F494103
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1458 | 467 | 2916 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100561006|Ga0068863_1005610061 |
| Length | 90 |
| Sequence | MPLTKEKKSTIFADFGGKETNTGSIEGQIALLTERMAQISNHLQDNNKKDFSTHRGLMQLVGKRKRLLNYLQKHNLTGYRQLIEKLGIRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 202 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 244 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 245 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 248 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 249 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 250 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 251 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 253 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 255 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 257 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 258 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 261 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 262 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 263 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 264 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 265 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 266 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 269 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 346 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 354 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 394 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 395 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 396 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 397 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 398 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 402 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 403 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 404 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 405 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 409 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 410 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 419 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 420 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 423 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 424 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 425 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 426 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 427 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 428 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 429 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 430 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 431 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 434 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 435 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 436 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 437 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 438 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 439 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 440 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 441 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 442 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 443 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 445 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 446 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 447 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 448 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 450 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 465 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 466 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 467 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.54 |
| Metatranscriptomes | 4.32 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.46 |
| Nodule | 0 |
| Rhizoplane | 2.06 |
| Rhizosphere | 91.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068863_100561006 | 3300005841 | Bacteria | 1128 |
| 2 | JGI24743J22301_10144941 | 3300001991 | Bacteria | 530 |
| 3 | JGI24744J21845_10020183 | 3300002077 | Unclassified | 1315 |
| 4 | JGI25158J39367_1009415 | 3300002739 | Bacteria | 1339 |
| 5 | JGI25159J45721_1048087 | 3300002987 | Bacteria | 593 |
| 6 | JGI25406J46586_10056108 | 3300003203 | Bacteria | 1294 |
| 7 | rootH2_10009422 | 3300003320 | Bacteria | 9760 |
| 8 | rootH2_10054917 | 3300003320 | Bacteria | 1016 |
| 9 | rootH2_10101489 | 3300003320 | Bacteria | 5815 |
| 10 | rootL2_10127521 | 3300003322 | Bacteria | 1280 |
| 11 | rootL2_10160151 | 3300003322 | Bacteria | 5246 |
| 12 | rootH1_10013931 | 3300003323 | Bacteria | 2628 |
| 13 | rootH1_10135123 | 3300003323 | Bacteria | 1958 |
| 14 | JGI25160J50197_1017226 | 3300003354 | Bacteria | 2297 |
| 15 | Ga0055531_10000245 | 3300003794 | Bacteria | 59122 |
| 16 | Ga0058859_10826476 | 3300004798 | Bacteria | 554 |
| 17 | Ga0058859_11159609 | 3300004798 | Unclassified | 543 |
| 18 | Ga0065714_10037081 | 3300005288 | Bacteria | 1024 |
| 19 | Ga0065714_10328222 | 3300005288 | Unclassified | 660 |
| 20 | Ga0065704_10033350 | 3300005289 | Unclassified | 1172 |
| 21 | Ga0065704_10191117 | 3300005289 | Bacteria | 1189 |
| 22 | Ga0065712_10043039 | 3300005290 | Bacteria | 815 |
| 23 | Ga0065712_10421381 | 3300005290 | Unclassified | 711 |
| 24 | Ga0065715_10400388 | 3300005293 | Bacteria | 874 |
| 25 | Ga0065715_10472634 | 3300005293 | Bacteria | 805 |
| 26 | Ga0065707_10220928 | 3300005295 | Bacteria | 1225 |
| 27 | Ga0065707_10761310 | 3300005295 | Bacteria | 614 |
| 28 | Ga0070658_11322238 | 3300005327 | Unclassified | 626 |
| 29 | Ga0070658_11465044 | 3300005327 | Unclassified | 592 |
| 30 | Ga0070676_10000153 | 3300005328 | Bacteria | 27368 |
| 31 | Ga0070676_10003325 | 3300005328 | Bacteria | 8365 |
| 32 | Ga0070676_10006732 | 3300005328 | Bacteria | 6155 |
| 33 | Ga0070676_10491606 | 3300005328 | Bacteria | 870 |
| 34 | Ga0070676_10535035 | 3300005328 | Bacteria | 837 |
| 35 | Ga0070676_10742147 | 3300005328 | Unclassified | 720 |
| 36 | Ga0070683_100023520 | 3300005329 | Bacteria | 5511 |
| 37 | Ga0070683_100081462 | 3300005329 | Bacteria | 3030 |
| 38 | Ga0070683_101261055 | 3300005329 | Bacteria | 710 |
| 39 | Ga0070690_100021818 | 3300005330 | Bacteria | 3914 |
| 40 | Ga0070690_100108133 | 3300005330 | Unclassified | 1852 |
| 41 | Ga0070690_101005548 | 3300005330 | Bacteria | 657 |
| 42 | Ga0070670_100007928 | 3300005331 | Bacteria | 9036 |
| 43 | Ga0070670_100021684 | 3300005331 | Bacteria | 5523 |
| 44 | Ga0070670_100043904 | 3300005331 | Bacteria | 3843 |
| 45 | Ga0070670_100124831 | 3300005331 | Bacteria | 2222 |
| 46 | Ga0070670_100338882 | 3300005331 | Bacteria | 1319 |
| 47 | Ga0070670_100522289 | 3300005331 | Bacteria | 1057 |
| 48 | Ga0070670_100615430 | 3300005331 | Bacteria | 973 |
| 49 | Ga0070670_101112968 | 3300005331 | Bacteria | 720 |
| 50 | Ga0070670_101324183 | 3300005331 | Bacteria | 659 |
| 51 | Ga0070670_102192332 | 3300005331 | Bacteria | 509 |
| 52 | Ga0070670_102228269 | 3300005331 | Bacteria | 505 |
| 53 | Ga0070677_10175900 | 3300005333 | Bacteria | 1015 |
| 54 | Ga0070677_10520436 | 3300005333 | Unclassified | 647 |
| 55 | Ga0070677_10929689 | 3300005333 | Unclassified | 504 |
| 56 | Ga0068869_100016793 | 3300005334 | Bacteria | 4944 |
| 57 | Ga0068869_100020420 | 3300005334 | Bacteria | 4541 |
| 58 | Ga0068869_100027564 | 3300005334 | Bacteria | 3962 |
| 59 | Ga0068869_100073866 | 3300005334 | Bacteria | 2530 |
| 60 | Ga0068869_100088092 | 3300005334 | Bacteria | 2330 |
| 61 | Ga0068869_100110634 | 3300005334 | Bacteria | 2089 |
| 62 | Ga0068869_100118832 | 3300005334 | Unclassified | 2019 |
| 63 | Ga0068869_100273695 | 3300005334 | Bacteria | 1356 |
| 64 | Ga0068869_100357704 | 3300005334 | Bacteria | 1191 |
| 65 | Ga0068869_100676580 | 3300005334 | Bacteria | 878 |
| 66 | Ga0068869_101215995 | 3300005334 | Bacteria | 662 |
| 67 | Ga0068869_101970654 | 3300005334 | Bacteria | 524 |
| 68 | Ga0070666_10000209 | 3300005335 | Bacteria | 40151 |
| 69 | Ga0070666_10011988 | 3300005335 | Bacteria | 5456 |
| 70 | Ga0070666_10024603 | 3300005335 | Bacteria | 3924 |
| 71 | Ga0070666_10041527 | 3300005335 | Bacteria | 3074 |
| 72 | Ga0070666_10185297 | 3300005335 | Bacteria | 1461 |
| 73 | Ga0070666_10318560 | 3300005335 | Bacteria | 1109 |
| 74 | Ga0070666_10397627 | 3300005335 | Unclassified | 990 |
| 75 | Ga0070666_10420410 | 3300005335 | Bacteria | 963 |
| 76 | Ga0070666_10421262 | 3300005335 | Unclassified | 962 |
| 77 | Ga0070666_10786231 | 3300005335 | Unclassified | 700 |
| 78 | Ga0070680_100301771 | 3300005336 | Bacteria | 1358 |
| 79 | Ga0070682_100834561 | 3300005337 | Bacteria | 752 |
| 80 | Ga0070682_100887543 | 3300005337 | Bacteria | 731 |
| 81 | Ga0070682_101109595 | 3300005337 | Bacteria | 663 |
| 82 | Ga0070682_101554308 | 3300005337 | Unclassified | 571 |
| 83 | Ga0068868_100001336 | 3300005338 | Bacteria | 17019 |
| 84 | Ga0068868_100002414 | 3300005338 | Bacteria | 12932 |
| 85 | Ga0068868_100020102 | 3300005338 | Bacteria | 5011 |
| 86 | Ga0068868_100022584 | 3300005338 | Bacteria | 4750 |
| 87 | Ga0068868_100023605 | 3300005338 | Bacteria | 4656 |
| 88 | Ga0068868_100136042 | 3300005338 | Bacteria | 2014 |
| 89 | Ga0068868_100195266 | 3300005338 | Bacteria | 1685 |
| 90 | Ga0068868_100272610 | 3300005338 | Bacteria | 1430 |
| 91 | Ga0068868_100297356 | 3300005338 | Bacteria | 1370 |
| 92 | Ga0068868_100410873 | 3300005338 | Bacteria | 1170 |
| 93 | Ga0070660_100573851 | 3300005339 | Unclassified | 942 |
| 94 | Ga0070660_100581730 | 3300005339 | Bacteria | 935 |
| 95 | Ga0070660_100620185 | 3300005339 | Unclassified | 905 |
| 96 | Ga0070660_100987860 | 3300005339 | Bacteria | 711 |
| 97 | Ga0070689_100157874 | 3300005340 | Unclassified | 1832 |
| 98 | Ga0070689_100493835 | 3300005340 | Bacteria | 1047 |
| 99 | Ga0070689_100688089 | 3300005340 | Bacteria | 892 |
| 100 | Ga0070689_100804037 | 3300005340 | Bacteria | 827 |
| 101 | Ga0070689_101464730 | 3300005340 | Bacteria | 618 |
| 102 | Ga0070689_101825901 | 3300005340 | Unclassified | 554 |
| 103 | Ga0070691_10010461 | 3300005341 | Bacteria | 4234 |
| 104 | Ga0070691_10576669 | 3300005341 | Bacteria | 661 |
| 105 | Ga0070687_100002811 | 3300005343 | Bacteria | 6635 |
| 106 | Ga0070687_100155279 | 3300005343 | Bacteria | 1348 |
| 107 | Ga0070687_101148675 | 3300005343 | Unclassified | 570 |
| 108 | Ga0070661_100130084 | 3300005344 | Bacteria | 1890 |
| 109 | Ga0070661_100201421 | 3300005344 | Bacteria | 1521 |
| 110 | Ga0070661_100405144 | 3300005344 | Bacteria | 1079 |
| 111 | Ga0070661_100455569 | 3300005344 | Bacteria | 1018 |
| 112 | Ga0070661_101107798 | 3300005344 | Unclassified | 660 |
| 113 | Ga0070668_100000556 | 3300005347 | Bacteria | 24937 |
| 114 | Ga0070668_100032555 | 3300005347 | Bacteria | 3967 |
| 115 | Ga0070668_100163333 | 3300005347 | Bacteria | 1808 |
| 116 | Ga0070668_100302528 | 3300005347 | Unclassified | 1342 |
| 117 | Ga0070668_100510433 | 3300005347 | Bacteria | 1042 |
| 118 | Ga0070668_100759615 | 3300005347 | Bacteria | 859 |
| 119 | Ga0070669_100056538 | 3300005353 | Unclassified | 2877 |
| 120 | Ga0070669_100089397 | 3300005353 | Bacteria | 2307 |
| 121 | Ga0070669_100094730 | 3300005353 | Unclassified | 2244 |
| 122 | Ga0070669_100541968 | 3300005353 | Bacteria | 969 |
| 123 | Ga0070669_100686648 | 3300005353 | Unclassified | 864 |
| 124 | Ga0070669_101382906 | 3300005353 | Bacteria | 611 |
| 125 | Ga0070675_100024988 | 3300005354 | Bacteria | 4788 |
| 126 | Ga0070675_100028383 | 3300005354 | Bacteria | 4504 |
| 127 | Ga0070675_100051669 | 3300005354 | Bacteria | 3378 |
| 128 | Ga0070675_100053321 | 3300005354 | Bacteria | 3326 |
| 129 | Ga0070675_100087065 | 3300005354 | Bacteria | 2612 |
| 130 | Ga0070675_100278735 | 3300005354 | Bacteria | 1469 |
| 131 | Ga0070675_100597133 | 3300005354 | Bacteria | 1001 |
| 132 | Ga0070671_100001985 | 3300005355 | Bacteria | 15713 |
| 133 | Ga0070671_100034628 | 3300005355 | Bacteria | 4181 |
| 134 | Ga0070671_100041198 | 3300005355 | Bacteria | 3838 |
| 135 | Ga0070671_100385016 | 3300005355 | Bacteria | 1199 |
| 136 | Ga0070671_100412863 | 3300005355 | Bacteria | 1156 |
| 137 | Ga0070671_100714595 | 3300005355 | Bacteria | 870 |
| 138 | Ga0070671_101035812 | 3300005355 | Unclassified | 720 |
| 139 | Ga0070671_101137528 | 3300005355 | Unclassified | 686 |
| 140 | Ga0070671_101978293 | 3300005355 | Bacteria | 519 |
| 141 | Ga0070674_100062017 | 3300005356 | Bacteria | 2611 |
| 142 | Ga0070674_100342171 | 3300005356 | Unclassified | 1205 |
| 143 | Ga0070674_100520484 | 3300005356 | Bacteria | 993 |
| 144 | Ga0070674_100572475 | 3300005356 | Bacteria | 950 |
| 145 | Ga0070674_100920875 | 3300005356 | Bacteria | 763 |
| 146 | Ga0070673_100000867 | 3300005364 | Bacteria | 17013 |
| 147 | Ga0070673_100006375 | 3300005364 | Bacteria | 7667 |
| 148 | Ga0070673_100024895 | 3300005364 | Bacteria | 4396 |
| 149 | Ga0070673_100041606 | 3300005364 | Bacteria | 3536 |
| 150 | Ga0070673_100060726 | 3300005364 | Unclassified | 2996 |
| 151 | Ga0070673_100912603 | 3300005364 | Bacteria | 815 |
| 152 | Ga0070673_101013672 | 3300005364 | Bacteria | 773 |
| 153 | Ga0070673_101180336 | 3300005364 | Bacteria | 717 |
| 154 | Ga0070673_101649871 | 3300005364 | Bacteria | 606 |
| 155 | Ga0070688_100278966 | 3300005365 | Bacteria | 1200 |
| 156 | Ga0070688_100356616 | 3300005365 | Unclassified | 1072 |
| 157 | Ga0070688_100655418 | 3300005365 | Bacteria | 809 |
| 158 | Ga0070688_100741030 | 3300005365 | Bacteria | 764 |
| 159 | Ga0070688_101606518 | 3300005365 | Bacteria | 531 |
| 160 | Ga0070659_100007187 | 3300005366 | Bacteria | 8080 |
| 161 | Ga0070659_100770727 | 3300005366 | Bacteria | 835 |
| 162 | Ga0070667_100000812 | 3300005367 | Bacteria | 29157 |
| 163 | Ga0070667_100008930 | 3300005367 | Bacteria | 8297 |
| 164 | Ga0070667_100038136 | 3300005367 | Bacteria | 4029 |
| 165 | Ga0070667_100040093 | 3300005367 | Bacteria | 3927 |
| 166 | Ga0070667_100060648 | 3300005367 | Bacteria | 3201 |
| 167 | Ga0070667_100099011 | 3300005367 | Bacteria | 2516 |
| 168 | Ga0070667_100117175 | 3300005367 | Unclassified | 2314 |
| 169 | Ga0070667_100253860 | 3300005367 | Bacteria | 1573 |
| 170 | Ga0070667_100270609 | 3300005367 | Bacteria | 1523 |
| 171 | Ga0070667_100562188 | 3300005367 | Bacteria | 1049 |
| 172 | Ga0070667_100756177 | 3300005367 | Bacteria | 901 |
| 173 | Ga0070667_100969352 | 3300005367 | Bacteria | 793 |
| 174 | Ga0070667_101344830 | 3300005367 | Bacteria | 670 |
| 175 | Ga0070701_10013206 | 3300005438 | Bacteria | 3751 |
| 176 | Ga0070701_10347508 | 3300005438 | Bacteria | 925 |
| 177 | Ga0070705_100215659 | 3300005440 | Bacteria | 1326 |
| 178 | Ga0070700_100439346 | 3300005441 | Unclassified | 990 |
| 179 | Ga0070700_100676271 | 3300005441 | Bacteria | 818 |
| 180 | Ga0070708_101399131 | 3300005445 | Bacteria | 653 |
| 181 | Ga0070663_100075874 | 3300005455 | Unclassified | 2458 |
| 182 | Ga0070663_100765925 | 3300005455 | Unclassified | 825 |
| 183 | Ga0070663_100770436 | 3300005455 | Unclassified | 823 |
| 184 | Ga0070663_100924549 | 3300005455 | Bacteria | 755 |
| 185 | Ga0070663_101175074 | 3300005455 | Bacteria | 673 |
| 186 | Ga0070678_100023430 | 3300005456 | Bacteria | 4113 |
| 187 | Ga0070678_100130837 | 3300005456 | Bacteria | 1993 |
| 188 | Ga0070678_100167308 | 3300005456 | Unclassified | 1787 |
| 189 | Ga0070678_100326560 | 3300005456 | Bacteria | 1312 |
| 190 | Ga0070678_100390860 | 3300005456 | Bacteria | 1206 |
| 191 | Ga0070678_100790745 | 3300005456 | Bacteria | 861 |
| 192 | Ga0070662_100001017 | 3300005457 | Bacteria | 17158 |
| 193 | Ga0070662_100002918 | 3300005457 | Bacteria | 10627 |
| 194 | Ga0070662_100019329 | 3300005457 | Bacteria | 4623 |
| 195 | Ga0070662_100292903 | 3300005457 | Unclassified | 1320 |
| 196 | Ga0070662_100381670 | 3300005457 | Unclassified | 1160 |
| 197 | Ga0070662_100537232 | 3300005457 | Bacteria | 978 |
| 198 | Ga0070662_100840518 | 3300005457 | Bacteria | 781 |
| 199 | Ga0070662_101342622 | 3300005457 | Bacteria | 616 |
| 200 | Ga0070681_10167290 | 3300005458 | Unclassified | 2121 |
| 201 | Ga0068867_100036770 | 3300005459 | Bacteria | 3556 |
| 202 | Ga0068867_100068327 | 3300005459 | Bacteria | 2652 |
| 203 | Ga0068867_100082748 | 3300005459 | Bacteria | 2422 |
| 204 | Ga0068867_100136101 | 3300005459 | Unclassified | 1915 |
| 205 | Ga0068867_100143037 | 3300005459 | Bacteria | 1871 |
| 206 | Ga0068867_100225703 | 3300005459 | Bacteria | 1511 |
| 207 | Ga0068867_101212847 | 3300005459 | Bacteria | 693 |
| 208 | Ga0070685_10137269 | 3300005466 | Bacteria | 1536 |
| 209 | Ga0070685_10300653 | 3300005466 | Bacteria | 1081 |
| 210 | Ga0070685_10322320 | 3300005466 | Bacteria | 1048 |
| 211 | Ga0070685_10370073 | 3300005466 | Bacteria | 984 |
| 212 | Ga0070685_10759654 | 3300005466 | Bacteria | 711 |
| 213 | Ga0070706_100936390 | 3300005467 | Bacteria | 800 |
| 214 | Ga0070698_100036892 | 3300005471 | Bacteria | 5044 |
| 215 | Ga0070698_100049913 | 3300005471 | Bacteria | 4269 |
| 216 | Ga0070684_100001060 | 3300005535 | Bacteria | 19661 |
| 217 | Ga0070684_100002383 | 3300005535 | Bacteria | 13852 |
| 218 | Ga0070684_100032732 | 3300005535 | Bacteria | 4434 |
| 219 | Ga0070684_100376101 | 3300005535 | Bacteria | 1308 |
| 220 | Ga0070684_100662580 | 3300005535 | Bacteria | 972 |
| 221 | Ga0070684_102118537 | 3300005535 | Bacteria | 531 |
| 222 | Ga0070684_102282173 | 3300005535 | Bacteria | 510 |
| 223 | Ga0068853_100000520 | 3300005539 | Bacteria | 26128 |
| 224 | Ga0068853_100020753 | 3300005539 | Bacteria | 5465 |
| 225 | Ga0068853_100065202 | 3300005539 | Bacteria | 3160 |
| 226 | Ga0068853_100519567 | 3300005539 | Bacteria | 1125 |
| 227 | Ga0068853_100663448 | 3300005539 | Bacteria | 993 |
| 228 | Ga0068853_101186315 | 3300005539 | Unclassified | 737 |
| 229 | Ga0068853_101491117 | 3300005539 | Bacteria | 655 |
| 230 | Ga0068853_101738683 | 3300005539 | Bacteria | 605 |
| 231 | Ga0068853_101821005 | 3300005539 | Bacteria | 590 |
| 232 | Ga0068853_102386995 | 3300005539 | Bacteria | 512 |
| 233 | Ga0070672_100000738 | 3300005543 | Bacteria | 19396 |
| 234 | Ga0070672_100048813 | 3300005543 | Bacteria | 3291 |
| 235 | Ga0070672_100101769 | 3300005543 | Bacteria | 2331 |
| 236 | Ga0070672_100347186 | 3300005543 | Bacteria | 1264 |
| 237 | Ga0070672_100597516 | 3300005543 | Unclassified | 961 |
| 238 | Ga0070672_101282081 | 3300005543 | Bacteria | 654 |
| 239 | Ga0070672_101497765 | 3300005543 | Bacteria | 604 |
| 240 | Ga0070686_100107815 | 3300005544 | Bacteria | 1892 |
| 241 | Ga0070686_100514885 | 3300005544 | Bacteria | 930 |
| 242 | Ga0070686_100966775 | 3300005544 | Bacteria | 696 |
| 243 | Ga0070693_100250499 | 3300005547 | Unclassified | 1174 |
| 244 | Ga0070693_100882055 | 3300005547 | Unclassified | 669 |
| 245 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 246 | Ga0070665_100000486 | 3300005548 | Bacteria | 57134 |
| 247 | Ga0070665_100024894 | 3300005548 | Bacteria | 6031 |
| 248 | Ga0070665_100231705 | 3300005548 | Bacteria | 1847 |
| 249 | Ga0070665_100454910 | 3300005548 | Bacteria | 1290 |
| 250 | Ga0070665_100824961 | 3300005548 | Bacteria | 940 |
| 251 | Ga0070665_101216511 | 3300005548 | Unclassified | 764 |
| 252 | Ga0070665_102622184 | 3300005548 | Bacteria | 505 |
| 253 | Ga0070704_100432572 | 3300005549 | Bacteria | 1129 |
| 254 | Ga0070704_100756215 | 3300005549 | Bacteria | 866 |
| 255 | Ga0070704_100811663 | 3300005549 | Unclassified | 836 |
| 256 | Ga0068855_100001195 | 3300005563 | Bacteria | 32239 |
| 257 | Ga0068855_100056754 | 3300005563 | Bacteria | 4592 |
| 258 | Ga0068855_100147675 | 3300005563 | Bacteria | 2675 |
| 259 | Ga0068855_100920202 | 3300005563 | Unclassified | 923 |
| 260 | Ga0070664_100002163 | 3300005564 | Bacteria | 15764 |
| 261 | Ga0070664_100034763 | 3300005564 | Bacteria | 4229 |
| 262 | Ga0070664_100085373 | 3300005564 | Bacteria | 2726 |
| 263 | Ga0070664_100092551 | 3300005564 | Bacteria | 2618 |
| 264 | Ga0070664_100100585 | 3300005564 | Unclassified | 2513 |
| 265 | Ga0070664_100173719 | 3300005564 | Bacteria | 1912 |
| 266 | Ga0070664_100456680 | 3300005564 | Bacteria | 1173 |
| 267 | Ga0070664_100672758 | 3300005564 | Bacteria | 963 |
| 268 | Ga0070664_100703265 | 3300005564 | Unclassified | 942 |
| 269 | Ga0070664_100736621 | 3300005564 | Bacteria | 920 |
| 270 | Ga0070664_101958890 | 3300005564 | Bacteria | 556 |
| 271 | Ga0068857_100007533 | 3300005577 | Bacteria | 9367 |
| 272 | Ga0068857_100092135 | 3300005577 | Unclassified | 2713 |
| 273 | Ga0068857_100116871 | 3300005577 | Bacteria | 2400 |
| 274 | Ga0068857_100143969 | 3300005577 | Bacteria | 2156 |
| 275 | Ga0068857_100328872 | 3300005577 | Bacteria | 1412 |
| 276 | Ga0068857_100410499 | 3300005577 | Bacteria | 1261 |
| 277 | Ga0068857_101082230 | 3300005577 | Unclassified | 774 |
| 278 | Ga0068857_102464664 | 3300005577 | Bacteria | 511 |
| 279 | Ga0068854_100075832 | 3300005578 | Bacteria | 2470 |
| 280 | Ga0068854_100113006 | 3300005578 | Bacteria | 2051 |
| 281 | Ga0068854_100161208 | 3300005578 | Bacteria | 1737 |
| 282 | Ga0068854_100228111 | 3300005578 | Bacteria | 1477 |
| 283 | Ga0068854_100627264 | 3300005578 | Unclassified | 920 |
| 284 | Ga0068854_101155729 | 3300005578 | Bacteria | 692 |
| 285 | Ga0068854_101973482 | 3300005578 | Bacteria | 537 |
| 286 | Ga0068856_100243724 | 3300005614 | Bacteria | 1812 |
| 287 | Ga0070702_100097632 | 3300005615 | Bacteria | 1795 |
| 288 | Ga0070702_100520081 | 3300005615 | Unclassified | 877 |
| 289 | Ga0070702_101372019 | 3300005615 | Unclassified | 577 |
| 290 | Ga0068852_100000223 | 3300005616 | Bacteria | 38460 |
| 291 | Ga0068852_100005616 | 3300005616 | Bacteria | 8998 |
| 292 | Ga0068852_100083763 | 3300005616 | Bacteria | 2836 |
| 293 | Ga0068852_100135099 | 3300005616 | Bacteria | 2277 |
| 294 | Ga0068852_100460264 | 3300005616 | Unclassified | 1261 |
| 295 | Ga0068852_100627285 | 3300005616 | Unclassified | 1081 |
| 296 | Ga0068852_101041590 | 3300005616 | Bacteria | 837 |
| 297 | Ga0068852_101374112 | 3300005616 | Bacteria | 728 |
| 298 | Ga0068859_100016918 | 3300005617 | Bacteria | 7320 |
| 299 | Ga0068859_100026368 | 3300005617 | Bacteria | 5827 |
| 300 | Ga0068859_100076707 | 3300005617 | Bacteria | 3383 |
| 301 | Ga0068859_100153847 | 3300005617 | Bacteria | 2376 |
| 302 | Ga0068859_100219040 | 3300005617 | Bacteria | 1991 |
| 303 | Ga0068859_100266281 | 3300005617 | Bacteria | 1806 |
| 304 | Ga0068859_100272729 | 3300005617 | Bacteria | 1784 |
| 305 | Ga0068859_102496880 | 3300005617 | Bacteria | 569 |
| 306 | Ga0068859_102674626 | 3300005617 | Bacteria | 548 |
| 307 | Ga0068859_102720851 | 3300005617 | Bacteria | 543 |
| 308 | Ga0068859_102995704 | 3300005617 | Unclassified | 516 |
| 309 | Ga0068864_100002330 | 3300005618 | Bacteria | 15704 |
| 310 | Ga0068864_100010946 | 3300005618 | Bacteria | 7499 |
| 311 | Ga0068864_100048675 | 3300005618 | Bacteria | 3645 |
| 312 | Ga0068864_100282029 | 3300005618 | Bacteria | 1551 |
| 313 | Ga0068864_100348728 | 3300005618 | Bacteria | 1396 |
| 314 | Ga0068864_100371791 | 3300005618 | Bacteria | 1353 |
| 315 | Ga0068864_101231849 | 3300005618 | Bacteria | 747 |
| 316 | Ga0068866_10023161 | 3300005718 | Bacteria | 2885 |
| 317 | Ga0068866_10080310 | 3300005718 | Bacteria | 1749 |
| 318 | Ga0068866_10164227 | 3300005718 | Bacteria | 1298 |
| 319 | Ga0068866_10279609 | 3300005718 | Bacteria | 1033 |
| 320 | Ga0068866_10470454 | 3300005718 | Bacteria | 826 |
| 321 | Ga0068866_11114522 | 3300005718 | Bacteria | 566 |
| 322 | Ga0068866_11155476 | 3300005718 | Unclassified | 557 |
| 323 | Ga0068861_100057736 | 3300005719 | Bacteria | 2965 |
| 324 | Ga0068861_100118137 | 3300005719 | Unclassified | 2135 |
| 325 | Ga0068861_100177987 | 3300005719 | Bacteria | 1768 |
| 326 | Ga0068861_100374722 | 3300005719 | Bacteria | 1256 |
| 327 | Ga0068861_100533110 | 3300005719 | Bacteria | 1067 |
| 328 | Ga0068861_100731899 | 3300005719 | Unclassified | 922 |
| 329 | Ga0068861_100887291 | 3300005719 | Bacteria | 843 |
| 330 | Ga0068861_101281305 | 3300005719 | Bacteria | 712 |
| 331 | Ga0068861_101393409 | 3300005719 | Bacteria | 684 |
| 332 | Ga0068861_102350248 | 3300005719 | Bacteria | 535 |
| 333 | Ga0068861_102482737 | 3300005719 | Bacteria | 521 |
| 334 | Ga0068851_10010493 | 3300005834 | Bacteria | 4327 |
| 335 | Ga0068851_10154441 | 3300005834 | Bacteria | 1257 |
| 336 | Ga0068851_10489199 | 3300005834 | Bacteria | 736 |
| 337 | Ga0068851_10604440 | 3300005834 | Bacteria | 668 |
| 338 | Ga0068851_10675666 | 3300005834 | Bacteria | 634 |
| 339 | Ga0068851_10714287 | 3300005834 | Bacteria | 618 |
| 340 | Ga0068870_10012476 | 3300005840 | Bacteria | 3973 |
| 341 | Ga0068870_10138923 | 3300005840 | Bacteria | 1419 |
| 342 | Ga0068870_10149303 | 3300005840 | Bacteria | 1375 |
| 343 | Ga0068870_10331047 | 3300005840 | Bacteria | 971 |
| 344 | Ga0068870_10877282 | 3300005840 | Unclassified | 632 |
| 345 | Ga0068863_100000858 | 3300005841 | Bacteria | 30354 |
| 346 | Ga0068863_100308391 | 3300005841 | Bacteria | 1536 |
| 347 | Ga0068863_100329429 | 3300005841 | Bacteria | 1484 |
| 348 | Ga0068863_100372317 | 3300005841 | Bacteria | 1394 |
| 349 | Ga0068863_100852382 | 3300005841 | Bacteria | 910 |
| 350 | Ga0068863_101543917 | 3300005841 | Unclassified | 673 |
| 351 | Ga0068863_101838583 | 3300005841 | Bacteria | 615 |
| 352 | Ga0068863_102691392 | 3300005841 | Bacteria | 506 |
| 353 | Ga0068858_100008022 | 3300005842 | Bacteria | 10169 |
| 354 | Ga0068858_100050171 | 3300005842 | Bacteria | 3862 |
| 355 | Ga0068858_100087035 | 3300005842 | Bacteria | 2906 |
| 356 | Ga0068858_100390819 | 3300005842 | Bacteria | 1336 |
| 357 | Ga0068858_100502440 | 3300005842 | Bacteria | 1172 |
| 358 | Ga0068858_100840137 | 3300005842 | Bacteria | 897 |
| 359 | Ga0068858_101358846 | 3300005842 | Bacteria | 700 |
| 360 | Ga0068858_101566210 | 3300005842 | Bacteria | 650 |
| 361 | Ga0068858_101871069 | 3300005842 | Bacteria | 593 |
| 362 | Ga0068858_102578430 | 3300005842 | Bacteria | 502 |
| 363 | Ga0068860_100000026 | 3300005843 | Bacteria | 270483 |
| 364 | Ga0068860_100006630 | 3300005843 | Bacteria | 11627 |
| 365 | Ga0068860_100014705 | 3300005843 | Bacteria | 7655 |
| 366 | Ga0068860_100031636 | 3300005843 | Bacteria | 5086 |
| 367 | Ga0068860_100058149 | 3300005843 | Bacteria | 3675 |
| 368 | Ga0068860_100060556 | 3300005843 | Bacteria | 3598 |
| 369 | Ga0068860_100134629 | 3300005843 | Bacteria | 2373 |
| 370 | Ga0068860_100146429 | 3300005843 | Bacteria | 2273 |
| 371 | Ga0068860_100161168 | 3300005843 | Unclassified | 2163 |
| 372 | Ga0068860_100187590 | 3300005843 | Bacteria | 2000 |
| 373 | Ga0068860_100216288 | 3300005843 | Bacteria | 1860 |
| 374 | Ga0068860_100572886 | 3300005843 | Bacteria | 1133 |
| 375 | Ga0068860_100861403 | 3300005843 | Bacteria | 921 |
| 376 | Ga0068860_102280828 | 3300005843 | Bacteria | 562 |
| 377 | Ga0068860_102282564 | 3300005843 | Bacteria | 562 |
| 378 | Ga0068860_102350146 | 3300005843 | Bacteria | 553 |
| 379 | Ga0068862_100120003 | 3300005844 | Bacteria | 2317 |
| 380 | Ga0068862_100853358 | 3300005844 | Bacteria | 893 |
| 381 | Ga0068862_101892228 | 3300005844 | Bacteria | 606 |
| 382 | Ga0081540_1015893 | 3300005983 | Bacteria | 4743 |
| 383 | Ga0081539_10058235 | 3300005985 | Bacteria | 2133 |
| 384 | Ga0070715_10242687 | 3300006163 | Bacteria | 937 |
| 385 | Ga0075366_10004995 | 3300006195 | Bacteria | 7158 |
| 386 | Ga0075366_10009633 | 3300006195 | Bacteria | 5399 |
| 387 | Ga0075366_10033515 | 3300006195 | Bacteria | 3026 |
| 388 | Ga0075366_10534924 | 3300006195 | Bacteria | 725 |
| 389 | Ga0097621_100000027 | 3300006237 | Bacteria | 71873 |
| 390 | Ga0097621_100506876 | 3300006237 | Bacteria | 1094 |
| 391 | Ga0097621_100736323 | 3300006237 | Bacteria | 910 |
| 392 | Ga0097621_100893514 | 3300006237 | Unclassified | 827 |
| 393 | Ga0097621_101558449 | 3300006237 | Bacteria | 628 |
| 394 | Ga0097621_101724099 | 3300006237 | Bacteria | 597 |
| 395 | Ga0097621_102042517 | 3300006237 | Bacteria | 548 |
| 396 | Ga0068871_100000107 | 3300006358 | Bacteria | 50575 |
| 397 | Ga0068871_100011119 | 3300006358 | Bacteria | 6598 |
| 398 | Ga0068871_100160875 | 3300006358 | Bacteria | 1920 |
| 399 | Ga0068871_100219701 | 3300006358 | Bacteria | 1646 |
| 400 | Ga0068871_100224703 | 3300006358 | Bacteria | 1628 |
| 401 | Ga0068871_100348237 | 3300006358 | Bacteria | 1310 |
| 402 | Ga0068871_100515883 | 3300006358 | Bacteria | 1079 |
| 403 | Ga0068871_100598330 | 3300006358 | Bacteria | 1003 |
| 404 | Ga0068871_101150867 | 3300006358 | Unclassified | 727 |
| 405 | Ga0068871_101221424 | 3300006358 | Bacteria | 705 |
| 406 | Ga0068871_102330538 | 3300006358 | Bacteria | 510 |
| 407 | Ga0075428_100497738 | 3300006844 | Bacteria | 1304 |
| 408 | Ga0075430_100640740 | 3300006846 | Bacteria | 876 |
| 409 | Ga0075431_100001800 | 3300006847 | Bacteria | 20232 |
| 410 | Ga0075429_100015792 | 3300006880 | Bacteria | 6539 |
| 411 | Ga0075429_100513647 | 3300006880 | Unclassified | 1050 |
| 412 | Ga0068865_100012268 | 3300006881 | Bacteria | 5390 |
| 413 | Ga0068865_100023713 | 3300006881 | Bacteria | 4021 |
| 414 | Ga0068865_100047038 | 3300006881 | Bacteria | 2963 |
| 415 | Ga0068865_100379893 | 3300006881 | Bacteria | 1152 |
| 416 | Ga0068865_100741006 | 3300006881 | Bacteria | 843 |
| 417 | Ga0097620_100016919 | 3300006931 | Bacteria | 7320 |
| 418 | Ga0097620_100026370 | 3300006931 | Bacteria | 5827 |
| 419 | Ga0097620_100076707 | 3300006931 | Bacteria | 3383 |
| 420 | Ga0097620_100153847 | 3300006931 | Bacteria | 2376 |
| 421 | Ga0097620_100219047 | 3300006931 | Bacteria | 1991 |
| 422 | Ga0097620_100266293 | 3300006931 | Bacteria | 1806 |
| 423 | Ga0097620_100272717 | 3300006931 | Bacteria | 1784 |
| 424 | Ga0097620_102498304 | 3300006931 | Bacteria | 569 |
| 425 | Ga0097620_102674555 | 3300006931 | Bacteria | 548 |
| 426 | Ga0097620_102720788 | 3300006931 | Bacteria | 543 |
| 427 | Ga0097620_102996779 | 3300006931 | Unclassified | 516 |
| 428 | Ga0105251_10354085 | 3300009011 | Bacteria | 670 |
| 429 | Ga0105244_10282407 | 3300009036 | Bacteria | 770 |
| 430 | Ga0105240_10000258 | 3300009093 | Bacteria | 105011 |
| 431 | Ga0105240_10000715 | 3300009093 | Bacteria | 60725 |
| 432 | Ga0105240_10017799 | 3300009093 | Bacteria | 9564 |
| 433 | Ga0105240_10082615 | 3300009093 | Bacteria | 3945 |
| 434 | Ga0105240_10132147 | 3300009093 | Bacteria | 2993 |
| 435 | Ga0105240_10208171 | 3300009093 | Bacteria | 2287 |
| 436 | Ga0105240_10682960 | 3300009093 | Bacteria | 1122 |
| 437 | Ga0105240_10967775 | 3300009093 | Bacteria | 912 |
| 438 | Ga0105240_11846305 | 3300009093 | Bacteria | 629 |
| 439 | Ga0111539_10479134 | 3300009094 | Bacteria | 1449 |
| 440 | Ga0111539_10519125 | 3300009094 | Bacteria | 1388 |
| 441 | Ga0105245_10626041 | 3300009098 | Bacteria | 1105 |
| 442 | Ga0105247_10001631 | 3300009101 | Bacteria | 15867 |
| 443 | Ga0105247_10052842 | 3300009101 | Bacteria | 2506 |
| 444 | Ga0114129_10015867 | 3300009147 | Bacteria | 10712 |
| 445 | Ga0105243_10167162 | 3300009148 | Bacteria | 1902 |
| 446 | Ga0105243_10282805 | 3300009148 | Unclassified | 1495 |
| 447 | Ga0105243_11259227 | 3300009148 | Bacteria | 755 |
| 448 | Ga0105241_10000721 | 3300009174 | Bacteria | 25017 |
| 449 | Ga0105241_10200099 | 3300009174 | Bacteria | 1668 |
| 450 | Ga0105241_10281108 | 3300009174 | Bacteria | 1421 |
| 451 | Ga0105241_10408323 | 3300009174 | Bacteria | 1193 |
| 452 | Ga0105241_10549747 | 3300009174 | Bacteria | 1036 |
| 453 | Ga0105241_10853314 | 3300009174 | Bacteria | 842 |
| 454 | Ga0105241_11002918 | 3300009174 | Bacteria | 781 |
| 455 | Ga0105241_12458113 | 3300009174 | Unclassified | 521 |
| 456 | Ga0105242_10019590 | 3300009176 | Bacteria | 5302 |
| 457 | Ga0105242_10139507 | 3300009176 | Bacteria | 2102 |
| 458 | Ga0105242_10163684 | 3300009176 | Bacteria | 1949 |
| 459 | Ga0105242_10231784 | 3300009176 | Bacteria | 1655 |
| 460 | Ga0105242_10809566 | 3300009176 | Unclassified | 928 |
| 461 | Ga0105242_10991771 | 3300009176 | Bacteria | 847 |
| 462 | Ga0105242_11104122 | 3300009176 | Bacteria | 807 |
| 463 | Ga0105242_12226265 | 3300009176 | Bacteria | 594 |
| 464 | Ga0105242_12226675 | 3300009176 | Bacteria | 594 |
| 465 | Ga0105242_12670042 | 3300009176 | Bacteria | 549 |
| 466 | Ga0105242_12734394 | 3300009176 | Unclassified | 543 |
| 467 | Ga0105242_13254132 | 3300009176 | Bacteria | 505 |
| 468 | Ga0105248_10066633 | 3300009177 | Bacteria | 4042 |
| 469 | Ga0105248_10152482 | 3300009177 | Bacteria | 2608 |
| 470 | Ga0105248_10460370 | 3300009177 | Bacteria | 1434 |
| 471 | Ga0105248_10737308 | 3300009177 | Unclassified | 1112 |
| 472 | Ga0105248_10903822 | 3300009177 | Bacteria | 997 |
| 473 | Ga0105248_10964121 | 3300009177 | Bacteria | 963 |
| 474 | Ga0105248_11127964 | 3300009177 | Bacteria | 886 |
| 475 | Ga0105248_12395203 | 3300009177 | Bacteria | 601 |
| 476 | Ga0105237_10000654 | 3300009545 | Bacteria | 48395 |
| 477 | Ga0105237_10022472 | 3300009545 | Bacteria | 6471 |
| 478 | Ga0105237_10061881 | 3300009545 | Bacteria | 3741 |
| 479 | Ga0105237_10095645 | 3300009545 | Bacteria | 2960 |
| 480 | Ga0105237_10296964 | 3300009545 | Bacteria | 1618 |
| 481 | Ga0105237_10362743 | 3300009545 | Bacteria | 1453 |
| 482 | Ga0105237_10410272 | 3300009545 | Unclassified | 1359 |
| 483 | Ga0105237_10467670 | 3300009545 | Bacteria | 1267 |
| 484 | Ga0105237_10818473 | 3300009545 | Bacteria | 938 |
| 485 | Ga0105237_11148097 | 3300009545 | Bacteria | 783 |
| 486 | Ga0105237_11324581 | 3300009545 | Bacteria | 726 |
| 487 | Ga0105237_12449324 | 3300009545 | Unclassified | 532 |
| 488 | Ga0105238_10006981 | 3300009551 | Bacteria | 11286 |
| 489 | Ga0105238_10060929 | 3300009551 | Bacteria | 3777 |
| 490 | Ga0105238_11080890 | 3300009551 | Unclassified | 824 |
| 491 | Ga0105249_10004870 | 3300009553 | Bacteria | 11583 |
| 492 | Ga0105249_10012686 | 3300009553 | Bacteria | 7430 |
| 493 | Ga0105249_10023081 | 3300009553 | Bacteria | 5579 |
| 494 | Ga0105249_10104818 | 3300009553 | Bacteria | 2665 |
| 495 | Ga0105249_10115110 | 3300009553 | Bacteria | 2547 |
| 496 | Ga0105249_10553664 | 3300009553 | Bacteria | 1201 |
| 497 | Ga0105249_10562396 | 3300009553 | Unclassified | 1192 |
| 498 | Ga0105249_11374299 | 3300009553 | Unclassified | 778 |
| 499 | Ga0105249_12608088 | 3300009553 | Bacteria | 578 |
| 500 | Ga0105249_13581314 | 3300009553 | Unclassified | 500 |
| 501 | Ga0099796_10221589 | 3300010159 | Bacteria | 775 |
| 502 | Ga0105239_10000353 | 3300010375 | Bacteria | 67099 |
| 503 | Ga0105239_10002319 | 3300010375 | Bacteria | 24303 |
| 504 | Ga0105239_10002402 | 3300010375 | Bacteria | 23874 |
| 505 | Ga0105239_10023616 | 3300010375 | Bacteria | 6771 |
| 506 | Ga0105239_10029540 | 3300010375 | Bacteria | 6027 |
| 507 | Ga0105239_10046183 | 3300010375 | Bacteria | 4772 |
| 508 | Ga0105239_10137123 | 3300010375 | Bacteria | 2724 |
| 509 | Ga0105239_10450950 | 3300010375 | Bacteria | 1459 |
| 510 | Ga0105239_10548614 | 3300010375 | Bacteria | 1316 |
| 511 | Ga0105239_10655614 | 3300010375 | Bacteria | 1199 |
| 512 | Ga0105239_11018647 | 3300010375 | Bacteria | 952 |
| 513 | Ga0105246_10064263 | 3300011119 | Bacteria | 2563 |
| 514 | Ga0105246_10109772 | 3300011119 | Bacteria | 2024 |
| 515 | Ga0105246_10176986 | 3300011119 | Unclassified | 1639 |
| 516 | Ga0105246_10580679 | 3300011119 | Bacteria | 965 |
| 517 | Ga0157327_1040044 | 3300012512 | Bacteria | 626 |
| 518 | Ga0157373_10042785 | 3300013100 | Unclassified | 3236 |
| 519 | Ga0157373_10057587 | 3300013100 | Bacteria | 2756 |
| 520 | Ga0157373_10113865 | 3300013100 | Bacteria | 1901 |
| 521 | Ga0157373_10326191 | 3300013100 | Unclassified | 1093 |
| 522 | Ga0157373_10469133 | 3300013100 | Unclassified | 907 |
| 523 | Ga0157371_10011331 | 3300013102 | Bacteria | 6878 |
| 524 | Ga0157371_10048034 | 3300013102 | Bacteria | 3034 |
| 525 | Ga0157371_10053895 | 3300013102 | Bacteria | 2856 |
| 526 | Ga0157371_10109883 | 3300013102 | Bacteria | 1957 |
| 527 | Ga0157371_10269678 | 3300013102 | Bacteria | 1228 |
| 528 | Ga0157371_10395378 | 3300013102 | Bacteria | 1011 |
| 529 | Ga0157371_10820428 | 3300013102 | Bacteria | 702 |
| 530 | Ga0157370_10005886 | 3300013104 | Bacteria | 13672 |
| 531 | Ga0157370_10021094 | 3300013104 | Bacteria | 6496 |
| 532 | Ga0157370_10097938 | 3300013104 | Bacteria | 2751 |
| 533 | Ga0157370_10600531 | 3300013104 | Bacteria | 1008 |
| 534 | Ga0157370_10754425 | 3300013104 | Unclassified | 887 |
| 535 | Ga0157370_10859977 | 3300013104 | Bacteria | 824 |
| 536 | Ga0157370_10918531 | 3300013104 | Bacteria | 794 |
| 537 | Ga0157370_11164858 | 3300013104 | Bacteria | 696 |
| 538 | Ga0157370_11334326 | 3300013104 | Unclassified | 646 |
| 539 | Ga0157369_10060951 | 3300013105 | Bacteria | 4068 |
| 540 | Ga0157369_10256753 | 3300013105 | Bacteria | 1823 |
| 541 | Ga0157369_10338684 | 3300013105 | Bacteria | 1562 |
| 542 | Ga0157369_10466049 | 3300013105 | Bacteria | 1308 |
| 543 | Ga0157369_11006248 | 3300013105 | Bacteria | 853 |
| 544 | Ga0157369_12125885 | 3300013105 | Bacteria | 569 |
| 545 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 546 | Ga0157374_10000841 | 3300013296 | Bacteria | 26835 |
| 547 | Ga0157374_10006478 | 3300013296 | Bacteria | 9936 |
| 548 | Ga0157374_10015281 | 3300013296 | Bacteria | 6732 |
| 549 | Ga0157374_10024723 | 3300013296 | Bacteria | 5385 |
| 550 | Ga0157374_10036109 | 3300013296 | Bacteria | 4525 |
| 551 | Ga0157374_10212713 | 3300013296 | Bacteria | 1896 |
| 552 | Ga0157374_10261668 | 3300013296 | Bacteria | 1704 |
| 553 | Ga0157374_10315603 | 3300013296 | Bacteria | 1548 |
| 554 | Ga0157374_10334544 | 3300013296 | Bacteria | 1502 |
| 555 | Ga0157374_10740734 | 3300013296 | Unclassified | 997 |
| 556 | Ga0157374_10823863 | 3300013296 | Bacteria | 944 |
| 557 | Ga0157378_10002090 | 3300013297 | Bacteria | 17837 |
| 558 | Ga0157378_10004442 | 3300013297 | Bacteria | 12335 |
| 559 | Ga0157378_10012644 | 3300013297 | Bacteria | 7387 |
| 560 | Ga0157378_10022590 | 3300013297 | Bacteria | 5535 |
| 561 | Ga0157378_10023595 | 3300013297 | Bacteria | 5411 |
| 562 | Ga0157378_10038804 | 3300013297 | Bacteria | 4223 |
| 563 | Ga0157378_10222060 | 3300013297 | Unclassified | 1797 |
| 564 | Ga0157378_10613946 | 3300013297 | Bacteria | 1100 |
| 565 | Ga0157378_10702050 | 3300013297 | Unclassified | 1031 |
| 566 | Ga0157378_10710397 | 3300013297 | Bacteria | 1025 |
| 567 | Ga0157378_11584247 | 3300013297 | Bacteria | 701 |
| 568 | Ga0157378_12791720 | 3300013297 | Unclassified | 541 |
| 569 | Ga0163162_10000100 | 3300013306 | Bacteria | 78269 |
| 570 | Ga0163162_10000190 | 3300013306 | Bacteria | 56892 |
| 571 | Ga0163162_10004205 | 3300013306 | Bacteria | 13837 |
| 572 | Ga0163162_10006285 | 3300013306 | Bacteria | 11505 |
| 573 | Ga0163162_10024736 | 3300013306 | Bacteria | 5931 |
| 574 | Ga0163162_10060245 | 3300013306 | Bacteria | 3830 |
| 575 | Ga0163162_10125475 | 3300013306 | Bacteria | 2673 |
| 576 | Ga0163162_10191116 | 3300013306 | Unclassified | 2175 |
| 577 | Ga0163162_10299598 | 3300013306 | Unclassified | 1740 |
| 578 | Ga0163162_10320794 | 3300013306 | Bacteria | 1682 |
| 579 | Ga0163162_10504866 | 3300013306 | Bacteria | 1340 |
| 580 | Ga0163162_10838151 | 3300013306 | Bacteria | 1035 |
| 581 | Ga0163162_11251766 | 3300013306 | Bacteria | 843 |
| 582 | Ga0163162_13058025 | 3300013306 | Bacteria | 537 |
| 583 | Ga0157372_10002276 | 3300013307 | Bacteria | 20798 |
| 584 | Ga0157372_10002704 | 3300013307 | Bacteria | 19172 |
| 585 | Ga0157372_10010700 | 3300013307 | Bacteria | 9763 |
| 586 | Ga0157372_10033620 | 3300013307 | Bacteria | 5635 |
| 587 | Ga0157372_10053877 | 3300013307 | Bacteria | 4485 |
| 588 | Ga0157372_10155951 | 3300013307 | Bacteria | 2637 |
| 589 | Ga0157372_10180343 | 3300013307 | Bacteria | 2445 |
| 590 | Ga0157372_10182645 | 3300013307 | Bacteria | 2428 |
| 591 | Ga0157372_10207420 | 3300013307 | Bacteria | 2271 |
| 592 | Ga0157372_10343570 | 3300013307 | Unclassified | 1739 |
| 593 | Ga0157372_10666226 | 3300013307 | Bacteria | 1211 |
| 594 | Ga0157372_10747764 | 3300013307 | Bacteria | 1137 |
| 595 | Ga0157372_10806846 | 3300013307 | Bacteria | 1090 |
| 596 | Ga0157372_10892147 | 3300013307 | Bacteria | 1032 |
| 597 | Ga0157372_10965339 | 3300013307 | Bacteria | 988 |
| 598 | Ga0157372_11151761 | 3300013307 | Unclassified | 897 |
| 599 | Ga0157372_11257504 | 3300013307 | Bacteria | 855 |
| 600 | Ga0157372_11304431 | 3300013307 | Bacteria | 838 |
| 601 | Ga0157372_11474463 | 3300013307 | Unclassified | 784 |
| 602 | Ga0157372_11638089 | 3300013307 | Bacteria | 741 |
| 603 | Ga0157372_11715134 | 3300013307 | Bacteria | 723 |
| 604 | Ga0157372_11827297 | 3300013307 | Unclassified | 699 |
| 605 | Ga0157375_10000057 | 3300013308 | Bacteria | 122654 |
| 606 | Ga0157375_10000336 | 3300013308 | Bacteria | 42479 |
| 607 | Ga0157375_10010520 | 3300013308 | Bacteria | 8143 |
| 608 | Ga0157375_10018827 | 3300013308 | Bacteria | 6267 |
| 609 | Ga0157375_10050668 | 3300013308 | Bacteria | 4073 |
| 610 | Ga0157375_10069395 | 3300013308 | Bacteria | 3531 |
| 611 | Ga0157375_10246349 | 3300013308 | Bacteria | 1947 |
| 612 | Ga0157375_10606472 | 3300013308 | Unclassified | 1253 |
| 613 | Ga0157375_12011110 | 3300013308 | Bacteria | 687 |
| 614 | Ga0157375_12307958 | 3300013308 | Unclassified | 641 |
| 615 | Ga0157375_12964785 | 3300013308 | Bacteria | 567 |
| 616 | Ga0163163_10000254 | 3300014325 | Bacteria | 54049 |
| 617 | Ga0163163_10002122 | 3300014325 | Bacteria | 16737 |
| 618 | Ga0163163_10009925 | 3300014325 | Bacteria | 8537 |
| 619 | Ga0163163_10014392 | 3300014325 | Bacteria | 7273 |
| 620 | Ga0163163_10056448 | 3300014325 | Bacteria | 3881 |
| 621 | Ga0163163_10143716 | 3300014325 | Bacteria | 2429 |
| 622 | Ga0163163_10147957 | 3300014325 | Unclassified | 2393 |
| 623 | Ga0163163_10288780 | 3300014325 | Bacteria | 1692 |
| 624 | Ga0163163_10375809 | 3300014325 | Bacteria | 1478 |
| 625 | Ga0163163_10899395 | 3300014325 | Bacteria | 949 |
| 626 | Ga0157380_10204970 | 3300014326 | Bacteria | 1753 |
| 627 | Ga0157380_10510024 | 3300014326 | Bacteria | 1170 |
| 628 | Ga0157380_12096366 | 3300014326 | Bacteria | 628 |
| 629 | Ga0157380_12457421 | 3300014326 | Bacteria | 587 |
| 630 | Ga0157380_12755416 | 3300014326 | Bacteria | 558 |
| 631 | Ga0157380_13291951 | 3300014326 | Unclassified | 516 |
| 632 | Ga0157377_10025991 | 3300014745 | Bacteria | 3128 |
| 633 | Ga0157377_10119689 | 3300014745 | Bacteria | 1594 |
| 634 | Ga0157377_10145828 | 3300014745 | Bacteria | 1459 |
| 635 | Ga0157377_10415921 | 3300014745 | Bacteria | 919 |
| 636 | Ga0157379_10000367 | 3300014968 | Bacteria | 36246 |
| 637 | Ga0157379_10017665 | 3300014968 | Bacteria | 6283 |
| 638 | Ga0157379_10072486 | 3300014968 | Bacteria | 3081 |
| 639 | Ga0157379_10121473 | 3300014968 | Bacteria | 2350 |
| 640 | Ga0157379_10301801 | 3300014968 | Bacteria | 1460 |
| 641 | Ga0157379_10306440 | 3300014968 | Bacteria | 1448 |
| 642 | Ga0157379_10387596 | 3300014968 | Bacteria | 1283 |
| 643 | Ga0157379_10736264 | 3300014968 | Bacteria | 927 |
| 644 | Ga0157379_10912218 | 3300014968 | Bacteria | 834 |
| 645 | Ga0157379_11283657 | 3300014968 | Unclassified | 706 |
| 646 | Ga0157376_10000135 | 3300014969 | Bacteria | 50667 |
| 647 | Ga0157376_10002989 | 3300014969 | Bacteria | 11593 |
| 648 | Ga0157376_10004908 | 3300014969 | Bacteria | 9323 |
| 649 | Ga0157376_10007359 | 3300014969 | Bacteria | 7849 |
| 650 | Ga0157376_10145446 | 3300014969 | Bacteria | 2131 |
| 651 | Ga0157376_10864712 | 3300014969 | Bacteria | 920 |
| 652 | Ga0157376_11266781 | 3300014969 | Bacteria | 767 |
| 653 | Ga0157376_11777682 | 3300014969 | Bacteria | 652 |
| 654 | Ga0157376_12124386 | 3300014969 | Bacteria | 600 |
| 655 | Ga0163161_10001091 | 3300017792 | Bacteria | 20526 |
| 656 | Ga0163161_10049399 | 3300017792 | Bacteria | 3040 |
| 657 | Ga0163161_10049900 | 3300017792 | Bacteria | 3026 |
| 658 | Ga0163161_10195228 | 3300017792 | Bacteria | 1558 |
| 659 | Ga0163161_10237726 | 3300017792 | Bacteria | 1416 |
| 660 | Ga0163161_10244328 | 3300017792 | Bacteria | 1397 |
| 661 | Ga0163161_10437549 | 3300017792 | Unclassified | 1055 |
| 662 | Ga0163161_10441963 | 3300017792 | Bacteria | 1050 |
| 663 | Ga0163161_10597784 | 3300017792 | Unclassified | 909 |
| 664 | Ga0163161_11078445 | 3300017792 | Bacteria | 689 |
| 665 | Ga0206352_10358371 | 3300020078 | Bacteria | 1001 |
| 666 | Ga0206352_11274644 | 3300020078 | Bacteria | 537 |
| 667 | Ga0213876_10010098 | 3300021384 | Bacteria | 5073 |
| 668 | Ga0213876_10252876 | 3300021384 | Bacteria | 936 |
| 669 | Ga0224712_10240349 | 3300022467 | Bacteria | 834 |
| 670 | Ga0209436_102820 | 3300025208 | Bacteria | 4937 |
| 671 | Ga0209258_100068 | 3300025242 | Bacteria | 286288 |
| 672 | Ga0209148_1000182 | 3300025254 | Bacteria | 123558 |
| 673 | Ga0209130_1011517 | 3300025284 | Bacteria | 2365 |
| 674 | Ga0209758_1041446 | 3300025297 | Bacteria | 1721 |
| 675 | Ga0207426_1000051 | 3300025302 | Bacteria | 391700 |
| 676 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 677 | Ga0207697_10015051 | 3300025315 | Bacteria | 3201 |
| 678 | Ga0207697_10049556 | 3300025315 | Bacteria | 1734 |
| 679 | Ga0207656_10001696 | 3300025321 | Bacteria | 7317 |
| 680 | Ga0207656_10056009 | 3300025321 | Bacteria | 1718 |
| 681 | Ga0207656_10727732 | 3300025321 | Bacteria | 508 |
| 682 | Ga0207682_10055094 | 3300025893 | Bacteria | 1653 |
| 683 | Ga0207682_10204378 | 3300025893 | Bacteria | 909 |
| 684 | Ga0207642_10013123 | 3300025899 | Bacteria | 3014 |
| 685 | Ga0207642_10106315 | 3300025899 | Unclassified | 1420 |
| 686 | Ga0207642_10142840 | 3300025899 | Unclassified | 1264 |
| 687 | Ga0207642_10344450 | 3300025899 | Bacteria | 877 |
| 688 | Ga0207642_10585982 | 3300025899 | Bacteria | 693 |
| 689 | Ga0207710_10004177 | 3300025900 | Bacteria | 6337 |
| 690 | Ga0207710_10037994 | 3300025900 | Bacteria | 2128 |
| 691 | Ga0207688_10011930 | 3300025901 | Bacteria | 4730 |
| 692 | Ga0207688_10038950 | 3300025901 | Bacteria | 2640 |
| 693 | Ga0207680_10003138 | 3300025903 | Bacteria | 7759 |
| 694 | Ga0207680_10007095 | 3300025903 | Bacteria | 5445 |
| 695 | Ga0207680_10046316 | 3300025903 | Bacteria | 2570 |
| 696 | Ga0207680_10082786 | 3300025903 | Bacteria | 2020 |
| 697 | Ga0207680_10151508 | 3300025903 | Bacteria | 1546 |
| 698 | Ga0207680_10441838 | 3300025903 | Bacteria | 923 |
| 699 | Ga0207680_10760628 | 3300025903 | Bacteria | 694 |
| 700 | Ga0207680_10767533 | 3300025903 | Bacteria | 691 |
| 701 | Ga0207647_10001743 | 3300025904 | Bacteria | 16673 |
| 702 | Ga0207647_10064282 | 3300025904 | Unclassified | 2230 |
| 703 | Ga0207647_10150160 | 3300025904 | Bacteria | 1362 |
| 704 | Ga0207647_10370806 | 3300025904 | Unclassified | 809 |
| 705 | Ga0207647_10783084 | 3300025904 | Bacteria | 514 |
| 706 | Ga0207685_10272782 | 3300025905 | Unclassified | 827 |
| 707 | Ga0207645_10000511 | 3300025907 | Bacteria | 32164 |
| 708 | Ga0207645_10008172 | 3300025907 | Bacteria | 7327 |
| 709 | Ga0207645_10012027 | 3300025907 | Bacteria | 5885 |
| 710 | Ga0207645_10388370 | 3300025907 | Bacteria | 938 |
| 711 | Ga0207645_10528136 | 3300025907 | Bacteria | 800 |
| 712 | Ga0207645_10558431 | 3300025907 | Bacteria | 777 |
| 713 | Ga0207643_10026488 | 3300025908 | Bacteria | 3210 |
| 714 | Ga0207643_10056780 | 3300025908 | Bacteria | 2227 |
| 715 | Ga0207643_10081881 | 3300025908 | Bacteria | 1871 |
| 716 | Ga0207643_10297520 | 3300025908 | Bacteria | 1004 |
| 717 | Ga0207705_10036694 | 3300025909 | Bacteria | 3507 |
| 718 | Ga0207705_10570424 | 3300025909 | Bacteria | 880 |
| 719 | Ga0207705_11292748 | 3300025909 | Unclassified | 557 |
| 720 | Ga0207654_10001646 | 3300025911 | Bacteria | 11680 |
| 721 | Ga0207654_10466305 | 3300025911 | Bacteria | 888 |
| 722 | Ga0207707_10273176 | 3300025912 | Unclassified | 1465 |
| 723 | Ga0207695_10000327 | 3300025913 | Bacteria | 113436 |
| 724 | Ga0207695_10008726 | 3300025913 | Bacteria | 12639 |
| 725 | Ga0207695_10014855 | 3300025913 | Bacteria | 9194 |
| 726 | Ga0207695_10038067 | 3300025913 | Bacteria | 5184 |
| 727 | Ga0207695_10091500 | 3300025913 | Bacteria | 3056 |
| 728 | Ga0207695_10253982 | 3300025913 | Bacteria | 1657 |
| 729 | Ga0207695_10513036 | 3300025913 | Unclassified | 1081 |
| 730 | Ga0207695_11461794 | 3300025913 | Bacteria | 564 |
| 731 | Ga0207671_10001643 | 3300025914 | Bacteria | 25455 |
| 732 | Ga0207671_10004018 | 3300025914 | Bacteria | 14291 |
| 733 | Ga0207671_10045170 | 3300025914 | Bacteria | 3257 |
| 734 | Ga0207671_10081617 | 3300025914 | Bacteria | 2425 |
| 735 | Ga0207671_10174218 | 3300025914 | Bacteria | 1672 |
| 736 | Ga0207671_10485760 | 3300025914 | Unclassified | 984 |
| 737 | Ga0207671_10922461 | 3300025914 | Bacteria | 690 |
| 738 | Ga0207662_10054739 | 3300025918 | Bacteria | 2380 |
| 739 | Ga0207662_10310070 | 3300025918 | Bacteria | 1051 |
| 740 | Ga0207662_11178037 | 3300025918 | Unclassified | 545 |
| 741 | Ga0207657_10338621 | 3300025919 | Bacteria | 1187 |
| 742 | Ga0207657_10507349 | 3300025919 | Bacteria | 945 |
| 743 | Ga0207657_11035826 | 3300025919 | Unclassified | 629 |
| 744 | Ga0207649_10006464 | 3300025920 | Bacteria | 6364 |
| 745 | Ga0207649_10071361 | 3300025920 | Bacteria | 2218 |
| 746 | Ga0207649_10184783 | 3300025920 | Bacteria | 1462 |
| 747 | Ga0207649_10344844 | 3300025920 | Bacteria | 1101 |
| 748 | Ga0207649_10418536 | 3300025920 | Bacteria | 1006 |
| 749 | Ga0207649_10478018 | 3300025920 | Bacteria | 944 |
| 750 | Ga0207681_10074867 | 3300025923 | Unclassified | 2373 |
| 751 | Ga0207681_10078607 | 3300025923 | Bacteria | 2322 |
| 752 | Ga0207681_10444946 | 3300025923 | Unclassified | 1053 |
| 753 | Ga0207681_11495350 | 3300025923 | Unclassified | 566 |
| 754 | Ga0207681_11504358 | 3300025923 | Bacteria | 564 |
| 755 | Ga0207694_10131982 | 3300025924 | Bacteria | 2003 |
| 756 | Ga0207694_11282988 | 3300025924 | Bacteria | 619 |
| 757 | Ga0207650_10004888 | 3300025925 | Bacteria | 9154 |
| 758 | Ga0207650_10009769 | 3300025925 | Bacteria | 6560 |
| 759 | Ga0207650_10035323 | 3300025925 | Bacteria | 3628 |
| 760 | Ga0207650_10046883 | 3300025925 | Bacteria | 3184 |
| 761 | Ga0207650_10195957 | 3300025925 | Unclassified | 1616 |
| 762 | Ga0207650_10304815 | 3300025925 | Unclassified | 1302 |
| 763 | Ga0207650_10476708 | 3300025925 | Bacteria | 1041 |
| 764 | Ga0207650_11174515 | 3300025925 | Unclassified | 653 |
| 765 | Ga0207650_11268940 | 3300025925 | Unclassified | 627 |
| 766 | Ga0207650_11379496 | 3300025925 | Unclassified | 600 |
| 767 | Ga0207650_11671015 | 3300025925 | Unclassified | 540 |
| 768 | Ga0207659_10033631 | 3300025926 | Bacteria | 3531 |
| 769 | Ga0207659_10034049 | 3300025926 | Bacteria | 3510 |
| 770 | Ga0207659_10056438 | 3300025926 | Bacteria | 2813 |
| 771 | Ga0207659_10325690 | 3300025926 | Bacteria | 1269 |
| 772 | Ga0207659_10743268 | 3300025926 | Bacteria | 841 |
| 773 | Ga0207659_11405584 | 3300025926 | Bacteria | 598 |
| 774 | Ga0207659_11497129 | 3300025926 | Bacteria | 577 |
| 775 | Ga0207687_11396149 | 3300025927 | Bacteria | 602 |
| 776 | Ga0207644_10005002 | 3300025931 | Bacteria | 8653 |
| 777 | Ga0207644_10062124 | 3300025931 | Bacteria | 2708 |
| 778 | Ga0207644_10946104 | 3300025931 | Bacteria | 722 |
| 779 | Ga0207690_10096270 | 3300025932 | Bacteria | 2104 |
| 780 | Ga0207706_10003803 | 3300025933 | Bacteria | 14383 |
| 781 | Ga0207706_10007905 | 3300025933 | Bacteria | 9817 |
| 782 | Ga0207706_10023224 | 3300025933 | Bacteria | 5570 |
| 783 | Ga0207706_10345305 | 3300025933 | Bacteria | 1294 |
| 784 | Ga0207706_10483715 | 3300025933 | Unclassified | 1069 |
| 785 | Ga0207706_10921640 | 3300025933 | Bacteria | 737 |
| 786 | Ga0207706_11348327 | 3300025933 | Bacteria | 588 |
| 787 | Ga0207686_10058398 | 3300025934 | Bacteria | 2432 |
| 788 | Ga0207686_10118317 | 3300025934 | Bacteria | 1799 |
| 789 | Ga0207686_10146299 | 3300025934 | Bacteria | 1639 |
| 790 | Ga0207686_10694100 | 3300025934 | Bacteria | 809 |
| 791 | Ga0207686_11095800 | 3300025934 | Unclassified | 649 |
| 792 | Ga0207709_10649030 | 3300025935 | Bacteria | 840 |
| 793 | Ga0207670_10004881 | 3300025936 | Bacteria | 7291 |
| 794 | Ga0207670_10459853 | 3300025936 | Bacteria | 1027 |
| 795 | Ga0207670_10613974 | 3300025936 | Unclassified | 894 |
| 796 | Ga0207670_10641953 | 3300025936 | Bacteria | 875 |
| 797 | Ga0207669_10272319 | 3300025937 | Bacteria | 1272 |
| 798 | Ga0207669_10319550 | 3300025937 | Bacteria | 1188 |
| 799 | Ga0207669_10481243 | 3300025937 | Unclassified | 989 |
| 800 | Ga0207669_10602284 | 3300025937 | Bacteria | 893 |
| 801 | Ga0207704_10000484 | 3300025938 | Bacteria | 17750 |
| 802 | Ga0207704_10026162 | 3300025938 | Bacteria | 3197 |
| 803 | Ga0207704_10184786 | 3300025938 | Bacteria | 1510 |
| 804 | Ga0207704_10601514 | 3300025938 | Unclassified | 900 |
| 805 | Ga0207704_11720276 | 3300025938 | Bacteria | 539 |
| 806 | Ga0207665_10160926 | 3300025939 | Bacteria | 1615 |
| 807 | Ga0207691_10002120 | 3300025940 | Bacteria | 19396 |
| 808 | Ga0207691_10012396 | 3300025940 | Bacteria | 8172 |
| 809 | Ga0207691_10049241 | 3300025940 | Bacteria | 3860 |
| 810 | Ga0207691_10093127 | 3300025940 | Bacteria | 2698 |
| 811 | Ga0207691_10165772 | 3300025940 | Bacteria | 1936 |
| 812 | Ga0207691_10166536 | 3300025940 | Bacteria | 1931 |
| 813 | Ga0207691_10281088 | 3300025940 | Unclassified | 1432 |
| 814 | Ga0207691_10322463 | 3300025940 | Bacteria | 1324 |
| 815 | Ga0207691_10331549 | 3300025940 | Bacteria | 1304 |
| 816 | Ga0207691_10450743 | 3300025940 | Unclassified | 1095 |
| 817 | Ga0207691_10811208 | 3300025940 | Bacteria | 786 |
| 818 | Ga0207711_10096985 | 3300025941 | Bacteria | 2603 |
| 819 | Ga0207711_10463167 | 3300025941 | Bacteria | 1180 |
| 820 | Ga0207711_10984058 | 3300025941 | Bacteria | 783 |
| 821 | Ga0207711_11697046 | 3300025941 | Unclassified | 575 |
| 822 | Ga0207689_10002405 | 3300025942 | Bacteria | 17429 |
| 823 | Ga0207689_10010393 | 3300025942 | Bacteria | 8016 |
| 824 | Ga0207689_10015655 | 3300025942 | Bacteria | 6422 |
| 825 | Ga0207689_10019942 | 3300025942 | Bacteria | 5646 |
| 826 | Ga0207689_10021007 | 3300025942 | Bacteria | 5487 |
| 827 | Ga0207689_10021416 | 3300025942 | Bacteria | 5435 |
| 828 | Ga0207689_10050087 | 3300025942 | Bacteria | 3445 |
| 829 | Ga0207689_10073362 | 3300025942 | Unclassified | 2811 |
| 830 | Ga0207689_10268307 | 3300025942 | Bacteria | 1413 |
| 831 | Ga0207689_10333242 | 3300025942 | Bacteria | 1260 |
| 832 | Ga0207689_10486626 | 3300025942 | Unclassified | 1033 |
| 833 | Ga0207689_10781778 | 3300025942 | Bacteria | 806 |
| 834 | Ga0207661_10015999 | 3300025944 | Bacteria | 5529 |
| 835 | Ga0207661_10020712 | 3300025944 | Bacteria | 4920 |
| 836 | Ga0207661_10059632 | 3300025944 | Bacteria | 3076 |
| 837 | Ga0207661_10069730 | 3300025944 | Bacteria | 2867 |
| 838 | Ga0207661_11366855 | 3300025944 | Bacteria | 650 |
| 839 | Ga0207679_10001121 | 3300025945 | Bacteria | 17095 |
| 840 | Ga0207679_10002674 | 3300025945 | Bacteria | 11004 |
| 841 | Ga0207679_10049169 | 3300025945 | Bacteria | 3075 |
| 842 | Ga0207679_10065635 | 3300025945 | Bacteria | 2717 |
| 843 | Ga0207679_10070822 | 3300025945 | Bacteria | 2628 |
| 844 | Ga0207679_10083573 | 3300025945 | Bacteria | 2447 |
| 845 | Ga0207679_10108491 | 3300025945 | Bacteria | 2186 |
| 846 | Ga0207679_10669751 | 3300025945 | Bacteria | 940 |
| 847 | Ga0207679_11092845 | 3300025945 | Unclassified | 732 |
| 848 | Ga0207667_10000340 | 3300025949 | Bacteria | 63904 |
| 849 | Ga0207667_10009409 | 3300025949 | Bacteria | 11510 |
| 850 | Ga0207667_10037270 | 3300025949 | Bacteria | 5199 |
| 851 | Ga0207667_10544960 | 3300025949 | Unclassified | 1174 |
| 852 | Ga0207651_10002824 | 3300025960 | Bacteria | 8358 |
| 853 | Ga0207651_10015789 | 3300025960 | Bacteria | 4401 |
| 854 | Ga0207651_10043110 | 3300025960 | Unclassified | 3009 |
| 855 | Ga0207651_10043279 | 3300025960 | Unclassified | 3004 |
| 856 | Ga0207651_10199654 | 3300025960 | Bacteria | 1602 |
| 857 | Ga0207651_10216028 | 3300025960 | Bacteria | 1547 |
| 858 | Ga0207651_10303453 | 3300025960 | Unclassified | 1328 |
| 859 | Ga0207651_10934214 | 3300025960 | Bacteria | 773 |
| 860 | Ga0207651_11668378 | 3300025960 | Unclassified | 574 |
| 861 | Ga0207651_11798250 | 3300025960 | Bacteria | 551 |
| 862 | Ga0207712_10003520 | 3300025961 | Bacteria | 9888 |
| 863 | Ga0207712_10009397 | 3300025961 | Bacteria | 6186 |
| 864 | Ga0207712_10011683 | 3300025961 | Bacteria | 5598 |
| 865 | Ga0207712_10012015 | 3300025961 | Bacteria | 5526 |
| 866 | Ga0207712_10018240 | 3300025961 | Bacteria | 4568 |
| 867 | Ga0207712_10072670 | 3300025961 | Bacteria | 2478 |
| 868 | Ga0207712_10115094 | 3300025961 | Bacteria | 2024 |
| 869 | Ga0207712_10372915 | 3300025961 | Bacteria | 1192 |
| 870 | Ga0207712_11314512 | 3300025961 | Bacteria | 646 |
| 871 | Ga0207668_10001106 | 3300025972 | Bacteria | 16044 |
| 872 | Ga0207668_10098164 | 3300025972 | Bacteria | 2170 |
| 873 | Ga0207668_10244856 | 3300025972 | Bacteria | 1453 |
| 874 | Ga0207668_10648319 | 3300025972 | Bacteria | 924 |
| 875 | Ga0207668_10943000 | 3300025972 | Bacteria | 769 |
| 876 | Ga0207640_10130502 | 3300025981 | Bacteria | 1816 |
| 877 | Ga0207640_10156691 | 3300025981 | Bacteria | 1680 |
| 878 | Ga0207640_10613137 | 3300025981 | Unclassified | 923 |
| 879 | Ga0207640_11521754 | 3300025981 | Bacteria | 601 |
| 880 | Ga0207640_11695298 | 3300025981 | Bacteria | 570 |
| 881 | Ga0207658_10000847 | 3300025986 | Bacteria | 25559 |
| 882 | Ga0207658_10010360 | 3300025986 | Bacteria | 6333 |
| 883 | Ga0207658_10013966 | 3300025986 | Bacteria | 5496 |
| 884 | Ga0207658_10036244 | 3300025986 | Bacteria | 3536 |
| 885 | Ga0207658_10244463 | 3300025986 | Unclassified | 1522 |
| 886 | Ga0207658_10422049 | 3300025986 | Bacteria | 1176 |
| 887 | Ga0207658_10452056 | 3300025986 | Bacteria | 1137 |
| 888 | Ga0207658_11014068 | 3300025986 | Bacteria | 757 |
| 889 | Ga0207658_11101403 | 3300025986 | Unclassified | 725 |
| 890 | Ga0207658_11332155 | 3300025986 | Bacteria | 656 |
| 891 | Ga0207677_10001136 | 3300026023 | Bacteria | 14521 |
| 892 | Ga0207677_10007895 | 3300026023 | Bacteria | 5915 |
| 893 | Ga0207677_10053438 | 3300026023 | Bacteria | 2750 |
| 894 | Ga0207677_10104847 | 3300026023 | Bacteria | 2091 |
| 895 | Ga0207677_10118524 | 3300026023 | Bacteria | 1986 |
| 896 | Ga0207677_10496489 | 3300026023 | Bacteria | 1054 |
| 897 | Ga0207677_10535892 | 3300026023 | Unclassified | 1018 |
| 898 | Ga0207677_10580982 | 3300026023 | Unclassified | 981 |
| 899 | Ga0207703_10010768 | 3300026035 | Bacteria | 7135 |
| 900 | Ga0207703_10648914 | 3300026035 | Unclassified | 1001 |
| 901 | Ga0207703_10726598 | 3300026035 | Bacteria | 945 |
| 902 | Ga0207703_10804331 | 3300026035 | Bacteria | 897 |
| 903 | Ga0207703_10928050 | 3300026035 | Bacteria | 834 |
| 904 | Ga0207703_11002670 | 3300026035 | Bacteria | 801 |
| 905 | Ga0207703_11140025 | 3300026035 | Bacteria | 749 |
| 906 | Ga0207703_12249299 | 3300026035 | Bacteria | 521 |
| 907 | Ga0207639_10083200 | 3300026041 | Bacteria | 2539 |
| 908 | Ga0207639_10308490 | 3300026041 | Bacteria | 1401 |
| 909 | Ga0207639_10379234 | 3300026041 | Unclassified | 1269 |
| 910 | Ga0207639_10398512 | 3300026041 | Bacteria | 1239 |
| 911 | Ga0207639_10526364 | 3300026041 | Bacteria | 1083 |
| 912 | Ga0207639_10828455 | 3300026041 | Bacteria | 863 |
| 913 | Ga0207639_11032459 | 3300026041 | Bacteria | 770 |
| 914 | Ga0207639_11218910 | 3300026041 | Bacteria | 706 |
| 915 | Ga0207639_11493536 | 3300026041 | Bacteria | 634 |
| 916 | Ga0207639_12132462 | 3300026041 | Bacteria | 522 |
| 917 | Ga0207678_10199143 | 3300026067 | Unclassified | 1712 |
| 918 | Ga0207678_10395394 | 3300026067 | Bacteria | 1196 |
| 919 | Ga0207678_10592582 | 3300026067 | Bacteria | 971 |
| 920 | Ga0207678_10607373 | 3300026067 | Unclassified | 959 |
| 921 | Ga0207678_10685741 | 3300026067 | Bacteria | 901 |
| 922 | Ga0207678_10689552 | 3300026067 | Unclassified | 899 |
| 923 | Ga0207678_11039657 | 3300026067 | Bacteria | 725 |
| 924 | Ga0207678_11300917 | 3300026067 | Bacteria | 643 |
| 925 | Ga0207678_11863662 | 3300026067 | Bacteria | 525 |
| 926 | Ga0207708_10357458 | 3300026075 | Bacteria | 1200 |
| 927 | Ga0207708_10525593 | 3300026075 | Unclassified | 995 |
| 928 | Ga0207702_10417315 | 3300026078 | Bacteria | 1297 |
| 929 | Ga0207702_10748205 | 3300026078 | Bacteria | 965 |
| 930 | Ga0207702_11429131 | 3300026078 | Bacteria | 685 |
| 931 | Ga0207641_10000418 | 3300026088 | Bacteria | 49680 |
| 932 | Ga0207641_10004489 | 3300026088 | Bacteria | 12072 |
| 933 | Ga0207641_10143228 | 3300026088 | Bacteria | 2159 |
| 934 | Ga0207641_10326368 | 3300026088 | Unclassified | 1457 |
| 935 | Ga0207641_10851373 | 3300026088 | Unclassified | 904 |
| 936 | Ga0207641_11122046 | 3300026088 | Bacteria | 785 |
| 937 | Ga0207641_11432600 | 3300026088 | Bacteria | 692 |
| 938 | Ga0207641_11645497 | 3300026088 | Bacteria | 644 |
| 939 | Ga0207641_12038058 | 3300026088 | Unclassified | 575 |
| 940 | Ga0207641_12570089 | 3300026088 | Bacteria | 507 |
| 941 | Ga0207641_12618480 | 3300026088 | Bacteria | 502 |
| 942 | Ga0207648_10001186 | 3300026089 | Bacteria | 29157 |
| 943 | Ga0207648_10013975 | 3300026089 | Bacteria | 7442 |
| 944 | Ga0207648_10051259 | 3300026089 | Bacteria | 3607 |
| 945 | Ga0207648_10059395 | 3300026089 | Bacteria | 3335 |
| 946 | Ga0207648_10086258 | 3300026089 | Bacteria | 2739 |
| 947 | Ga0207648_10160349 | 3300026089 | Bacteria | 1986 |
| 948 | Ga0207648_10308727 | 3300026089 | Unclassified | 1420 |
| 949 | Ga0207648_10397334 | 3300026089 | Bacteria | 1248 |
| 950 | Ga0207648_10537985 | 3300026089 | Unclassified | 1072 |
| 951 | Ga0207648_11453593 | 3300026089 | Bacteria | 644 |
| 952 | Ga0207648_11922026 | 3300026089 | Bacteria | 553 |
| 953 | Ga0207648_12010344 | 3300026089 | Unclassified | 539 |
| 954 | Ga0207676_10013981 | 3300026095 | Bacteria | 5762 |
| 955 | Ga0207676_10184534 | 3300026095 | Bacteria | 1830 |
| 956 | Ga0207676_10299451 | 3300026095 | Bacteria | 1468 |
| 957 | Ga0207676_10332248 | 3300026095 | Bacteria | 1399 |
| 958 | Ga0207676_11364470 | 3300026095 | Bacteria | 704 |
| 959 | Ga0207676_12609778 | 3300026095 | Bacteria | 501 |
| 960 | Ga0207674_10012911 | 3300026116 | Bacteria | 9316 |
| 961 | Ga0207674_10013730 | 3300026116 | Bacteria | 8966 |
| 962 | Ga0207674_10101039 | 3300026116 | Unclassified | 2865 |
| 963 | Ga0207674_10146034 | 3300026116 | Bacteria | 2324 |
| 964 | Ga0207674_10153470 | 3300026116 | Bacteria | 2259 |
| 965 | Ga0207674_10439326 | 3300026116 | Bacteria | 1261 |
| 966 | Ga0207674_10558402 | 3300026116 | Bacteria | 1106 |
| 967 | Ga0207674_11334436 | 3300026116 | Bacteria | 687 |
| 968 | Ga0207675_100018406 | 3300026118 | Bacteria | 6513 |
| 969 | Ga0207675_100073850 | 3300026118 | Unclassified | 3191 |
| 970 | Ga0207675_100083470 | 3300026118 | Bacteria | 2996 |
| 971 | Ga0207675_100106426 | 3300026118 | Bacteria | 2644 |
| 972 | Ga0207675_100229221 | 3300026118 | Bacteria | 1792 |
| 973 | Ga0207675_100293606 | 3300026118 | Bacteria | 1582 |
| 974 | Ga0207675_100578976 | 3300026118 | Unclassified | 1124 |
| 975 | Ga0207675_100605670 | 3300026118 | Bacteria | 1099 |
| 976 | Ga0207675_100826956 | 3300026118 | Unclassified | 940 |
| 977 | Ga0207675_101919330 | 3300026118 | Bacteria | 610 |
| 978 | Ga0207683_10005675 | 3300026121 | Bacteria | 10702 |
| 979 | Ga0207683_10031869 | 3300026121 | Bacteria | 4577 |
| 980 | Ga0207683_10060923 | 3300026121 | Bacteria | 3319 |
| 981 | Ga0207683_10063612 | 3300026121 | Bacteria | 3250 |
| 982 | Ga0207683_10226237 | 3300026121 | Bacteria | 1705 |
| 983 | Ga0207683_10248030 | 3300026121 | Bacteria | 1624 |
| 984 | Ga0207698_10020032 | 3300026142 | Bacteria | 4596 |
| 985 | Ga0207698_10070584 | 3300026142 | Bacteria | 2768 |
| 986 | Ga0207698_10076391 | 3300026142 | Bacteria | 2681 |
| 987 | Ga0207698_10225207 | 3300026142 | Bacteria | 1698 |
| 988 | Ga0207698_10539586 | 3300026142 | Unclassified | 1141 |
| 989 | Ga0207698_10792905 | 3300026142 | Unclassified | 949 |
| 990 | Ga0207698_10832350 | 3300026142 | Bacteria | 927 |
| 991 | Ga0207698_10871467 | 3300026142 | Bacteria | 906 |
| 992 | Ga0207698_11635413 | 3300026142 | Bacteria | 659 |
| 993 | Ga0207698_11955835 | 3300026142 | Bacteria | 601 |
| 994 | Ga0209981_1025019 | 3300027378 | Bacteria | 863 |
| 995 | Ga0209984_1031578 | 3300027424 | Bacteria | 749 |
| 996 | Ga0209995_1011784 | 3300027471 | Bacteria | 1423 |
| 997 | Ga0209968_1056776 | 3300027526 | Unclassified | 686 |
| 998 | Ga0209968_1082126 | 3300027526 | Bacteria | 580 |
| 999 | Ga0209999_1026399 | 3300027543 | Bacteria | 1074 |
| 1000 | Ga0210002_1047950 | 3300027617 | Bacteria | 733 |
| 1001 | Ga0209974_10168124 | 3300027876 | Bacteria | 798 |
| 1002 | Ga0209974_10230101 | 3300027876 | Bacteria | 692 |
| 1003 | Ga0207428_10371385 | 3300027907 | Unclassified | 1050 |
| 1004 | Ga0207428_10640257 | 3300027907 | Bacteria | 764 |
| 1005 | Ga0207428_10715529 | 3300027907 | Bacteria | 715 |
| 1006 | Ga0268266_10000034 | 3300028379 | Bacteria | 354251 |
| 1007 | Ga0268266_10002645 | 3300028379 | Bacteria | 18878 |
| 1008 | Ga0268266_10037874 | 3300028379 | Bacteria | 4106 |
| 1009 | Ga0268266_10041488 | 3300028379 | Bacteria | 3927 |
| 1010 | Ga0268265_10418024 | 3300028380 | Bacteria | 1244 |
| 1011 | Ga0268265_11843614 | 3300028380 | Unclassified | 611 |
| 1012 | Ga0268265_12091992 | 3300028380 | Bacteria | 573 |
| 1013 | Ga0268265_12490657 | 3300028380 | Bacteria | 523 |
| 1014 | Ga0268264_10000117 | 3300028381 | Bacteria | 195037 |
| 1015 | Ga0268264_10000739 | 3300028381 | Bacteria | 37219 |
| 1016 | Ga0268264_10007632 | 3300028381 | Bacteria | 9016 |
| 1017 | Ga0268264_10045709 | 3300028381 | Bacteria | 3636 |
| 1018 | Ga0268264_10125122 | 3300028381 | Bacteria | 2271 |
| 1019 | Ga0268264_10157121 | 3300028381 | Bacteria | 2045 |
| 1020 | Ga0268264_10360793 | 3300028381 | Bacteria | 1386 |
| 1021 | Ga0268264_10537925 | 3300028381 | Unclassified | 1144 |
| 1022 | Ga0268264_10553839 | 3300028381 | Bacteria | 1128 |
| 1023 | Ga0268264_10740900 | 3300028381 | Bacteria | 978 |
| 1024 | Ga0268264_10814069 | 3300028381 | Bacteria | 934 |
| 1025 | Ga0268264_11237682 | 3300028381 | Bacteria | 756 |
| 1026 | Ga0307517_10075365 | 3300028786 | Bacteria | 2960 |
| 1027 | Ga0307517_10097860 | 3300028786 | Bacteria | 2339 |
| 1028 | Ga0307517_10278037 | 3300028786 | Bacteria | 957 |
| 1029 | Ga0265324_10197047 | 3300029957 | Bacteria | 684 |
| 1030 | Ga0307511_10000153 | 3300030521 | Bacteria | 65598 |
| 1031 | Ga0265340_10138071 | 3300031247 | Bacteria | 1116 |
| 1032 | Ga0265327_10220582 | 3300031251 | Bacteria | 853 |
| 1033 | Ga0307513_10337849 | 3300031456 | Bacteria | 1258 |
| 1034 | Ga0307513_10596328 | 3300031456 | Bacteria | 814 |
| 1035 | Ga0307509_10590973 | 3300031507 | Bacteria | 784 |
| 1036 | Ga0307408_100040477 | 3300031548 | Bacteria | 3300 |
| 1037 | Ga0265313_10089316 | 3300031595 | Bacteria | 1386 |
| 1038 | Ga0307516_10013017 | 3300031730 | Bacteria | 8908 |
| 1039 | Ga0307516_10101287 | 3300031730 | Unclassified | 2696 |
| 1040 | Ga0307405_10310771 | 3300031731 | Bacteria | 1200 |
| 1041 | Ga0307405_11333177 | 3300031731 | Bacteria | 625 |
| 1042 | Ga0307413_10267875 | 3300031824 | Bacteria | 1277 |
| 1043 | Ga0307413_10583886 | 3300031824 | Bacteria | 912 |
| 1044 | Ga0307518_10570043 | 3300031838 | Unclassified | 553 |
| 1045 | Ga0307410_10031519 | 3300031852 | Bacteria | 3403 |
| 1046 | Ga0307410_10062277 | 3300031852 | Bacteria | 2556 |
| 1047 | Ga0307406_10305366 | 3300031901 | Bacteria | 1224 |
| 1048 | Ga0307407_10028144 | 3300031903 | Bacteria | 3001 |
| 1049 | Ga0307412_10304404 | 3300031911 | Bacteria | 1261 |
| 1050 | Ga0307409_101743126 | 3300031995 | Bacteria | 652 |
| 1051 | Ga0307416_100031968 | 3300032002 | Bacteria | 3970 |
| 1052 | Ga0307416_100181822 | 3300032002 | Bacteria | 1972 |
| 1053 | Ga0307416_102050099 | 3300032002 | Bacteria | 674 |
| 1054 | Ga0307414_10237961 | 3300032004 | Bacteria | 1505 |
| 1055 | Ga0307414_11328522 | 3300032004 | Bacteria | 667 |
| 1056 | Ga0307411_10650473 | 3300032005 | Bacteria | 912 |
| 1057 | Ga0307411_11348200 | 3300032005 | Bacteria | 651 |
| 1058 | Ga0307415_100120477 | 3300032126 | Bacteria | 1966 |
| 1059 | Ga0307415_102047549 | 3300032126 | Unclassified | 558 |
| 1060 | Ga0307510_10000191 | 3300033180 | Bacteria | 53108 |
| 1061 | Ga0307510_10223308 | 3300033180 | Bacteria | 1393 |
| 1062 | Ga0373934_0284889 | 3300035086 | Bacteria | 684 |
| 1063 | Ga0373936_0156366 | 3300035113 | Bacteria | 991 |
| 1064 | Ga0373945_0296781 | 3300035116 | Bacteria | 691 |
| 1065 | Ga0373953_0170263 | 3300035117 | Bacteria | 937 |
| 1066 | Ga0373953_0240197 | 3300035117 | Bacteria | 786 |
| 1067 | Ga0373954_0212408 | 3300035118 | Bacteria | 951 |
| 1068 | Ga0373954_0661935 | 3300035118 | Bacteria | 518 |
| 1069 | Ga0373956_0098657 | 3300035119 | Bacteria | 1353 |
| 1070 | Ga0373957_0368098 | 3300035120 | Bacteria | 615 |
| 1071 | Ga0373943_0357336 | 3300035170 | Bacteria | 838 |
| 1072 | Ga0373943_0695050 | 3300035170 | Unclassified | 602 |
| 1073 | Ga0373946_0052222 | 3300035171 | Bacteria | 1714 |
| 1074 | Ga0373955_0004303 | 3300035172 | Bacteria | 6290 |
| 1075 | Ga0373955_0141242 | 3300035172 | Bacteria | 1412 |
| 1076 | Ga0373924_0018853 | 3300035410 | Bacteria | 2666 |
| 1077 | Ga0373924_0129571 | 3300035410 | Bacteria | 1097 |
| 1078 | Ga0373935_0101981 | 3300035692 | Bacteria | 1893 |
| 1079 | Ga0373935_0548261 | 3300035692 | Unclassified | 843 |
| 1080 | Ga0373933_0027963 | 3300035724 | Bacteria | 3251 |
| 1081 | Ga0373933_0515849 | 3300035724 | Bacteria | 783 |
| 1082 | Ga0373933_0534008 | 3300035724 | Unclassified | 769 |
| 1083 | Ga0373947_0206812 | 3300035725 | Bacteria | 1286 |
| 1084 | Ga0373937_0100271 | 3300036401 | Bacteria | 2687 |
| 1085 | Ga0373937_0113245 | 3300036401 | Bacteria | 2524 |
| 1086 | Ga0373937_0152449 | 3300036401 | Bacteria | 2165 |
| 1087 | Ga0373937_0267166 | 3300036401 | Bacteria | 1614 |
| 1088 | Ga0373937_1212067 | 3300036401 | Bacteria | 703 |
| 1089 | Ga0265778_056678 | 3300036457 | Bacteria | 543 |
| 1090 | Ga0373925_0863719 | 3300037068 | Bacteria | 746 |
| 1091 | Ga0373925_0876141 | 3300037068 | Bacteria | 740 |
| 1092 | Ga0373925_1713577 | 3300037068 | Bacteria | 513 |
| 1093 | Ga0395899_0533335 | 3300037312 | Bacteria | 757 |
| 1094 | Ga0395898_0202872 | 3300037466 | Bacteria | 1893 |
| 1095 | Ga0395905_0000527 | 3300037471 | Bacteria | 52435 |
| 1096 | Ga0395905_0432429 | 3300037471 | Bacteria | 1213 |
| 1097 | Ga0395905_0595596 | 3300037471 | Unclassified | 1007 |
| 1098 | Ga0395905_1056098 | 3300037471 | Bacteria | 715 |
| 1099 | Ga0395901_0256467 | 3300038443 | Bacteria | 1821 |
| 1100 | Ga0436365_1161343 | 3300039437 | Bacteria | 9975 |
| 1101 | Ga0436365_1410658 | 3300039437 | Bacteria | 1467 |
| 1102 | Ga0436363_1230165 | 3300039450 | Bacteria | 570 |
| 1103 | Ga0439436_0000773 | 3300041404 | Bacteria | 8667 |
| 1104 | Ga0439436_0061468 | 3300041404 | Bacteria | 1052 |
| 1105 | Ga0439436_0084115 | 3300041404 | Bacteria | 886 |
| 1106 | Ga0439439_0016397 | 3300041406 | Bacteria | 1814 |
| 1107 | Ga0439439_0069573 | 3300041406 | Bacteria | 941 |
| 1108 | Ga0439453_0046775 | 3300041408 | Bacteria | 864 |
| 1109 | Ga0439465_0024662 | 3300041413 | Bacteria | 1896 |
| 1110 | Ga0451789_0607989 | 3300041443 | Bacteria | 1052 |
| 1111 | Ga0451789_1128496 | 3300041443 | Bacteria | 621 |
| 1112 | Ga0451790_23413 | 3300041444 | Bacteria | 615 |
| 1113 | Ga0451797_0944792 | 3300041453 | Bacteria | 525 |
| 1114 | Ga0451805_117129 | 3300041461 | Bacteria | 753 |
| 1115 | Ga0451807_1591963 | 3300041486 | Unclassified | 629 |
| 1116 | Ga0451807_2561754 | 3300041486 | Bacteria | 872 |
| 1117 | Ga0451837_1423970 | 3300041494 | Bacteria | 506 |
| 1118 | Ga0451847_0237332 | 3300041503 | Bacteria | 655 |
| 1119 | Ga0451855_0970425 | 3300041511 | Bacteria | 580 |
| 1120 | Ga0451853_1110616 | 3300041512 | Bacteria | 815 |
| 1121 | Ga0451853_2649306 | 3300041512 | Bacteria | 1154 |
| 1122 | Ga0451853_3714240 | 3300041512 | Unclassified | 571 |
| 1123 | Ga0439433_0050987 | 3300041999 | Bacteria | 976 |
| 1124 | Ga0439449_0004545 | 3300042007 | Bacteria | 5359 |
| 1125 | Ga0439449_0015374 | 3300042007 | Bacteria | 2875 |
| 1126 | Ga0439449_0280988 | 3300042007 | Bacteria | 627 |
| 1127 | Ga0439457_000175 | 3300042014 | Bacteria | 16689 |
| 1128 | Ga0439457_003006 | 3300042014 | Bacteria | 4686 |
| 1129 | Ga0439457_027556 | 3300042014 | Bacteria | 1258 |
| 1130 | Ga0439462_0031419 | 3300042015 | Bacteria | 1406 |
| 1131 | Ga0439444_0149920 | 3300042437 | Unclassified | 563 |
| 1132 | Ga0439459_0191789 | 3300042438 | Unclassified | 554 |
| 1133 | Ga0451577_0090941 | 3300042876 | Bacteria | 2724 |
| 1134 | Ga0466969_0064878 | 3300044656 | Bacteria | 1767 |
| 1135 | Ga0466972_0000782 | 3300044658 | Bacteria | 15085 |
| 1136 | Ga0466972_0223006 | 3300044658 | Bacteria | 882 |
| 1137 | Ga0466972_0322658 | 3300044658 | Bacteria | 722 |
| 1138 | Ga0453683_0646177 | 3300044673 | Unclassified | 691 |
| 1139 | Ga0453683_0734579 | 3300044673 | Unclassified | 648 |
| 1140 | Ga0466965_0064770 | 3300044683 | Unclassified | 1830 |
| 1141 | Ga0466965_0536104 | 3300044683 | Unclassified | 660 |
| 1142 | Ga0453684_0130453 | 3300044712 | Bacteria | 3016 |
| 1143 | Ga0453684_0210816 | 3300044712 | Bacteria | 2258 |
| 1144 | Ga0453684_0213439 | 3300044712 | Bacteria | 2241 |
| 1145 | Ga0453684_0579157 | 3300044712 | Unclassified | 1233 |
| 1146 | Ga0453684_1780334 | 3300044712 | Bacteria | 627 |
| 1147 | Ga0466971_0018466 | 3300044719 | Bacteria | 3089 |
| 1148 | Ga0466968_0006371 | 3300044735 | Bacteria | 4445 |
| 1149 | Ga0466970_0097553 | 3300044765 | Bacteria | 1599 |
| 1150 | Ga0466970_0145604 | 3300044765 | Bacteria | 1306 |
| 1151 | Ga0466957_0081791 | 3300044842 | Bacteria | 2012 |
| 1152 | Ga0466957_0863054 | 3300044842 | Bacteria | 645 |
| 1153 | Ga0466959_0004300 | 3300045049 | Bacteria | 9505 |
| 1154 | Ga0466959_0033132 | 3300045049 | Bacteria | 3822 |
| 1155 | Ga0466959_0114695 | 3300045049 | Bacteria | 1920 |
| 1156 | Ga0451576_0579263 | 3300045051 | Bacteria | 1179 |
| 1157 | Ga0451576_1002077 | 3300045051 | Bacteria | 875 |
| 1158 | Ga0451576_1271054 | 3300045051 | Unclassified | 768 |
| 1159 | Ga0451576_2516393 | 3300045051 | Bacteria | 526 |
| 1160 | Ga0466967_2121513 | 3300045976 | Bacteria | 558 |
| 1161 | Ga0495627_035808 | 3300046453 | Bacteria | 1545 |
| 1162 | Ga0495592_0063149 | 3300046454 | Bacteria | 2717 |
| 1163 | Ga0495603_0639279 | 3300046455 | Bacteria | 609 |
| 1164 | Ga0495603_0790340 | 3300046455 | Bacteria | 541 |
| 1165 | Ga0495629_0027491 | 3300046459 | Bacteria | 4039 |
| 1166 | Ga0495638_0616263 | 3300046460 | Bacteria | 531 |
| 1167 | Ga0495651_0446326 | 3300046462 | Bacteria | 837 |
| 1168 | Ga0495653_0101732 | 3300046463 | Bacteria | 2081 |
| 1169 | Ga0495653_0175749 | 3300046463 | Bacteria | 1474 |
| 1170 | Ga0495650_0055028 | 3300046471 | Bacteria | 1621 |
| 1171 | Ga0495580_0102092 | 3300046472 | Bacteria | 1994 |
| 1172 | Ga0495580_0238353 | 3300046472 | Unclassified | 1248 |
| 1173 | Ga0495582_0030486 | 3300046473 | Bacteria | 2961 |
| 1174 | Ga0495639_0228734 | 3300046475 | Unclassified | 916 |
| 1175 | Ga0495594_0530767 | 3300046499 | Bacteria | 668 |
| 1176 | Ga0495606_0164734 | 3300046507 | Bacteria | 1290 |
| 1177 | Ga0495608_0426579 | 3300046511 | Bacteria | 809 |
| 1178 | Ga0495618_0076337 | 3300046514 | Bacteria | 2135 |
| 1179 | Ga0495628_0028725 | 3300046516 | Bacteria | 4517 |
| 1180 | Ga0495628_0851680 | 3300046516 | Bacteria | 635 |
| 1181 | Ga0495630_0019380 | 3300046517 | Bacteria | 5000 |
| 1182 | Ga0495630_0936083 | 3300046517 | Bacteria | 659 |
| 1183 | Ga0495630_0954690 | 3300046517 | Bacteria | 652 |
| 1184 | Ga0495648_0002156 | 3300046524 | Bacteria | 18542 |
| 1185 | Ga0495652_0171524 | 3300046529 | Bacteria | 1674 |
| 1186 | Ga0495652_0209637 | 3300046529 | Bacteria | 1472 |
| 1187 | Ga0495640_0698324 | 3300046533 | Bacteria | 609 |
| 1188 | Ga0495586_0026118 | 3300046535 | Bacteria | 3125 |
| 1189 | Ga0495586_0527390 | 3300046535 | Bacteria | 682 |
| 1190 | Ga0495587_0047198 | 3300046536 | Bacteria | 2554 |
| 1191 | Ga0495587_0051874 | 3300046536 | Bacteria | 2423 |
| 1192 | Ga0495645_0177184 | 3300046543 | Bacteria | 1463 |
| 1193 | Ga0495645_0863827 | 3300046543 | Unclassified | 539 |
| 1194 | Ga0495622_0035324 | 3300046557 | Bacteria | 2331 |
| 1195 | Ga0495622_0054440 | 3300046557 | Bacteria | 1856 |
| 1196 | Ga0495633_0000058 | 3300046558 | Bacteria | 147584 |
| 1197 | Ga0495633_0033010 | 3300046558 | Bacteria | 2498 |
| 1198 | Ga0495667_0137316 | 3300046559 | Bacteria | 1576 |
| 1199 | Ga0495667_0420386 | 3300046559 | Bacteria | 841 |
| 1200 | Ga0495667_0517903 | 3300046559 | Bacteria | 746 |
| 1201 | Ga0495668_0001368 | 3300046616 | Bacteria | 23908 |
| 1202 | Ga0495611_0001667 | 3300046648 | Bacteria | 10769 |
| 1203 | Ga0495625_0547287 | 3300046660 | Bacteria | 701 |
| 1204 | Ga0495635_0053001 | 3300046663 | Bacteria | 2795 |
| 1205 | Ga0495661_0207894 | 3300046665 | Bacteria | 1021 |
| 1206 | Ga0495657_0756930 | 3300046675 | Bacteria | 556 |
| 1207 | Ga0495599_0120173 | 3300046678 | Bacteria | 1634 |
| 1208 | Ga0495623_0328171 | 3300046679 | Bacteria | 838 |
| 1209 | Ga0495646_0515539 | 3300046680 | Unclassified | 613 |
| 1210 | Ga0495647_0009671 | 3300046681 | Bacteria | 3271 |
| 1211 | Ga0495658_0003503 | 3300046683 | Bacteria | 7765 |
| 1212 | Ga0495613_0336152 | 3300046689 | Bacteria | 1040 |
| 1213 | Ga0495613_0860336 | 3300046689 | Unclassified | 589 |
| 1214 | Ga0495613_0872876 | 3300046689 | Bacteria | 584 |
| 1215 | Ga0495670_0108311 | 3300046691 | Bacteria | 1436 |
| 1216 | Ga0495671_0630112 | 3300046692 | Unclassified | 510 |
| 1217 | Ga0495649_0039065 | 3300046694 | Bacteria | 2602 |
| 1218 | Ga0495600_0167120 | 3300046809 | Bacteria | 1421 |
| 1219 | Ga0495600_0350565 | 3300046809 | Unclassified | 925 |
| 1220 | Ga0495660_0313076 | 3300046810 | Bacteria | 708 |
| 1221 | Ga0495581_0634855 | 3300047315 | Unclassified | 618 |
| 1222 | Ga0495604_0402380 | 3300047317 | Bacteria | 901 |
| 1223 | Ga0495674_0030231 | 3300047319 | Bacteria | 4927 |
| 1224 | Ga0495674_0141904 | 3300047319 | Bacteria | 2019 |
| 1225 | Ga0495672_0008108 | 3300047320 | Bacteria | 7801 |
| 1226 | Ga0495680_0045605 | 3300047322 | Bacteria | 3461 |
| 1227 | Ga0495687_000079 | 3300047443 | Bacteria | 147704 |
| 1228 | Ga0495675_0281079 | 3300047444 | Bacteria | 992 |
| 1229 | Ga0495675_0548526 | 3300047444 | Bacteria | 659 |
| 1230 | Ga0495684_0345329 | 3300047471 | Bacteria | 1058 |
| 1231 | Ga0495684_0830947 | 3300047471 | Unclassified | 601 |
| 1232 | Ga0495686_0000041 | 3300047472 | Bacteria | 297599 |
| 1233 | Ga0495686_0163358 | 3300047472 | Bacteria | 1300 |
| 1234 | Ga0495593_0258546 | 3300047673 | Unclassified | 872 |
| 1235 | Ga0495602_0260725 | 3300048088 | Bacteria | 1286 |
| 1236 | Ga0495615_0260881 | 3300048090 | Bacteria | 552 |
| 1237 | Ga0496101_0029522 | 3300048904 | Bacteria | 3836 |
| 1238 | Ga0496101_0086909 | 3300048904 | Bacteria | 2320 |
| 1239 | Ga0496102_1484329 | 3300048905 | Unclassified | 597 |
| 1240 | Ga0496104_0311247 | 3300048907 | Bacteria | 1488 |
| 1241 | Ga0496104_0520494 | 3300048907 | Bacteria | 1101 |
| 1242 | Ga0496104_0564189 | 3300048907 | Bacteria | 1049 |
| 1243 | Ga0496104_0602241 | 3300048907 | Bacteria | 1009 |
| 1244 | Ga0496104_0823960 | 3300048907 | Bacteria | 834 |
| 1245 | Ga0496104_1187524 | 3300048907 | Bacteria | 666 |
| 1246 | Ga0496105_0313901 | 3300048908 | Bacteria | 1258 |
| 1247 | Ga0496105_0636435 | 3300048908 | Bacteria | 824 |
| 1248 | Ga0496105_1023385 | 3300048908 | Unclassified | 617 |
| 1249 | Ga0496106_0192553 | 3300048909 | Bacteria | 1622 |
| 1250 | Ga0496106_0931880 | 3300048909 | Bacteria | 685 |
| 1251 | Ga0496108_0519843 | 3300048911 | Bacteria | 1039 |
| 1252 | Ga0496108_0791172 | 3300048911 | Bacteria | 819 |
| 1253 | Ga0496109_0202796 | 3300048912 | Bacteria | 1865 |
| 1254 | Ga0496110_0579487 | 3300048913 | Unclassified | 1019 |
| 1255 | Ga0496111_0147300 | 3300048914 | Unclassified | 1746 |
| 1256 | Ga0496111_0257821 | 3300048914 | Unclassified | 1294 |
| 1257 | Ga0496114_1551099 | 3300048917 | Unclassified | 550 |
| 1258 | Ga0496114_1671387 | 3300048917 | Bacteria | 525 |
| 1259 | Ga0496115_0111602 | 3300048918 | Bacteria | 2247 |
| 1260 | Ga0496126_0115249 | 3300048929 | Bacteria | 2337 |
| 1261 | Ga0501306_006749 | 3300049127 | Unclassified | 1357 |
| 1262 | Ga0501306_031891 | 3300049127 | Bacteria | 787 |
| 1263 | Ga0501308_005356 | 3300049128 | Unclassified | 1274 |
| 1264 | Ga0501308_023797 | 3300049128 | Bacteria | 784 |
| 1265 | Ga0501309_026641 | 3300049129 | Bacteria | 836 |
| 1266 | Ga0501343_022051 | 3300049132 | Bacteria | 566 |
| 1267 | Ga0501304_006136 | 3300049160 | Bacteria | 962 |
| 1268 | Ga0501304_016374 | 3300049160 | Bacteria | 701 |
| 1269 | Ga0501305_009096 | 3300049161 | Unclassified | 1299 |
| 1270 | Ga0501305_107732 | 3300049161 | Bacteria | 524 |
| 1271 | Ga0501307_023769 | 3300049162 | Bacteria | 814 |
| 1272 | Ga0501292_073265 | 3300049515 | Bacteria | 640 |
| 1273 | Ga0501311_003025 | 3300049527 | Bacteria | 1677 |
| 1274 | Ga0501311_035594 | 3300049527 | Bacteria | 737 |
| 1275 | Ga0501312_042569 | 3300049528 | Bacteria | 746 |
| 1276 | Ga0501312_108295 | 3300049528 | Bacteria | 528 |
| 1277 | Ga0501313_024232 | 3300049529 | Bacteria | 763 |
| 1278 | Ga0501314_033862 | 3300049530 | Bacteria | 577 |
| 1279 | Ga0501314_042373 | 3300049530 | Bacteria | 534 |
| 1280 | Ga0501315_035010 | 3300049531 | Bacteria | 739 |
| 1281 | Ga0501315_055171 | 3300049531 | Bacteria | 632 |
| 1282 | Ga0501316_017821 | 3300049532 | Bacteria | 874 |
| 1283 | Ga0501316_028864 | 3300049532 | Bacteria | 734 |
| 1284 | Ga0501317_024362 | 3300049533 | Bacteria | 841 |
| 1285 | Ga0501317_056761 | 3300049533 | Bacteria | 634 |
| 1286 | Ga0501319_002395 | 3300049535 | Bacteria | 1184 |
| 1287 | Ga0501320_011532 | 3300049536 | Bacteria | 917 |
| 1288 | Ga0501320_049111 | 3300049536 | Bacteria | 571 |
| 1289 | Ga0501320_057587 | 3300049536 | Bacteria | 541 |
| 1290 | Ga0501321_034190 | 3300049537 | Bacteria | 692 |
| 1291 | Ga0501323_073342 | 3300049539 | Unclassified | 550 |
| 1292 | Ga0501323_081965 | 3300049539 | Bacteria | 528 |
| 1293 | Ga0501324_036394 | 3300049540 | Bacteria | 552 |
| 1294 | Ga0501327_17434 | 3300049543 | Bacteria | 519 |
| 1295 | Ga0501329_01188 | 3300049545 | Bacteria | 1101 |
| 1296 | Ga0501335_003859 | 3300049551 | Unclassified | 1287 |
| 1297 | Ga0501335_009515 | 3300049551 | Bacteria | 927 |
| 1298 | Ga0501335_013870 | 3300049551 | Bacteria | 809 |
| 1299 | Ga0501335_026997 | 3300049551 | Bacteria | 635 |
| 1300 | Ga0501336_006401 | 3300049552 | Bacteria | 873 |
| 1301 | Ga0501337_013145 | 3300049553 | Unclassified | 623 |
| 1302 | Ga0501031_0080903 | 3300049568 | Bacteria | 2117 |
| 1303 | Ga0501032_0201676 | 3300049569 | Bacteria | 1298 |
| 1304 | Ga0501032_0354471 | 3300049569 | Bacteria | 945 |
| 1305 | Ga0501034_0002711 | 3300049571 | Bacteria | 20864 |
| 1306 | Ga0501034_0110084 | 3300049571 | Bacteria | 2745 |
| 1307 | Ga0501034_0215449 | 3300049571 | Bacteria | 1874 |
| 1308 | Ga0501034_1637955 | 3300049571 | Bacteria | 516 |
| 1309 | Ga0501036_0042050 | 3300049572 | Bacteria | 3868 |
| 1310 | Ga0501036_0048821 | 3300049572 | Bacteria | 3583 |
| 1311 | Ga0501036_0732853 | 3300049572 | Bacteria | 816 |
| 1312 | Ga0501037_0003876 | 3300049573 | Bacteria | 10850 |
| 1313 | Ga0501037_0076129 | 3300049573 | Unclassified | 2437 |
| 1314 | Ga0501037_0751092 | 3300049573 | Unclassified | 646 |
| 1315 | Ga0501038_0007909 | 3300049574 | Bacteria | 9802 |
| 1316 | Ga0501038_0274287 | 3300049574 | Bacteria | 1329 |
| 1317 | Ga0501039_0016596 | 3300049575 | Bacteria | 5640 |
| 1318 | Ga0501039_0102135 | 3300049575 | Bacteria | 2238 |
| 1319 | Ga0501039_0908984 | 3300049575 | Bacteria | 685 |
| 1320 | Ga0501040_0355901 | 3300049576 | Bacteria | 1049 |
| 1321 | Ga0501040_0499181 | 3300049576 | Unclassified | 877 |
| 1322 | Ga0501043_0002356 | 3300049579 | Bacteria | 16018 |
| 1323 | Ga0501043_0007741 | 3300049579 | Bacteria | 8502 |
| 1324 | Ga0501043_0874158 | 3300049579 | Bacteria | 646 |
| 1325 | Ga0501046_0010797 | 3300049580 | Bacteria | 7830 |
| 1326 | Ga0501046_0083527 | 3300049580 | Bacteria | 2465 |
| 1327 | Ga0501046_0150167 | 3300049580 | Bacteria | 1758 |
| 1328 | Ga0501046_0313485 | 3300049580 | Unclassified | 1144 |
| 1329 | Ga0501047_0002262 | 3300049581 | Bacteria | 18429 |
| 1330 | Ga0501047_0120134 | 3300049581 | Bacteria | 2510 |
| 1331 | Ga0501047_0128751 | 3300049581 | Bacteria | 2412 |
| 1332 | Ga0501048_0052661 | 3300049582 | Bacteria | 2897 |
| 1333 | Ga0501048_0276361 | 3300049582 | Bacteria | 1194 |
| 1334 | Ga0501067_0059523 | 3300049583 | Bacteria | 2114 |
| 1335 | Ga0501067_0338365 | 3300049583 | Bacteria | 838 |
| 1336 | Ga0501068_0030089 | 3300049584 | Bacteria | 3219 |
| 1337 | Ga0501068_0164647 | 3300049584 | Bacteria | 1398 |
| 1338 | Ga0501069_0073669 | 3300049585 | Bacteria | 1915 |
| 1339 | Ga0501070_0068242 | 3300049586 | Bacteria | 2944 |
| 1340 | Ga0501070_0103344 | 3300049586 | Bacteria | 2356 |
| 1341 | Ga0501071_0664783 | 3300049587 | Bacteria | 802 |
| 1342 | Ga0501072_0141946 | 3300049588 | Bacteria | 1915 |
| 1343 | Ga0501073_0000270 | 3300049589 | Bacteria | 34510 |
| 1344 | Ga0501073_0713981 | 3300049589 | Bacteria | 691 |
| 1345 | Ga0501074_0001640 | 3300049590 | Bacteria | 15163 |
| 1346 | Ga0501074_0283631 | 3300049590 | Bacteria | 1177 |
| 1347 | Ga0501075_0394655 | 3300049591 | Bacteria | 1055 |
| 1348 | Ga0501076_0402329 | 3300049592 | Unclassified | 1126 |
| 1349 | Ga0501202_013855 | 3300049652 | Bacteria | 1538 |
| 1350 | Ga0501209_196824 | 3300049656 | Bacteria | 619 |
| 1351 | Ga0501222_048641 | 3300049662 | Bacteria | 618 |
| 1352 | Ga0501227_021307 | 3300049665 | Bacteria | 1494 |
| 1353 | Ga0501225_0332697 | 3300049705 | Bacteria | 521 |
| 1354 | Ga0501079_0079711 | 3300049741 | Bacteria | 2532 |
| 1355 | Ga0501079_0598875 | 3300049741 | Bacteria | 867 |
| 1356 | Ga0501079_1223246 | 3300049741 | Bacteria | 592 |
| 1357 | Ga0501080_0007763 | 3300049742 | Bacteria | 9696 |
| 1358 | Ga0501080_0133978 | 3300049742 | Bacteria | 2293 |
| 1359 | Ga0501080_0205679 | 3300049742 | Bacteria | 1805 |
| 1360 | Ga0501083_0021595 | 3300049744 | Bacteria | 4471 |
| 1361 | Ga0501083_0191833 | 3300049744 | Unclassified | 1333 |
| 1362 | Ga0501241_003385 | 3300049758 | Bacteria | 3009 |
| 1363 | Ga0501241_013722 | 3300049758 | Bacteria | 1472 |
| 1364 | Ga0501272_073127 | 3300049769 | Bacteria | 504 |
| 1365 | Ga0501274_045872 | 3300049771 | Bacteria | 537 |
| 1366 | Ga0501283_045236 | 3300049779 | Bacteria | 770 |
| 1367 | Ga0501035_0020366 | 3300049822 | Bacteria | 6090 |
| 1368 | Ga0501035_0025624 | 3300049822 | Bacteria | 5405 |
| 1369 | Ga0501035_0375294 | 3300049822 | Bacteria | 1187 |
| 1370 | Ga0501044_0009741 | 3300049823 | Bacteria | 10452 |
| 1371 | Ga0501044_0046711 | 3300049823 | Bacteria | 4482 |
| 1372 | Ga0501044_0114882 | 3300049823 | Bacteria | 2697 |
| 1373 | Ga0501044_0138323 | 3300049823 | Bacteria | 2425 |
| 1374 | Ga0501044_0222520 | 3300049823 | Bacteria | 1838 |
| 1375 | Ga0501045_0117942 | 3300049824 | Bacteria | 1970 |
| 1376 | Ga0501284_00023 | 3300050005 | Bacteria | 78607 |
| 1377 | nmdc:mga0k408_12225_c1 | 3300050493 | Bacteria | 4691 |
| 1378 | nmdc:mga0k408_23571_c1 | 3300050493 | Bacteria | 3474 |
| 1379 | nmdc:mga05p37_745128_c1 | 3300050507 | Bacteria | 1081 |
| 1380 | nmdc:mga09592_27033_c1 | 3300050508 | Bacteria | 4758 |
| 1381 | nmdc:mga0qj67_604779_c1 | 3300050509 | Bacteria | 877 |
| 1382 | nmdc:mga06r32_256103_c1 | 3300050510 | Bacteria | 1738 |
| 1383 | nmdc:mga08y16_693577_c1 | 3300050511 | Unclassified | 1019 |
| 1384 | nmdc:mga08y16_735068_c1 | 3300050511 | Bacteria | 984 |
| 1385 | nmdc:mga08y16_894010_c1 | 3300050511 | Bacteria | 875 |
| 1386 | nmdc:mga0rr50_1672052_c1 | 3300050513 | Unclassified | 537 |
| 1387 | Ga0495601_0427249 | 3300053077 | Bacteria | 858 |
| 1388 | Ga0495619_0219968 | 3300053085 | Bacteria | 1315 |
| 1389 | Ga0500578_0476906 | 3300053086 | Bacteria | 706 |
| 1390 | Ga0500643_151082 | 3300053087 | Bacteria | 623 |
| 1391 | Ga0500644_0000176 | 3300053088 | Bacteria | 40998 |
| 1392 | Ga0500644_0154595 | 3300053088 | Bacteria | 922 |
| 1393 | Ga0500581_200430 | 3300053089 | Bacteria | 886 |
| 1394 | Ga0500646_0005852 | 3300053090 | Bacteria | 3117 |
| 1395 | Ga0500646_0009223 | 3300053090 | Bacteria | 2526 |
| 1396 | Ga0500646_0009264 | 3300053090 | Bacteria | 2520 |
| 1397 | Ga0500646_0031751 | 3300053090 | Bacteria | 1455 |
| 1398 | Ga0500583_0002896 | 3300053092 | Bacteria | 5277 |
| 1399 | Ga0500583_0012897 | 3300053092 | Bacteria | 3209 |
| 1400 | Ga0500583_0112135 | 3300053092 | Bacteria | 1344 |
| 1401 | Ga0500651_0036109 | 3300053093 | Bacteria | 3114 |
| 1402 | Ga0500651_0062544 | 3300053093 | Bacteria | 2324 |
| 1403 | Ga0500650_0383475 | 3300053098 | Bacteria | 610 |
| 1404 | Ga0500650_0422779 | 3300053098 | Bacteria | 574 |
| 1405 | Ga0500569_005759 | 3300053109 | Bacteria | 2679 |
| 1406 | Ga0500607_128022 | 3300053121 | Bacteria | 1216 |
| 1407 | Ga0500628_032220 | 3300053129 | Bacteria | 1145 |
| 1408 | Ga0500628_056819 | 3300053129 | Unclassified | 945 |
| 1409 | Ga0500642_0151852 | 3300053130 | Bacteria | 1087 |
| 1410 | Ga0500642_0258992 | 3300053130 | Bacteria | 797 |
| 1411 | Ga0500655_014429 | 3300053133 | Bacteria | 1446 |
| 1412 | Ga0500655_059915 | 3300053133 | Bacteria | 766 |
| 1413 | Ga0500658_0030744 | 3300053134 | Bacteria | 2096 |
| 1414 | Ga0500559_0001550 | 3300053136 | Bacteria | 12870 |
| 1415 | Ga0500561_0045612 | 3300053137 | Bacteria | 1176 |
| 1416 | Ga0500568_0046952 | 3300053139 | Bacteria | 1712 |
| 1417 | Ga0500568_0216598 | 3300053139 | Bacteria | 700 |
| 1418 | Ga0500577_0002125 | 3300053142 | Bacteria | 5059 |
| 1419 | Ga0500577_0551714 | 3300053142 | Unclassified | 503 |
| 1420 | Ga0500588_0167191 | 3300053146 | Bacteria | 803 |
| 1421 | Ga0500588_0414446 | 3300053146 | Bacteria | 513 |
| 1422 | Ga0500589_046079 | 3300053147 | Bacteria | 2031 |
| 1423 | Ga0500590_032046 | 3300053148 | Bacteria | 2725 |
| 1424 | Ga0500616_0118630 | 3300053153 | Bacteria | 1267 |
| 1425 | Ga0500616_0154990 | 3300053153 | Bacteria | 1056 |
| 1426 | Ga0500616_0295553 | 3300053153 | Bacteria | 675 |
| 1427 | Ga0500622_0000258 | 3300053156 | Bacteria | 53957 |
| 1428 | Ga0500622_0001151 | 3300053156 | Bacteria | 22018 |
| 1429 | Ga0500627_0345971 | 3300053158 | Bacteria | 642 |
| 1430 | Ga0500633_0071117 | 3300053160 | Bacteria | 1242 |
| 1431 | Ga0500636_0002485 | 3300053177 | Bacteria | 10231 |
| 1432 | Ga0500637_0118533 | 3300053178 | Bacteria | 1536 |
| 1433 | Ga0500611_000018 | 3300053727 | Bacteria | 111023 |
| 1434 | Ga0500645_212072 | 3300053730 | Bacteria | 520 |
| 1435 | Ga0500656_024752 | 3300053732 | Bacteria | 766 |
| 1436 | Ga0501084_0028117 | 3300054114 | Bacteria | 4698 |
| 1437 | Ga0501084_0418284 | 3300054114 | Bacteria | 1133 |
| 1438 | Ga0500661_001977 | 3300055283 | Bacteria | 3871 |
| 1439 | Ga0587082_192654 | 3300059504 | Unclassified | 506 |
| 1440 | Ga0587090_105454 | 3300059510 | Bacteria | 595 |
| 1441 | Ga0587091_049155 | 3300059511 | Bacteria | 860 |
| 1442 | Ga0587092_020882 | 3300059512 | Bacteria | 1012 |
| 1443 | Ga0587092_090431 | 3300059512 | Unclassified | 617 |
| 1444 | Ga0587106_041022 | 3300059605 | Unclassified | 786 |
| 1445 | Ga0587101_103719 | 3300059623 | Bacteria | 569 |
| 1446 | Ga0587109_202017 | 3300059624 | Bacteria | 518 |
| 1447 | Ga0587117_043313 | 3300059627 | Bacteria | 724 |
| 1448 | Ga0587128_163040 | 3300059630 | Bacteria | 515 |
| 1449 | Ga0587068_094914 | 3300059641 | Unclassified | 619 |
| 1450 | Ga0587072_117445 | 3300059643 | Unclassified | 613 |
| 1451 | Ga0587076_216631 | 3300059645 | Bacteria | 500 |
| 1452 | Ga0587071_084572 | 3300060344 | Bacteria | 712 |
| 1453 | Ga0587071_139652 | 3300060344 | Unclassified | 594 |
| 1454 | Ga0501082_0146151 | 3300060353 | Bacteria | 2052 |
| 1455 | Ga0466962_0306215 | 3300061719 | Bacteria | 786 |
| 1456 | Ga0530510_1392462 | 3300061734 | Bacteria | 538 |
| 1457 | 2945981361 | 2945977869 | Bacteria | 7777518 |
| 1458 | 2946019240 | 2946013367 | Bacteria | 7766675 |
| 1459 | Ga0068863_100561006 | |||
| 1460 | JGI24743J22301_10144941 | |||
| 1461 | JGI24744J21845_10020183 | |||
| 1462 | JGI25158J39367_1009415 | |||
| 1463 | JGI25159J45721_1048087 | |||
| 1464 | JGI25406J46586_10056108 | |||
| 1465 | rootH2_10009422 | |||
| 1466 | rootH2_10054917 | |||
| 1467 | rootH2_10101489 | |||
| 1468 | rootL2_10127521 | |||
| 1469 | rootL2_10160151 | |||
| 1470 | rootH1_10013931 | |||
| 1471 | rootH1_10135123 | |||
| 1472 | JGI25160J50197_1017226 | |||
| 1473 | Ga0055531_10000245 | |||
| 1474 | Ga0058859_10826476 | |||
| 1475 | Ga0058859_11159609 | |||
| 1476 | Ga0065714_10037081 | |||
| 1477 | Ga0065714_10328222 | |||
| 1478 | Ga0065704_10033350 | |||
| 1479 | Ga0065704_10191117 | |||
| 1480 | Ga0065712_10043039 | |||
| 1481 | Ga0065712_10421381 | |||
| 1482 | Ga0065715_10400388 | |||
| 1483 | Ga0065715_10472634 | |||
| 1484 | Ga0065707_10220928 | |||
| 1485 | Ga0065707_10761310 | |||
| 1486 | Ga0070658_11322238 | |||
| 1487 | Ga0070658_11465044 | |||
| 1488 | Ga0070676_10000153 | |||
| 1489 | Ga0070676_10003325 | |||
| 1490 | Ga0070676_10006732 | |||
| 1491 | Ga0070676_10491606 | |||
| 1492 | Ga0070676_10535035 | |||
| 1493 | Ga0070676_10742147 | |||
| 1494 | Ga0070683_100023520 | |||
| 1495 | Ga0070683_100081462 | |||
| 1496 | Ga0070683_101261055 | |||
| 1497 | Ga0070690_100021818 | |||
| 1498 | Ga0070690_100108133 | |||
| 1499 | Ga0070690_101005548 | |||
| 1500 | Ga0070670_100007928 | |||
| 1501 | Ga0070670_100021684 | |||
| 1502 | Ga0070670_100043904 | |||
| 1503 | Ga0070670_100124831 | |||
| 1504 | Ga0070670_100338882 | |||
| 1505 | Ga0070670_100522289 | |||
| 1506 | Ga0070670_100615430 | |||
| 1507 | Ga0070670_101112968 | |||
| 1508 | Ga0070670_101324183 | |||
| 1509 | Ga0070670_102192332 | |||
| 1510 | Ga0070670_102228269 | |||
| 1511 | Ga0070677_10175900 | |||
| 1512 | Ga0070677_10520436 | |||
| 1513 | Ga0070677_10929689 | |||
| 1514 | Ga0068869_100016793 | |||
| 1515 | Ga0068869_100020420 | |||
| 1516 | Ga0068869_100027564 | |||
| 1517 | Ga0068869_100073866 | |||
| 1518 | Ga0068869_100088092 | |||
| 1519 | Ga0068869_100110634 | |||
| 1520 | Ga0068869_100118832 | |||
| 1521 | Ga0068869_100273695 | |||
| 1522 | Ga0068869_100357704 | |||
| 1523 | Ga0068869_100676580 | |||
| 1524 | Ga0068869_101215995 | |||
| 1525 | Ga0068869_101970654 | |||
| 1526 | Ga0070666_10000209 | |||
| 1527 | Ga0070666_10011988 | |||
| 1528 | Ga0070666_10024603 | |||
| 1529 | Ga0070666_10041527 | |||
| 1530 | Ga0070666_10185297 | |||
| 1531 | Ga0070666_10318560 | |||
| 1532 | Ga0070666_10397627 | |||
| 1533 | Ga0070666_10420410 | |||
| 1534 | Ga0070666_10421262 | |||
| 1535 | Ga0070666_10786231 | |||
| 1536 | Ga0070680_100301771 | |||
| 1537 | Ga0070682_100834561 | |||
| 1538 | Ga0070682_100887543 | |||
| 1539 | Ga0070682_101109595 | |||
| 1540 | Ga0070682_101554308 | |||
| 1541 | Ga0068868_100001336 | |||
| 1542 | Ga0068868_100002414 | |||
| 1543 | Ga0068868_100020102 | |||
| 1544 | Ga0068868_100022584 | |||
| 1545 | Ga0068868_100023605 | |||
| 1546 | Ga0068868_100136042 | |||
| 1547 | Ga0068868_100195266 | |||
| 1548 | Ga0068868_100272610 | |||
| 1549 | Ga0068868_100297356 | |||
| 1550 | Ga0068868_100410873 | |||
| 1551 | Ga0070660_100573851 | |||
| 1552 | Ga0070660_100581730 | |||
| 1553 | Ga0070660_100620185 | |||
| 1554 | Ga0070660_100987860 | |||
| 1555 | Ga0070689_100157874 | |||
| 1556 | Ga0070689_100493835 | |||
| 1557 | Ga0070689_100688089 | |||
| 1558 | Ga0070689_100804037 | |||
| 1559 | Ga0070689_101464730 | |||
| 1560 | Ga0070689_101825901 | |||
| 1561 | Ga0070691_10010461 | |||
| 1562 | Ga0070691_10576669 | |||
| 1563 | Ga0070687_100002811 | |||
| 1564 | Ga0070687_100155279 | |||
| 1565 | Ga0070687_101148675 | |||
| 1566 | Ga0070661_100130084 | |||
| 1567 | Ga0070661_100201421 | |||
| 1568 | Ga0070661_100405144 | |||
| 1569 | Ga0070661_100455569 | |||
| 1570 | Ga0070661_101107798 | |||
| 1571 | Ga0070668_100000556 | |||
| 1572 | Ga0070668_100032555 | |||
| 1573 | Ga0070668_100163333 | |||
| 1574 | Ga0070668_100302528 | |||
| 1575 | Ga0070668_100510433 | |||
| 1576 | Ga0070668_100759615 | |||
| 1577 | Ga0070669_100056538 | |||
| 1578 | Ga0070669_100089397 | |||
| 1579 | Ga0070669_100094730 | |||
| 1580 | Ga0070669_100541968 | |||
| 1581 | Ga0070669_100686648 | |||
| 1582 | Ga0070669_101382906 | |||
| 1583 | Ga0070675_100024988 | |||
| 1584 | Ga0070675_100028383 | |||
| 1585 | Ga0070675_100051669 | |||
| 1586 | Ga0070675_100053321 | |||
| 1587 | Ga0070675_100087065 | |||
| 1588 | Ga0070675_100278735 | |||
| 1589 | Ga0070675_100597133 | |||
| 1590 | Ga0070671_100001985 | |||
| 1591 | Ga0070671_100034628 | |||
| 1592 | Ga0070671_100041198 | |||
| 1593 | Ga0070671_100385016 | |||
| 1594 | Ga0070671_100412863 | |||
| 1595 | Ga0070671_100714595 | |||
| 1596 | Ga0070671_101035812 | |||
| 1597 | Ga0070671_101137528 | |||
| 1598 | Ga0070671_101978293 | |||
| 1599 | Ga0070674_100062017 | |||
| 1600 | Ga0070674_100342171 | |||
| 1601 | Ga0070674_100520484 | |||
| 1602 | Ga0070674_100572475 | |||
| 1603 | Ga0070674_100920875 | |||
| 1604 | Ga0070673_100000867 | |||
| 1605 | Ga0070673_100006375 | |||
| 1606 | Ga0070673_100024895 | |||
| 1607 | Ga0070673_100041606 | |||
| 1608 | Ga0070673_100060726 | |||
| 1609 | Ga0070673_100912603 | |||
| 1610 | Ga0070673_101013672 | |||
| 1611 | Ga0070673_101180336 | |||
| 1612 | Ga0070673_101649871 | |||
| 1613 | Ga0070688_100278966 | |||
| 1614 | Ga0070688_100356616 | |||
| 1615 | Ga0070688_100655418 | |||
| 1616 | Ga0070688_100741030 | |||
| 1617 | Ga0070688_101606518 | |||
| 1618 | Ga0070659_100007187 | |||
| 1619 | Ga0070659_100770727 | |||
| 1620 | Ga0070667_100000812 | |||
| 1621 | Ga0070667_100008930 | |||
| 1622 | Ga0070667_100038136 | |||
| 1623 | Ga0070667_100040093 | |||
| 1624 | Ga0070667_100060648 | |||
| 1625 | Ga0070667_100099011 | |||
| 1626 | Ga0070667_100117175 | |||
| 1627 | Ga0070667_100253860 | |||
| 1628 | Ga0070667_100270609 | |||
| 1629 | Ga0070667_100562188 | |||
| 1630 | Ga0070667_100756177 | |||
| 1631 | Ga0070667_100969352 | |||
| 1632 | Ga0070667_101344830 | |||
| 1633 | Ga0070701_10013206 | |||
| 1634 | Ga0070701_10347508 | |||
| 1635 | Ga0070705_100215659 | |||
| 1636 | Ga0070700_100439346 | |||
| 1637 | Ga0070700_100676271 | |||
| 1638 | Ga0070708_101399131 | |||
| 1639 | Ga0070663_100075874 | |||
| 1640 | Ga0070663_100765925 | |||
| 1641 | Ga0070663_100770436 | |||
| 1642 | Ga0070663_100924549 | |||
| 1643 | Ga0070663_101175074 | |||
| 1644 | Ga0070678_100023430 | |||
| 1645 | Ga0070678_100130837 | |||
| 1646 | Ga0070678_100167308 | |||
| 1647 | Ga0070678_100326560 | |||
| 1648 | Ga0070678_100390860 | |||
| 1649 | Ga0070678_100790745 | |||
| 1650 | Ga0070662_100001017 | |||
| 1651 | Ga0070662_100002918 | |||
| 1652 | Ga0070662_100019329 | |||
| 1653 | Ga0070662_100292903 | |||
| 1654 | Ga0070662_100381670 | |||
| 1655 | Ga0070662_100537232 | |||
| 1656 | Ga0070662_100840518 | |||
| 1657 | Ga0070662_101342622 | |||
| 1658 | Ga0070681_10167290 | |||
| 1659 | Ga0068867_100036770 | |||
| 1660 | Ga0068867_100068327 | |||
| 1661 | Ga0068867_100082748 | |||
| 1662 | Ga0068867_100136101 | |||
| 1663 | Ga0068867_100143037 | |||
| 1664 | Ga0068867_100225703 | |||
| 1665 | Ga0068867_101212847 | |||
| 1666 | Ga0070685_10137269 | |||
| 1667 | Ga0070685_10300653 | |||
| 1668 | Ga0070685_10322320 | |||
| 1669 | Ga0070685_10370073 | |||
| 1670 | Ga0070685_10759654 | |||
| 1671 | Ga0070706_100936390 | |||
| 1672 | Ga0070698_100036892 | |||
| 1673 | Ga0070698_100049913 | |||
| 1674 | Ga0070684_100001060 | |||
| 1675 | Ga0070684_100002383 | |||
| 1676 | Ga0070684_100032732 | |||
| 1677 | Ga0070684_100376101 | |||
| 1678 | Ga0070684_100662580 | |||
| 1679 | Ga0070684_102118537 | |||
| 1680 | Ga0070684_102282173 | |||
| 1681 | Ga0068853_100000520 | |||
| 1682 | Ga0068853_100020753 | |||
| 1683 | Ga0068853_100065202 | |||
| 1684 | Ga0068853_100519567 | |||
| 1685 | Ga0068853_100663448 | |||
| 1686 | Ga0068853_101186315 | |||
| 1687 | Ga0068853_101491117 | |||
| 1688 | Ga0068853_101738683 | |||
| 1689 | Ga0068853_101821005 | |||
| 1690 | Ga0068853_102386995 | |||
| 1691 | Ga0070672_100000738 | |||
| 1692 | Ga0070672_100048813 | |||
| 1693 | Ga0070672_100101769 | |||
| 1694 | Ga0070672_100347186 | |||
| 1695 | Ga0070672_100597516 | |||
| 1696 | Ga0070672_101282081 | |||
| 1697 | Ga0070672_101497765 | |||
| 1698 | Ga0070686_100107815 | |||
| 1699 | Ga0070686_100514885 | |||
| 1700 | Ga0070686_100966775 | |||
| 1701 | Ga0070693_100250499 | |||
| 1702 | Ga0070693_100882055 | |||
| 1703 | Ga0070665_100000016 | |||
| 1704 | Ga0070665_100000486 | |||
| 1705 | Ga0070665_100024894 | |||
| 1706 | Ga0070665_100231705 | |||
| 1707 | Ga0070665_100454910 | |||
| 1708 | Ga0070665_100824961 | |||
| 1709 | Ga0070665_101216511 | |||
| 1710 | Ga0070665_102622184 | |||
| 1711 | Ga0070704_100432572 | |||
| 1712 | Ga0070704_100756215 | |||
| 1713 | Ga0070704_100811663 | |||
| 1714 | Ga0068855_100001195 | |||
| 1715 | Ga0068855_100056754 | |||
| 1716 | Ga0068855_100147675 | |||
| 1717 | Ga0068855_100920202 | |||
| 1718 | Ga0070664_100002163 | |||
| 1719 | Ga0070664_100034763 | |||
| 1720 | Ga0070664_100085373 | |||
| 1721 | Ga0070664_100092551 | |||
| 1722 | Ga0070664_100100585 | |||
| 1723 | Ga0070664_100173719 | |||
| 1724 | Ga0070664_100456680 | |||
| 1725 | Ga0070664_100672758 | |||
| 1726 | Ga0070664_100703265 | |||
| 1727 | Ga0070664_100736621 | |||
| 1728 | Ga0070664_101958890 | |||
| 1729 | Ga0068857_100007533 | |||
| 1730 | Ga0068857_100092135 | |||
| 1731 | Ga0068857_100116871 | |||
| 1732 | Ga0068857_100143969 | |||
| 1733 | Ga0068857_100328872 | |||
| 1734 | Ga0068857_100410499 | |||
| 1735 | Ga0068857_101082230 | |||
| 1736 | Ga0068857_102464664 | |||
| 1737 | Ga0068854_100075832 | |||
| 1738 | Ga0068854_100113006 | |||
| 1739 | Ga0068854_100161208 | |||
| 1740 | Ga0068854_100228111 | |||
| 1741 | Ga0068854_100627264 | |||
| 1742 | Ga0068854_101155729 | |||
| 1743 | Ga0068854_101973482 | |||
| 1744 | Ga0068856_100243724 | |||
| 1745 | Ga0070702_100097632 | |||
| 1746 | Ga0070702_100520081 | |||
| 1747 | Ga0070702_101372019 | |||
| 1748 | Ga0068852_100000223 | |||
| 1749 | Ga0068852_100005616 | |||
| 1750 | Ga0068852_100083763 | |||
| 1751 | Ga0068852_100135099 | |||
| 1752 | Ga0068852_100460264 | |||
| 1753 | Ga0068852_100627285 | |||
| 1754 | Ga0068852_101041590 | |||
| 1755 | Ga0068852_101374112 | |||
| 1756 | Ga0068859_100016918 | |||
| 1757 | Ga0068859_100026368 | |||
| 1758 | Ga0068859_100076707 | |||
| 1759 | Ga0068859_100153847 | |||
| 1760 | Ga0068859_100219040 | |||
| 1761 | Ga0068859_100266281 | |||
| 1762 | Ga0068859_100272729 | |||
| 1763 | Ga0068859_102496880 | |||
| 1764 | Ga0068859_102674626 | |||
| 1765 | Ga0068859_102720851 | |||
| 1766 | Ga0068859_102995704 | |||
| 1767 | Ga0068864_100002330 | |||
| 1768 | Ga0068864_100010946 | |||
| 1769 | Ga0068864_100048675 | |||
| 1770 | Ga0068864_100282029 | |||
| 1771 | Ga0068864_100348728 | |||
| 1772 | Ga0068864_100371791 | |||
| 1773 | Ga0068864_101231849 | |||
| 1774 | Ga0068866_10023161 | |||
| 1775 | Ga0068866_10080310 | |||
| 1776 | Ga0068866_10164227 | |||
| 1777 | Ga0068866_10279609 | |||
| 1778 | Ga0068866_10470454 | |||
| 1779 | Ga0068866_11114522 | |||
| 1780 | Ga0068866_11155476 | |||
| 1781 | Ga0068861_100057736 | |||
| 1782 | Ga0068861_100118137 | |||
| 1783 | Ga0068861_100177987 | |||
| 1784 | Ga0068861_100374722 | |||
| 1785 | Ga0068861_100533110 | |||
| 1786 | Ga0068861_100731899 | |||
| 1787 | Ga0068861_100887291 | |||
| 1788 | Ga0068861_101281305 | |||
| 1789 | Ga0068861_101393409 | |||
| 1790 | Ga0068861_102350248 | |||
| 1791 | Ga0068861_102482737 | |||
| 1792 | Ga0068851_10010493 | |||
| 1793 | Ga0068851_10154441 | |||
| 1794 | Ga0068851_10489199 | |||
| 1795 | Ga0068851_10604440 | |||
| 1796 | Ga0068851_10675666 | |||
| 1797 | Ga0068851_10714287 | |||
| 1798 | Ga0068870_10012476 | |||
| 1799 | Ga0068870_10138923 | |||
| 1800 | Ga0068870_10149303 | |||
| 1801 | Ga0068870_10331047 | |||
| 1802 | Ga0068870_10877282 | |||
| 1803 | Ga0068863_100000858 | |||
| 1804 | Ga0068863_100308391 | |||
| 1805 | Ga0068863_100329429 | |||
| 1806 | Ga0068863_100372317 | |||
| 1807 | Ga0068863_100852382 | |||
| 1808 | Ga0068863_101543917 | |||
| 1809 | Ga0068863_101838583 | |||
| 1810 | Ga0068863_102691392 | |||
| 1811 | Ga0068858_100008022 | |||
| 1812 | Ga0068858_100050171 | |||
| 1813 | Ga0068858_100087035 | |||
| 1814 | Ga0068858_100390819 | |||
| 1815 | Ga0068858_100502440 | |||
| 1816 | Ga0068858_100840137 | |||
| 1817 | Ga0068858_101358846 | |||
| 1818 | Ga0068858_101566210 | |||
| 1819 | Ga0068858_101871069 | |||
| 1820 | Ga0068858_102578430 | |||
| 1821 | Ga0068860_100000026 | |||
| 1822 | Ga0068860_100006630 | |||
| 1823 | Ga0068860_100014705 | |||
| 1824 | Ga0068860_100031636 | |||
| 1825 | Ga0068860_100058149 | |||
| 1826 | Ga0068860_100060556 | |||
| 1827 | Ga0068860_100134629 | |||
| 1828 | Ga0068860_100146429 | |||
| 1829 | Ga0068860_100161168 | |||
| 1830 | Ga0068860_100187590 | |||
| 1831 | Ga0068860_100216288 | |||
| 1832 | Ga0068860_100572886 | |||
| 1833 | Ga0068860_100861403 | |||
| 1834 | Ga0068860_102280828 | |||
| 1835 | Ga0068860_102282564 | |||
| 1836 | Ga0068860_102350146 | |||
| 1837 | Ga0068862_100120003 | |||
| 1838 | Ga0068862_100853358 | |||
| 1839 | Ga0068862_101892228 | |||
| 1840 | Ga0081540_1015893 | |||
| 1841 | Ga0081539_10058235 | |||
| 1842 | Ga0070715_10242687 | |||
| 1843 | Ga0075366_10004995 | |||
| 1844 | Ga0075366_10009633 | |||
| 1845 | Ga0075366_10033515 | |||
| 1846 | Ga0075366_10534924 | |||
| 1847 | Ga0097621_100000027 | |||
| 1848 | Ga0097621_100506876 | |||
| 1849 | Ga0097621_100736323 | |||
| 1850 | Ga0097621_100893514 | |||
| 1851 | Ga0097621_101558449 | |||
| 1852 | Ga0097621_101724099 | |||
| 1853 | Ga0097621_102042517 | |||
| 1854 | Ga0068871_100000107 | |||
| 1855 | Ga0068871_100011119 | |||
| 1856 | Ga0068871_100160875 | |||
| 1857 | Ga0068871_100219701 | |||
| 1858 | Ga0068871_100224703 | |||
| 1859 | Ga0068871_100348237 | |||
| 1860 | Ga0068871_100515883 | |||
| 1861 | Ga0068871_100598330 | |||
| 1862 | Ga0068871_101150867 | |||
| 1863 | Ga0068871_101221424 | |||
| 1864 | Ga0068871_102330538 | |||
| 1865 | Ga0075428_100497738 | |||
| 1866 | Ga0075430_100640740 | |||
| 1867 | Ga0075431_100001800 | |||
| 1868 | Ga0075429_100015792 | |||
| 1869 | Ga0075429_100513647 | |||
| 1870 | Ga0068865_100012268 | |||
| 1871 | Ga0068865_100023713 | |||
| 1872 | Ga0068865_100047038 | |||
| 1873 | Ga0068865_100379893 | |||
| 1874 | Ga0068865_100741006 | |||
| 1875 | Ga0097620_100016919 | |||
| 1876 | Ga0097620_100026370 | |||
| 1877 | Ga0097620_100076707 | |||
| 1878 | Ga0097620_100153847 | |||
| 1879 | Ga0097620_100219047 | |||
| 1880 | Ga0097620_100266293 | |||
| 1881 | Ga0097620_100272717 | |||
| 1882 | Ga0097620_102498304 | |||
| 1883 | Ga0097620_102674555 | |||
| 1884 | Ga0097620_102720788 | |||
| 1885 | Ga0097620_102996779 | |||
| 1886 | Ga0105251_10354085 | |||
| 1887 | Ga0105244_10282407 | |||
| 1888 | Ga0105240_10000258 | |||
| 1889 | Ga0105240_10000715 | |||
| 1890 | Ga0105240_10017799 | |||
| 1891 | Ga0105240_10082615 | |||
| 1892 | Ga0105240_10132147 | |||
| 1893 | Ga0105240_10208171 | |||
| 1894 | Ga0105240_10682960 | |||
| 1895 | Ga0105240_10967775 | |||
| 1896 | Ga0105240_11846305 | |||
| 1897 | Ga0111539_10479134 | |||
| 1898 | Ga0111539_10519125 | |||
| 1899 | Ga0105245_10626041 | |||
| 1900 | Ga0105247_10001631 | |||
| 1901 | Ga0105247_10052842 | |||
| 1902 | Ga0114129_10015867 | |||
| 1903 | Ga0105243_10167162 | |||
| 1904 | Ga0105243_10282805 | |||
| 1905 | Ga0105243_11259227 | |||
| 1906 | Ga0105241_10000721 | |||
| 1907 | Ga0105241_10200099 | |||
| 1908 | Ga0105241_10281108 | |||
| 1909 | Ga0105241_10408323 | |||
| 1910 | Ga0105241_10549747 | |||
| 1911 | Ga0105241_10853314 | |||
| 1912 | Ga0105241_11002918 | |||
| 1913 | Ga0105241_12458113 | |||
| 1914 | Ga0105242_10019590 | |||
| 1915 | Ga0105242_10139507 | |||
| 1916 | Ga0105242_10163684 | |||
| 1917 | Ga0105242_10231784 | |||
| 1918 | Ga0105242_10809566 | |||
| 1919 | Ga0105242_10991771 | |||
| 1920 | Ga0105242_11104122 | |||
| 1921 | Ga0105242_12226265 | |||
| 1922 | Ga0105242_12226675 | |||
| 1923 | Ga0105242_12670042 | |||
| 1924 | Ga0105242_12734394 | |||
| 1925 | Ga0105242_13254132 | |||
| 1926 | Ga0105248_10066633 | |||
| 1927 | Ga0105248_10152482 | |||
| 1928 | Ga0105248_10460370 | |||
| 1929 | Ga0105248_10737308 | |||
| 1930 | Ga0105248_10903822 | |||
| 1931 | Ga0105248_10964121 | |||
| 1932 | Ga0105248_11127964 | |||
| 1933 | Ga0105248_12395203 | |||
| 1934 | Ga0105237_10000654 | |||
| 1935 | Ga0105237_10022472 | |||
| 1936 | Ga0105237_10061881 | |||
| 1937 | Ga0105237_10095645 | |||
| 1938 | Ga0105237_10296964 | |||
| 1939 | Ga0105237_10362743 | |||
| 1940 | Ga0105237_10410272 | |||
| 1941 | Ga0105237_10467670 | |||
| 1942 | Ga0105237_10818473 | |||
| 1943 | Ga0105237_11148097 | |||
| 1944 | Ga0105237_11324581 | |||
| 1945 | Ga0105237_12449324 | |||
| 1946 | Ga0105238_10006981 | |||
| 1947 | Ga0105238_10060929 | |||
| 1948 | Ga0105238_11080890 | |||
| 1949 | Ga0105249_10004870 | |||
| 1950 | Ga0105249_10012686 | |||
| 1951 | Ga0105249_10023081 | |||
| 1952 | Ga0105249_10104818 | |||
| 1953 | Ga0105249_10115110 | |||
| 1954 | Ga0105249_10553664 | |||
| 1955 | Ga0105249_10562396 | |||
| 1956 | Ga0105249_11374299 | |||
| 1957 | Ga0105249_12608088 | |||
| 1958 | Ga0105249_13581314 | |||
| 1959 | Ga0099796_10221589 | |||
| 1960 | Ga0105239_10000353 | |||
| 1961 | Ga0105239_10002319 | |||
| 1962 | Ga0105239_10002402 | |||
| 1963 | Ga0105239_10023616 | |||
| 1964 | Ga0105239_10029540 | |||
| 1965 | Ga0105239_10046183 | |||
| 1966 | Ga0105239_10137123 | |||
| 1967 | Ga0105239_10450950 | |||
| 1968 | Ga0105239_10548614 | |||
| 1969 | Ga0105239_10655614 | |||
| 1970 | Ga0105239_11018647 | |||
| 1971 | Ga0105246_10064263 | |||
| 1972 | Ga0105246_10109772 | |||
| 1973 | Ga0105246_10176986 | |||
| 1974 | Ga0105246_10580679 | |||
| 1975 | Ga0157327_1040044 | |||
| 1976 | Ga0157373_10042785 | |||
| 1977 | Ga0157373_10057587 | |||
| 1978 | Ga0157373_10113865 | |||
| 1979 | Ga0157373_10326191 | |||
| 1980 | Ga0157373_10469133 | |||
| 1981 | Ga0157371_10011331 | |||
| 1982 | Ga0157371_10048034 | |||
| 1983 | Ga0157371_10053895 | |||
| 1984 | Ga0157371_10109883 | |||
| 1985 | Ga0157371_10269678 | |||
| 1986 | Ga0157371_10395378 | |||
| 1987 | Ga0157371_10820428 | |||
| 1988 | Ga0157370_10005886 | |||
| 1989 | Ga0157370_10021094 | |||
| 1990 | Ga0157370_10097938 | |||
| 1991 | Ga0157370_10600531 | |||
| 1992 | Ga0157370_10754425 | |||
| 1993 | Ga0157370_10859977 | |||
| 1994 | Ga0157370_10918531 | |||
| 1995 | Ga0157370_11164858 | |||
| 1996 | Ga0157370_11334326 | |||
| 1997 | Ga0157369_10060951 | |||
| 1998 | Ga0157369_10256753 | |||
| 1999 | Ga0157369_10338684 | |||
| 2000 | Ga0157369_10466049 | |||
| 2001 | Ga0157369_11006248 | |||
| 2002 | Ga0157369_12125885 | |||
| 2003 | Ga0157374_10000002 | |||
| 2004 | Ga0157374_10000841 | |||
| 2005 | Ga0157374_10006478 | |||
| 2006 | Ga0157374_10015281 | |||
| 2007 | Ga0157374_10024723 | |||
| 2008 | Ga0157374_10036109 | |||
| 2009 | Ga0157374_10212713 | |||
| 2010 | Ga0157374_10261668 | |||
| 2011 | Ga0157374_10315603 | |||
| 2012 | Ga0157374_10334544 | |||
| 2013 | Ga0157374_10740734 | |||
| 2014 | Ga0157374_10823863 | |||
| 2015 | Ga0157378_10002090 | |||
| 2016 | Ga0157378_10004442 | |||
| 2017 | Ga0157378_10012644 | |||
| 2018 | Ga0157378_10022590 | |||
| 2019 | Ga0157378_10023595 | |||
| 2020 | Ga0157378_10038804 | |||
| 2021 | Ga0157378_10222060 | |||
| 2022 | Ga0157378_10613946 | |||
| 2023 | Ga0157378_10702050 | |||
| 2024 | Ga0157378_10710397 | |||
| 2025 | Ga0157378_11584247 | |||
| 2026 | Ga0157378_12791720 | |||
| 2027 | Ga0163162_10000100 | |||
| 2028 | Ga0163162_10000190 | |||
| 2029 | Ga0163162_10004205 | |||
| 2030 | Ga0163162_10006285 | |||
| 2031 | Ga0163162_10024736 | |||
| 2032 | Ga0163162_10060245 | |||
| 2033 | Ga0163162_10125475 | |||
| 2034 | Ga0163162_10191116 | |||
| 2035 | Ga0163162_10299598 | |||
| 2036 | Ga0163162_10320794 | |||
| 2037 | Ga0163162_10504866 | |||
| 2038 | Ga0163162_10838151 | |||
| 2039 | Ga0163162_11251766 | |||
| 2040 | Ga0163162_13058025 | |||
| 2041 | Ga0157372_10002276 | |||
| 2042 | Ga0157372_10002704 | |||
| 2043 | Ga0157372_10010700 | |||
| 2044 | Ga0157372_10033620 | |||
| 2045 | Ga0157372_10053877 | |||
| 2046 | Ga0157372_10155951 | |||
| 2047 | Ga0157372_10180343 | |||
| 2048 | Ga0157372_10182645 | |||
| 2049 | Ga0157372_10207420 | |||
| 2050 | Ga0157372_10343570 | |||
| 2051 | Ga0157372_10666226 | |||
| 2052 | Ga0157372_10747764 | |||
| 2053 | Ga0157372_10806846 | |||
| 2054 | Ga0157372_10892147 | |||
| 2055 | Ga0157372_10965339 | |||
| 2056 | Ga0157372_11151761 | |||
| 2057 | Ga0157372_11257504 | |||
| 2058 | Ga0157372_11304431 | |||
| 2059 | Ga0157372_11474463 | |||
| 2060 | Ga0157372_11638089 | |||
| 2061 | Ga0157372_11715134 | |||
| 2062 | Ga0157372_11827297 | |||
| 2063 | Ga0157375_10000057 | |||
| 2064 | Ga0157375_10000336 | |||
| 2065 | Ga0157375_10010520 | |||
| 2066 | Ga0157375_10018827 | |||
| 2067 | Ga0157375_10050668 | |||
| 2068 | Ga0157375_10069395 | |||
| 2069 | Ga0157375_10246349 | |||
| 2070 | Ga0157375_10606472 | |||
| 2071 | Ga0157375_12011110 | |||
| 2072 | Ga0157375_12307958 | |||
| 2073 | Ga0157375_12964785 | |||
| 2074 | Ga0163163_10000254 | |||
| 2075 | Ga0163163_10002122 | |||
| 2076 | Ga0163163_10009925 | |||
| 2077 | Ga0163163_10014392 | |||
| 2078 | Ga0163163_10056448 | |||
| 2079 | Ga0163163_10143716 | |||
| 2080 | Ga0163163_10147957 | |||
| 2081 | Ga0163163_10288780 | |||
| 2082 | Ga0163163_10375809 | |||
| 2083 | Ga0163163_10899395 | |||
| 2084 | Ga0157380_10204970 | |||
| 2085 | Ga0157380_10510024 | |||
| 2086 | Ga0157380_12096366 | |||
| 2087 | Ga0157380_12457421 | |||
| 2088 | Ga0157380_12755416 | |||
| 2089 | Ga0157380_13291951 | |||
| 2090 | Ga0157377_10025991 | |||
| 2091 | Ga0157377_10119689 | |||
| 2092 | Ga0157377_10145828 | |||
| 2093 | Ga0157377_10415921 | |||
| 2094 | Ga0157379_10000367 | |||
| 2095 | Ga0157379_10017665 | |||
| 2096 | Ga0157379_10072486 | |||
| 2097 | Ga0157379_10121473 | |||
| 2098 | Ga0157379_10301801 | |||
| 2099 | Ga0157379_10306440 | |||
| 2100 | Ga0157379_10387596 | |||
| 2101 | Ga0157379_10736264 | |||
| 2102 | Ga0157379_10912218 | |||
| 2103 | Ga0157379_11283657 | |||
| 2104 | Ga0157376_10000135 | |||
| 2105 | Ga0157376_10002989 | |||
| 2106 | Ga0157376_10004908 | |||
| 2107 | Ga0157376_10007359 | |||
| 2108 | Ga0157376_10145446 | |||
| 2109 | Ga0157376_10864712 | |||
| 2110 | Ga0157376_11266781 | |||
| 2111 | Ga0157376_11777682 | |||
| 2112 | Ga0157376_12124386 | |||
| 2113 | Ga0163161_10001091 | |||
| 2114 | Ga0163161_10049399 | |||
| 2115 | Ga0163161_10049900 | |||
| 2116 | Ga0163161_10195228 | |||
| 2117 | Ga0163161_10237726 | |||
| 2118 | Ga0163161_10244328 | |||
| 2119 | Ga0163161_10437549 | |||
| 2120 | Ga0163161_10441963 | |||
| 2121 | Ga0163161_10597784 | |||
| 2122 | Ga0163161_11078445 | |||
| 2123 | Ga0206352_10358371 | |||
| 2124 | Ga0206352_11274644 | |||
| 2125 | Ga0213876_10010098 | |||
| 2126 | Ga0213876_10252876 | |||
| 2127 | Ga0224712_10240349 | |||
| 2128 | Ga0209436_102820 | |||
| 2129 | Ga0209258_100068 | |||
| 2130 | Ga0209148_1000182 | |||
| 2131 | Ga0209130_1011517 | |||
| 2132 | Ga0209758_1041446 | |||
| 2133 | Ga0207426_1000051 | |||
| 2134 | Ga0209257_1000025 | |||
| 2135 | Ga0207697_10015051 | |||
| 2136 | Ga0207697_10049556 | |||
| 2137 | Ga0207656_10001696 | |||
| 2138 | Ga0207656_10056009 | |||
| 2139 | Ga0207656_10727732 | |||
| 2140 | Ga0207682_10055094 | |||
| 2141 | Ga0207682_10204378 | |||
| 2142 | Ga0207642_10013123 | |||
| 2143 | Ga0207642_10106315 | |||
| 2144 | Ga0207642_10142840 | |||
| 2145 | Ga0207642_10344450 | |||
| 2146 | Ga0207642_10585982 | |||
| 2147 | Ga0207710_10004177 | |||
| 2148 | Ga0207710_10037994 | |||
| 2149 | Ga0207688_10011930 | |||
| 2150 | Ga0207688_10038950 | |||
| 2151 | Ga0207680_10003138 | |||
| 2152 | Ga0207680_10007095 | |||
| 2153 | Ga0207680_10046316 | |||
| 2154 | Ga0207680_10082786 | |||
| 2155 | Ga0207680_10151508 | |||
| 2156 | Ga0207680_10441838 | |||
| 2157 | Ga0207680_10760628 | |||
| 2158 | Ga0207680_10767533 | |||
| 2159 | Ga0207647_10001743 | |||
| 2160 | Ga0207647_10064282 | |||
| 2161 | Ga0207647_10150160 | |||
| 2162 | Ga0207647_10370806 | |||
| 2163 | Ga0207647_10783084 | |||
| 2164 | Ga0207685_10272782 | |||
| 2165 | Ga0207645_10000511 | |||
| 2166 | Ga0207645_10008172 | |||
| 2167 | Ga0207645_10012027 | |||
| 2168 | Ga0207645_10388370 | |||
| 2169 | Ga0207645_10528136 | |||
| 2170 | Ga0207645_10558431 | |||
| 2171 | Ga0207643_10026488 | |||
| 2172 | Ga0207643_10056780 | |||
| 2173 | Ga0207643_10081881 | |||
| 2174 | Ga0207643_10297520 | |||
| 2175 | Ga0207705_10036694 | |||
| 2176 | Ga0207705_10570424 | |||
| 2177 | Ga0207705_11292748 | |||
| 2178 | Ga0207654_10001646 | |||
| 2179 | Ga0207654_10466305 | |||
| 2180 | Ga0207707_10273176 | |||
| 2181 | Ga0207695_10000327 | |||
| 2182 | Ga0207695_10008726 | |||
| 2183 | Ga0207695_10014855 | |||
| 2184 | Ga0207695_10038067 | |||
| 2185 | Ga0207695_10091500 | |||
| 2186 | Ga0207695_10253982 | |||
| 2187 | Ga0207695_10513036 | |||
| 2188 | Ga0207695_11461794 | |||
| 2189 | Ga0207671_10001643 | |||
| 2190 | Ga0207671_10004018 | |||
| 2191 | Ga0207671_10045170 | |||
| 2192 | Ga0207671_10081617 | |||
| 2193 | Ga0207671_10174218 | |||
| 2194 | Ga0207671_10485760 | |||
| 2195 | Ga0207671_10922461 | |||
| 2196 | Ga0207662_10054739 | |||
| 2197 | Ga0207662_10310070 | |||
| 2198 | Ga0207662_11178037 | |||
| 2199 | Ga0207657_10338621 | |||
| 2200 | Ga0207657_10507349 | |||
| 2201 | Ga0207657_11035826 | |||
| 2202 | Ga0207649_10006464 | |||
| 2203 | Ga0207649_10071361 | |||
| 2204 | Ga0207649_10184783 | |||
| 2205 | Ga0207649_10344844 | |||
| 2206 | Ga0207649_10418536 | |||
| 2207 | Ga0207649_10478018 | |||
| 2208 | Ga0207681_10074867 | |||
| 2209 | Ga0207681_10078607 | |||
| 2210 | Ga0207681_10444946 | |||
| 2211 | Ga0207681_11495350 | |||
| 2212 | Ga0207681_11504358 | |||
| 2213 | Ga0207694_10131982 | |||
| 2214 | Ga0207694_11282988 | |||
| 2215 | Ga0207650_10004888 | |||
| 2216 | Ga0207650_10009769 | |||
| 2217 | Ga0207650_10035323 | |||
| 2218 | Ga0207650_10046883 | |||
| 2219 | Ga0207650_10195957 | |||
| 2220 | Ga0207650_10304815 | |||
| 2221 | Ga0207650_10476708 | |||
| 2222 | Ga0207650_11174515 | |||
| 2223 | Ga0207650_11268940 | |||
| 2224 | Ga0207650_11379496 | |||
| 2225 | Ga0207650_11671015 | |||
| 2226 | Ga0207659_10033631 | |||
| 2227 | Ga0207659_10034049 | |||
| 2228 | Ga0207659_10056438 | |||
| 2229 | Ga0207659_10325690 | |||
| 2230 | Ga0207659_10743268 | |||
| 2231 | Ga0207659_11405584 | |||
| 2232 | Ga0207659_11497129 | |||
| 2233 | Ga0207687_11396149 | |||
| 2234 | Ga0207644_10005002 | |||
| 2235 | Ga0207644_10062124 | |||
| 2236 | Ga0207644_10946104 | |||
| 2237 | Ga0207690_10096270 | |||
| 2238 | Ga0207706_10003803 | |||
| 2239 | Ga0207706_10007905 | |||
| 2240 | Ga0207706_10023224 | |||
| 2241 | Ga0207706_10345305 | |||
| 2242 | Ga0207706_10483715 | |||
| 2243 | Ga0207706_10921640 | |||
| 2244 | Ga0207706_11348327 | |||
| 2245 | Ga0207686_10058398 | |||
| 2246 | Ga0207686_10118317 | |||
| 2247 | Ga0207686_10146299 | |||
| 2248 | Ga0207686_10694100 | |||
| 2249 | Ga0207686_11095800 | |||
| 2250 | Ga0207709_10649030 | |||
| 2251 | Ga0207670_10004881 | |||
| 2252 | Ga0207670_10459853 | |||
| 2253 | Ga0207670_10613974 | |||
| 2254 | Ga0207670_10641953 | |||
| 2255 | Ga0207669_10272319 | |||
| 2256 | Ga0207669_10319550 | |||
| 2257 | Ga0207669_10481243 | |||
| 2258 | Ga0207669_10602284 | |||
| 2259 | Ga0207704_10000484 | |||
| 2260 | Ga0207704_10026162 | |||
| 2261 | Ga0207704_10184786 | |||
| 2262 | Ga0207704_10601514 | |||
| 2263 | Ga0207704_11720276 | |||
| 2264 | Ga0207665_10160926 | |||
| 2265 | Ga0207691_10002120 | |||
| 2266 | Ga0207691_10012396 | |||
| 2267 | Ga0207691_10049241 | |||
| 2268 | Ga0207691_10093127 | |||
| 2269 | Ga0207691_10165772 | |||
| 2270 | Ga0207691_10166536 | |||
| 2271 | Ga0207691_10281088 | |||
| 2272 | Ga0207691_10322463 | |||
| 2273 | Ga0207691_10331549 | |||
| 2274 | Ga0207691_10450743 | |||
| 2275 | Ga0207691_10811208 | |||
| 2276 | Ga0207711_10096985 | |||
| 2277 | Ga0207711_10463167 | |||
| 2278 | Ga0207711_10984058 | |||
| 2279 | Ga0207711_11697046 | |||
| 2280 | Ga0207689_10002405 | |||
| 2281 | Ga0207689_10010393 | |||
| 2282 | Ga0207689_10015655 | |||
| 2283 | Ga0207689_10019942 | |||
| 2284 | Ga0207689_10021007 | |||
| 2285 | Ga0207689_10021416 | |||
| 2286 | Ga0207689_10050087 | |||
| 2287 | Ga0207689_10073362 | |||
| 2288 | Ga0207689_10268307 | |||
| 2289 | Ga0207689_10333242 | |||
| 2290 | Ga0207689_10486626 | |||
| 2291 | Ga0207689_10781778 | |||
| 2292 | Ga0207661_10015999 | |||
| 2293 | Ga0207661_10020712 | |||
| 2294 | Ga0207661_10059632 | |||
| 2295 | Ga0207661_10069730 | |||
| 2296 | Ga0207661_11366855 | |||
| 2297 | Ga0207679_10001121 | |||
| 2298 | Ga0207679_10002674 | |||
| 2299 | Ga0207679_10049169 | |||
| 2300 | Ga0207679_10065635 | |||
| 2301 | Ga0207679_10070822 | |||
| 2302 | Ga0207679_10083573 | |||
| 2303 | Ga0207679_10108491 | |||
| 2304 | Ga0207679_10669751 | |||
| 2305 | Ga0207679_11092845 | |||
| 2306 | Ga0207667_10000340 | |||
| 2307 | Ga0207667_10009409 | |||
| 2308 | Ga0207667_10037270 | |||
| 2309 | Ga0207667_10544960 | |||
| 2310 | Ga0207651_10002824 | |||
| 2311 | Ga0207651_10015789 | |||
| 2312 | Ga0207651_10043110 | |||
| 2313 | Ga0207651_10043279 | |||
| 2314 | Ga0207651_10199654 | |||
| 2315 | Ga0207651_10216028 | |||
| 2316 | Ga0207651_10303453 | |||
| 2317 | Ga0207651_10934214 | |||
| 2318 | Ga0207651_11668378 | |||
| 2319 | Ga0207651_11798250 | |||
| 2320 | Ga0207712_10003520 | |||
| 2321 | Ga0207712_10009397 | |||
| 2322 | Ga0207712_10011683 | |||
| 2323 | Ga0207712_10012015 | |||
| 2324 | Ga0207712_10018240 | |||
| 2325 | Ga0207712_10072670 | |||
| 2326 | Ga0207712_10115094 | |||
| 2327 | Ga0207712_10372915 | |||
| 2328 | Ga0207712_11314512 | |||
| 2329 | Ga0207668_10001106 | |||
| 2330 | Ga0207668_10098164 | |||
| 2331 | Ga0207668_10244856 | |||
| 2332 | Ga0207668_10648319 | |||
| 2333 | Ga0207668_10943000 | |||
| 2334 | Ga0207640_10130502 | |||
| 2335 | Ga0207640_10156691 | |||
| 2336 | Ga0207640_10613137 | |||
| 2337 | Ga0207640_11521754 | |||
| 2338 | Ga0207640_11695298 | |||
| 2339 | Ga0207658_10000847 | |||
| 2340 | Ga0207658_10010360 | |||
| 2341 | Ga0207658_10013966 | |||
| 2342 | Ga0207658_10036244 | |||
| 2343 | Ga0207658_10244463 | |||
| 2344 | Ga0207658_10422049 | |||
| 2345 | Ga0207658_10452056 | |||
| 2346 | Ga0207658_11014068 | |||
| 2347 | Ga0207658_11101403 | |||
| 2348 | Ga0207658_11332155 | |||
| 2349 | Ga0207677_10001136 | |||
| 2350 | Ga0207677_10007895 | |||
| 2351 | Ga0207677_10053438 | |||
| 2352 | Ga0207677_10104847 | |||
| 2353 | Ga0207677_10118524 | |||
| 2354 | Ga0207677_10496489 | |||
| 2355 | Ga0207677_10535892 | |||
| 2356 | Ga0207677_10580982 | |||
| 2357 | Ga0207703_10010768 | |||
| 2358 | Ga0207703_10648914 | |||
| 2359 | Ga0207703_10726598 | |||
| 2360 | Ga0207703_10804331 | |||
| 2361 | Ga0207703_10928050 | |||
| 2362 | Ga0207703_11002670 | |||
| 2363 | Ga0207703_11140025 | |||
| 2364 | Ga0207703_12249299 | |||
| 2365 | Ga0207639_10083200 | |||
| 2366 | Ga0207639_10308490 | |||
| 2367 | Ga0207639_10379234 | |||
| 2368 | Ga0207639_10398512 | |||
| 2369 | Ga0207639_10526364 | |||
| 2370 | Ga0207639_10828455 | |||
| 2371 | Ga0207639_11032459 | |||
| 2372 | Ga0207639_11218910 | |||
| 2373 | Ga0207639_11493536 | |||
| 2374 | Ga0207639_12132462 | |||
| 2375 | Ga0207678_10199143 | |||
| 2376 | Ga0207678_10395394 | |||
| 2377 | Ga0207678_10592582 | |||
| 2378 | Ga0207678_10607373 | |||
| 2379 | Ga0207678_10685741 | |||
| 2380 | Ga0207678_10689552 | |||
| 2381 | Ga0207678_11039657 | |||
| 2382 | Ga0207678_11300917 | |||
| 2383 | Ga0207678_11863662 | |||
| 2384 | Ga0207708_10357458 | |||
| 2385 | Ga0207708_10525593 | |||
| 2386 | Ga0207702_10417315 | |||
| 2387 | Ga0207702_10748205 | |||
| 2388 | Ga0207702_11429131 | |||
| 2389 | Ga0207641_10000418 | |||
| 2390 | Ga0207641_10004489 | |||
| 2391 | Ga0207641_10143228 | |||
| 2392 | Ga0207641_10326368 | |||
| 2393 | Ga0207641_10851373 | |||
| 2394 | Ga0207641_11122046 | |||
| 2395 | Ga0207641_11432600 | |||
| 2396 | Ga0207641_11645497 | |||
| 2397 | Ga0207641_12038058 | |||
| 2398 | Ga0207641_12570089 | |||
| 2399 | Ga0207641_12618480 | |||
| 2400 | Ga0207648_10001186 | |||
| 2401 | Ga0207648_10013975 | |||
| 2402 | Ga0207648_10051259 | |||
| 2403 | Ga0207648_10059395 | |||
| 2404 | Ga0207648_10086258 | |||
| 2405 | Ga0207648_10160349 | |||
| 2406 | Ga0207648_10308727 | |||
| 2407 | Ga0207648_10397334 | |||
| 2408 | Ga0207648_10537985 | |||
| 2409 | Ga0207648_11453593 | |||
| 2410 | Ga0207648_11922026 | |||
| 2411 | Ga0207648_12010344 | |||
| 2412 | Ga0207676_10013981 | |||
| 2413 | Ga0207676_10184534 | |||
| 2414 | Ga0207676_10299451 | |||
| 2415 | Ga0207676_10332248 | |||
| 2416 | Ga0207676_11364470 | |||
| 2417 | Ga0207676_12609778 | |||
| 2418 | Ga0207674_10012911 | |||
| 2419 | Ga0207674_10013730 | |||
| 2420 | Ga0207674_10101039 | |||
| 2421 | Ga0207674_10146034 | |||
| 2422 | Ga0207674_10153470 | |||
| 2423 | Ga0207674_10439326 | |||
| 2424 | Ga0207674_10558402 | |||
| 2425 | Ga0207674_11334436 | |||
| 2426 | Ga0207675_100018406 | |||
| 2427 | Ga0207675_100073850 | |||
| 2428 | Ga0207675_100083470 | |||
| 2429 | Ga0207675_100106426 | |||
| 2430 | Ga0207675_100229221 | |||
| 2431 | Ga0207675_100293606 | |||
| 2432 | Ga0207675_100578976 | |||
| 2433 | Ga0207675_100605670 | |||
| 2434 | Ga0207675_100826956 | |||
| 2435 | Ga0207675_101919330 | |||
| 2436 | Ga0207683_10005675 | |||
| 2437 | Ga0207683_10031869 | |||
| 2438 | Ga0207683_10060923 | |||
| 2439 | Ga0207683_10063612 | |||
| 2440 | Ga0207683_10226237 | |||
| 2441 | Ga0207683_10248030 | |||
| 2442 | Ga0207698_10020032 | |||
| 2443 | Ga0207698_10070584 | |||
| 2444 | Ga0207698_10076391 | |||
| 2445 | Ga0207698_10225207 | |||
| 2446 | Ga0207698_10539586 | |||
| 2447 | Ga0207698_10792905 | |||
| 2448 | Ga0207698_10832350 | |||
| 2449 | Ga0207698_10871467 | |||
| 2450 | Ga0207698_11635413 | |||
| 2451 | Ga0207698_11955835 | |||
| 2452 | Ga0209981_1025019 | |||
| 2453 | Ga0209984_1031578 | |||
| 2454 | Ga0209995_1011784 | |||
| 2455 | Ga0209968_1056776 | |||
| 2456 | Ga0209968_1082126 | |||
| 2457 | Ga0209999_1026399 | |||
| 2458 | Ga0210002_1047950 | |||
| 2459 | Ga0209974_10168124 | |||
| 2460 | Ga0209974_10230101 | |||
| 2461 | Ga0207428_10371385 | |||
| 2462 | Ga0207428_10640257 | |||
| 2463 | Ga0207428_10715529 | |||
| 2464 | Ga0268266_10000034 | |||
| 2465 | Ga0268266_10002645 | |||
| 2466 | Ga0268266_10037874 | |||
| 2467 | Ga0268266_10041488 | |||
| 2468 | Ga0268265_10418024 | |||
| 2469 | Ga0268265_11843614 | |||
| 2470 | Ga0268265_12091992 | |||
| 2471 | Ga0268265_12490657 | |||
| 2472 | Ga0268264_10000117 | |||
| 2473 | Ga0268264_10000739 | |||
| 2474 | Ga0268264_10007632 | |||
| 2475 | Ga0268264_10045709 | |||
| 2476 | Ga0268264_10125122 | |||
| 2477 | Ga0268264_10157121 | |||
| 2478 | Ga0268264_10360793 | |||
| 2479 | Ga0268264_10537925 | |||
| 2480 | Ga0268264_10553839 | |||
| 2481 | Ga0268264_10740900 | |||
| 2482 | Ga0268264_10814069 | |||
| 2483 | Ga0268264_11237682 | |||
| 2484 | Ga0307517_10075365 | |||
| 2485 | Ga0307517_10097860 | |||
| 2486 | Ga0307517_10278037 | |||
| 2487 | Ga0265324_10197047 | |||
| 2488 | Ga0307511_10000153 | |||
| 2489 | Ga0265340_10138071 | |||
| 2490 | Ga0265327_10220582 | |||
| 2491 | Ga0307513_10337849 | |||
| 2492 | Ga0307513_10596328 | |||
| 2493 | Ga0307509_10590973 | |||
| 2494 | Ga0307408_100040477 | |||
| 2495 | Ga0265313_10089316 | |||
| 2496 | Ga0307516_10013017 | |||
| 2497 | Ga0307516_10101287 | |||
| 2498 | Ga0307405_10310771 | |||
| 2499 | Ga0307405_11333177 | |||
| 2500 | Ga0307413_10267875 | |||
| 2501 | Ga0307413_10583886 | |||
| 2502 | Ga0307518_10570043 | |||
| 2503 | Ga0307410_10031519 | |||
| 2504 | Ga0307410_10062277 | |||
| 2505 | Ga0307406_10305366 | |||
| 2506 | Ga0307407_10028144 | |||
| 2507 | Ga0307412_10304404 | |||
| 2508 | Ga0307409_101743126 | |||
| 2509 | Ga0307416_100031968 | |||
| 2510 | Ga0307416_100181822 | |||
| 2511 | Ga0307416_102050099 | |||
| 2512 | Ga0307414_10237961 | |||
| 2513 | Ga0307414_11328522 | |||
| 2514 | Ga0307411_10650473 | |||
| 2515 | Ga0307411_11348200 | |||
| 2516 | Ga0307415_100120477 | |||
| 2517 | Ga0307415_102047549 | |||
| 2518 | Ga0307510_10000191 | |||
| 2519 | Ga0307510_10223308 | |||
| 2520 | Ga0373934_0284889 | |||
| 2521 | Ga0373936_0156366 | |||
| 2522 | Ga0373945_0296781 | |||
| 2523 | Ga0373953_0170263 | |||
| 2524 | Ga0373953_0240197 | |||
| 2525 | Ga0373954_0212408 | |||
| 2526 | Ga0373954_0661935 | |||
| 2527 | Ga0373956_0098657 | |||
| 2528 | Ga0373957_0368098 | |||
| 2529 | Ga0373943_0357336 | |||
| 2530 | Ga0373943_0695050 | |||
| 2531 | Ga0373946_0052222 | |||
| 2532 | Ga0373955_0004303 | |||
| 2533 | Ga0373955_0141242 | |||
| 2534 | Ga0373924_0018853 | |||
| 2535 | Ga0373924_0129571 | |||
| 2536 | Ga0373935_0101981 | |||
| 2537 | Ga0373935_0548261 | |||
| 2538 | Ga0373933_0027963 | |||
| 2539 | Ga0373933_0515849 | |||
| 2540 | Ga0373933_0534008 | |||
| 2541 | Ga0373947_0206812 | |||
| 2542 | Ga0373937_0100271 | |||
| 2543 | Ga0373937_0113245 | |||
| 2544 | Ga0373937_0152449 | |||
| 2545 | Ga0373937_0267166 | |||
| 2546 | Ga0373937_1212067 | |||
| 2547 | Ga0265778_056678 | |||
| 2548 | Ga0373925_0863719 | |||
| 2549 | Ga0373925_0876141 | |||
| 2550 | Ga0373925_1713577 | |||
| 2551 | Ga0395899_0533335 | |||
| 2552 | Ga0395898_0202872 | |||
| 2553 | Ga0395905_0000527 | |||
| 2554 | Ga0395905_0432429 | |||
| 2555 | Ga0395905_0595596 | |||
| 2556 | Ga0395905_1056098 | |||
| 2557 | Ga0395901_0256467 | |||
| 2558 | Ga0436365_1161343 | |||
| 2559 | Ga0436365_1410658 | |||
| 2560 | Ga0436363_1230165 | |||
| 2561 | Ga0439436_0000773 | |||
| 2562 | Ga0439436_0061468 | |||
| 2563 | Ga0439436_0084115 | |||
| 2564 | Ga0439439_0016397 | |||
| 2565 | Ga0439439_0069573 | |||
| 2566 | Ga0439453_0046775 | |||
| 2567 | Ga0439465_0024662 | |||
| 2568 | Ga0451789_0607989 | |||
| 2569 | Ga0451789_1128496 | |||
| 2570 | Ga0451790_23413 | |||
| 2571 | Ga0451797_0944792 | |||
| 2572 | Ga0451805_117129 | |||
| 2573 | Ga0451807_1591963 | |||
| 2574 | Ga0451807_2561754 | |||
| 2575 | Ga0451837_1423970 | |||
| 2576 | Ga0451847_0237332 | |||
| 2577 | Ga0451855_0970425 | |||
| 2578 | Ga0451853_1110616 | |||
| 2579 | Ga0451853_2649306 | |||
| 2580 | Ga0451853_3714240 | |||
| 2581 | Ga0439433_0050987 | |||
| 2582 | Ga0439449_0004545 | |||
| 2583 | Ga0439449_0015374 | |||
| 2584 | Ga0439449_0280988 | |||
| 2585 | Ga0439457_000175 | |||
| 2586 | Ga0439457_003006 | |||
| 2587 | Ga0439457_027556 | |||
| 2588 | Ga0439462_0031419 | |||
| 2589 | Ga0439444_0149920 | |||
| 2590 | Ga0439459_0191789 | |||
| 2591 | Ga0451577_0090941 | |||
| 2592 | Ga0466969_0064878 | |||
| 2593 | Ga0466972_0000782 | |||
| 2594 | Ga0466972_0223006 | |||
| 2595 | Ga0466972_0322658 | |||
| 2596 | Ga0453683_0646177 | |||
| 2597 | Ga0453683_0734579 | |||
| 2598 | Ga0466965_0064770 | |||
| 2599 | Ga0466965_0536104 | |||
| 2600 | Ga0453684_0130453 | |||
| 2601 | Ga0453684_0210816 | |||
| 2602 | Ga0453684_0213439 | |||
| 2603 | Ga0453684_0579157 | |||
| 2604 | Ga0453684_1780334 | |||
| 2605 | Ga0466971_0018466 | |||
| 2606 | Ga0466968_0006371 | |||
| 2607 | Ga0466970_0097553 | |||
| 2608 | Ga0466970_0145604 | |||
| 2609 | Ga0466957_0081791 | |||
| 2610 | Ga0466957_0863054 | |||
| 2611 | Ga0466959_0004300 | |||
| 2612 | Ga0466959_0033132 | |||
| 2613 | Ga0466959_0114695 | |||
| 2614 | Ga0451576_0579263 | |||
| 2615 | Ga0451576_1002077 | |||
| 2616 | Ga0451576_1271054 | |||
| 2617 | Ga0451576_2516393 | |||
| 2618 | Ga0466967_2121513 | |||
| 2619 | Ga0495627_035808 | |||
| 2620 | Ga0495592_0063149 | |||
| 2621 | Ga0495603_0639279 | |||
| 2622 | Ga0495603_0790340 | |||
| 2623 | Ga0495629_0027491 | |||
| 2624 | Ga0495638_0616263 | |||
| 2625 | Ga0495651_0446326 | |||
| 2626 | Ga0495653_0101732 | |||
| 2627 | Ga0495653_0175749 | |||
| 2628 | Ga0495650_0055028 | |||
| 2629 | Ga0495580_0102092 | |||
| 2630 | Ga0495580_0238353 | |||
| 2631 | Ga0495582_0030486 | |||
| 2632 | Ga0495639_0228734 | |||
| 2633 | Ga0495594_0530767 | |||
| 2634 | Ga0495606_0164734 | |||
| 2635 | Ga0495608_0426579 | |||
| 2636 | Ga0495618_0076337 | |||
| 2637 | Ga0495628_0028725 | |||
| 2638 | Ga0495628_0851680 | |||
| 2639 | Ga0495630_0019380 | |||
| 2640 | Ga0495630_0936083 | |||
| 2641 | Ga0495630_0954690 | |||
| 2642 | Ga0495648_0002156 | |||
| 2643 | Ga0495652_0171524 | |||
| 2644 | Ga0495652_0209637 | |||
| 2645 | Ga0495640_0698324 | |||
| 2646 | Ga0495586_0026118 | |||
| 2647 | Ga0495586_0527390 | |||
| 2648 | Ga0495587_0047198 | |||
| 2649 | Ga0495587_0051874 | |||
| 2650 | Ga0495645_0177184 | |||
| 2651 | Ga0495645_0863827 | |||
| 2652 | Ga0495622_0035324 | |||
| 2653 | Ga0495622_0054440 | |||
| 2654 | Ga0495633_0000058 | |||
| 2655 | Ga0495633_0033010 | |||
| 2656 | Ga0495667_0137316 | |||
| 2657 | Ga0495667_0420386 | |||
| 2658 | Ga0495667_0517903 | |||
| 2659 | Ga0495668_0001368 | |||
| 2660 | Ga0495611_0001667 | |||
| 2661 | Ga0495625_0547287 | |||
| 2662 | Ga0495635_0053001 | |||
| 2663 | Ga0495661_0207894 | |||
| 2664 | Ga0495657_0756930 | |||
| 2665 | Ga0495599_0120173 | |||
| 2666 | Ga0495623_0328171 | |||
| 2667 | Ga0495646_0515539 | |||
| 2668 | Ga0495647_0009671 | |||
| 2669 | Ga0495658_0003503 | |||
| 2670 | Ga0495613_0336152 | |||
| 2671 | Ga0495613_0860336 | |||
| 2672 | Ga0495613_0872876 | |||
| 2673 | Ga0495670_0108311 | |||
| 2674 | Ga0495671_0630112 | |||
| 2675 | Ga0495649_0039065 | |||
| 2676 | Ga0495600_0167120 | |||
| 2677 | Ga0495600_0350565 | |||
| 2678 | Ga0495660_0313076 | |||
| 2679 | Ga0495581_0634855 | |||
| 2680 | Ga0495604_0402380 | |||
| 2681 | Ga0495674_0030231 | |||
| 2682 | Ga0495674_0141904 | |||
| 2683 | Ga0495672_0008108 | |||
| 2684 | Ga0495680_0045605 | |||
| 2685 | Ga0495687_000079 | |||
| 2686 | Ga0495675_0281079 | |||
| 2687 | Ga0495675_0548526 | |||
| 2688 | Ga0495684_0345329 | |||
| 2689 | Ga0495684_0830947 | |||
| 2690 | Ga0495686_0000041 | |||
| 2691 | Ga0495686_0163358 | |||
| 2692 | Ga0495593_0258546 | |||
| 2693 | Ga0495602_0260725 | |||
| 2694 | Ga0495615_0260881 | |||
| 2695 | Ga0496101_0029522 | |||
| 2696 | Ga0496101_0086909 | |||
| 2697 | Ga0496102_1484329 | |||
| 2698 | Ga0496104_0311247 | |||
| 2699 | Ga0496104_0520494 | |||
| 2700 | Ga0496104_0564189 | |||
| 2701 | Ga0496104_0602241 | |||
| 2702 | Ga0496104_0823960 | |||
| 2703 | Ga0496104_1187524 | |||
| 2704 | Ga0496105_0313901 | |||
| 2705 | Ga0496105_0636435 | |||
| 2706 | Ga0496105_1023385 | |||
| 2707 | Ga0496106_0192553 | |||
| 2708 | Ga0496106_0931880 | |||
| 2709 | Ga0496108_0519843 | |||
| 2710 | Ga0496108_0791172 | |||
| 2711 | Ga0496109_0202796 | |||
| 2712 | Ga0496110_0579487 | |||
| 2713 | Ga0496111_0147300 | |||
| 2714 | Ga0496111_0257821 | |||
| 2715 | Ga0496114_1551099 | |||
| 2716 | Ga0496114_1671387 | |||
| 2717 | Ga0496115_0111602 | |||
| 2718 | Ga0496126_0115249 | |||
| 2719 | Ga0501306_006749 | |||
| 2720 | Ga0501306_031891 | |||
| 2721 | Ga0501308_005356 | |||
| 2722 | Ga0501308_023797 | |||
| 2723 | Ga0501309_026641 | |||
| 2724 | Ga0501343_022051 | |||
| 2725 | Ga0501304_006136 | |||
| 2726 | Ga0501304_016374 | |||
| 2727 | Ga0501305_009096 | |||
| 2728 | Ga0501305_107732 | |||
| 2729 | Ga0501307_023769 | |||
| 2730 | Ga0501292_073265 | |||
| 2731 | Ga0501311_003025 | |||
| 2732 | Ga0501311_035594 | |||
| 2733 | Ga0501312_042569 | |||
| 2734 | Ga0501312_108295 | |||
| 2735 | Ga0501313_024232 | |||
| 2736 | Ga0501314_033862 | |||
| 2737 | Ga0501314_042373 | |||
| 2738 | Ga0501315_035010 | |||
| 2739 | Ga0501315_055171 | |||
| 2740 | Ga0501316_017821 | |||
| 2741 | Ga0501316_028864 | |||
| 2742 | Ga0501317_024362 | |||
| 2743 | Ga0501317_056761 | |||
| 2744 | Ga0501319_002395 | |||
| 2745 | Ga0501320_011532 | |||
| 2746 | Ga0501320_049111 | |||
| 2747 | Ga0501320_057587 | |||
| 2748 | Ga0501321_034190 | |||
| 2749 | Ga0501323_073342 | |||
| 2750 | Ga0501323_081965 | |||
| 2751 | Ga0501324_036394 | |||
| 2752 | Ga0501327_17434 | |||
| 2753 | Ga0501329_01188 | |||
| 2754 | Ga0501335_003859 | |||
| 2755 | Ga0501335_009515 | |||
| 2756 | Ga0501335_013870 | |||
| 2757 | Ga0501335_026997 | |||
| 2758 | Ga0501336_006401 | |||
| 2759 | Ga0501337_013145 | |||
| 2760 | Ga0501031_0080903 | |||
| 2761 | Ga0501032_0201676 | |||
| 2762 | Ga0501032_0354471 | |||
| 2763 | Ga0501034_0002711 | |||
| 2764 | Ga0501034_0110084 | |||
| 2765 | Ga0501034_0215449 | |||
| 2766 | Ga0501034_1637955 | |||
| 2767 | Ga0501036_0042050 | |||
| 2768 | Ga0501036_0048821 | |||
| 2769 | Ga0501036_0732853 | |||
| 2770 | Ga0501037_0003876 | |||
| 2771 | Ga0501037_0076129 | |||
| 2772 | Ga0501037_0751092 | |||
| 2773 | Ga0501038_0007909 | |||
| 2774 | Ga0501038_0274287 | |||
| 2775 | Ga0501039_0016596 | |||
| 2776 | Ga0501039_0102135 | |||
| 2777 | Ga0501039_0908984 | |||
| 2778 | Ga0501040_0355901 | |||
| 2779 | Ga0501040_0499181 | |||
| 2780 | Ga0501043_0002356 | |||
| 2781 | Ga0501043_0007741 | |||
| 2782 | Ga0501043_0874158 | |||
| 2783 | Ga0501046_0010797 | |||
| 2784 | Ga0501046_0083527 | |||
| 2785 | Ga0501046_0150167 | |||
| 2786 | Ga0501046_0313485 | |||
| 2787 | Ga0501047_0002262 | |||
| 2788 | Ga0501047_0120134 | |||
| 2789 | Ga0501047_0128751 | |||
| 2790 | Ga0501048_0052661 | |||
| 2791 | Ga0501048_0276361 | |||
| 2792 | Ga0501067_0059523 | |||
| 2793 | Ga0501067_0338365 | |||
| 2794 | Ga0501068_0030089 | |||
| 2795 | Ga0501068_0164647 | |||
| 2796 | Ga0501069_0073669 | |||
| 2797 | Ga0501070_0068242 | |||
| 2798 | Ga0501070_0103344 | |||
| 2799 | Ga0501071_0664783 | |||
| 2800 | Ga0501072_0141946 | |||
| 2801 | Ga0501073_0000270 | |||
| 2802 | Ga0501073_0713981 | |||
| 2803 | Ga0501074_0001640 | |||
| 2804 | Ga0501074_0283631 | |||
| 2805 | Ga0501075_0394655 | |||
| 2806 | Ga0501076_0402329 | |||
| 2807 | Ga0501202_013855 | |||
| 2808 | Ga0501209_196824 | |||
| 2809 | Ga0501222_048641 | |||
| 2810 | Ga0501227_021307 | |||
| 2811 | Ga0501225_0332697 | |||
| 2812 | Ga0501079_0079711 | |||
| 2813 | Ga0501079_0598875 | |||
| 2814 | Ga0501079_1223246 | |||
| 2815 | Ga0501080_0007763 | |||
| 2816 | Ga0501080_0133978 | |||
| 2817 | Ga0501080_0205679 | |||
| 2818 | Ga0501083_0021595 | |||
| 2819 | Ga0501083_0191833 | |||
| 2820 | Ga0501241_003385 | |||
| 2821 | Ga0501241_013722 | |||
| 2822 | Ga0501272_073127 | |||
| 2823 | Ga0501274_045872 | |||
| 2824 | Ga0501283_045236 | |||
| 2825 | Ga0501035_0020366 | |||
| 2826 | Ga0501035_0025624 | |||
| 2827 | Ga0501035_0375294 | |||
| 2828 | Ga0501044_0009741 | |||
| 2829 | Ga0501044_0046711 | |||
| 2830 | Ga0501044_0114882 | |||
| 2831 | Ga0501044_0138323 | |||
| 2832 | Ga0501044_0222520 | |||
| 2833 | Ga0501045_0117942 | |||
| 2834 | Ga0501284_00023 | |||
| 2835 | nmdc:mga0k408_12225_c1 | |||
| 2836 | nmdc:mga0k408_23571_c1 | |||
| 2837 | nmdc:mga05p37_745128_c1 | |||
| 2838 | nmdc:mga09592_27033_c1 | |||
| 2839 | nmdc:mga0qj67_604779_c1 | |||
| 2840 | nmdc:mga06r32_256103_c1 | |||
| 2841 | nmdc:mga08y16_693577_c1 | |||
| 2842 | nmdc:mga08y16_735068_c1 | |||
| 2843 | nmdc:mga08y16_894010_c1 | |||
| 2844 | nmdc:mga0rr50_1672052_c1 | |||
| 2845 | Ga0495601_0427249 | |||
| 2846 | Ga0495619_0219968 | |||
| 2847 | Ga0500578_0476906 | |||
| 2848 | Ga0500643_151082 | |||
| 2849 | Ga0500644_0000176 | |||
| 2850 | Ga0500644_0154595 | |||
| 2851 | Ga0500581_200430 | |||
| 2852 | Ga0500646_0005852 | |||
| 2853 | Ga0500646_0009223 | |||
| 2854 | Ga0500646_0009264 | |||
| 2855 | Ga0500646_0031751 | |||
| 2856 | Ga0500583_0002896 | |||
| 2857 | Ga0500583_0012897 | |||
| 2858 | Ga0500583_0112135 | |||
| 2859 | Ga0500651_0036109 | |||
| 2860 | Ga0500651_0062544 | |||
| 2861 | Ga0500650_0383475 | |||
| 2862 | Ga0500650_0422779 | |||
| 2863 | Ga0500569_005759 | |||
| 2864 | Ga0500607_128022 | |||
| 2865 | Ga0500628_032220 | |||
| 2866 | Ga0500628_056819 | |||
| 2867 | Ga0500642_0151852 | |||
| 2868 | Ga0500642_0258992 | |||
| 2869 | Ga0500655_014429 | |||
| 2870 | Ga0500655_059915 | |||
| 2871 | Ga0500658_0030744 | |||
| 2872 | Ga0500559_0001550 | |||
| 2873 | Ga0500561_0045612 | |||
| 2874 | Ga0500568_0046952 | |||
| 2875 | Ga0500568_0216598 | |||
| 2876 | Ga0500577_0002125 | |||
| 2877 | Ga0500577_0551714 | |||
| 2878 | Ga0500588_0167191 | |||
| 2879 | Ga0500588_0414446 | |||
| 2880 | Ga0500589_046079 | |||
| 2881 | Ga0500590_032046 | |||
| 2882 | Ga0500616_0118630 | |||
| 2883 | Ga0500616_0154990 | |||
| 2884 | Ga0500616_0295553 | |||
| 2885 | Ga0500622_0000258 | |||
| 2886 | Ga0500622_0001151 | |||
| 2887 | Ga0500627_0345971 | |||
| 2888 | Ga0500633_0071117 | |||
| 2889 | Ga0500636_0002485 | |||
| 2890 | Ga0500637_0118533 | |||
| 2891 | Ga0500611_000018 | |||
| 2892 | Ga0500645_212072 | |||
| 2893 | Ga0500656_024752 | |||
| 2894 | Ga0501084_0028117 | |||
| 2895 | Ga0501084_0418284 | |||
| 2896 | Ga0500661_001977 | |||
| 2897 | Ga0587082_192654 | |||
| 2898 | Ga0587090_105454 | |||
| 2899 | Ga0587091_049155 | |||
| 2900 | Ga0587092_020882 | |||
| 2901 | Ga0587092_090431 | |||
| 2902 | Ga0587106_041022 | |||
| 2903 | Ga0587101_103719 | |||
| 2904 | Ga0587109_202017 | |||
| 2905 | Ga0587117_043313 | |||
| 2906 | Ga0587128_163040 | |||
| 2907 | Ga0587068_094914 | |||
| 2908 | Ga0587072_117445 | |||
| 2909 | Ga0587076_216631 | |||
| 2910 | Ga0587071_084572 | |||
| 2911 | Ga0587071_139652 | |||
| 2912 | Ga0501082_0146151 | |||
| 2913 | Ga0466962_0306215 | |||
| 2914 | Ga0530510_1392462 | |||
| 2915 | 2945981361 | |||
| 2916 | 2946019240 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fmw-assembly1.cif.gz_O | the structure of a hibernating ribosome in the lyme disease pathogen | 0.9698 | 4 | 90 |
| 6az1-assembly1.cif.gz_T | cryo-em structure of the small subunit of leishmania ribosome bound to paromomycin | 0.9655 | 30 | 73 |
| 8a3w-assembly1.cif.gz_ST | cryo-em structure of leishmania major 80s ribosome : wild type | 0.9637 | 30 | 73 |
| 6th6-assembly1.cif.gz_Aq | cryo-em structure of t. kodakarensis 70s ribosome | 0.9621 | 30 | 75 |
| 6vwl-assembly1.cif.gz_n | 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) | 0.9587 | 4 | 89 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6az1T02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9655 | 30 | 73 | 1.10.287.10 |
| 5ll6Y02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.965 | 30 | 73 | 1.10.287.10 |
| 3jamN02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9572 | 30 | 73 | 1.10.287.10 |
| 4uk9O02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.9562 | 30 | 75 | 1.10.287.10 |
| 4uljO02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding | 0.956 | 30 | 75 | 1.10.287.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432U7P7-F1-model_v4 | Small ribosomal subunit protein uS15 | 0.9808 | 24 | 90 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-O83857-F1-model_v4 | Small ribosomal subunit protein uS15 (30S ribosomal protein S15) | 0.977 | 4 | 90 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A2E3C3A7-F1-model_v4 | Small ribosomal subunit protein uS15 | 0.9761 | 4 | 90 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-A0A842IGM9-F1-model_v4 | Small ribosomal subunit protein uS15 | 0.9758 | 3 | 90 |
GO:0003735
GO:0006412 GO:0019843 GO:0022627 |
| AF-E3T2X5-F1-model_v4 | Small ribosomal subunit protein uS15c | 0.9757 | 23 | 89 |
GO:0003735
GO:0005840 GO:0006412 GO:0009507 GO:1990904 |