 3300005578 Bacteria 4858
242 Ga0068854_100026506 3300005578 Bacteria 3984
243 Ga0068854_100153246 3300005578 Bacteria 1779
244 Ga0068856_100002597 3300005614 Bacteria 18595
245 Ga0068856_100006444 3300005614 Bacteria 11514
246 Ga0068856_100123648 3300005614 Bacteria 2590
247 Ga0068856_100170868 3300005614 Bacteria 2186
248 Ga0068856_100220706 3300005614 Unclassified 1911
249 Ga0068856_100337961 3300005614 Bacteria 1524
250 Ga0068856_100395393 3300005614 Unclassified 1402
251 Ga0070702_100012214 3300005615 Bacteria 4296
252 Ga0070702_100022622 3300005615 Bacteria 3327
253 Ga0070702_100023822 3300005615 Bacteria 3258
254 Ga0070702_100047628 3300005615 Unclassified 2436
255 Ga0070702_100097801 3300005615 Bacteria 1794
256 Ga0068852_100003186 3300005616 Bacteria 11456
257 Ga0068852_100015271 3300005616 Bacteria 5947
258 Ga0068852_100034442 3300005616 Bacteria 4213
259 Ga0068852_100063194 3300005616 Bacteria 3223
260 Ga0068852_100164676 3300005616 Bacteria 2073
261 Ga0068852_100434768 3300005616 Unclassified 1296
262 Ga0068859_100002825 3300005617 Bacteria 17604
263 Ga0068859_100005044 3300005617 Bacteria 13403
264 Ga0068859_100094085 3300005617 Unclassified 3049
265 Ga0068859_100260494 3300005617 Bacteria 1825
266 Ga0068864_100003691 3300005618 Bacteria 12643
267 Ga0068864_100004392 3300005618 Bacteria 11577
268 Ga0068864_100039550 3300005618 Bacteria 4031
269 Ga0068864_100168540 3300005618 Bacteria 1995
270 Ga0068864_100279590 3300005618 Bacteria 1557
271 Ga0068866_10000294 3300005718 Bacteria 23748
272 Ga0068861_100003318 3300005719 Bacteria 10657
273 Ga0068861_100025608 3300005719 Bacteria 4280
274 Ga0068861_100146275 3300005719 Bacteria 1934
275 Ga0068851_10041359 3300005834 Bacteria 2317
276 Ga0068851_10047424 3300005834 Bacteria 2176
277 Ga0068870_10000048 3300005840 Bacteria 37476
278 Ga0068870_10000555 3300005840 Bacteria 14125
279 Ga0068870_10014085 3300005840 Bacteria 3772
280 Ga0068870_10107612 3300005840 Unclassified 1586
281 Ga0068863_100001975 3300005841 Bacteria 20397
282 Ga0068863_100023486 3300005841 Bacteria 5887
283 Ga0068863_100032997 3300005841 Bacteria 4932
284 Ga0068863_100070126 3300005841 Unclassified 3314
285 Ga0068863_100120391 3300005841 Bacteria 2502
286 Ga0068863_100144908 3300005841 Bacteria 2271
287 Ga0068863_100372628 3300005841 Bacteria 1393
288 Ga0068858_100003376 3300005842 Bacteria 15892
289 Ga0068858_100026265 3300005842 Bacteria 5413
290 Ga0068858_100090996 3300005842 Bacteria 2840
291 Ga0068858_100095411 3300005842 Bacteria 2771
292 Ga0068858_100230357 3300005842 Bacteria 1756
293 Ga0068860_100000933 3300005843 Bacteria 32339
294 Ga0068860_100021346 3300005843 Bacteria 6269
295 Ga0068860_100028676 3300005843 Bacteria 5358
296 Ga0068860_100063529 3300005843 Bacteria 3506
297 Ga0068860_100184584 3300005843 Bacteria 2017
298 Ga0068862_100002722 3300005844 Bacteria 15513
299 Ga0068862_100003011 3300005844 Bacteria 14700
300 Ga0068862_100056146 3300005844 Bacteria 3373
301 Ga0081455_10004363 3300005937 Bacteria 15926
302 Ga0081455_10008450 3300005937 Bacteria 10706
303 Ga0081455_10028599 3300005937 Bacteria 5093
304 Ga0081455_10083437 3300005937 Bacteria 2611
305 Ga0081455_10127627 3300005937 Bacteria 1993
306 Ga0081538_10001450 3300005981 Bacteria 24368
307 Ga0081540_1000413 3300005983 Bacteria 42230
308 Ga0081540_1035995 3300005983 Bacteria 2646
309 Ga0070717_10000425 3300006028 Bacteria 27019
310 Ga0075365_10006308 3300006038 Bacteria 6512
311 Ga0075365_10014812 3300006038 Bacteria 4699
312 Ga0075365_10120548 3300006038 Bacteria 1809
313 Ga0075368_10095769 3300006042 Bacteria 1216
314 Ga0075363_100220534 3300006048 Bacteria 1087
315 Ga0075364_10141796 3300006051 Bacteria 1617
316 Ga0070715_10000739 3300006163 Bacteria 8815
317 Ga0070715_10014909 3300006163 Unclassified 2889
318 Ga0070715_10053517 3300006163 Bacteria 1745
319 Ga0070716_100001906 3300006173 Bacteria 9470
320 Ga0070716_100128096 3300006173 Unclassified 1600
321 Ga0070712_100026897 3300006175 Bacteria 3837
322 Ga0070712_100037354 3300006175 Bacteria 3310
323 Ga0070712_100041503 3300006175 Unclassified 3159
324 Ga0075367_10006690 3300006178 Bacteria 5846
325 Ga0075427_10000239 3300006194 Bacteria 5795
326 Ga0097621_100000833 3300006237 Bacteria 21751
327 Ga0097621_100004811 3300006237 Bacteria 9455
328 Ga0097621_100010471 3300006237 Bacteria 6789
329 Ga0097621_100028375 3300006237 Bacteria 4411
330 Ga0097621_100037965 3300006237 Bacteria 3863
331 Ga0097621_100094813 3300006237 Unclassified 2502
332 Ga0068871_100015994 3300006358 Bacteria 5636
333 Ga0068871_100027741 3300006358 Bacteria 4431
334 Ga0068871_100097250 3300006358 Bacteria 2461
335 Ga0075428_100054688 3300006844 Unclassified 4374
336 Ga0075428_100060487 3300006844 Bacteria 4148
337 Ga0075428_100100973 3300006844 Bacteria 3145
338 Ga0075428_100101032 3300006844 Bacteria 3144
339 Ga0075428_100215306 3300006844 Bacteria 2075
340 Ga0075428_100509652 3300006844 Bacteria 1287
341 Ga0075430_100002831 3300006846 Bacteria 14516
342 Ga0075430_100045973 3300006846 Bacteria 3687
343 Ga0075430_100068729 3300006846 Bacteria 2972
344 Ga0075431_100000132 3300006847 Bacteria 49934
345 Ga0075431_100015471 3300006847 Bacteria 7731
346 Ga0075431_100035687 3300006847 Bacteria 5119
347 Ga0075431_100115025 3300006847 Bacteria 2777
348 Ga0075431_100238948 3300006847 Bacteria 1848
349 Ga0075431_100441237 3300006847 Bacteria 1299
350 Ga0075433_10002201 3300006852 Bacteria 14781
351 Ga0075433_10005076 3300006852 Bacteria 10322
352 Ga0075433_10051260 3300006852 Bacteria 3594
353 Ga0075433_10110922 3300006852 Bacteria 2434
354 Ga0075434_100002941 3300006871 Bacteria 15148
355 Ga0075434_100004401 3300006871 Bacteria 12692
356 Ga0075434_100026478 3300006871 Bacteria 5682
357 Ga0075434_100027637 3300006871 Bacteria 5571
358 Ga0075434_100044384 3300006871 Bacteria 4409
359 Ga0075434_100050708 3300006871 Bacteria 4123
360 Ga0075434_100053446 3300006871 Bacteria 4013
361 Ga0075434_100086641 3300006871 Bacteria 3132
362 Ga0075434_100127829 3300006871 Bacteria 2558
363 Ga0075434_100157576 3300006871 Bacteria 2290
364 Ga0075429_100002461 3300006880 Bacteria 15577
365 Ga0075429_100061162 3300006880 Bacteria 3280
366 Ga0075429_100109548 3300006880 Bacteria 2414
367 Ga0075429_100113010 3300006880 Bacteria 2374
368 Ga0075429_100237924 3300006880 Bacteria 1595
369 Ga0068865_100009219 3300006881 Bacteria 6111
370 Ga0068865_100014125 3300006881 Bacteria 5068
371 Ga0068865_100038489 3300006881 Unclassified 3238
372 Ga0068865_100064695 3300006881 Bacteria 2574
373 Ga0068865_100357772 3300006881 Bacteria 1184
374 Ga0075436_100154946 3300006914 Bacteria 1613
375 Ga0097620_100002825 3300006931 Bacteria 17604
376 Ga0097620_100005044 3300006931 Bacteria 13403
377 Ga0097620_100094083 3300006931 Unclassified 3049
378 Ga0097620_100260496 3300006931 Bacteria 1825
379 Ga0075435_100014230 3300007076 Bacteria 5941
380 Ga0075435_100036370 3300007076 Bacteria 3913
381 Ga0075435_100071058 3300007076 Bacteria 2842
382 Ga0075435_100097503 3300007076 Unclassified 2433
383 Ga0075435_100135975 3300007076 Bacteria 2059
384 Ga0075435_100170095 3300007076 Bacteria 1838
385 Ga0075435_100185871 3300007076 Unclassified 1757
386 Ga0075435_100333834 3300007076 Bacteria 1299
387 Ga0105251_10060310 3300009011 Bacteria 1786
388 Ga0105250_10016499 3300009092 Bacteria 3007
389 Ga0105240_10003696 3300009093 Bacteria 23644
390 Ga0105240_10054446 3300009093 Bacteria 5014
391 Ga0105240_10121756 3300009093 Bacteria 3141
392 Ga0105240_10295109 3300009093 Unclassified 1856
393 Ga0105240_10347654 3300009093 Bacteria 1683
394 Ga0105240_10470698 3300009093 Bacteria 1402
395 Ga0111539_10000933 3300009094 Bacteria 38278
396 Ga0111539_10002792 3300009094 Bacteria 23179
397 Ga0111539_10004846 3300009094 Bacteria 17535
398 Ga0111539_10020347 3300009094 Bacteria 8174
399 Ga0111539_10080968 3300009094 Bacteria 3819
400 Ga0111539_10253638 3300009094 Bacteria 2048
401 Ga0111539_10343015 3300009094 Bacteria 1739
402 Ga0111539_10594110 3300009094 Bacteria 1289
403 Ga0105245_10000370 3300009098 Bacteria 41982
404 Ga0105245_10051898 3300009098 Bacteria 3677
405 Ga0105245_10076963 3300009098 Bacteria 3040
406 Ga0105245_10105703 3300009098 Bacteria 2611
407 Ga0105245_10383175 3300009098 Bacteria 1401
408 Ga0105245_10638626 3300009098 Bacteria 1094
409 Ga0105247_10000941 3300009101 Bacteria 21940
410 Ga0105247_10032611 3300009101 Unclassified 3165
411 Ga0105247_10054178 3300009101 Bacteria 2475
412 Ga0105247_10124738 3300009101 Bacteria 1672
413 Ga0105247_10191132 3300009101 Unclassified 1371
414 Ga0105247_10203221 3300009101 Bacteria 1332
415 Ga0105247_10216652 3300009101 Bacteria 1294
416 Ga0105247_10257280 3300009101 Bacteria 1196
417 Ga0114129_10000280 3300009147 Bacteria 58505
418 Ga0114129_10001684 3300009147 Bacteria 30152
419 Ga0114129_10003178 3300009147 Bacteria 23049
420 Ga0114129_10005006 3300009147 Bacteria 18662
421 Ga0114129_10039645 3300009147 Bacteria 6641
422 Ga0114129_10044181 3300009147 Bacteria 6268
423 Ga0114129_10651977 3300009147 Bacteria 1359
424 Ga0105243_10003132 3300009148 Bacteria 13584
425 Ga0105243_10041794 3300009148 Bacteria 3586
426 Ga0105243_10042428 3300009148 Bacteria 3561
427 Ga0105243_10051976 3300009148 Bacteria 3244
428 Ga0105243_10112672 3300009148 Bacteria 2279
429 Ga0105243_10139323 3300009148 Bacteria 2068
430 Ga0105241_10003551 3300009174 Bacteria 11603
431 Ga0105241_10081736 3300009174 Bacteria 2532
432 Ga0105241_10239450 3300009174 Bacteria 1533
433 Ga0105241_10244204 3300009174 Bacteria 1519
434 Ga0105241_10259968 3300009174 Unclassified 1475
435 Ga0105242_10001245 3300009176 Bacteria 20067
436 Ga0105242_10035192 3300009176 Bacteria 4016
437 Ga0105242_10060537 3300009176 Unclassified 3111
438 Ga0105242_10084063 3300009176 Bacteria 2666
439 Ga0105242_10198287 3300009176 Bacteria 1782
440 Ga0105242_10257844 3300009176 Bacteria 1574
441 Ga0105248_10001324 3300009177 Bacteria 27565
442 Ga0105248_10005301 3300009177 Bacteria 14193
443 Ga0105248_10005481 3300009177 Bacteria 13935
444 Ga0105248_10053771 3300009177 Bacteria 4517
445 Ga0105248_10223547 3300009177 Bacteria 2119
446 Ga0105248_10396853 3300009177 Unclassified 1553
447 Ga0105248_10446949 3300009177 Bacteria 1456
448 Ga0105237_10032477 3300009545 Bacteria 5284
449 Ga0105237_10057636 3300009545 Bacteria 3887
450 Ga0105237_10069508 3300009545 Bacteria 3517
451 Ga0105237_10184271 3300009545 Bacteria 2088
452 Ga0105238_10040095 3300009551 Bacteria 4747
453 Ga0105238_10050719 3300009551 Bacteria 4177
454 Ga0105238_10099024 3300009551 Bacteria 2899
455 Ga0105238_10427661 3300009551 Bacteria 1319
456 Ga0105249_10002759 3300009553 Bacteria 15181
457 Ga0105249_10023209 3300009553 Bacteria 5565
458 Ga0105249_10196964 3300009553 Bacteria 1969
459 Ga0105249_10209557 3300009553 Bacteria 1912
460 Ga0105239_10091805 3300010375 Unclassified 3351
461 Ga0105239_10163498 3300010375 Bacteria 2488
462 Ga0105239_10295664 3300010375 Bacteria 1823
463 Ga0105239_10424323 3300010375 Bacteria 1507
464 Ga0105239_10503383 3300010375 Bacteria 1377
465 Ga0105246_10000510 3300011119 Bacteria 21126
466 Ga0105246_10028412 3300011119 Bacteria 3674
467 Ga0105246_10030976 3300011119 Bacteria 3537
468 Ga0105246_10060545 3300011119 Bacteria 2631
469 Ga0105246_10093394 3300011119 Unclassified 2173
470 Ga0105246_10187645 3300011119 Bacteria 1597
471 Ga0105246_10295276 3300011119 Unclassified 1306
472 Ga0157373_10007085 3300013100 Bacteria 8359
473 Ga0157373_10008396 3300013100 Bacteria 7669
474 Ga0157371_10008538 3300013102 Bacteria 8154
475 Ga0157371_10136722 3300013102 Bacteria 1745
476 Ga0157370_10008485 3300013104 Bacteria 11083
477 Ga0157370_10223385 3300013104 Bacteria 1744
478 Ga0157369_10195186 3300013105 Bacteria 2126
479 Ga0157374_10001994 3300013296 Bacteria 17142
480 Ga0157374_10017984 3300013296 Bacteria 6232
481 Ga0157374_10024070 3300013296 Bacteria 5454
482 Ga0157374_10025719 3300013296 Bacteria 5289
483 Ga0157374_10071030 3300013296 Bacteria 3282
484 Ga0157374_10213049 3300013296 Unclassified 1894
485 Ga0157374_10363961 3300013296 Unclassified 1438
486 Ga0157378_10006053 3300013297 Bacteria 10595
487 Ga0157378_10104314 3300013297 Bacteria 2591
488 Ga0157378_10111319 3300013297 Bacteria 2510
489 Ga0157378_10193990 3300013297 Bacteria 1918
490 Ga0163162_10008106 3300013306 Bacteria 10252
491 Ga0163162_10212728 3300013306 Bacteria 2063
492 Ga0163162_10297967 3300013306 Bacteria 1744
493 Ga0157372_10005559 3300013307 Bacteria 13400
494 Ga0157372_10010864 3300013307 Bacteria 9692
495 Ga0157372_10271211 3300013307 Unclassified 1972
496 Ga0157375_10003733 3300013308 Bacteria 13213
497 Ga0157375_10004143 3300013308 Bacteria 12581
498 Ga0157375_10156389 3300013308 Unclassified 2419
499 Ga0157375_10272680 3300013308 Unclassified 1854
500 Ga0163163_10004364 3300014325 Bacteria 12051
501 Ga0163163_10011627 3300014325 Bacteria 7995
502 Ga0163163_10016172 3300014325 Bacteria 6926
503 Ga0163163_10030715 3300014325 Bacteria 5180
504 Ga0163163_10035735 3300014325 Bacteria 4822
505 Ga0163163_10081094 3300014325 Bacteria 3246
506 Ga0163163_10223536 3300014325 Bacteria 1932
507 Ga0163163_10238937 3300014325 Bacteria 1866
508 Ga0157380_10001925 3300014326 Bacteria 13801
509 Ga0157380_10182811 3300014326 Bacteria 1843
510 Ga0157377_10000101 3300014745 Bacteria 60248
511 Ga0157377_10034073 3300014745 Bacteria 2784
512 Ga0157377_10060655 3300014745 Bacteria 2160
513 Ga0157379_10004422 3300014968 Bacteria 12048
514 Ga0157379_10015102 3300014968 Bacteria 6773
515 Ga0157379_10040063 3300014968 Bacteria 4181
516 Ga0157379_10103927 3300014968 Bacteria 2549
517 Ga0157379_10129808 3300014968 Bacteria 2268
518 Ga0157379_10227835 3300014968 Bacteria 1689
519 Ga0157379_10245194 3300014968 Bacteria 1625
520 Ga0157379_10325561 3300014968 Bacteria 1404
521 Ga0157376_10003977 3300014969 Bacteria 10215
522 Ga0157376_10019988 3300014969 Bacteria 5172
523 Ga0157376_10059403 3300014969 Unclassified 3206
524 Ga0157376_10355128 3300014969 Bacteria 1404
525 Ga0163161_10006193 3300017792 Bacteria 8290
526 Ga0163161_10023300 3300017792 Bacteria 4367
527 Ga0163161_10183238 3300017792 Bacteria 1607
528 Ga0163161_10458922 3300017792 Unclassified 1031
529 Ga0207666_1000044 3300025271 Bacteria 24638
530 Ga0207666_1000084 3300025271 Bacteria 15613
531 Ga0207673_1000183 3300025290 Bacteria 6211
532 Ga0207697_10000051 3300025315 Bacteria 47188
533 Ga0207697_10002615 3300025315 Bacteria 9261
534 Ga0207656_10064533 3300025321 Unclassified 1614
535 Ga0207653_10000964 3300025885 Bacteria 9488
536 Ga0207653_10001329 3300025885 Bacteria 8032
537 Ga0207682_10000635 3300025893 Bacteria 16359
538 Ga0207682_10000815 3300025893 Bacteria 14433
539 Ga0207692_10025329 3300025898 Unclassified 2769
540 Ga0207642_10004273 3300025899 Bacteria 4601
541 Ga0207642_10024909 3300025899 Bacteria 2413
542 Ga0207642_10084375 3300025899 Bacteria 1551
543 Ga0207710_10002302 3300025900 Bacteria 8939
544 Ga0207710_10002328 3300025900 Bacteria 8879
545 Ga0207710_10013441 3300025900 Bacteria 3444
546 Ga0207710_10047672 3300025900 Bacteria 1916
547 Ga0207710_10047879 3300025900 Bacteria 1912
548 Ga0207688_10000044 3300025901 Bacteria 43600
549 Ga0207688_10000197 3300025901 Bacteria 26763
550 Ga0207688_10000346 3300025901 Bacteria 21494
551 Ga0207688_10003234 3300025901 Bacteria 8896
552 Ga0207680_10002632 3300025903 Bacteria 8381
553 Ga0207680_10009774 3300025903 Bacteria 4773
554 Ga0207680_10024713 3300025903 Bacteria 3302
555 Ga0207680_10046995 3300025903 Bacteria 2555
556 Ga0207647_10002117 3300025904 Bacteria 15175
557 Ga0207647_10006669 3300025904 Bacteria 8389
558 Ga0207647_10017129 3300025904 Bacteria 4932
559 Ga0207647_10072136 3300025904 Unclassified 2083
560 Ga0207685_10002628 3300025905 Bacteria 4169
561 Ga0207685_10046112 3300025905 Unclassified 1657
562 Ga0207685_10058465 3300025905 Unclassified 1517
563 Ga0207699_10000760 3300025906 Bacteria 15436
564 Ga0207699_10037393 3300025906 Unclassified 2775
565 Ga0207699_10176167 3300025906 Bacteria 1434
566 Ga0207645_10000218 3300025907 Bacteria 47372
567 Ga0207645_10002258 3300025907 Bacteria 15323
568 Ga0207645_10007653 3300025907 Bacteria 7613
569 Ga0207645_10043351 3300025907 Bacteria 2879
570 Ga0207645_10096759 3300025907 Bacteria 1902
571 Ga0207643_10000400 3300025908 Bacteria 28899
572 Ga0207643_10000870 3300025908 Bacteria 18192
573 Ga0207643_10001076 3300025908 Bacteria 16139
574 Ga0207643_10005389 3300025908 Bacteria 6847
575 Ga0207705_10237662 3300025909 Bacteria 1387
576 Ga0207654_10004223 3300025911 Bacteria 7250
577 Ga0207654_10020598 3300025911 Bacteria 3498
578 Ga0207654_10058636 3300025911 Bacteria 2242
579 Ga0207654_10077921 3300025911 Bacteria 1988
580 Ga0207654_10180532 3300025911 Bacteria 1377
581 Ga0207654_10183667 3300025911 Bacteria 1366
582 Ga0207654_10191974 3300025911 Bacteria 1339
583 Ga0207707_10005047 3300025912 Bacteria 11585
584 Ga0207707_10006308 3300025912 Bacteria 10356
585 Ga0207707_10073600 3300025912 Bacteria 2979
586 Ga0207707_10419616 3300025912 Bacteria 1147
587 Ga0207695_10023341 3300025913 Bacteria 6992
588 Ga0207695_10072321 3300025913 Bacteria 3519
589 Ga0207695_10090219 3300025913 Bacteria 3081
590 Ga0207695_10275543 3300025913 Bacteria 1577
591 Ga0207695_10431288 3300025913 Bacteria 1202
592 Ga0207671_10038266 3300025914 Bacteria 3555
593 Ga0207671_10064215 3300025914 Unclassified 2729
594 Ga0207671_10224789 3300025914 Unclassified 1471
595 Ga0207693_10003582 3300025915 Bacteria 13276
596 Ga0207693_10010960 3300025915 Bacteria 7345
597 Ga0207693_10013445 3300025915 Bacteria 6599
598 Ga0207693_10013697 3300025915 Bacteria 6533
599 Ga0207693_10048449 3300025915 Bacteria 3336
600 Ga0207693_10064100 3300025915 Bacteria 2879
601 Ga0207693_10076592 3300025915 Bacteria 2619
602 Ga0207693_10088411 3300025915 Unclassified 2428
603 Ga0207693_10128732 3300025915 Bacteria 1990
604 Ga0207663_10019001 3300025916 Bacteria 3862
605 Ga0207663_10038225 3300025916 Bacteria 2900
606 Ga0207663_10041665 3300025916 Bacteria 2800
607 Ga0207663_10050950 3300025916 Bacteria 2575
608 Ga0207663_10083386 3300025916 Bacteria 2100
609 Ga0207663_10273245 3300025916 Bacteria 1252
610 Ga0207660_10000571 3300025917 Bacteria 24778
611 Ga0207660_10005879 3300025917 Bacteria 7967
612 Ga0207660_10028355 3300025917 Bacteria 3829
613 Ga0207660_10091758 3300025917 Bacteria 2253
614 Ga0207660_10438880 3300025917 Bacteria 1055
615 Ga0207662_10000100 3300025918 Bacteria 40845
616 Ga0207662_10000677 3300025918 Bacteria 15501
617 Ga0207662_10002523 3300025918 Bacteria 9215
618 Ga0207662_10008813 3300025918 Bacteria 5536
619 Ga0207662_10196108 3300025918 Bacteria 1305
620 Ga0207657_10002107 3300025919 Bacteria 21516
621 Ga0207657_10004436 3300025919 Bacteria 14848
622 Ga0207657_10038965 3300025919 Bacteria 4225
623 Ga0207657_10040555 3300025919 Bacteria 4124
624 Ga0207657_10042518 3300025919 Bacteria 4008
625 Ga0207657_10183166 3300025919 Unclassified 1692
626 Ga0207649_10000310 3300025920 Bacteria 37179
627 Ga0207649_10059114 3300025920 Bacteria 2404
628 Ga0207649_10354882 3300025920 Bacteria 1086
629 Ga0207652_10005950 3300025921 Bacteria 9867
630 Ga0207652_10017065 3300025921 Bacteria 5938
631 Ga0207652_10063415 3300025921 Bacteria 3196
632 Ga0207652_10065747 3300025921 Bacteria 3141
633 Ga0207652_10149260 3300025921 Bacteria 2092
634 Ga0207646_10058492 3300025922 Bacteria 3443
635 Ga0207646_10449813 3300025922 Bacteria 1162
636 Ga0207681_10000803 3300025923 Bacteria 20696
637 Ga0207681_10014449 3300025923 Bacteria 4907
638 Ga0207694_10050279 3300025924 Bacteria 3228
639 Ga0207694_10060883 3300025924 Bacteria 2938
640 Ga0207694_10373693 3300025924 Bacteria 1182
641 Ga0207650_10005586 3300025925 Bacteria 8589
642 Ga0207650_10022154 3300025925 Bacteria 4497
643 Ga0207650_10040740 3300025925 Bacteria 3401
644 Ga0207650_10042885 3300025925 Unclassified 3319
645 Ga0207650_10050106 3300025925 Unclassified 3086
646 Ga0207650_10110410 3300025925 Bacteria 2128
647 Ga0207650_10203227 3300025925 Bacteria 1588
648 Ga0207659_10000040 3300025926 Bacteria 91375
649 Ga0207659_10010644 3300025926 Bacteria 5784
650 Ga0207659_10278066 3300025926 Unclassified 1368
651 Ga0207687_10001077 3300025927 Bacteria 18525
652 Ga0207687_10038537 3300025927 Bacteria 3267
653 Ga0207687_10040562 3300025927 Bacteria 3192
654 Ga0207687_10051128 3300025927 Bacteria 2879
655 Ga0207687_10111076 3300025927 Unclassified 2034
656 Ga0207687_10231836 3300025927 Unclassified 1459
657 Ga0207700_10000797 3300025928 Bacteria 18209
658 Ga0207700_10007214 3300025928 Bacteria 6778
659 Ga0207700_10018216 3300025928 Bacteria 4713
660 Ga0207700_10211012 3300025928 Bacteria 1642
661 Ga0207664_10013394 3300025929 Bacteria 5884
662 Ga0207664_10076626 3300025929 Bacteria 2707
663 Ga0207664_10097727 3300025929 Unclassified 2420
664 Ga0207664_10144815 3300025929 Bacteria 2014
665 Ga0207664_10460634 3300025929 Unclassified 1135
666 Ga0207644_10020275 3300025931 Bacteria 4519
667 Ga0207644_10032566 3300025931 Unclassified 3637
668 Ga0207644_10054704 3300025931 Bacteria 2875
669 Ga0207644_10113443 3300025931 Bacteria 2052
670 Ga0207644_10164013 3300025931 Bacteria 1729
671 Ga0207690_10000277 3300025932 Bacteria 36311
672 Ga0207706_10003292 3300025933 Bacteria 15468
673 Ga0207706_10007125 3300025933 Bacteria 10350
674 Ga0207706_10048791 3300025933 Bacteria 3744
675 Ga0207706_10074280 3300025933 Bacteria 2990
676 Ga0207706_10095177 3300025933 Bacteria 2620
677 Ga0207706_10152305 3300025933 Bacteria 2034
678 Ga0207706_10155882 3300025933 Unclassified 2008
679 Ga0207686_10001074 3300025934 Bacteria 16034
680 Ga0207686_10007975 3300025934 Bacteria 5710
681 Ga0207686_10028342 3300025934 Unclassified 3291
682 Ga0207686_10064279 3300025934 Bacteria 2336
683 Ga0207686_10095353 3300025934 Bacteria 1974
684 Ga0207686_10110287 3300025934 Bacteria 1854
685 Ga0207686_10206335 3300025934 Unclassified 1410
686 Ga0207709_10003933 3300025935 Bacteria 8677
687 Ga0207709_10020822 3300025935 Bacteria 3704
688 Ga0207709_10036589 3300025935 Bacteria 2910
689 Ga0207670_10000977 3300025936 Bacteria 15087
690 Ga0207670_10028475 3300025936 Bacteria 3547
691 Ga0207670_10224640 3300025936 Bacteria 1439
692 Ga0207669_10000347 3300025937 Bacteria 21120
693 Ga0207669_10046437 3300025937 Bacteria 2566
694 Ga0207669_10242318 3300025937 Bacteria 1337
695 Ga0207704_10000624 3300025938 Bacteria 15670
696 Ga0207704_10011417 3300025938 Bacteria 4373
697 Ga0207704_10050233 3300025938 Bacteria 2514
698 Ga0207704_10103788 3300025938 Unclassified 1902
699 Ga0207665_10002407 3300025939 Bacteria 12653
700 Ga0207665_10013442 3300025939 Bacteria 5382
701 Ga0207665_10040630 3300025939 Bacteria 3104
702 Ga0207691_10000940 3300025940 Bacteria 28841
703 Ga0207691_10002224 3300025940 Bacteria 18973
704 Ga0207691_10003147 3300025940 Bacteria 16133
705 Ga0207691_10027700 3300025940 Bacteria 5311
706 Ga0207691_10315431 3300025940 Bacteria 1341
707 Ga0207711_10003275 3300025941 Bacteria 14083
708 Ga0207711_10014033 3300025941 Bacteria 6656
709 Ga0207711_10016938 3300025941 Bacteria 6052
710 Ga0207711_10023511 3300025941 Bacteria 5158
711 Ga0207711_10094257 3300025941 Unclassified 2638
712 Ga0207711_10166756 3300025941 Bacteria 1996
713 Ga0207689_10000514 3300025942 Bacteria 36737
714 Ga0207689_10002387 3300025942 Bacteria 17532
715 Ga0207689_10012049 3300025942 Bacteria 7409
716 Ga0207689_10047365 3300025942 Bacteria 3550
717 Ga0207689_10165614 3300025942 Bacteria 1821
718 Ga0207689_10254067 3300025942 Bacteria 1454
719 Ga0207661_10000191 3300025944 Bacteria 39865
720 Ga0207661_10089799 3300025944 Unclassified 2557
721 Ga0207679_10000099 3300025945 Bacteria 74047
722 Ga0207679_10001868 3300025945 Bacteria 13091
723 Ga0207679_10075118 3300025945 Plasmid 2563
724 Ga0207679_10203207 3300025945 Bacteria 1656
725 Ga0207679_10393891 3300025945 Bacteria 1217
726 Ga0207667_10014048 3300025949 Bacteria 9140
727 Ga0207667_10054765 3300025949 Bacteria 4195
728 Ga0207667_10060608 3300025949 Bacteria 3960
729 Ga0207667_10139859 3300025949 Bacteria 2493
730 Ga0207651_10000202 3300025960 Bacteria 26070
731 Ga0207651_10035179 3300025960 Bacteria 3253
732 Ga0207651_10050584 3300025960 Bacteria 2822
733 Ga0207651_10177174 3300025960 Bacteria 1687
734 Ga0207712_10001297 3300025961 Bacteria 17122
735 Ga0207712_10004060 3300025961 Bacteria 9243
736 Ga0207712_10038043 3300025961 Bacteria 3288
737 Ga0207712_10111375 3300025961 Unclassified 2054
738 Ga0207712_10310894 3300025961 Bacteria 1297
739 Ga0207668_10001518 3300025972 Bacteria 13565
740 Ga0207668_10003969 3300025972 Bacteria 8715
741 Ga0207668_10047240 3300025972 Bacteria 2946
742 Ga0207668_10060574 3300025972 Bacteria 2657
743 Ga0207668_10187902 3300025972 Bacteria 1635
744 Ga0207640_10000425 3300025981 Bacteria 26102
745 Ga0207640_10105205 3300025981 Bacteria 1988
746 Ga0207658_10003433 3300025986 Bacteria 11216
747 Ga0207658_10015942 3300025986 Bacteria 5161
748 Ga0207658_10217708 3300025986 Bacteria 1604
749 Ga0207658_10296336 3300025986 Unclassified 1392
750 Ga0207677_10000495 3300026023 Bacteria 25594
751 Ga0207677_10053257 3300026023 Bacteria 2753
752 Ga0207703_10003491 3300026035 Bacteria 13158
753 Ga0207703_10030257 3300026035 Bacteria 4278
754 Ga0207703_10036654 3300026035 Bacteria 3904
755 Ga0207703_10045294 3300026035 Bacteria 3538
756 Ga0207703_10050838 3300026035 Bacteria 3356
757 Ga0207703_10081190 3300026035 Bacteria 2702
758 Ga0207639_10043894 3300026041 Bacteria 3359
759 Ga0207639_10052294 3300026041 Bacteria 3112
760 Ga0207639_10081399 3300026041 Bacteria 2564
761 Ga0207678_10002254 3300026067 Bacteria 17463
762 Ga0207678_10005396 3300026067 Bacteria 11454
763 Ga0207678_10017170 3300026067 Bacteria 6353
764 Ga0207678_10038688 3300026067 Bacteria 4143
765 Ga0207678_10189769 3300026067 Bacteria 1756
766 Ga0207678_10233462 3300026067 Bacteria 1575
767 Ga0207708_10000602 3300026075 Bacteria 27734
768 Ga0207708_10000636 3300026075 Bacteria 26970
769 Ga0207708_10001067 3300026075 Bacteria 20564
770 Ga0207708_10002106 3300026075 Bacteria 14656
771 Ga0207702_10012003 3300026078 Bacteria 7203
772 Ga0207702_10032777 3300026078 Bacteria 4336
773 Ga0207702_10064691 3300026078 Bacteria 3130
774 Ga0207702_10098210 3300026078 Bacteria 2579
775 Ga0207702_10225900 3300026078 Bacteria 1747
776 Ga0207702_10230426 3300026078 Unclassified 1731
777 Ga0207641_10000246 3300026088 Bacteria 70235
778 Ga0207641_10017711 3300026088 Bacteria 5836
779 Ga0207641_10047921 3300026088 Bacteria 3605
780 Ga0207641_10066361 3300026088 Bacteria 3088
781 Ga0207641_10175259 3300026088 Bacteria 1960
782 Ga0207641_10349243 3300026088 Bacteria 1409
783 Ga0207641_10370072 3300026088 Bacteria 1370
784 Ga0207648_10000575 3300026089 Bacteria 41197
785 Ga0207648_10004636 3300026089 Bacteria 14075
786 Ga0207648_10007651 3300026089 Bacteria 10576
787 Ga0207648_10009899 3300026089 Bacteria 9087
788 Ga0207676_10002628 3300026095 Bacteria 12800
789 Ga0207676_10042856 3300026095 Bacteria 3481
790 Ga0207676_10139934 3300026095 Bacteria 2070
791 Ga0207676_10167958 3300026095 Bacteria 1908
792 Ga0207674_10002439 3300026116 Bacteria 23481
793 Ga0207674_10003170 3300026116 Bacteria 20247
794 Ga0207674_10163778 3300026116 Bacteria 2178
795 Ga0207675_100002589 3300026118 Bacteria 17916
796 Ga0207675_100002803 3300026118 Bacteria 17126
797 Ga0207675_100004434 3300026118 Bacteria 13568
798 Ga0207683_10002498 3300026121 Bacteria 16043
799 Ga0207683_10004946 3300026121 Bacteria 11465
800 Ga0207683_10016507 3300026121 Bacteria 6285
801 Ga0207683_10022331 3300026121 Bacteria 5430
802 Ga0207683_10083734 3300026121 Unclassified 2834
803 Ga0207683_10083994 3300026121 Bacteria 2830
804 Ga0207698_10004542 3300026142 Bacteria 8472
805 Ga0207698_10029601 3300026142 Bacteria 3925
806 Ga0207698_10072912 3300026142 Bacteria 2731
807 Ga0207698_10110705 3300026142 Bacteria 2301
808 Ga0209973_1008503 3300027252 Bacteria 1173
809 Ga0210002_1000370 3300027617 Bacteria 6107
810 Ga0210002_1017154 3300027617 Bacteria 1150
811 Ga0209966_1001412 3300027695 Bacteria 4186
812 Ga0209998_10000754 3300027717 Bacteria 8475
813 Ga0209998_10006767 3300027717 Bacteria 2377
814 Ga0209974_10000697 3300027876 Bacteria 11450
815 Ga0209974_10000776 3300027876 Bacteria 10871
816 Ga0209974_10021914 3300027876 Bacteria 2115
817 Ga0207428_10000114 3300027907 Bacteria 109533
818 Ga0207428_10000736 3300027907 Bacteria 37641
819 Ga0207428_10003035 3300027907 Bacteria 16519
820 Ga0207428_10022508 3300027907 Bacteria 5317
821 Ga0207428_10053222 3300027907 Bacteria 3228
822 Ga0207428_10170899 3300027907 Unclassified 1646
823 Ga0268266_10010491 3300028379 Bacteria 8097
824 Ga0268266_10011314 3300028379 Bacteria 7766
825 Ga0268266_10291610 3300028379 Unclassified 1519
826 Ga0268266_10310139 3300028379 Bacteria 1474
827 Ga0268265_10001326 3300028380 Bacteria 21194
828 Ga0268264_10001756 3300028381 Bacteria 19870
829 Ga0268264_10055713 3300028381 Bacteria 3304
830 Ga0268264_10075492 3300028381 Bacteria 2866
831 Ga0268264_10158476 3300028381 Bacteria 2036
832 Ga0268264_10258764 3300028381 Bacteria 1620
833 Ga0265316_10242379 3300031344 Bacteria 1325
834 Ga0265313_10106101 3300031595 Bacteria 1240
835 Ga0265314_10020384 3300031711 Bacteria 5118
836 Ga0373948_0006733 3300034817 Bacteria 1911
837 Ga0373948_0009864 3300034817 Bacteria 1656
838 Ga0373950_0011829 3300034818 Bacteria 1432
839 Ga0373950_0013207 3300034818 Bacteria 1374
840 Ga0373958_0018799 3300034819 Bacteria 1256
841 Ga0373959_0007572 3300034820 Bacteria 1828
842 Ga0373959_0016796 3300034820 Bacteria 1361
843 Ga0373959_0041169 3300034820 Bacteria 969
844 Ga0373938_0001319 3300034957 Bacteria 3988
845 Ga0373938_0003528 3300034957 Bacteria 2569
846 Ga0373926_0057044 3300035083 Bacteria 1418
847 Ga0373929_0000610 3300035085 Bacteria 6908
848 Ga0373934_0003180 3300035086 Bacteria 6001
849 Ga0373944_0000935 3300035089 Bacteria 7241
850 Ga0373949_0004952 3300035090 Bacteria 3006
851 Ga0373949_0020344 3300035090 Bacteria 1518
852 Ga0373949_0023302 3300035090 Bacteria 1432
853 Ga0373951_0002481 3300035091 Bacteria 4648
854 Ga0373951_0031210 3300035091 Bacteria 1256
855 Ga0373951_0034107 3300035091 Bacteria 1208
856 Ga0373952_0002203 3300035092 Bacteria 3509
857 Ga0373952_0004061 3300035092 Bacteria 2644
858 Ga0373952_0004766 3300035092 Bacteria 2468
859 Ga0373952_0010320 3300035092 Bacteria 1803
860 Ga0373923_0002833 3300035111 Bacteria 5432
861 Ga0373932_0001277 3300035112 Bacteria 7136
862 Ga0373932_0002476 3300035112 Unclassified 4659
863 Ga0373932_0003953 3300035112 Bacteria 3531
864 Ga0373936_0015396 3300035113 Bacteria 2931
865 Ga0373936_0035356 3300035113 Bacteria 1989
866 Ga0373939_0000468 3300035114 Bacteria 10226
867 Ga0373939_0002068 3300035114 Bacteria 4786
868 Ga0373939_0007403 3300035114 Bacteria 2666
869 Ga0373939_0010870 3300035114 Bacteria 2287
870 Ga0373941_0002202 3300035115 Bacteria 4259
871 Ga0373941_0008826 3300035115 Bacteria 2520
872 Ga0373945_0026621 3300035116 Bacteria 2015
873 Ga0373945_0029517 3300035116 Unclassified 1928
874 Ga0373953_0001292 3300035117 Bacteria 7178
875 Ga0373953_0002191 3300035117 Bacteria 5851
876 Ga0373954_0003589 3300035118 Bacteria 6597
877 Ga0373954_0011165 3300035118 Bacteria 3976
878 Ga0373954_0158873 3300035118 Unclassified 1105
879 Ga0373956_0008912 3300035119 Bacteria 4066
880 Ga0373957_0009377 3300035120 Bacteria 3202
881 Ga0373957_0016179 3300035120 Bacteria 2579
882 Ga0373960_0000452 3300035121 Bacteria 8081
883 Ga0373943_0001197 3300035170 Bacteria 11598
884 Ga0373943_0011130 3300035170 Bacteria 4044
885 Ga0373946_0005850 3300035171 Bacteria 4453
886 Ga0373946_0010839 3300035171 Unclassified 3386
887 Ga0373946_0012003 3300035171 Bacteria 3238
888 Ga0373946_0015351 3300035171 Bacteria 2903
889 Ga0373946_0021449 3300035171 Bacteria 2505
890 Ga0373946_0029291 3300035171 Bacteria 2190
891 Ga0373955_0004054 3300035172 Bacteria 6461
892 Ga0373955_0024756 3300035172 Unclassified 3073
893 Ga0373955_0025589 3300035172 Bacteria 3033
894 Ga0373942_0007530 3300035207 Plasmid 2527
895 Ga0373961_0005726 3300035241 Plasmid 2984
896 Ga0373961_0008407 3300035241 Bacteria 2509
897 Ga0373962_0000361 3300035242 Bacteria 9978
898 Ga0373962_0001735 3300035242 Bacteria 5188
899 Ga0373962_0009557 3300035242 Bacteria 2405
900 Ga0373924_0001111 3300035410 Bacteria 8611
901 Ga0373924_0027816 3300035410 Bacteria 2250
902 Ga0373931_0002564 3300035691 Bacteria 8087
903 Ga0373931_0011637 3300035691 Bacteria 4250
904 Ga0373931_0060942 3300035691 Bacteria 2033
905 Ga0373931_0066208 3300035691 Bacteria 1960
906 Ga0373931_0118904 3300035691 Bacteria 1508
907 Ga0373935_0000031 3300035692 Bacteria 55218
908 Ga0373935_0025316 3300035692 Plasmid 3657
909 Ga0373935_0030558 3300035692 Bacteria 3339
910 Ga0373935_0073887 3300035692 Bacteria 2203
911 Ga0373927_0007930 3300035695 Bacteria 7170
912 Ga0373927_0011771 3300035695 Bacteria 5825
913 Ga0373927_0067477 3300035695 Bacteria 2314
914 Ga0373927_0083378 3300035695 Unclassified 2072
915 Ga0373927_0098526 3300035695 Unclassified 1900
916 Ga0373933_0005826 3300035724 Bacteria 6704
917 Ga0373933_0027473 3300035724 Bacteria 3277
918 Ga0373933_0028344 3300035724 Bacteria 3230
919 Ga0373933_0038755 3300035724 Unclassified 2801
920 Ga0373947_0000337 3300035725 Bacteria 26475
921 Ga0373947_0002335 3300035725 Bacteria 11471
922 Ga0373947_0018603 3300035725 Bacteria 4000
923 Ga0373947_0037682 3300035725 Bacteria 2870
924 Ga0373947_0112565 3300035725 Bacteria 1721
925 Ga0373937_0001998 3300036401 Bacteria 17053
926 Ga0373937_0003071 3300036401 Bacteria 13963
927 Ga0373937_0003498 3300036401 Bacteria 13203
928 Ga0373937_0077081 3300036401 Bacteria 3080
929 Ga0373925_0000047 3300037068 Bacteria 130221
930 Ga0373925_0005753 3300037068 Bacteria 9215
931 Ga0373925_0010508 3300037068 Bacteria 6715
932 Ga0373925_0017707 3300037068 Bacteria 5168
933 Ga0373925_0079176 3300037068 Bacteria 2496
934 Ga0373925_0093163 3300037068 Unclassified 2305
935 Ga0395900_0319016 3300037418 Bacteria 1535
936 Ga0395898_0060592 3300037466 Bacteria 3678
937 Ga0436361_0333066 3300039447 Bacteria 6240
938 Ga0439450_025453 3300042008 Unclassified 1297
939 Ga0439460_0028405 3300042461 Bacteria 1578
940 Ga0451576_0335448 3300045051 Archaea 1583
941 Ga0495617_021029 3300046452 Bacteria 2205
942 Ga0495592_0000323 3300046454 Bacteria 39878
943 Ga0495592_0008480 3300046454 Bacteria 7713
944 Ga0495592_0090327 3300046454 Bacteria 2198
945 Ga0495603_0001898 3300046455 Bacteria 12338
946 Ga0495603_0012206 3300046455 Bacteria 5203
947 Ga0495603_0014063 3300046455 Bacteria 4840
948 Ga0495629_0000702 3300046459 Bacteria 27126
949 Ga0495629_0002648 3300046459 Bacteria 13722
950 Ga0495629_0004812 3300046459 Bacteria 10127
951 Ga0495629_0047533 3300046459 Bacteria 3010
952 Ga0495629_0257027 3300046459 Bacteria 1201
953 Ga0495638_0022247 3300046460 Bacteria 4163
954 Ga0495641_0045936 3300046461 Bacteria 2009
955 Ga0495641_0054933 3300046461 Unclassified 1809
956 Ga0495641_0063745 3300046461 Bacteria 1660
957 Ga0495651_0000168 3300046462 Bacteria 48211
958 Ga0495651_0003967 3300046462 Bacteria 11315
959 Ga0495651_0012590 3300046462 Bacteria 6527
960 Ga0495651_0034589 3300046462 Bacteria 3938
961 Ga0495651_0183700 3300046462 Bacteria 1478
962 Ga0495653_0000027 3300046463 Bacteria 154096
963 Ga0495653_0002433 3300046463 Bacteria 14806
964 Ga0495653_0008661 3300046463 Bacteria 8340
965 Ga0495653_0033947 3300046463 Bacteria 4039
966 Ga0495580_0136092 3300046472 Unclassified 1703
967 Ga0495580_0175582 3300046472 Bacteria 1480
968 Ga0495582_0000474 3300046473 Bacteria 22052
969 Ga0495582_0002635 3300046473 Bacteria 9999
970 Ga0495582_0025361 3300046473 Bacteria 3247
971 Ga0495605_0039794 3300046474 Bacteria 2353
972 Ga0495639_0004100 3300046475 Bacteria 6240
973 Ga0495639_0028580 3300046475 Bacteria 2471
974 Ga0495662_0001316 3300046476 Bacteria 12297
975 Ga0495662_0016190 3300046476 Bacteria 3615
976 Ga0495662_0043342 3300046476 Bacteria 2172
977 Ga0495662_0057181 3300046476 Bacteria 1884
978 Ga0495662_0058970 3300046476 Bacteria 1854
979 Ga0495662_0128917 3300046476 Bacteria 1243
980 Ga0495664_0000021 3300046477 Bacteria 145551
981 Ga0495664_0000711 3300046477 Bacteria 16919
982 Ga0495664_0000935 3300046477 Bacteria 15082
983 Ga0495664_0003490 3300046477 Bacteria 8561
984 Ga0495664_0027844 3300046477 Bacteria 3297
985 Ga0495664_0049247 3300046477 Bacteria 2501
986 Ga0495584_0015280 3300046491 Bacteria 3911
987 Ga0495584_0056389 3300046491 Bacteria 1977
988 Ga0495584_0155704 3300046491 Bacteria 1161
989 Ga0495585_0016608 3300046492 Bacteria 4265
990 Ga0495585_0018040 3300046492 Bacteria 4072
991 Ga0495585_0060278 3300046492 Bacteria 2089
992 Ga0495585_0129065 3300046492 Bacteria 1332
993 Ga0495594_0016308 3300046499 Bacteria 3913
994 Ga0495594_0054286 3300046499 Bacteria 2208
995 Ga0495594_0094064 3300046499 Bacteria 1681
996 Ga0495594_0173263 3300046499 Bacteria 1227
997 Ga0495607_0168045 3300046501 Bacteria 1109
998 Ga0495608_0000020 3300046511 Bacteria 169036
999 Ga0495608_0006100 3300046511 Bacteria 8550
1000 Ga0495608_0013077 3300046511 Bacteria 5759
1001 Ga0495608_0034751 3300046511 Bacteria 3402
1002 Ga0495608_0067176 3300046511 Unclassified 2346
1003 Ga0495618_0000117 3300046514 Bacteria 58104
1004 Ga0495618_0006438 3300046514 Bacteria 7130
1005 Ga0495618_0048829 3300046514 Bacteria 2672
1006 Ga0495618_0121698 3300046514 Unclassified 1671
1007 Ga0495628_0000005 3300046516 Bacteria 420969
1008 Ga0495628_0011629 3300046516 Bacteria 7439
1009 Ga0495628_0015728 3300046516 Bacteria 6316
1010 Ga0495628_0032685 3300046516 Bacteria 4198
1011 Ga0495630_0016774 3300046517 Bacteria 5359
1012 Ga0495630_0177353 3300046517 Unclassified 1624
1013 Ga0495630_0199135 3300046517 Unclassified 1528
1014 Ga0495630_0290822 3300046517 Bacteria 1248
1015 Ga0495630_0380009 3300046517 Unclassified 1082
1016 Ga0495637_0023766 3300046520 Bacteria 2778
1017 Ga0495644_0026102 3300046523 Bacteria 2217
1018 Ga0495644_0066531 3300046523 Bacteria 1354
1019 Ga0495644_0089890 3300046523 Bacteria 1159
1020 Ga0495666_0003661 3300046526 Bacteria 7760
1021 Ga0495652_0000001 3300046529 Bacteria 1045081
1022 Ga0495652_0003397 3300046529 Bacteria 15737
1023 Ga0495652_0013212 3300046529 Bacteria 7433
1024 Ga0495652_0039522 3300046529 Bacteria 4079
1025 Ga0495652_0065876 3300046529 Bacteria 3043
1026 Ga0495652_0110539 3300046529 Unclassified 2210
1027 Ga0495654_0067503 3300046530 Unclassified 1703
1028 Ga0495640_0000035 3300046533 Bacteria 73471
1029 Ga0495640_0007191 3300046533 Bacteria 8763
1030 Ga0495640_0025502 3300046533 Bacteria 4286
1031 Ga0495640_0088104 3300046533 Bacteria 2052
1032 Ga0495640_0195327 3300046533 Bacteria 1285
1033 Ga0495640_0264897 3300046533 Bacteria 1073
1034 Ga0495586_0023861 3300046535 Bacteria 3266
1035 Ga0495587_0000017 3300046536 Bacteria 172923
1036 Ga0495587_0001485 3300046536 Bacteria 15621
1037 Ga0495587_0007045 3300046536 Bacteria 7299
1038 Ga0495587_0027867 3300046536 Bacteria 3439
1039 Ga0495645_0000014 3300046543 Bacteria 172712
1040 Ga0495645_0001772 3300046543 Bacteria 14693
1041 Ga0495645_0005456 3300046543 Bacteria 8732
1042 Ga0495645_0006715 3300046543 Bacteria 7994
1043 Ga0495622_0122301 3300046557 Bacteria 1188
1044 Ga0495633_0014822 3300046558 Bacteria 4060
1045 Ga0495667_0000031 3300046559 Bacteria 147377
1046 Ga0495667_0000946 3300046559 Bacteria 18764
1047 Ga0495667_0001192 3300046559 Bacteria 16979
1048 Ga0495667_0028745 3300046559 Bacteria 3744
1049 Ga0495656_0000732 3300046615 Bacteria 10619
1050 Ga0495656_0022605 3300046615 Bacteria 2465
1051 Ga0495656_0032351 3300046615 Unclassified 2127
1052 Ga0495656_0114226 3300046615 Bacteria 1267
1053 Ga0495634_0000006 3300046642 Bacteria 172775
1054 Ga0495634_0081048 3300046642 Bacteria 2123
1055 Ga0495611_0004409 3300046648 Bacteria 6091
1056 Ga0495611_0138392 3300046648 Unclassified 1137
1057 Ga0495635_0000030 3300046663 Bacteria 117651
1058 Ga0495635_0005492 3300046663 Bacteria 8815
1059 Ga0495635_0065331 3300046663 Bacteria 2496
1060 Ga0495659_0003385 3300046664 Bacteria 5106
1061 Ga0495588_0017873 3300046674 Bacteria 3451
1062 Ga0495588_0082164 3300046674 Bacteria 1682
1063 Ga0495588_0087559 3300046674 Bacteria 1629
1064 Ga0495588_0096485 3300046674 Bacteria 1551
1065 Ga0495657_0001166 3300046675 Bacteria 23015
1066 Ga0495657_0009684 3300046675 Bacteria 7289
1067 Ga0495657_0010489 3300046675 Bacteria 6971
1068 Ga0495657_0014123 3300046675 Bacteria 5869
1069 Ga0495599_0000002 3300046678 Bacteria 348168
1070 Ga0495599_0004625 3300046678 Bacteria 8152
1071 Ga0495599_0046992 3300046678 Bacteria 2705
1072 Ga0495599_0061804 3300046678 Bacteria 2340
1073 Ga0495599_0134932 3300046678 Bacteria 1532
1074 Ga0495623_0000035 3300046679 Bacteria 83487
1075 Ga0495623_0007498 3300046679 Bacteria 7083
1076 Ga0495623_0009450 3300046679 Bacteria 6331
1077 Ga0495646_0000018 3300046680 Bacteria 121135
1078 Ga0495646_0000846 3300046680 Bacteria 17305
1079 Ga0495646_0008509 3300046680 Bacteria 6517
1080 Ga0495646_0020336 3300046680 Bacteria 4199
1081 Ga0495647_0003820 3300046681 Bacteria 4849
1082 Ga0495647_0019115 3300046681 Bacteria 2447
1083 Ga0495647_0040526 3300046681 Unclassified 1770
1084 Ga0495647_0162747 3300046681 Bacteria 962
1085 Ga0495658_0000168 3300046683 Bacteria 37055
1086 Ga0495658_0000231 3300046683 Bacteria 31949
1087 Ga0495658_0003159 3300046683 Bacteria 8212
1088 Ga0495658_0014023 3300046683 Bacteria 4086
1089 Ga0495613_0013624 3300046689 Bacteria 6034
1090 Ga0495613_0042797 3300046689 Bacteria 3350
1091 Ga0495613_0046388 3300046689 Bacteria 3213
1092 Ga0495613_0150435 3300046689 Bacteria 1660
1093 Ga0495613_0233938 3300046689 Bacteria 1286
1094 Ga0495624_0046464 3300046690 Bacteria 2760
1095 Ga0495624_0170606 3300046690 Bacteria 1327
1096 Ga0495670_0000601 3300046691 Bacteria 17188
1097 Ga0495670_0047763 3300046691 Bacteria 2140
1098 Ga0495671_0066171 3300046692 Bacteria 1779
1099 Ga0495589_0162166 3300046794 Unclassified 1065
1100 Ga0495600_0000048 3300046809 Bacteria 70636
1101 Ga0495600_0003843 3300046809 Bacteria 8907
1102 Ga0495600_0006717 3300046809 Bacteria 7013
1103 Ga0495600_0012550 3300046809 Bacteria 5301
1104 Ga0495600_0222770 3300046809 Bacteria 1206
1105 Ga0495581_0034318 3300047315 Bacteria 2935
1106 Ga0495581_0069521 3300047315 Bacteria 2036
1107 Ga0495581_0101634 3300047315 Bacteria 1670
1108 Ga0495604_0000007 3300047317 Bacteria 412174
1109 Ga0495604_0002660 3300047317 Bacteria 14340
1110 Ga0495604_0004228 3300047317 Bacteria 11364
1111 Ga0495604_0005155 3300047317 Bacteria 10348
1112 Ga0495604_0041610 3300047317 Bacteria 3604
1113 Ga0495636_0033684 3300047318 Bacteria 2106
1114 Ga0495674_0000001 3300047319 Bacteria 778665
1115 Ga0495674_0014368 3300047319 Bacteria 7413
1116 Ga0495674_0020533 3300047319 Bacteria 6113
1117 Ga0495674_0028883 3300047319 Bacteria 5052
1118 Ga0495674_0137046 3300047319 Bacteria 2059
1119 Ga0495674_0203553 3300047319 Unclassified 1641
1120 Ga0495674_0238525 3300047319 Bacteria 1499
1121 Ga0495676_0021831 3300047321 Bacteria 5582
1122 Ga0495676_0031573 3300047321 Bacteria 4477
1123 Ga0495676_0074030 3300047321 Bacteria 2609
1124 Ga0495676_0154727 3300047321 Bacteria 1628
1125 Ga0495680_0000308 3300047322 Bacteria 54837
1126 Ga0495680_0019585 3300047322 Bacteria 5709
1127 Ga0495680_0025167 3300047322 Bacteria 4930
1128 Ga0495680_0029834 3300047322 Bacteria 4461
1129 Ga0495680_0035461 3300047322 Bacteria 4018
1130 Ga0495680_0054148 3300047322 Bacteria 3117
1131 Ga0495680_0116059 3300047322 Bacteria 1980
1132 Ga0495675_0000042 3300047444 Bacteria 85603
1133 Ga0495675_0000984 3300047444 Bacteria 17289
1134 Ga0495675_0003357 3300047444 Bacteria 9639
1135 Ga0495679_049097 3300047446 Bacteria 1274
1136 Ga0495684_0000009 3300047471 Bacteria 199436
1137 Ga0495684_0002180 3300047471 Bacteria 15670
1138 Ga0495684_0076836 3300047471 Bacteria 2536
1139 Ga0495684_0113637 3300047471 Bacteria 2042
1140 Ga0495684_0131576 3300047471 Bacteria 1879
1141 Ga0495593_0000445 3300047673 Bacteria 23167
1142 Ga0495593_0001477 3300047673 Bacteria 13808
1143 Ga0495593_0012315 3300047673 Bacteria 4887
1144 Ga0495593_0105960 3300047673 Bacteria 1438
1145 Ga0495602_0000004 3300048088 Bacteria 326932
1146 Ga0495602_0000726 3300048088 Bacteria 31111
1147 Ga0495602_0003678 3300048088 Bacteria 15899
1148 Ga0495602_0004917 3300048088 Bacteria 13994
1149 Ga0495602_0166674 3300048088 Bacteria 1714
1150 Ga0495614_0030980 3300048089 Bacteria 2303
1151 Ga0495626_0084077 3300048091 Bacteria 1409
1152 Ga0496100_0000599 3300048903 Bacteria 17022
1153 Ga0496100_0003283 3300048903 Bacteria 8408
1154 Ga0496100_0005815 3300048903 Bacteria 6671
1155 Ga0496100_0008105 3300048903 Bacteria 5845
1156 Ga0496100_0026697 3300048903 Unclassified 3543
1157 Ga0496100_0061669 3300048903 Bacteria 2471
1158 Ga0496100_0062049 3300048903 Unclassified 2465
1159 Ga0496100_0144982 3300048903 Bacteria 1687
1160 Ga0496100_0212672 3300048903 Bacteria 1415
1161 Ga0496100_0401854 3300048903 Unclassified 1043
1162 Ga0496101_0000494 3300048904 Bacteria 24861
1163 Ga0496101_0002343 3300048904 Bacteria 11621
1164 Ga0496101_0013487 3300048904 Bacteria 5476
1165 Ga0496101_0037429 3300048904 Bacteria 3441
1166 Ga0496101_0095690 3300048904 Bacteria 2215
1167 Ga0496101_0104848 3300048904 Bacteria 2121
1168 Ga0496101_0107685 3300048904 Bacteria 2094
1169 Ga0496101_0185310 3300048904 Unclassified 1604
1170 Ga0496102_0002665 3300048905 Bacteria 15185
1171 Ga0496102_0005771 3300048905 Bacteria 10526
1172 Ga0496102_0014709 3300048905 Bacteria 6802
1173 Ga0496102_0026451 3300048905 Bacteria 5175
1174 Ga0496102_0027089 3300048905 Bacteria 5118
1175 Ga0496102_0046269 3300048905 Bacteria 3951
1176 Ga0496102_0071116 3300048905 Bacteria 3194
1177 Ga0496102_0074250 3300048905 Unclassified 3125
1178 Ga0496102_0103298 3300048905 Bacteria 2650
1179 Ga0496102_0125803 3300048905 Bacteria 2396
1180 Ga0496102_0356341 3300048905 Unclassified 1377
1181 Ga0496102_0457216 3300048905 Unclassified 1197
1182 Ga0496103_0006275 3300048906 Bacteria 7107
1183 Ga0496103_0009094 3300048906 Bacteria 5883
1184 Ga0496103_0009658 3300048906 Bacteria 5712
1185 Ga0496103_0021457 3300048906 Bacteria 3885
1186 Ga0496103_0166655 3300048906 Unclassified 1413
1187 Ga0496103_0241784 3300048906 Unclassified 1161
1188 Ga0496103_0254724 3300048906 Bacteria 1129
1189 Ga0496104_0000618 3300048907 Bacteria 30466
1190 Ga0496104_0005842 3300048907 Bacteria 10776
1191 Ga0496104_0006701 3300048907 Bacteria 10136
1192 Ga0496104_0007286 3300048907 Bacteria 9761
1193 Ga0496104_0010629 3300048907 Bacteria 8224
1194 Ga0496104_0017209 3300048907 Bacteria 6576
1195 Ga0496104_0018794 3300048907 Bacteria 6311
1196 Ga0496104_0021878 3300048907 Bacteria 5873
1197 Ga0496104_0075236 3300048907 Bacteria 3215
1198 Ga0496104_0175385 3300048907 Bacteria 2054
1199 Ga0496104_0199614 3300048907 Bacteria 1912
1200 Ga0496104_0335214 3300048907 Bacteria 1425
1201 Ga0496104_0359845 3300048907 Unclassified 1367
1202 Ga0496105_0001329 3300048908 Bacteria 17318
1203 Ga0496105_0001514 3300048908 Bacteria 16426
1204 Ga0496105_0012808 3300048908 Bacteria 6647
1205 Ga0496105_0041920 3300048908 Bacteria 3772
1206 Ga0496105_0054824 3300048908 Bacteria 3291
1207 Ga0496105_0057469 3300048908 Bacteria 3212
1208 Ga0496105_0068472 3300048908 Unclassified 2932
1209 Ga0496105_0083459 3300048908 Bacteria 2638
1210 Ga0496105_0084080 3300048908 Bacteria 2628
1211 Ga0496105_0085055 3300048908 Bacteria 2613
1212 Ga0496105_0085063 3300048908 Bacteria 2613
1213 Ga0496105_0098135 3300048908 Bacteria 2419
1214 Ga0496106_0002551 3300048909 Bacteria 13535
1215 Ga0496106_0006010 3300048909 Bacteria 8977
1216 Ga0496106_0016780 3300048909 Bacteria 5418
1217 Ga0496106_0022101 3300048909 Bacteria 4725
1218 Ga0496106_0028569 3300048909 Bacteria 4154
1219 Ga0496106_0049401 3300048909 Bacteria 3168
1220 Ga0496106_0050141 3300048909 Unclassified 3145
1221 Ga0496106_0058443 3300048909 Bacteria 2919
1222 Ga0496106_0110102 3300048909 Bacteria 2143
1223 Ga0496106_0172970 3300048909 Bacteria 1712
1224 Ga0496106_0255857 3300048909 Bacteria 1401
1225 Ga0496107_0001078 3300048910 Bacteria 16394
1226 Ga0496107_0005515 3300048910 Bacteria 8658
1227 Ga0496107_0021706 3300048910 Bacteria 4536
1228 Ga0496107_0022948 3300048910 Bacteria 4411
1229 Ga0496107_0026904 3300048910 Bacteria 4082
1230 Ga0496107_0031123 3300048910 Bacteria 3805
1231 Ga0496107_0041649 3300048910 Bacteria 3298
1232 Ga0496107_0073940 3300048910 Unclassified 2479
1233 Ga0496107_0100771 3300048910 Unclassified 2117
1234 Ga0496107_0155953 3300048910 Unclassified 1690
1235 Ga0496107_0165529 3300048910 Unclassified 1639
1236 Ga0496107_0177324 3300048910 Bacteria 1582
1237 Ga0496108_0000544 3300048911 Bacteria 29516
1238 Ga0496108_0000598 3300048911 Bacteria 28277
1239 Ga0496108_0027147 3300048911 Bacteria 4724
1240 Ga0496108_0032337 3300048911 Bacteria 4346
1241 Ga0496108_0060277 3300048911 Bacteria 3193
1242 Ga0496108_0063838 3300048911 Bacteria 3101
1243 Ga0496108_0066773 3300048911 Unclassified 3034
1244 Ga0496108_0068441 3300048911 Bacteria 2996
1245 Ga0496108_0109944 3300048911 Bacteria 2356
1246 Ga0496108_0189298 3300048911 Bacteria 1783
1247 Ga0496108_0226093 3300048911 Unclassified 1626
1248 Ga0496108_0236888 3300048911 Bacteria 1587
1249 Ga0496109_0000150 3300048912 Bacteria 68777
1250 Ga0496109_0003416 3300048912 Bacteria 13286
1251 Ga0496109_0006280 3300048912 Bacteria 9999
1252 Ga0496109_0006399 3300048912 Bacteria 9914
1253 Ga0496109_0066010 3300048912 Bacteria 3312
1254 Ga0496109_0069270 3300048912 Bacteria 3235
1255 Ga0496109_0081926 3300048912 Bacteria 2973
1256 Ga0496109_0116423 3300048912 Bacteria 2487
1257 Ga0496109_0167301 3300048912 Bacteria 2062
1258 Ga0496109_0174999 3300048912 Bacteria 2014
1259 Ga0496109_0206190 3300048912 Unclassified 1848
1260 Ga0496110_0001581 3300048913 Bacteria 16633
1261 Ga0496110_0009968 3300048913 Bacteria 7707
1262 Ga0496110_0028016 3300048913 Unclassified 4834
1263 Ga0496110_0064235 3300048913 Bacteria 3243
1264 Ga0496110_0085429 3300048913 Unclassified 2816
1265 Ga0496110_0151650 3300048913 Bacteria 2099
1266 Ga0496110_0210835 3300048913 Bacteria 1766
1267 Ga0496110_0236479 3300048913 Bacteria 1662
1268 Ga0496110_0338151 3300048913 Bacteria 1371
1269 Ga0496110_0366927 3300048913 Unclassified 1312
1270 Ga0496110_0373892 3300048913 Bacteria 1298
1271 Ga0496110_0396880 3300048913 Unclassified 1257
1272 Ga0496111_0002315 3300048914 Bacteria 11464
1273 Ga0496111_0021159 3300048914 Bacteria 4538
1274 Ga0496111_0025046 3300048914 Unclassified 4208
1275 Ga0496111_0049774 3300048914 Bacteria 3021
1276 Ga0496111_0073266 3300048914 Bacteria 2494
1277 Ga0496111_0183135 3300048914 Bacteria 1557
1278 Ga0496111_0197599 3300048914 Bacteria 1495
1279 Ga0496111_0253789 3300048914 Unclassified 1305
1280 Ga0496111_0302870 3300048914 Bacteria 1185
1281 Ga0496111_0358903 3300048914 Bacteria 1079
1282 Ga0496112_0000515 3300048915 Bacteria 26277
1283 Ga0496112_0001706 3300048915 Bacteria 17153
1284 Ga0496112_0003199 3300048915 Bacteria 13476
1285 Ga0496112_0036954 3300048915 Bacteria 4765
1286 Ga0496112_0050373 3300048915 Bacteria 4083
1287 Ga0496112_0071356 3300048915 Bacteria 3432
1288 Ga0496112_0120239 3300048915 Bacteria 2596
1289 Ga0496112_0431203 3300048915 Bacteria 1256
1290 Ga0496112_0500538 3300048915 Unclassified 1150
1291 Ga0496113_0000577 3300048916 Bacteria 18288
1292 Ga0496113_0001438 3300048916 Bacteria 13225
1293 Ga0496113_0003250 3300048916 Bacteria 9693
1294 Ga0496113_0009913 3300048916 Bacteria 6278
1295 Ga0496113_0022684 3300048916 Bacteria 4444
1296 Ga0496113_0063905 3300048916 Bacteria 2782
1297 Ga0496113_0085636 3300048916 Bacteria 2421
1298 Ga0496113_0085659 3300048916 Bacteria 2420
1299 Ga0496113_0105549 3300048916 Unclassified 2187
1300 Ga0496113_0167236 3300048916 Unclassified 1740
1301 Ga0496113_0242507 3300048916 Bacteria 1438
1302 Ga0496113_0279346 3300048916 Bacteria 1335
1303 Ga0496114_0003461 3300048917 Bacteria 12111
1304 Ga0496114_0010616 3300048917 Bacteria 7326
1305 Ga0496114_0012460 3300048917 Bacteria 6807
1306 Ga0496114_0025198 3300048917 Bacteria 4860
1307 Ga0496114_0026844 3300048917 Bacteria 4717
1308 Ga0496114_0046341 3300048917 Bacteria 3613
1309 Ga0496114_0064502 3300048917 Bacteria 3067
1310 Ga0496114_0072370 3300048917 Bacteria 2899
1311 Ga0496114_0089487 3300048917 Bacteria 2612
1312 Ga0496114_0253877 3300048917 Unclassified 1547
1313 Ga0496115_0024212 3300048918 Bacteria 4716
1314 Ga0496115_0025295 3300048918 Bacteria 4621
1315 Ga0496115_0033491 3300048918 Bacteria 4056
1316 Ga0496115_0035592 3300048918 Bacteria 3940
1317 Ga0496115_0046670 3300048918 Bacteria 3463
1318 Ga0496115_0075254 3300048918 Bacteria 2742
1319 Ga0496115_0107490 3300048918 Bacteria 2290
1320 Ga0496115_0120646 3300048918 Bacteria 2157
1321 Ga0496115_0128066 3300048918 Unclassified 2092
1322 Ga0496115_0138828 3300048918 Bacteria 2005
1323 Ga0501032_0151203 3300049569 Bacteria 1526
1324 Ga0501034_0052553 3300049571 Bacteria 4104
1325 Ga0501034_0393036 3300049571 Bacteria 1310
1326 Ga0501036_0340069 3300049572 Bacteria 1253
1327 Ga0501038_0070854 3300049574 Bacteria 2958
1328 Ga0501038_0271706 3300049574 Bacteria 1336
1329 Ga0501038_0299769 3300049574 Bacteria 1262
1330 Ga0501039_0221986 3300049575 Bacteria 1486
1331 Ga0501039_0382003 3300049575 Bacteria 1106
1332 Ga0501070_0311084 3300049586 Bacteria 1282
1333 Ga0501070_0358284 3300049586 Bacteria 1183
1334 Ga0501076_0244189 3300049592 Bacteria 1469
1335 Ga0501076_0376161 3300049592 Bacteria 1167
1336 Ga0501080_0432932 3300049742 Bacteria 1181
1337 Ga0501035_0005615 3300049822 Bacteria 11843
1338 Ga0501035_0207879 3300049822 Bacteria 1676
1339 Ga0501044_0222297 3300049823 Bacteria 1839
1340 nmdc:mga03683_49041_c1 3300050489 Bacteria 1756
1341 nmdc:mga03n38_104006_c1 3300050490 Unclassified 1373
1342 nmdc:mga0yw44_135_c1 3300050492 Bacteria 25348
1343 nmdc:mga0yw44_201881_c1 3300050492 Bacteria 1313
1344 nmdc:mga0yw44_2239_c1 3300050492 Bacteria 6480
1345 nmdc:mga0yw44_37082_c1 3300050492 Bacteria 2877
1346 nmdc:mga0yw44_4842_c1 3300050492 Bacteria 6255
1347 nmdc:mga0yw44_72845_c1 3300050492 Unclassified 2136
1348 nmdc:mga06z11_10880_c1 3300050494 Bacteria 3897
1349 nmdc:mga05p37_211446_c1 3300050507 Bacteria 2344
1350 nmdc:mga05p37_223_c1 3300050507 Bacteria 57418
1351 nmdc:mga05p37_22429_c1 3300050507 Bacteria 7657
1352 nmdc:mga05p37_249786_c1 3300050507 Bacteria 2128
1353 nmdc:mga05p37_304502_c1 3300050507 Bacteria 1892
1354 nmdc:mga05p37_30735_c1 3300050507 Bacteria 2944
1355 nmdc:mga05p37_504119_c1 3300050507 Bacteria 1388
1356 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
1357 nmdc:mga09592_1434_c1 3300050508 Bacteria 19112
1358 nmdc:mga09592_47744_c1 3300050508 Bacteria 3609
1359 nmdc:mga09592_70675_c1 3300050508 Bacteria 2962
1360 nmdc:mga09592_75131_c1 3300050508 Bacteria 2872
1361 nmdc:mga0qj67_103172_c1 3300050509 Bacteria 2300
1362 nmdc:mga0qj67_26868_c1 3300050509 Bacteria 4458
1363 nmdc:mga0qj67_29779_c1 3300050509 Bacteria 4242
1364 nmdc:mga0qj67_39546_c1 3300050509 Bacteria 3704
1365 nmdc:mga06r32_155489_c1 3300050510 Bacteria 2268
1366 nmdc:mga06r32_186_c1 3300050510 Bacteria 49161
1367 nmdc:mga06r32_43726_c1 3300050510 Bacteria 4263
1368 nmdc:mga06r32_806_c1 3300050510 Bacteria 27804
1369 nmdc:mga08y16_1035_c1 3300050511 Bacteria 27236
1370 nmdc:mga08y16_176415_c1 3300050511 Bacteria 2219
1371 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
1372 nmdc:mga08y16_3000_c1 3300050511 Bacteria 17414
1373 nmdc:mga08y16_363748_c1 3300050511 Unclassified 1485
1374 nmdc:mga08y16_412252_c1 3300050511 Bacteria 1382
1375 nmdc:mga08y16_89854_c1 3300050511 Bacteria 3201
1376 nmdc:mga0n895_11211_c1 3300050512 Bacteria 7983
1377 nmdc:mga0n895_22286_c1 3300050512 Bacteria 5938
1378 nmdc:mga0n895_2402_c1 3300050512 Bacteria 14597
1379 nmdc:mga0n895_30334_c1 3300050512 Bacteria 5167
1380 nmdc:mga0n895_34308_c1 3300050512 Bacteria 4883
1381 nmdc:mga0n895_36077_c1 3300050512 Bacteria 4772
1382 nmdc:mga0n895_65248_c1 3300050512 Bacteria 3603
1383 nmdc:mga0n895_71650_c1 3300050512 Bacteria 3437
1384 nmdc:mga0n895_85077_c1 3300050512 Unclassified 3156
1385 nmdc:mga0rr50_120507_c1 3300050513 Bacteria 2088
1386 nmdc:mga0rr50_123644_c1 3300050513 Bacteria 2063
1387 nmdc:mga0rr50_15932_c1 3300050513 Bacteria 4976
1388 nmdc:mga0rr50_17917_c1 3300050513 Bacteria 4743
1389 nmdc:mga0rr50_202887_c1 3300050513 Unclassified 1630
1390 nmdc:mga0rr50_26806_c1 3300050513 Plasmid 4028
1391 nmdc:mga0rr50_59473_c1 3300050513 Bacteria 2869
1392 nmdc:mga08x19_201298_c1 3300050514 Bacteria 1365
1393 nmdc:mga08x19_59979_c1 3300050514 Bacteria 2464
1394 nmdc:mga0a205_13046_c1 3300050515 Bacteria 7716
1395 nmdc:mga0a205_16008_c1 3300050515 Bacteria 7018
1396 nmdc:mga0a205_1905_c1 3300050515 Bacteria 18117
1397 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
1398 Ga0495601_0000020 3300053077 Bacteria 160011
1399 Ga0495601_0000102 3300053077 Bacteria 46420
1400 Ga0495601_0000232 3300053077 Bacteria 29854
1401 Ga0495601_0005229 3300053077 Bacteria 7550
1402 Ga0495601_0006091 3300053077 Bacteria 7036
1403 Ga0495601_0014874 3300053077 Bacteria 4697
1404 Ga0495601_0048049 3300053077 Bacteria 2687
1405 Ga0495612_0000020 3300053078 Bacteria 137759
1406 Ga0495612_0001651 3300053078 Bacteria 9178
1407 Ga0495612_0006808 3300053078 Bacteria 4680
1408 Ga0495612_0006943 3300053078 Bacteria 4633
1409 Ga0495612_0013576 3300053078 Bacteria 3280
1410 Ga0495612_0023473 3300053078 Bacteria 2475
1411 Ga0495655_0001142 3300053083 Bacteria 4096
1412 Ga0495655_0006026 3300053083 Unclassified 2179
1413 Ga0495655_0017111 3300053083 Unclassified 1573
1414 Ga0495595_0000047 3300053084 Bacteria 62097
1415 Ga0495595_0000284 3300053084 Bacteria 19932
1416 Ga0495595_0001961 3300053084 Bacteria 7990
1417 Ga0495595_0004403 3300053084 Bacteria 5666
1418 Ga0495595_0032080 3300053084 Unclassified 2364
1419 Ga0495595_0034012 3300053084 Bacteria 2303
1420 Ga0495619_0000011 3300053085 Bacteria 287128
1421 Ga0495619_0000092 3300053085 Bacteria 69233
1422 Ga0495619_0000145 3300053085 Bacteria 52248
1423 Ga0495619_0000341 3300053085 Bacteria 32535
1424 Ga0495619_0001312 3300053085 Bacteria 16329
1425 Ga0495619_0004545 3300053085 Bacteria 8860
1426 Ga0495619_0005415 3300053085 Bacteria 8084
1427 Ga0495619_0016154 3300053085 Bacteria 4725
1428 Ga0495619_0026304 3300053085 Bacteria 3742
1429 Ga0495619_0045010 3300053085 Bacteria 2898
1430 Ga0500643_001354 3300053087 Bacteria 14257
1431 Ga0500593_002357 3300053117 Bacteria 6926
1432 Ga0500595_000029 3300053119 Bacteria 122318
1433 Ga0500595_017223 3300053119 Bacteria 2672
1434 Ga0500652_000086 3300053131 Bacteria 38984
1435 Ga0500636_0023610 3300053177 Bacteria 3635
1436 Ga0501084_0203268 3300054114 Bacteria 1672
1437 JGI24746J21847_1000713
1438 JGI24746J21847_1013634
1439 JGI24739J22299_10002354
1440 JGI24739J22299_10018214
1441 JGI24737J22298_10000583
1442 JGI24737J22298_10041560
1443 JGI24750J21931_1000574
1444 JGI24745J21846_1000334
1445 JGI24745J21846_1008400
1446 JGI24738J21930_10021266
1447 JGI24744J21845_10000414
1448 JGI24744J21845_10009162
1449 JGI24744J21845_10013844
1450 JGI24034J26672_10000259
1451 JGI24034J26672_10000505
1452 JGI24034J26672_10016114
1453 JGI24742J22300_10000043
1454 JGI25405J52794_10002442
1455 Ga0065712_10070182
1456 Ga0065715_10259753
1457 Ga0070676_10021315
1458 Ga0070676_10049580
1459 Ga0070676_10078722
1460 Ga0070676_10189854
1461 Ga0070683_100000656
1462 Ga0070683_100003103
1463 Ga0070683_100074077
1464 Ga0070683_100077908
1465 Ga0070683_100103903
1466 Ga0070683_100359163
1467 Ga0070690_100001658
1468 Ga0070690_100001831
1469 Ga0070690_100032490
1470 Ga0070690_100142366
1471 Ga0070670_100002207
1472 Ga0070670_100016346
1473 Ga0070670_100067176
1474 Ga0070670_100092366
1475 Ga0070670_100108703
1476 Ga0070670_100154184
1477 Ga0070670_100274015
1478 Ga0070677_10000076
1479 Ga0070677_10006595
1480 Ga0068869_100000216
1481 Ga0068869_100003321
1482 Ga0068869_100016912
1483 Ga0068869_100020350
1484 Ga0068869_100218176
1485 Ga0068869_100277554
1486 Ga0070666_10002180
1487 Ga0070666_10017246
1488 Ga0070666_10020081
1489 Ga0070666_10050722
1490 Ga0070666_10072560
1491 Ga0070680_100002960
1492 Ga0070680_100003735
1493 Ga0070680_100019228
1494 Ga0070682_100000285
1495 Ga0070682_100011413
1496 Ga0070682_100031677
1497 Ga0070682_100049267
1498 Ga0070682_100073428
1499 Ga0070682_100122865
1500 Ga0068868_100000474
1501 Ga0068868_100089186
1502 Ga0068868_100253399
1503 Ga0070660_100000874
1504 Ga0070660_100001332
1505 Ga0070660_100049252
1506 Ga0070689_100004112
1507 Ga0070689_100011551
1508 Ga0070689_100044257
1509 Ga0070689_100406625
1510 Ga0070691_10001440
1511 Ga0070691_10023960
1512 Ga0070691_10033534
1513 Ga0070687_100005766
1514 Ga0070661_100002370
1515 Ga0070661_100023545
1516 Ga0070661_100054477
1517 Ga0070692_10000173
1518 Ga0070692_10000841
1519 Ga0070668_100002051
1520 Ga0070668_100202879
1521 Ga0070669_100001956
1522 Ga0070669_100011387
1523 Ga0070675_100000622
1524 Ga0070675_100057314
1525 Ga0070675_100068345
1526 Ga0070675_100206227
1527 Ga0070671_100001629
1528 Ga0070671_100012131
1529 Ga0070671_100018516
1530 Ga0070671_100095238
1531 Ga0070671_100132167
1532 Ga0070671_100250920
1533 Ga0070674_100027715
1534 Ga0070674_100047491
1535 Ga0070674_100105650
1536 Ga0070674_100210530
1537 Ga0070674_100233068
1538 Ga0070673_100000418
1539 Ga0070673_100000640
1540 Ga0070673_100037488
1541 Ga0070673_100070898
1542 Ga0070673_100189629
1543 Ga0070688_100000906
1544 Ga0070688_100001260
1545 Ga0070688_100008005
1546 Ga0070688_100061411
1547 Ga0070688_100132522
1548 Ga0070659_100001362
1549 Ga0070659_100003550
1550 Ga0070659_100037636
1551 Ga0070659_100062209
1552 Ga0070659_100437291
1553 Ga0070667_100001650
1554 Ga0070667_100015334
1555 Ga0070667_100035664
1556 Ga0070667_100104193
1557 Ga0070667_100188861
1558 Ga0070667_100292313
1559 Ga0070703_10003120
1560 Ga0070709_10004958
1561 Ga0070709_10007315
1562 Ga0070709_10175311
1563 Ga0070709_10338479
1564 Ga0070714_100027432
1565 Ga0070714_100033507
1566 Ga0070714_100050626
1567 Ga0070714_100069271
1568 Ga0070714_100155094
1569 Ga0070713_100000526
1570 Ga0070713_100069032
1571 Ga0070713_100073376
1572 Ga0070713_100241283
1573 Ga0070713_100293160
1574 Ga0070710_10021860
1575 Ga0070710_10024235
1576 Ga0070701_10000264
1577 Ga0070701_10015338
1578 Ga0070701_10041566
1579 Ga0070711_100017524
1580 Ga0070711_100092561
1581 Ga0070711_100103772
1582 Ga0070705_100001279
1583 Ga0070705_100067351
1584 Ga0070705_100177813
1585 Ga0070700_100004852
1586 Ga0070700_100010848
1587 Ga0070700_100030981
1588 Ga0070700_100072767
1589 Ga0070694_100000576
1590 Ga0070694_100002530
1591 Ga0070708_100150592
1592 Ga0070663_100001039
1593 Ga0070663_100014289
1594 Ga0070663_100016904
1595 Ga0070663_100110880
1596 Ga0070663_100210250
1597 Ga0070678_100008209
1598 Ga0070678_100009636
1599 Ga0070678_100036667
1600 Ga0070678_100040359
1601 Ga0070678_100107360
1602 Ga0070662_100009914
1603 Ga0070662_100064734
1604 Ga0070662_100183385
1605 Ga0070662_100237177
1606 Ga0070681_10008583
1607 Ga0070681_10008649
1608 Ga0070681_10152054
1609 Ga0070681_10236056
1610 Ga0070681_10372367
1611 Ga0070681_10465262
1612 Ga0068867_100048243
1613 Ga0070685_10000645
1614 Ga0070685_10039257
1615 Ga0070685_10043864
1616 Ga0070685_10106134
1617 Ga0070707_100117784
1618 Ga0070699_100000676
1619 Ga0070699_100077901
1620 Ga0070699_100315526
1621 Ga0070679_100021636
1622 Ga0070679_100032292
1623 Ga0070679_100070445
1624 Ga0070679_100102817
1625 Ga0070679_100589355
1626 Ga0070684_100001969
1627 Ga0070684_100002245
1628 Ga0070684_100124386
1629 Ga0070684_100133700
1630 Ga0070684_100417922
1631 Ga0070697_100070677
1632 Ga0070697_100081262
1633 Ga0068853_100005266
1634 Ga0068853_100206837
1635 Ga0068853_100246551
1636 Ga0070672_100021363
1637 Ga0070672_100079680
1638 Ga0070672_100212707
1639 Ga0070686_100001137
1640 Ga0070686_100002237
1641 Ga0070686_100003181
1642 Ga0070686_100014107
1643 Ga0070686_100064365
1644 Ga0070695_100011111
1645 Ga0070696_100007394
1646 Ga0070696_100036204
1647 Ga0070696_100158540
1648 Ga0070696_100218345
1649 Ga0070693_100001170
1650 Ga0070693_100008690
1651 Ga0070693_100012214
1652 Ga0070693_100059626
1653 Ga0070693_100087770
1654 Ga0070665_100167945
1655 Ga0070665_100200619
1656 Ga0070665_100217209
1657 Ga0070704_100000444
1658 Ga0070704_100226163
1659 Ga0068855_100004774
1660 Ga0068855_100010841
1661 Ga0068855_100018831
1662 Ga0068855_100095578
1663 Ga0070664_100000973
1664 Ga0070664_100112001
1665 Ga0070664_100124567
1666 Ga0070664_100126441
1667 Ga0070664_100155637
1668 Ga0070664_100171499
1669 Ga0070664_100307618
1670 Ga0070664_100311117
1671 Ga0070664_100334521
1672 Ga0068857_100001725
1673 Ga0068857_100002282
1674 Ga0068857_100134067
1675 Ga0068857_100391336
1676 Ga0068854_100008414
1677 Ga0068854_100017017
1678 Ga0068854_100026506
1679 Ga0068854_100153246
1680 Ga0068856_100002597
1681 Ga0068856_100006444
1682 Ga0068856_100123648
1683 Ga0068856_100170868
1684 Ga0068856_100220706
1685 Ga0068856_100337961
1686 Ga0068856_100395393
1687 Ga0070702_100012214
1688 Ga0070702_100022622
1689 Ga0070702_100023822
1690 Ga0070702_100047628
1691 Ga0070702_100097801
1692 Ga0068852_100003186
1693 Ga0068852_100015271
1694 Ga0068852_100034442
1695 Ga0068852_100063194
1696 Ga0068852_100164676
1697 Ga0068852_100434768
1698 Ga0068859_100002825
1699 Ga0068859_100005044
1700 Ga0068859_100094085
1701 Ga0068859_100260494
1702 Ga0068864_100003691
1703 Ga0068864_100004392
1704 Ga0068864_100039550
1705 Ga0068864_100168540
1706 Ga0068864_100279590
1707 Ga0068866_10000294
1708 Ga0068861_100003318
1709 Ga0068861_100025608
1710 Ga0068861_100146275
1711 Ga0068851_10041359
1712 Ga0068851_10047424
1713 Ga0068870_10000048
1714 Ga0068870_10000555
1715 Ga0068870_10014085
1716 Ga0068870_10107612
1717 Ga0068863_100001975
1718 Ga0068863_100023486
1719 Ga0068863_100032997
1720 Ga0068863_100070126
1721 Ga0068863_100120391
1722 Ga0068863_100144908
1723 Ga0068863_100372628
1724 Ga0068858_100003376
1725 Ga0068858_100026265
1726 Ga0068858_100090996
1727 Ga0068858_100095411
1728 Ga0068858_100230357
1729 Ga0068860_100000933
1730 Ga0068860_100021346
1731 Ga0068860_100028676
1732 Ga0068860_100063529
1733 Ga0068860_100184584
1734 Ga0068862_100002722
1735 Ga0068862_100003011
1736 Ga0068862_100056146
1737 Ga0081455_10004363
1738 Ga0081455_10008450
1739 Ga0081455_10028599
1740 Ga0081455_10083437
1741 Ga0081455_10127627
1742 Ga0081538_10001450
1743 Ga0081540_1000413
1744 Ga0081540_1035995
1745 Ga0070717_10000425
1746 Ga0075365_10006308
1747 Ga0075365_10014812
1748 Ga0075365_10120548
1749 Ga0075368_10095769
1750 Ga0075363_100220534
1751 Ga0075364_10141796
1752 Ga0070715_10000739
1753 Ga0070715_10014909
1754 Ga0070715_10053517
1755 Ga0070716_100001906
1756 Ga0070716_100128096
1757 Ga0070712_100026897
1758 Ga0070712_100037354
1759 Ga0070712_100041503
1760 Ga0075367_10006690
1761 Ga0075427_10000239
1762 Ga0097621_100000833
1763 Ga0097621_100004811
1764 Ga0097621_100010471
1765 Ga0097621_100028375
1766 Ga0097621_100037965
1767 Ga0097621_100094813
1768 Ga0068871_100015994
1769 Ga0068871_100027741
1770 Ga0068871_100097250
1771 Ga0075428_100054688
1772 Ga0075428_100060487
1773 Ga0075428_100100973
1774 Ga0075428_100101032
1775 Ga0075428_100215306
1776 Ga0075428_100509652
1777 Ga0075430_100002831
1778 Ga0075430_100045973
1779 Ga0075430_100068729
1780 Ga0075431_100000132
1781 Ga0075431_100015471
1782 Ga0075431_100035687
1783 Ga0075431_100115025
1784 Ga0075431_100238948
1785 Ga0075431_100441237
1786 Ga0075433_10002201
1787 Ga0075433_10005076
1788 Ga0075433_10051260
1789 Ga0075433_10110922
1790 Ga0075434_100002941
1791 Ga0075434_100004401
1792 Ga0075434_100026478
1793 Ga0075434_100027637
1794 Ga0075434_100044384
1795 Ga0075434_100050708
1796 Ga0075434_100053446
1797 Ga0075434_100086641
1798 Ga0075434_100127829
1799 Ga0075434_100157576
1800 Ga0075429_100002461
1801 Ga0075429_100061162
1802 Ga0075429_100109548
1803 Ga0075429_100113010
1804 Ga0075429_100237924
1805 Ga0068865_100009219
1806 Ga0068865_100014125
1807 Ga0068865_100038489
1808 Ga0068865_100064695
1809 Ga0068865_100357772
1810 Ga0075436_100154946
1811 Ga0097620_100002825
1812 Ga0097620_100005044
1813 Ga0097620_100094083
1814 Ga0097620_100260496
1815 Ga0075435_100014230
1816 Ga0075435_100036370
1817 Ga0075435_100071058
1818 Ga0075435_100097503
1819 Ga0075435_100135975
1820 Ga0075435_100170095
1821 Ga0075435_100185871
1822 Ga0075435_100333834
1823 Ga0105251_10060310
1824 Ga0105250_10016499
1825 Ga0105240_10003696
1826 Ga0105240_10054446
1827 Ga0105240_10121756
1828 Ga0105240_10295109
1829 Ga0105240_10347654
1830 Ga0105240_10470698
1831 Ga0111539_10000933
1832 Ga0111539_10002792
1833 Ga0111539_10004846
1834 Ga0111539_10020347
1835 Ga0111539_10080968
1836 Ga0111539_10253638
1837 Ga0111539_10343015
1838 Ga0111539_10594110
1839 Ga0105245_10000370
1840 Ga0105245_10051898
1841 Ga0105245_10076963
1842 Ga0105245_10105703
1843 Ga0105245_10383175
1844 Ga0105245_10638626
1845 Ga0105247_10000941
1846 Ga0105247_10032611
1847 Ga0105247_10054178
1848 Ga0105247_10124738
1849 Ga0105247_10191132
1850 Ga0105247_10203221
1851 Ga0105247_10216652
1852 Ga0105247_10257280
1853 Ga0114129_10000280
1854 Ga0114129_10001684
1855 Ga0114129_10003178
1856 Ga0114129_10005006
1857 Ga0114129_10039645
1858 Ga0114129_10044181
1859 Ga0114129_10651977
1860 Ga0105243_10003132
1861 Ga0105243_10041794
1862 Ga0105243_10042428
1863 Ga0105243_10051976
1864 Ga0105243_10112672
1865 Ga0105243_10139323
1866 Ga0105241_10003551
1867 Ga0105241_10081736
1868 Ga0105241_10239450
1869 Ga0105241_10244204
1870 Ga0105241_10259968
1871 Ga0105242_10001245
1872 Ga0105242_10035192
1873 Ga0105242_10060537
1874 Ga0105242_10084063
1875 Ga0105242_10198287
1876 Ga0105242_10257844
1877 Ga0105248_10001324
1878 Ga0105248_10005301
1879 Ga0105248_10005481
1880 Ga0105248_10053771
1881 Ga0105248_10223547
1882 Ga0105248_10396853
1883 Ga0105248_10446949
1884 Ga0105237_10032477
1885 Ga0105237_10057636
1886 Ga0105237_10069508
1887 Ga0105237_10184271
1888 Ga0105238_10040095
1889 Ga0105238_10050719
1890 Ga0105238_10099024
1891 Ga0105238_10427661
1892 Ga0105249_10002759
1893 Ga0105249_10023209
1894 Ga0105249_10196964
1895 Ga0105249_10209557
1896 Ga0105239_10091805
1897 Ga0105239_10163498
1898 Ga0105239_10295664
1899 Ga0105239_10424323
1900 Ga0105239_10503383
1901 Ga0105246_10000510
1902 Ga0105246_10028412
1903 Ga0105246_10030976
1904 Ga0105246_10060545
1905 Ga0105246_10093394
1906 Ga0105246_10187645
1907 Ga0105246_10295276
1908 Ga0157373_10007085
1909 Ga0157373_10008396
1910 Ga0157371_10008538
1911 Ga0157371_10136722
1912 Ga0157370_10008485
1913 Ga0157370_10223385
1914 Ga0157369_10195186
1915 Ga0157374_10001994
1916 Ga0157374_10017984
1917 Ga0157374_10024070
1918 Ga0157374_10025719
1919 Ga0157374_10071030
1920 Ga0157374_10213049
1921 Ga0157374_10363961
1922 Ga0157378_10006053
1923 Ga0157378_10104314
1924 Ga0157378_10111319
1925 Ga0157378_10193990
1926 Ga0163162_10008106
1927 Ga0163162_10212728
1928 Ga0163162_10297967
1929 Ga0157372_10005559
1930 Ga0157372_10010864
1931 Ga0157372_10271211
1932 Ga0157375_10003733
1933 Ga0157375_10004143
1934 Ga0157375_10156389
1935 Ga0157375_10272680
1936 Ga0163163_10004364
1937 Ga0163163_10011627
1938 Ga0163163_10016172
1939 Ga0163163_10030715
1940 Ga0163163_10035735
1941 Ga0163163_10081094
1942 Ga0163163_10223536
1943 Ga0163163_10238937
1944 Ga0157380_10001925
1945 Ga0157380_10182811
1946 Ga0157377_10000101
1947 Ga0157377_10034073
1948 Ga0157377_10060655
1949 Ga0157379_10004422
1950 Ga0157379_10015102
1951 Ga0157379_10040063
1952 Ga0157379_10103927
1953 Ga0157379_10129808
1954 Ga0157379_10227835
1955 Ga0157379_10245194
1956 Ga0157379_10325561
1957 Ga0157376_10003977
1958 Ga0157376_10019988
1959 Ga0157376_10059403
1960 Ga0157376_10355128
1961 Ga0163161_10006193
1962 Ga0163161_10023300
1963 Ga0163161_10183238
1964 Ga0163161_10458922
1965 Ga0207666_1000044
1966 Ga0207666_1000084
1967 Ga0207673_1000183
1968 Ga0207697_10000051
1969 Ga0207697_10002615
1970 Ga0207656_10064533
1971 Ga0207653_10000964
1972 Ga0207653_10001329
1973 Ga0207682_10000635
1974 Ga0207682_10000815
1975 Ga0207692_10025329
1976 Ga0207642_10004273
1977 Ga0207642_10024909
1978 Ga0207642_10084375
1979 Ga0207710_10002302
1980 Ga0207710_10002328
1981 Ga0207710_10013441
1982 Ga0207710_10047672
1983 Ga0207710_10047879
1984 Ga0207688_10000044
1985 Ga0207688_10000197
1986 Ga0207688_10000346
1987 Ga0207688_10003234
1988 Ga0207680_10002632
1989 Ga0207680_10009774
1990 Ga0207680_10024713
1991 Ga0207680_10046995
1992 Ga0207647_10002117
1993 Ga0207647_10006669
1994 Ga0207647_10017129
1995 Ga0207647_10072136
1996 Ga0207685_10002628
1997 Ga0207685_10046112
1998 Ga0207685_10058465
1999 Ga0207699_10000760
2000 Ga0207699_10037393
2001 Ga0207699_10176167
2002 Ga0207645_10000218
2003 Ga0207645_10002258
2004 Ga0207645_10007653
2005 Ga0207645_10043351
2006 Ga0207645_10096759
2007 Ga0207643_10000400
2008 Ga0207643_10000870
2009 Ga0207643_10001076
2010 Ga0207643_10005389
2011 Ga0207705_10237662
2012 Ga0207654_10004223
2013 Ga0207654_10020598
2014 Ga0207654_10058636
2015 Ga0207654_10077921
2016 Ga0207654_10180532
2017 Ga0207654_10183667
2018 Ga0207654_10191974
2019 Ga0207707_10005047
2020 Ga0207707_10006308
2021 Ga0207707_10073600
2022 Ga0207707_10419616
2023 Ga0207695_10023341
2024 Ga0207695_10072321
2025 Ga0207695_10090219
2026 Ga0207695_10275543
2027 Ga0207695_10431288
2028 Ga0207671_10038266
2029 Ga0207671_10064215
2030 Ga0207671_10224789
2031 Ga0207693_10003582
2032 Ga0207693_10010960
2033 Ga0207693_10013445
2034 Ga0207693_10013697
2035 Ga0207693_10048449
2036 Ga0207693_10064100
2037 Ga0207693_10076592
2038 Ga0207693_10088411
2039 Ga0207693_10128732
2040 Ga0207663_10019001
2041 Ga0207663_10038225
2042 Ga0207663_10041665
2043 Ga0207663_10050950
2044 Ga0207663_10083386
2045 Ga0207663_10273245
2046 Ga0207660_10000571
2047 Ga0207660_10005879
2048 Ga0207660_10028355
2049 Ga0207660_10091758
2050 Ga0207660_10438880
2051 Ga0207662_10000100
2052 Ga0207662_10000677
2053 Ga0207662_10002523
2054 Ga0207662_10008813
2055 Ga0207662_10196108
2056 Ga0207657_10002107
2057 Ga0207657_10004436
2058 Ga0207657_10038965
2059 Ga0207657_10040555
2060 Ga0207657_10042518
2061 Ga0207657_10183166
2062 Ga0207649_10000310
2063 Ga0207649_10059114
2064 Ga0207649_10354882
2065 Ga0207652_10005950
2066 Ga0207652_10017065
2067 Ga0207652_10063415
2068 Ga0207652_10065747
2069 Ga0207652_10149260
2070 Ga0207646_10058492
2071 Ga0207646_10449813
2072 Ga0207681_10000803
2073 Ga0207681_10014449
2074 Ga0207694_10050279
2075 Ga0207694_10060883
2076 Ga0207694_10373693
2077 Ga0207650_10005586
2078 Ga0207650_10022154
2079 Ga0207650_10040740
2080 Ga0207650_10042885
2081 Ga0207650_10050106
2082 Ga0207650_10110410
2083 Ga0207650_10203227
2084 Ga0207659_10000040
2085 Ga0207659_10010644
2086 Ga0207659_10278066
2087 Ga0207687_10001077
2088 Ga0207687_10038537
2089 Ga0207687_10040562
2090 Ga0207687_10051128
2091 Ga0207687_10111076
2092 Ga0207687_10231836
2093 Ga0207700_10000797
2094 Ga0207700_10007214
2095 Ga0207700_10018216
2096 Ga0207700_10211012
2097 Ga0207664_10013394
2098 Ga0207664_10076626
2099 Ga0207664_10097727
2100 Ga0207664_10144815
2101 Ga0207664_10460634
2102 Ga0207644_10020275
2103 Ga0207644_10032566
2104 Ga0207644_10054704
2105 Ga0207644_10113443
2106 Ga0207644_10164013
2107 Ga0207690_10000277
2108 Ga0207706_10003292
2109 Ga0207706_10007125
2110 Ga0207706_10048791
2111 Ga0207706_10074280
2112 Ga0207706_10095177
2113 Ga0207706_10152305
2114 Ga0207706_10155882
2115 Ga0207686_10001074
2116 Ga0207686_10007975
2117 Ga0207686_10028342
2118 Ga0207686_10064279
2119 Ga0207686_10095353
2120 Ga0207686_10110287
2121 Ga0207686_10206335
2122 Ga0207709_10003933
2123 Ga0207709_10020822
2124 Ga0207709_10036589
2125 Ga0207670_10000977
2126 Ga0207670_10028475
2127 Ga0207670_10224640
2128 Ga0207669_10000347
2129 Ga0207669_10046437
2130 Ga0207669_10242318
2131 Ga0207704_10000624
2132 Ga0207704_10011417
2133 Ga0207704_10050233
2134 Ga0207704_10103788
2135 Ga0207665_10002407
2136 Ga0207665_10013442
2137 Ga0207665_10040630
2138 Ga0207691_10000940
2139 Ga0207691_10002224
2140 Ga0207691_10003147
2141 Ga0207691_10027700
2142 Ga0207691_10315431
2143 Ga0207711_10003275
2144 Ga0207711_10014033
2145 Ga0207711_10016938
2146 Ga0207711_10023511
2147 Ga0207711_10094257
2148 Ga0207711_10166756
2149 Ga0207689_10000514
2150 Ga0207689_10002387
2151 Ga0207689_10012049
2152 Ga0207689_10047365
2153 Ga0207689_10165614
2154 Ga0207689_10254067
2155 Ga0207661_10000191
2156 Ga0207661_10089799
2157 Ga0207679_10000099
2158 Ga0207679_10001868
2159 Ga0207679_10075118
2160 Ga0207679_10203207
2161 Ga0207679_10393891
2162 Ga0207667_10014048
2163 Ga0207667_10054765
2164 Ga0207667_10060608
2165 Ga0207667_10139859
2166 Ga0207651_10000202
2167 Ga0207651_10035179
2168 Ga0207651_10050584
2169 Ga0207651_10177174
2170 Ga0207712_10001297
2171 Ga0207712_10004060
2172 Ga0207712_10038043
2173 Ga0207712_10111375
2174 Ga0207712_10310894
2175 Ga0207668_10001518
2176 Ga0207668_10003969
2177 Ga0207668_10047240
2178 Ga0207668_10060574
2179 Ga0207668_10187902
2180 Ga0207640_10000425
2181 Ga0207640_10105205
2182 Ga0207658_10003433
2183 Ga0207658_10015942
2184 Ga0207658_10217708
2185 Ga0207658_10296336
2186 Ga0207677_10000495
2187 Ga0207677_10053257
2188 Ga0207703_10003491
2189 Ga0207703_10030257
2190 Ga0207703_10036654
2191 Ga0207703_10045294
2192 Ga0207703_10050838
2193 Ga0207703_10081190
2194 Ga0207639_10043894
2195 Ga0207639_10052294
2196 Ga0207639_10081399
2197 Ga0207678_10002254
2198 Ga0207678_10005396
2199 Ga0207678_10017170
2200 Ga0207678_10038688
2201 Ga0207678_10189769
2202 Ga0207678_10233462
2203 Ga0207708_10000602
2204 Ga0207708_10000636
2205 Ga0207708_10001067
2206 Ga0207708_10002106
2207 Ga0207702_10012003
2208 Ga0207702_10032777
2209 Ga0207702_10064691
2210 Ga0207702_10098210
2211 Ga0207702_10225900
2212 Ga0207702_10230426
2213 Ga0207641_10000246
2214 Ga0207641_10017711
2215 Ga0207641_10047921
2216 Ga0207641_10066361
2217 Ga0207641_10175259
2218 Ga0207641_10349243
2219 Ga0207641_10370072
2220 Ga0207648_10000575
2221 Ga0207648_10004636
2222 Ga0207648_10007651
2223 Ga0207648_10009899
2224 Ga0207676_10002628
2225 Ga0207676_10042856
2226 Ga0207676_10139934
2227 Ga0207676_10167958
2228 Ga0207674_10002439
2229 Ga0207674_10003170
2230 Ga0207674_10163778
2231 Ga0207675_100002589
2232 Ga0207675_100002803
2233 Ga0207675_100004434
2234 Ga0207683_10002498
2235 Ga0207683_10004946
2236 Ga0207683_10016507
2237 Ga0207683_10022331
2238 Ga0207683_10083734
2239 Ga0207683_10083994
2240 Ga0207698_10004542
2241 Ga0207698_10029601
2242 Ga0207698_10072912
2243 Ga0207698_10110705
2244 Ga0209973_1008503
2245 Ga0210002_1000370
2246 Ga0210002_1017154
2247 Ga0209966_1001412
2248 Ga0209998_10000754
2249 Ga0209998_10006767
2250 Ga0209974_10000697
2251 Ga0209974_10000776
2252 Ga0209974_10021914
2253 Ga0207428_10000114
2254 Ga0207428_10000736
2255 Ga0207428_10003035
2256 Ga0207428_10022508
2257 Ga0207428_10053222
2258 Ga0207428_10170899
2259 Ga0268266_10010491
2260 Ga0268266_10011314
2261 Ga0268266_10291610
2262 Ga0268266_10310139
2263 Ga0268265_10001326
2264 Ga0268264_10001756
2265 Ga0268264_10055713
2266 Ga0268264_10075492
2267 Ga0268264_10158476
2268 Ga0268264_10258764
2269 Ga0265316_10242379
2270 Ga0265313_10106101
2271 Ga0265314_10020384
2272 Ga0373948_0006733
2273 Ga0373948_0009864
2274 Ga0373950_0011829
2275 Ga0373950_0013207
2276 Ga0373958_0018799
2277 Ga0373959_0007572
2278 Ga0373959_0016796
2279 Ga0373959_0041169
2280 Ga0373938_0001319
2281 Ga0373938_0003528
2282 Ga0373926_0057044
2283 Ga0373929_0000610
2284 Ga0373934_0003180
2285 Ga0373944_0000935
2286 Ga0373949_0004952
2287 Ga0373949_0020344
2288 Ga0373949_0023302
2289 Ga0373951_0002481
2290 Ga0373951_0031210
2291 Ga0373951_0034107
2292 Ga0373952_0002203
2293 Ga0373952_0004061
2294 Ga0373952_0004766
2295 Ga0373952_0010320
2296 Ga0373923_0002833
2297 Ga0373932_0001277
2298 Ga0373932_0002476
2299 Ga0373932_0003953
2300 Ga0373936_0015396
2301 Ga0373936_0035356
2302 Ga0373939_0000468
2303 Ga0373939_0002068
2304 Ga0373939_0007403
2305 Ga0373939_0010870
2306 Ga0373941_0002202
2307 Ga0373941_0008826
2308 Ga0373945_0026621
2309 Ga0373945_0029517
2310 Ga0373953_0001292
2311 Ga0373953_0002191
2312 Ga0373954_0003589
2313 Ga0373954_0011165
2314 Ga0373954_0158873
2315 Ga0373956_0008912
2316 Ga0373957_0009377
2317 Ga0373957_0016179
2318 Ga0373960_0000452
2319 Ga0373943_0001197
2320 Ga0373943_0011130
2321 Ga0373946_0005850
2322 Ga0373946_0010839
2323 Ga0373946_0012003
2324 Ga0373946_0015351
2325 Ga0373946_0021449
2326 Ga0373946_0029291
2327 Ga0373955_0004054
2328 Ga0373955_0024756
2329 Ga0373955_0025589
2330 Ga0373942_0007530
2331 Ga0373961_0005726
2332 Ga0373961_0008407
2333 Ga0373962_0000361
2334 Ga0373962_0001735
2335 Ga0373962_0009557
2336 Ga0373924_0001111
2337 Ga0373924_0027816
2338 Ga0373931_0002564
2339 Ga0373931_0011637
2340 Ga0373931_0060942
2341 Ga0373931_0066208
2342 Ga0373931_0118904
2343 Ga0373935_0000031
2344 Ga0373935_0025316
2345 Ga0373935_0030558
2346 Ga0373935_0073887
2347 Ga0373927_0007930
2348 Ga0373927_0011771
2349 Ga0373927_0067477
2350 Ga0373927_0083378
2351 Ga0373927_0098526
2352 Ga0373933_0005826
2353 Ga0373933_0027473
2354 Ga0373933_0028344
2355 Ga0373933_0038755
2356 Ga0373947_0000337
2357 Ga0373947_0002335
2358 Ga0373947_0018603
2359 Ga0373947_0037682
2360 Ga0373947_0112565
2361 Ga0373937_0001998
2362 Ga0373937_0003071
2363 Ga0373937_0003498
2364 Ga0373937_0077081
2365 Ga0373925_0000047
2366 Ga0373925_0005753
2367 Ga0373925_0010508
2368 Ga0373925_0017707
2369 Ga0373925_0079176
2370 Ga0373925_0093163
2371 Ga0395900_0319016
2372 Ga0395898_0060592
2373 Ga0436361_0333066
2374 Ga0439450_025453
2375 Ga0439460_0028405
2376 Ga0451576_0335448
2377 Ga0495617_021029
2378 Ga0495592_0000323
2379 Ga0495592_0008480
2380 Ga0495592_0090327
2381 Ga0495603_0001898
2382 Ga0495603_0012206
2383 Ga0495603_0014063
2384 Ga0495629_0000702
2385 Ga0495629_0002648
2386 Ga0495629_0004812
2387 Ga0495629_0047533
2388 Ga0495629_0257027
2389 Ga0495638_0022247
2390 Ga0495641_0045936
2391 Ga0495641_0054933
2392 Ga0495641_0063745
2393 Ga0495651_0000168
2394 Ga0495651_0003967
2395 Ga0495651_0012590
2396 Ga0495651_0034589
2397 Ga0495651_0183700
2398 Ga0495653_0000027
2399 Ga0495653_0002433
2400 Ga0495653_0008661
2401 Ga0495653_0033947
2402 Ga0495580_0136092
2403 Ga0495580_0175582
2404 Ga0495582_0000474
2405 Ga0495582_0002635
2406 Ga0495582_0025361
2407 Ga0495605_0039794
2408 Ga0495639_0004100
2409 Ga0495639_0028580
2410 Ga0495662_0001316
2411 Ga0495662_0016190
2412 Ga0495662_0043342
2413 Ga0495662_0057181
2414 Ga0495662_0058970
2415 Ga0495662_0128917
2416 Ga0495664_0000021
2417 Ga0495664_0000711
2418 Ga0495664_0000935
2419 Ga0495664_0003490
2420 Ga0495664_0027844
2421 Ga0495664_0049247
2422 Ga0495584_0015280
2423 Ga0495584_0056389
2424 Ga0495584_0155704
2425 Ga0495585_0016608
2426 Ga0495585_0018040
2427 Ga0495585_0060278
2428 Ga0495585_0129065
2429 Ga0495594_0016308
2430 Ga0495594_0054286
2431 Ga0495594_0094064
2432 Ga0495594_0173263
2433 Ga0495607_0168045
2434 Ga0495608_0000020
2435 Ga0495608_0006100
2436 Ga0495608_0013077
2437 Ga0495608_0034751
2438 Ga0495608_0067176
2439 Ga0495618_0000117
2440 Ga0495618_0006438
2441 Ga0495618_0048829
2442 Ga0495618_0121698
2443 Ga0495628_0000005
2444 Ga0495628_0011629
2445 Ga0495628_0015728
2446 Ga0495628_0032685
2447 Ga0495630_0016774
2448 Ga0495630_0177353
2449 Ga0495630_0199135
2450 Ga0495630_0290822
2451 Ga0495630_0380009
2452 Ga0495637_0023766
2453 Ga0495644_0026102
2454 Ga0495644_0066531
2455 Ga0495644_0089890
2456 Ga0495666_0003661
2457 Ga0495652_0000001
2458 Ga0495652_0003397
2459 Ga0495652_0013212
2460 Ga0495652_0039522
2461 Ga0495652_0065876
2462 Ga0495652_0110539
2463 Ga0495654_0067503
2464 Ga0495640_0000035
2465 Ga0495640_0007191
2466 Ga0495640_0025502
2467 Ga0495640_0088104
2468 Ga0495640_0195327
2469 Ga0495640_0264897
2470 Ga0495586_0023861
2471 Ga0495587_0000017
2472 Ga0495587_0001485
2473 Ga0495587_0007045
2474 Ga0495587_0027867
2475 Ga0495645_0000014
2476 Ga0495645_0001772
2477 Ga0495645_0005456
2478 Ga0495645_0006715
2479 Ga0495622_0122301
2480 Ga0495633_0014822
2481 Ga0495667_0000031
2482 Ga0495667_0000946
2483 Ga0495667_0001192
2484 Ga0495667_0028745
2485 Ga0495656_0000732
2486 Ga0495656_0022605
2487 Ga0495656_0032351
2488 Ga0495656_0114226
2489 Ga0495634_0000006
2490 Ga0495634_0081048
2491 Ga0495611_0004409
2492 Ga0495611_0138392
2493 Ga0495635_0000030
2494 Ga0495635_0005492
2495 Ga0495635_0065331
2496 Ga0495659_0003385
2497 Ga0495588_0017873
2498 Ga0495588_0082164
2499 Ga0495588_0087559
2500 Ga0495588_0096485
2501 Ga0495657_0001166
2502 Ga0495657_0009684
2503 Ga0495657_0010489
2504 Ga0495657_0014123
2505 Ga0495599_0000002
2506 Ga0495599_0004625
2507 Ga0495599_0046992
2508 Ga0495599_0061804
2509 Ga0495599_0134932
2510 Ga0495623_0000035
2511 Ga0495623_0007498
2512 Ga0495623_0009450
2513 Ga0495646_0000018
2514 Ga0495646_0000846
2515 Ga0495646_0008509
2516 Ga0495646_0020336
2517 Ga0495647_0003820
2518 Ga0495647_0019115
2519 Ga0495647_0040526
2520 Ga0495647_0162747
2521 Ga0495658_0000168
2522 Ga0495658_0000231
2523 Ga0495658_0003159
2524 Ga0495658_0014023
2525 Ga0495613_0013624
2526 Ga0495613_0042797
2527 Ga0495613_0046388
2528 Ga0495613_0150435
2529 Ga0495613_0233938
2530 Ga0495624_0046464
2531 Ga0495624_0170606
2532 Ga0495670_0000601
2533 Ga0495670_0047763
2534 Ga0495671_0066171
2535 Ga0495589_0162166
2536 Ga0495600_0000048
2537 Ga0495600_0003843
2538 Ga0495600_0006717
2539 Ga0495600_0012550
2540 Ga0495600_0222770
2541 Ga0495581_0034318
2542 Ga0495581_0069521
2543 Ga0495581_0101634
2544 Ga0495604_0000007
2545 Ga0495604_0002660
2546 Ga0495604_0004228
2547 Ga0495604_0005155
2548 Ga0495604_0041610
2549 Ga0495636_0033684
2550 Ga0495674_0000001
2551 Ga0495674_0014368
2552 Ga0495674_0020533
2553 Ga0495674_0028883
2554 Ga0495674_0137046
2555 Ga0495674_0203553
2556 Ga0495674_0238525
2557 Ga0495676_0021831
2558 Ga0495676_0031573
2559 Ga0495676_0074030
2560 Ga0495676_0154727
2561 Ga0495680_0000308
2562 Ga0495680_0019585
2563 Ga0495680_0025167
2564 Ga0495680_0029834
2565 Ga0495680_0035461
2566 Ga0495680_0054148
2567 Ga0495680_0116059
2568 Ga0495675_0000042
2569 Ga0495675_0000984
2570 Ga0495675_0003357
2571 Ga0495679_049097
2572 Ga0495684_0000009
2573 Ga0495684_0002180
2574 Ga0495684_0076836
2575 Ga0495684_0113637
2576 Ga0495684_0131576
2577 Ga0495593_0000445
2578 Ga0495593_0001477
2579 Ga0495593_0012315
2580 Ga0495593_0105960
2581 Ga0495602_0000004
2582 Ga0495602_0000726
2583 Ga0495602_0003678
2584 Ga0495602_0004917
2585 Ga0495602_0166674
2586 Ga0495614_0030980
2587 Ga0495626_0084077
2588 Ga0496100_0000599
2589 Ga0496100_0003283
2590 Ga0496100_0005815
2591 Ga0496100_0008105
2592 Ga0496100_0026697
2593 Ga0496100_0061669
2594 Ga0496100_0062049
2595 Ga0496100_0144982
2596 Ga0496100_0212672
2597 Ga0496100_0401854
2598 Ga0496101_0000494
2599 Ga0496101_0002343
2600 Ga0496101_0013487
2601 Ga0496101_0037429
2602 Ga0496101_0095690
2603 Ga0496101_0104848
2604 Ga0496101_0107685
2605 Ga0496101_0185310
2606 Ga0496102_0002665
2607 Ga0496102_0005771
2608 Ga0496102_0014709
2609 Ga0496102_0026451
2610 Ga0496102_0027089
2611 Ga0496102_0046269
2612 Ga0496102_0071116
2613 Ga0496102_0074250
2614 Ga0496102_0103298
2615 Ga0496102_0125803
2616 Ga0496102_0356341
2617 Ga0496102_0457216
2618 Ga0496103_0006275
2619 Ga0496103_0009094
2620 Ga0496103_0009658
2621 Ga0496103_0021457
2622 Ga0496103_0166655
2623 Ga0496103_0241784
2624 Ga0496103_0254724
2625 Ga0496104_0000618
2626 Ga0496104_0005842
2627 Ga0496104_0006701
2628 Ga0496104_0007286
2629 Ga0496104_0010629
2630 Ga0496104_0017209
2631 Ga0496104_0018794
2632 Ga0496104_0021878
2633 Ga0496104_0075236
2634 Ga0496104_0175385
2635 Ga0496104_0199614
2636 Ga0496104_0335214
2637 Ga0496104_0359845
2638 Ga0496105_0001329
2639 Ga0496105_0001514
2640 Ga0496105_0012808
2641 Ga0496105_0041920
2642 Ga0496105_0054824
2643 Ga0496105_0057469
2644 Ga0496105_0068472
2645 Ga0496105_0083459
2646 Ga0496105_0084080
2647 Ga0496105_0085055
2648 Ga0496105_0085063
2649 Ga0496105_0098135
2650 Ga0496106_0002551
2651 Ga0496106_0006010
2652 Ga0496106_0016780
2653 Ga0496106_0022101
2654 Ga0496106_0028569
2655 Ga0496106_0049401
2656 Ga0496106_0050141
2657 Ga0496106_0058443
2658 Ga0496106_0110102
2659 Ga0496106_0172970
2660 Ga0496106_0255857
2661 Ga0496107_0001078
2662 Ga0496107_0005515
2663 Ga0496107_0021706
2664 Ga0496107_0022948
2665 Ga0496107_0026904
2666 Ga0496107_0031123
2667 Ga0496107_0041649
2668 Ga0496107_0073940
2669 Ga0496107_0100771
2670 Ga0496107_0155953
2671 Ga0496107_0165529
2672 Ga0496107_0177324
2673 Ga0496108_0000544
2674 Ga0496108_0000598
2675 Ga0496108_0027147
2676 Ga0496108_0032337
2677 Ga0496108_0060277
2678 Ga0496108_0063838
2679 Ga0496108_0066773
2680 Ga0496108_0068441
2681 Ga0496108_0109944
2682 Ga0496108_0189298
2683 Ga0496108_0226093
2684 Ga0496108_0236888
2685 Ga0496109_0000150
2686 Ga0496109_0003416
2687 Ga0496109_0006280
2688 Ga0496109_0006399
2689 Ga0496109_0066010
2690 Ga0496109_0069270
2691 Ga0496109_0081926
2692 Ga0496109_0116423
2693 Ga0496109_0167301
2694 Ga0496109_0174999
2695 Ga0496109_0206190
2696 Ga0496110_0001581
2697 Ga0496110_0009968
2698 Ga0496110_0028016
2699 Ga0496110_0064235
2700 Ga0496110_0085429
2701 Ga0496110_0151650
2702 Ga0496110_0210835
2703 Ga0496110_0236479
2704 Ga0496110_0338151
2705 Ga0496110_0366927
2706 Ga0496110_0373892
2707 Ga0496110_0396880
2708 Ga0496111_0002315
2709 Ga0496111_0021159
2710 Ga0496111_0025046
2711 Ga0496111_0049774
2712 Ga0496111_0073266
2713 Ga0496111_0183135
2714 Ga0496111_0197599
2715 Ga0496111_0253789
2716 Ga0496111_0302870
2717 Ga0496111_0358903
2718 Ga0496112_0000515
2719 Ga0496112_0001706
2720 Ga0496112_0003199
2721 Ga0496112_0036954
2722 Ga0496112_0050373
2723 Ga0496112_0071356
2724 Ga0496112_0120239
2725 Ga0496112_0431203
2726 Ga0496112_0500538
2727 Ga0496113_0000577
2728 Ga0496113_0001438
2729 Ga0496113_0003250
2730 Ga0496113_0009913
2731 Ga0496113_0022684
2732 Ga0496113_0063905
2733 Ga0496113_0085636
2734 Ga0496113_0085659
2735 Ga0496113_0105549
2736 Ga0496113_0167236
2737 Ga0496113_0242507
2738 Ga0496113_0279346
2739 Ga0496114_0003461
2740 Ga0496114_0010616
2741 Ga0496114_0012460
2742 Ga0496114_0025198
2743 Ga0496114_0026844
2744 Ga0496114_0046341
2745 Ga0496114_0064502
2746 Ga0496114_0072370
2747 Ga0496114_0089487
2748 Ga0496114_0253877
2749 Ga0496115_0024212
2750 Ga0496115_0025295
2751 Ga0496115_0033491
2752 Ga0496115_0035592
2753 Ga0496115_0046670
2754 Ga0496115_0075254
2755 Ga0496115_0107490
2756 Ga0496115_0120646
2757 Ga0496115_0128066
2758 Ga0496115_0138828
2759 Ga0501032_0151203
2760 Ga0501034_0052553
2761 Ga0501034_0393036
2762 Ga0501036_0340069
2763 Ga0501038_0070854
2764 Ga0501038_0271706
2765 Ga0501038_0299769
2766 Ga0501039_0221986
2767 Ga0501039_0382003
2768 Ga0501070_0311084
2769 Ga0501070_0358284
2770 Ga0501076_0244189
2771 Ga0501076_0376161
2772 Ga0501080_0432932
2773 Ga0501035_0005615
2774 Ga0501035_0207879
2775 Ga0501044_0222297
2776 nmdc:mga03683_49041_c1
2777 nmdc:mga03n38_104006_c1
2778 nmdc:mga0yw44_135_c1
2779 nmdc:mga0yw44_201881_c1
2780 nmdc:mga0yw44_2239_c1
2781 nmdc:mga0yw44_37082_c1
2782 nmdc:mga0yw44_4842_c1
2783 nmdc:mga0yw44_72845_c1
2784 nmdc:mga06z11_10880_c1
2785 nmdc:mga05p37_211446_c1
2786 nmdc:mga05p37_223_c1
2787 nmdc:mga05p37_22429_c1
2788 nmdc:mga05p37_249786_c1
2789 nmdc:mga05p37_304502_c1
2790 nmdc:mga05p37_30735_c1
2791 nmdc:mga05p37_504119_c1
2792 nmdc:mga05p37_56_c3
2793 nmdc:mga09592_1434_c1
2794 nmdc:mga09592_47744_c1
2795 nmdc:mga09592_70675_c1
2796 nmdc:mga09592_75131_c1
2797 nmdc:mga0qj67_103172_c1
2798 nmdc:mga0qj67_26868_c1
2799 nmdc:mga0qj67_29779_c1
2800 nmdc:mga0qj67_39546_c1
2801 nmdc:mga06r32_155489_c1
2802 nmdc:mga06r32_186_c1
2803 nmdc:mga06r32_43726_c1
2804 nmdc:mga06r32_806_c1
2805 nmdc:mga08y16_1035_c1
2806 nmdc:mga08y16_176415_c1
2807 nmdc:mga08y16_206_c1
2808 nmdc:mga08y16_3000_c1
2809 nmdc:mga08y16_363748_c1
2810 nmdc:mga08y16_412252_c1
2811 nmdc:mga08y16_89854_c1
2812 nmdc:mga0n895_11211_c1
2813 nmdc:mga0n895_22286_c1
2814 nmdc:mga0n895_2402_c1
2815 nmdc:mga0n895_30334_c1
2816 nmdc:mga0n895_34308_c1
2817 nmdc:mga0n895_36077_c1
2818 nmdc:mga0n895_65248_c1
2819 nmdc:mga0n895_71650_c1
2820 nmdc:mga0n895_85077_c1
2821 nmdc:mga0rr50_120507_c1
2822 nmdc:mga0rr50_123644_c1
2823 nmdc:mga0rr50_15932_c1
2824 nmdc:mga0rr50_17917_c1
2825 nmdc:mga0rr50_202887_c1
2826 nmdc:mga0rr50_26806_c1
2827 nmdc:mga0rr50_59473_c1
2828 nmdc:mga08x19_201298_c1
2829 nmdc:mga08x19_59979_c1
2830 nmdc:mga0a205_13046_c1
2831 nmdc:mga0a205_16008_c1
2832 nmdc:mga0a205_1905_c1
2833 nmdc:mga0a205_80_c1
2834 Ga0495601_0000020
2835 Ga0495601_0000102
2836 Ga0495601_0000232
2837 Ga0495601_0005229
2838 Ga0495601_0006091
2839 Ga0495601_0014874
2840 Ga0495601_0048049
2841 Ga0495612_0000020
2842 Ga0495612_0001651
2843 Ga0495612_0006808
2844 Ga0495612_0006943
2845 Ga0495612_0013576
2846 Ga0495612_0023473
2847 Ga0495655_0001142
2848 Ga0495655_0006026
2849 Ga0495655_0017111
2850 Ga0495595_0000047
2851 Ga0495595_0000284
2852 Ga0495595_0001961
2853 Ga0495595_0004403
2854 Ga0495595_0032080
2855 Ga0495595_0034012
2856 Ga0495619_0000011
2857 Ga0495619_0000092
2858 Ga0495619_0000145
2859 Ga0495619_0000341
2860 Ga0495619_0001312
2861 Ga0495619_0004545
2862 Ga0495619_0005415
2863 Ga0495619_0016154
2864 Ga0495619_0026304
2865 Ga0495619_0045010
2866 Ga0500643_001354
2867 Ga0500593_002357
2868 Ga0500595_000029
2869 Ga0500595_017223
2870 Ga0500652_000086
2871 Ga0500636_0023610
2872 Ga0501084_0203268

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

102

310

0.86

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

85

358

0.76

PF13379

NMT1_2

NMT1-like family

81

312

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.8094 84 372
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8015 85 375
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.7965 83 374
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7864 85 375
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.7846 84 372
ID Description Score Start End Superfamily
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8206 171 259 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8065 168 265 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7858 168 265 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7819 171 258 3.40.190.10
4kqpA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.766 170 260 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A521YL89-F1-model_v4 ABC transporter substrate-binding protein 0.9408 76 377
AF-A0A561QAR1-F1-model_v4 NitT/TauT family transport system substrate-binding protein 0.9381 76 377 GO:0042918
AF-A0A537N981-F1-model_v4 ABC transporter substrate-binding protein 0.9372 76 377
AF-A0A537N981-F1-model_v4 ABC transporter substrate-binding protein 0.9196 76 377
AF-A0A1Q7BRX8-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9176 76 377

Map