F494103

General Info

Members Datasets Scaffolds Average Seq Length
1458 467 2916 90

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100561006|Ga0068863_1005610061
Length 90
Sequence MPLTKEKKSTIFADFGGKETNTGSIEGQIALLTERMAQISNHLQDNNKKDFSTHRGLMQLVGKRKRLLNYLQKHNLTGYRQLIEKLGIRK

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
244 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
245 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
248 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
249 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
252 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
253 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
254 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
255 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
256 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
257 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
258 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
263 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
264 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
265 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
266 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
269 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
303 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
304 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
314 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
334 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
335 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
346 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
354 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
384 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
385 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
386 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
387 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
388 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
389 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
390 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
391 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
392 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
393 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
394 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
395 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
396 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
397 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
398 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
401 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
402 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
403 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
404 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
405 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
408 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
409 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
410 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
411 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
412 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
413 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
414 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
415 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
418 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
419 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
420 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
421 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
422 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
423 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
424 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
425 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
426 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
427 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
428 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
429 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
430 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
431 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
432 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
433 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
434 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
435 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
436 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
437 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
438 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
439 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
440 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
441 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
442 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
443 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
444 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
445 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
446 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
447 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
448 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
449 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
450 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
462 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
464 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
466 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
467 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.54
Metatranscriptomes 4.32
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 2.06
Rhizosphere 91.22
Stem 0
Stem Tuber 0
Unclassified 15.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100561006 3300005841 Bacteria 1128
2 JGI24743J22301_10144941 3300001991 Bacteria 530
3 JGI24744J21845_10020183 3300002077 Unclassified 1315
4 JGI25158J39367_1009415 3300002739 Bacteria 1339
5 JGI25159J45721_1048087 3300002987 Bacteria 593
6 JGI25406J46586_10056108 3300003203 Bacteria 1294
7 rootH2_10009422 3300003320 Bacteria 9760
8 rootH2_10054917 3300003320 Bacteria 1016
9 rootH2_10101489 3300003320 Bacteria 5815
10 rootL2_10127521 3300003322 Bacteria 1280
11 rootL2_10160151 3300003322 Bacteria 5246
12 rootH1_10013931 3300003323 Bacteria 2628
13 rootH1_10135123 3300003323 Bacteria 1958
14 JGI25160J50197_1017226 3300003354 Bacteria 2297
15 Ga0055531_10000245 3300003794 Bacteria 59122
16 Ga0058859_10826476 3300004798 Bacteria 554
17 Ga0058859_11159609 3300004798 Unclassified 543
18 Ga0065714_10037081 3300005288 Bacteria 1024
19 Ga0065714_10328222 3300005288 Unclassified 660
20 Ga0065704_10033350 3300005289 Unclassified 1172
21 Ga0065704_10191117 3300005289 Bacteria 1189
22 Ga0065712_10043039 3300005290 Bacteria 815
23 Ga0065712_10421381 3300005290 Unclassified 711
24 Ga0065715_10400388 3300005293 Bacteria 874
25 Ga0065715_10472634 3300005293 Bacteria 805
26 Ga0065707_10220928 3300005295 Bacteria 1225
27 Ga0065707_10761310 3300005295 Bacteria 614
28 Ga0070658_11322238 3300005327 Unclassified 626
29 Ga0070658_11465044 3300005327 Unclassified 592
30 Ga0070676_10000153 3300005328 Bacteria 27368
31 Ga0070676_10003325 3300005328 Bacteria 8365
32 Ga0070676_10006732 3300005328 Bacteria 6155
33 Ga0070676_10491606 3300005328 Bacteria 870
34 Ga0070676_10535035 3300005328 Bacteria 837
35 Ga0070676_10742147 3300005328 Unclassified 720
36 Ga0070683_100023520 3300005329 Bacteria 5511
37 Ga0070683_100081462 3300005329 Bacteria 3030
38 Ga0070683_101261055 3300005329 Bacteria 710
39 Ga0070690_100021818 3300005330 Bacteria 3914
40 Ga0070690_100108133 3300005330 Unclassified 1852
41 Ga0070690_101005548 3300005330 Bacteria 657
42 Ga0070670_100007928 3300005331 Bacteria 9036
43 Ga0070670_100021684 3300005331 Bacteria 5523
44 Ga0070670_100043904 3300005331 Bacteria 3843
45 Ga0070670_100124831 3300005331 Bacteria 2222
46 Ga0070670_100338882 3300005331 Bacteria 1319
47 Ga0070670_100522289 3300005331 Bacteria 1057
48 Ga0070670_100615430 3300005331 Bacteria 973
49 Ga0070670_101112968 3300005331 Bacteria 720
50 Ga0070670_101324183 3300005331 Bacteria 659
51 Ga0070670_102192332 3300005331 Bacteria 509
52 Ga0070670_102228269 3300005331 Bacteria 505
53 Ga0070677_10175900 3300005333 Bacteria 1015
54 Ga0070677_10520436 3300005333 Unclassified 647
55 Ga0070677_10929689 3300005333 Unclassified 504
56 Ga0068869_100016793 3300005334 Bacteria 4944
57 Ga0068869_100020420 3300005334 Bacteria 4541
58 Ga0068869_100027564 3300005334 Bacteria 3962
59 Ga0068869_100073866 3300005334 Bacteria 2530
60 Ga0068869_100088092 3300005334 Bacteria 2330
61 Ga0068869_100110634 3300005334 Bacteria 2089
62 Ga0068869_100118832 3300005334 Unclassified 2019
63 Ga0068869_100273695 3300005334 Bacteria 1356
64 Ga0068869_100357704 3300005334 Bacteria 1191
65 Ga0068869_100676580 3300005334 Bacteria 878
66 Ga0068869_101215995 3300005334 Bacteria 662
67 Ga0068869_101970654 3300005334 Bacteria 524
68 Ga0070666_10000209 3300005335 Bacteria 40151
69 Ga0070666_10011988 3300005335 Bacteria 5456
70 Ga0070666_10024603 3300005335 Bacteria 3924
71 Ga0070666_10041527 3300005335 Bacteria 3074
72 Ga0070666_10185297 3300005335 Bacteria 1461
73 Ga0070666_10318560 3300005335 Bacteria 1109
74 Ga0070666_10397627 3300005335 Unclassified 990
75 Ga0070666_10420410 3300005335 Bacteria 963
76 Ga0070666_10421262 3300005335 Unclassified 962
77 Ga0070666_10786231 3300005335 Unclassified 700
78 Ga0070680_100301771 3300005336 Bacteria 1358
79 Ga0070682_100834561 3300005337 Bacteria 752
80 Ga0070682_100887543 3300005337 Bacteria 731
81 Ga0070682_101109595 3300005337 Bacteria 663
82 Ga0070682_101554308 3300005337 Unclassified 571
83 Ga0068868_100001336 3300005338 Bacteria 17019
84 Ga0068868_100002414 3300005338 Bacteria 12932
85 Ga0068868_100020102 3300005338 Bacteria 5011
86 Ga0068868_100022584 3300005338 Bacteria 4750
87 Ga0068868_100023605 3300005338 Bacteria 4656
88 Ga0068868_100136042 3300005338 Bacteria 2014
89 Ga0068868_100195266 3300005338 Bacteria 1685
90 Ga0068868_100272610 3300005338 Bacteria 1430
91 Ga0068868_100297356 3300005338 Bacteria 1370
92 Ga0068868_100410873 3300005338 Bacteria 1170
93 Ga0070660_100573851 3300005339 Unclassified 942
94 Ga0070660_100581730 3300005339 Bacteria 935
95 Ga0070660_100620185 3300005339 Unclassified 905
96 Ga0070660_100987860 3300005339 Bacteria 711
97 Ga0070689_100157874 3300005340 Unclassified 1832
98 Ga0070689_100493835 3300005340 Bacteria 1047
99 Ga0070689_100688089 3300005340 Bacteria 892
100 Ga0070689_100804037 3300005340 Bacteria 827
101 Ga0070689_101464730 3300005340 Bacteria 618
102 Ga0070689_101825901 3300005340 Unclassified 554
103 Ga0070691_10010461 3300005341 Bacteria 4234
104 Ga0070691_10576669 3300005341 Bacteria 661
105 Ga0070687_100002811 3300005343 Bacteria 6635
106 Ga0070687_100155279 3300005343 Bacteria 1348
107 Ga0070687_101148675 3300005343 Unclassified 570
108 Ga0070661_100130084 3300005344 Bacteria 1890
109 Ga0070661_100201421 3300005344 Bacteria 1521
110 Ga0070661_100405144 3300005344 Bacteria 1079
111 Ga0070661_100455569 3300005344 Bacteria 1018
112 Ga0070661_101107798 3300005344 Unclassified 660
113 Ga0070668_100000556 3300005347 Bacteria 24937
114 Ga0070668_100032555 3300005347 Bacteria 3967
115 Ga0070668_100163333 3300005347 Bacteria 1808
116 Ga0070668_100302528 3300005347 Unclassified 1342
117 Ga0070668_100510433 3300005347 Bacteria 1042
118 Ga0070668_100759615 3300005347 Bacteria 859
119 Ga0070669_100056538 3300005353 Unclassified 2877
120 Ga0070669_100089397 3300005353 Bacteria 2307
121 Ga0070669_100094730 3300005353 Unclassified 2244
122 Ga0070669_100541968 3300005353 Bacteria 969
123 Ga0070669_100686648 3300005353 Unclassified 864
124 Ga0070669_101382906 3300005353 Bacteria 611
125 Ga0070675_100024988 3300005354 Bacteria 4788
126 Ga0070675_100028383 3300005354 Bacteria 4504
127 Ga0070675_100051669 3300005354 Bacteria 3378
128 Ga0070675_100053321 3300005354 Bacteria 3326
129 Ga0070675_100087065 3300005354 Bacteria 2612
130 Ga0070675_100278735 3300005354 Bacteria 1469
131 Ga0070675_100597133 3300005354 Bacteria 1001
132 Ga0070671_100001985 3300005355 Bacteria 15713
133 Ga0070671_100034628 3300005355 Bacteria 4181
134 Ga0070671_100041198 3300005355 Bacteria 3838
135 Ga0070671_100385016 3300005355 Bacteria 1199
136 Ga0070671_100412863 3300005355 Bacteria 1156
137 Ga0070671_100714595 3300005355 Bacteria 870
138 Ga0070671_101035812 3300005355 Unclassified 720
139 Ga0070671_101137528 3300005355 Unclassified 686
140 Ga0070671_101978293 3300005355 Bacteria 519
141 Ga0070674_100062017 3300005356 Bacteria 2611
142 Ga0070674_100342171 3300005356 Unclassified 1205
143 Ga0070674_100520484 3300005356 Bacteria 993
144 Ga0070674_100572475 3300005356 Bacteria 950
145 Ga0070674_100920875 3300005356 Bacteria 763
146 Ga0070673_100000867 3300005364 Bacteria 17013
147 Ga0070673_100006375 3300005364 Bacteria 7667
148 Ga0070673_100024895 3300005364 Bacteria 4396
149 Ga0070673_100041606 3300005364 Bacteria 3536
150 Ga0070673_100060726 3300005364 Unclassified 2996
151 Ga0070673_100912603 3300005364 Bacteria 815
152 Ga0070673_101013672 3300005364 Bacteria 773
153 Ga0070673_101180336 3300005364 Bacteria 717
154 Ga0070673_101649871 3300005364 Bacteria 606
155 Ga0070688_100278966 3300005365 Bacteria 1200
156 Ga0070688_100356616 3300005365 Unclassified 1072
157 Ga0070688_100655418 3300005365 Bacteria 809
158 Ga0070688_100741030 3300005365 Bacteria 764
159 Ga0070688_101606518 3300005365 Bacteria 531
160 Ga0070659_100007187 3300005366 Bacteria 8080
161 Ga0070659_100770727 3300005366 Bacteria 835
162 Ga0070667_100000812 3300005367 Bacteria 29157
163 Ga0070667_100008930 3300005367 Bacteria 8297
164 Ga0070667_100038136 3300005367 Bacteria 4029
165 Ga0070667_100040093 3300005367 Bacteria 3927
166 Ga0070667_100060648 3300005367 Bacteria 3201
167 Ga0070667_100099011 3300005367 Bacteria 2516
168 Ga0070667_100117175 3300005367 Unclassified 2314
169 Ga0070667_100253860 3300005367 Bacteria 1573
170 Ga0070667_100270609 3300005367 Bacteria 1523
171 Ga0070667_100562188 3300005367 Bacteria 1049
172 Ga0070667_100756177 3300005367 Bacteria 901
173 Ga0070667_100969352 3300005367 Bacteria 793
174 Ga0070667_101344830 3300005367 Bacteria 670
175 Ga0070701_10013206 3300005438 Bacteria 3751
176 Ga0070701_10347508 3300005438 Bacteria 925
177 Ga0070705_100215659 3300005440 Bacteria 1326
178 Ga0070700_100439346 3300005441 Unclassified 990
179 Ga0070700_100676271 3300005441 Bacteria 818
180 Ga0070708_101399131 3300005445 Bacteria 653
181 Ga0070663_100075874 3300005455 Unclassified 2458
182 Ga0070663_100765925 3300005455 Unclassified 825
183 Ga0070663_100770436 3300005455 Unclassified 823
184 Ga0070663_100924549 3300005455 Bacteria 755
185 Ga0070663_101175074 3300005455 Bacteria 673
186 Ga0070678_100023430 3300005456 Bacteria 4113
187 Ga0070678_100130837 3300005456 Bacteria 1993
188 Ga0070678_100167308 3300005456 Unclassified 1787
189 Ga0070678_100326560 3300005456 Bacteria 1312
190 Ga0070678_100390860 3300005456 Bacteria 1206
191 Ga0070678_100790745 3300005456 Bacteria 861
192 Ga0070662_100001017 3300005457 Bacteria 17158
193 Ga0070662_100002918 3300005457 Bacteria 10627
194 Ga0070662_100019329 3300005457 Bacteria 4623
195 Ga0070662_100292903 3300005457 Unclassified 1320
196 Ga0070662_100381670 3300005457 Unclassified 1160
197 Ga0070662_100537232 3300005457 Bacteria 978
198 Ga0070662_100840518 3300005457 Bacteria 781
199 Ga0070662_101342622 3300005457 Bacteria 616
200 Ga0070681_10167290 3300005458 Unclassified 2121
201 Ga0068867_100036770 3300005459 Bacteria 3556
202 Ga0068867_100068327 3300005459 Bacteria 2652
203 Ga0068867_100082748 3300005459 Bacteria 2422
204 Ga0068867_100136101 3300005459 Unclassified 1915
205 Ga0068867_100143037 3300005459 Bacteria 1871
206 Ga0068867_100225703 3300005459 Bacteria 1511
207 Ga0068867_101212847 3300005459 Bacteria 693
208 Ga0070685_10137269 3300005466 Bacteria 1536
209 Ga0070685_10300653 3300005466 Bacteria 1081
210 Ga0070685_10322320 3300005466 Bacteria 1048
211 Ga0070685_10370073 3300005466 Bacteria 984
212 Ga0070685_10759654 3300005466 Bacteria 711
213 Ga0070706_100936390 3300005467 Bacteria 800
214 Ga0070698_100036892 3300005471 Bacteria 5044
215 Ga0070698_100049913 3300005471 Bacteria 4269
216 Ga0070684_100001060 3300005535 Bacteria 19661
217 Ga0070684_100002383 3300005535 Bacteria 13852
218 Ga0070684_100032732 3300005535 Bacteria 4434
219 Ga0070684_100376101 3300005535 Bacteria 1308
220 Ga0070684_100662580 3300005535 Bacteria 972
221 Ga0070684_102118537 3300005535 Bacteria 531
222 Ga0070684_102282173 3300005535 Bacteria 510
223 Ga0068853_100000520 3300005539 Bacteria 26128
224 Ga0068853_100020753 3300005539 Bacteria 5465
225 Ga0068853_100065202 3300005539 Bacteria 3160
226 Ga0068853_100519567 3300005539 Bacteria 1125
227 Ga0068853_100663448 3300005539 Bacteria 993
228 Ga0068853_101186315 3300005539 Unclassified 737
229 Ga0068853_101491117 3300005539 Bacteria 655
230 Ga0068853_101738683 3300005539 Bacteria 605
231 Ga0068853_101821005 3300005539 Bacteria 590
232 Ga0068853_102386995 3300005539 Bacteria 512
233 Ga0070672_100000738 3300005543 Bacteria 19396
234 Ga0070672_100048813 3300005543 Bacteria 3291
235 Ga0070672_100101769 3300005543 Bacteria 2331
236 Ga0070672_100347186 3300005543 Bacteria 1264
237 Ga0070672_100597516 3300005543 Unclassified 961
238 Ga0070672_101282081 3300005543 Bacteria 654
239 Ga0070672_101497765 3300005543 Bacteria 604
240 Ga0070686_100107815 3300005544 Bacteria 1892
241 Ga0070686_100514885 3300005544 Bacteria 930
242 Ga0070686_100966775 3300005544 Bacteria 696
243 Ga0070693_100250499 3300005547 Unclassified 1174
244 Ga0070693_100882055 3300005547 Unclassified 669
245 Ga0070665_100000016 3300005548 Bacteria 451538
246 Ga0070665_100000486 3300005548 Bacteria 57134
247 Ga0070665_100024894 3300005548 Bacteria 6031
248 Ga0070665_100231705 3300005548 Bacteria 1847
249 Ga0070665_100454910 3300005548 Bacteria 1290
250 Ga0070665_100824961 3300005548 Bacteria 940
251 Ga0070665_101216511 3300005548 Unclassified 764
252 Ga0070665_102622184 3300005548 Bacteria 505
253 Ga0070704_100432572 3300005549 Bacteria 1129
254 Ga0070704_100756215 3300005549 Bacteria 866
255 Ga0070704_100811663 3300005549 Unclassified 836
256 Ga0068855_100001195 3300005563 Bacteria 32239
257 Ga0068855_100056754 3300005563 Bacteria 4592
258 Ga0068855_100147675 3300005563 Bacteria 2675
259 Ga0068855_100920202 3300005563 Unclassified 923
260 Ga0070664_100002163 3300005564 Bacteria 15764
261 Ga0070664_100034763 3300005564 Bacteria 4229
262 Ga0070664_100085373 3300005564 Bacteria 2726
263 Ga0070664_100092551 3300005564 Bacteria 2618
264 Ga0070664_100100585 3300005564 Unclassified 2513
265 Ga0070664_100173719 3300005564 Bacteria 1912
266 Ga0070664_100456680 3300005564 Bacteria 1173
267 Ga0070664_100672758 3300005564 Bacteria 963
268 Ga0070664_100703265 3300005564 Unclassified 942
269 Ga0070664_100736621 3300005564 Bacteria 920
270 Ga0070664_101958890 3300005564 Bacteria 556
271 Ga0068857_100007533 3300005577 Bacteria 9367
272 Ga0068857_100092135 3300005577 Unclassified 2713
273 Ga0068857_100116871 3300005577 Bacteria 2400
274 Ga0068857_100143969 3300005577 Bacteria 2156
275 Ga0068857_100328872 3300005577 Bacteria 1412
276 Ga0068857_100410499 3300005577 Bacteria 1261
277 Ga0068857_101082230 3300005577 Unclassified 774
278 Ga0068857_102464664 3300005577 Bacteria 511
279 Ga0068854_100075832 3300005578 Bacteria 2470
280 Ga0068854_100113006 3300005578 Bacteria 2051
281 Ga0068854_100161208 3300005578 Bacteria 1737
282 Ga0068854_100228111 3300005578 Bacteria 1477
283 Ga0068854_100627264 3300005578 Unclassified 920
284 Ga0068854_101155729 3300005578 Bacteria 692
285 Ga0068854_101973482 3300005578 Bacteria 537
286 Ga0068856_100243724 3300005614 Bacteria 1812
287 Ga0070702_100097632 3300005615 Bacteria 1795
288 Ga0070702_100520081 3300005615 Unclassified 877
289 Ga0070702_101372019 3300005615 Unclassified 577
290 Ga0068852_100000223 3300005616 Bacteria 38460
291 Ga0068852_100005616 3300005616 Bacteria 8998
292 Ga0068852_100083763 3300005616 Bacteria 2836
293 Ga0068852_100135099 3300005616 Bacteria 2277
294 Ga0068852_100460264 3300005616 Unclassified 1261
295 Ga0068852_100627285 3300005616 Unclassified 1081
296 Ga0068852_101041590 3300005616 Bacteria 837
297 Ga0068852_101374112 3300005616 Bacteria 728
298 Ga0068859_100016918 3300005617 Bacteria 7320
299 Ga0068859_100026368 3300005617 Bacteria 5827
300 Ga0068859_100076707 3300005617 Bacteria 3383
301 Ga0068859_100153847 3300005617 Bacteria 2376
302 Ga0068859_100219040 3300005617 Bacteria 1991
303 Ga0068859_100266281 3300005617 Bacteria 1806
304 Ga0068859_100272729 3300005617 Bacteria 1784
305 Ga0068859_102496880 3300005617 Bacteria 569
306 Ga0068859_102674626 3300005617 Bacteria 548
307 Ga0068859_102720851 3300005617 Bacteria 543
308 Ga0068859_102995704 3300005617 Unclassified 516
309 Ga0068864_100002330 3300005618 Bacteria 15704
310 Ga0068864_100010946 3300005618 Bacteria 7499
311 Ga0068864_100048675 3300005618 Bacteria 3645
312 Ga0068864_100282029 3300005618 Bacteria 1551
313 Ga0068864_100348728 3300005618 Bacteria 1396
314 Ga0068864_100371791 3300005618 Bacteria 1353
315 Ga0068864_101231849 3300005618 Bacteria 747
316 Ga0068866_10023161 3300005718 Bacteria 2885
317 Ga0068866_10080310 3300005718 Bacteria 1749
318 Ga0068866_10164227 3300005718 Bacteria 1298
319 Ga0068866_10279609 3300005718 Bacteria 1033
320 Ga0068866_10470454 3300005718 Bacteria 826
321 Ga0068866_11114522 3300005718 Bacteria 566
322 Ga0068866_11155476 3300005718 Unclassified 557
323 Ga0068861_100057736 3300005719 Bacteria 2965
324 Ga0068861_100118137 3300005719 Unclassified 2135
325 Ga0068861_100177987 3300005719 Bacteria 1768
326 Ga0068861_100374722 3300005719 Bacteria 1256
327 Ga0068861_100533110 3300005719 Bacteria 1067
328 Ga0068861_100731899 3300005719 Unclassified 922
329 Ga0068861_100887291 3300005719 Bacteria 843
330 Ga0068861_101281305 3300005719 Bacteria 712
331 Ga0068861_101393409 3300005719 Bacteria 684
332 Ga0068861_102350248 3300005719 Bacteria 535
333 Ga0068861_102482737 3300005719 Bacteria 521
334 Ga0068851_10010493 3300005834 Bacteria 4327
335 Ga0068851_10154441 3300005834 Bacteria 1257
336 Ga0068851_10489199 3300005834 Bacteria 736
337 Ga0068851_10604440 3300005834 Bacteria 668
338 Ga0068851_10675666 3300005834 Bacteria 634
339 Ga0068851_10714287 3300005834 Bacteria 618
340 Ga0068870_10012476 3300005840 Bacteria 3973
341 Ga0068870_10138923 3300005840 Bacteria 1419
342 Ga0068870_10149303 3300005840 Bacteria 1375
343 Ga0068870_10331047 3300005840 Bacteria 971
344 Ga0068870_10877282 3300005840 Unclassified 632
345 Ga0068863_100000858 3300005841 Bacteria 30354
346 Ga0068863_100308391 3300005841 Bacteria 1536
347 Ga0068863_100329429 3300005841 Bacteria 1484
348 Ga0068863_100372317 3300005841 Bacteria 1394
349 Ga0068863_100852382 3300005841 Bacteria 910
350 Ga0068863_101543917 3300005841 Unclassified 673
351 Ga0068863_101838583 3300005841 Bacteria 615
352 Ga0068863_102691392 3300005841 Bacteria 506
353 Ga0068858_100008022 3300005842 Bacteria 10169
354 Ga0068858_100050171 3300005842 Bacteria 3862
355 Ga0068858_100087035 3300005842 Bacteria 2906
356 Ga0068858_100390819 3300005842 Bacteria 1336
357 Ga0068858_100502440 3300005842 Bacteria 1172
358 Ga0068858_100840137 3300005842 Bacteria 897
359 Ga0068858_101358846 3300005842 Bacteria 700
360 Ga0068858_101566210 3300005842 Bacteria 650
361 Ga0068858_101871069 3300005842 Bacteria 593
362 Ga0068858_102578430 3300005842 Bacteria 502
363 Ga0068860_100000026 3300005843 Bacteria 270483
364 Ga0068860_100006630 3300005843 Bacteria 11627
365 Ga0068860_100014705 3300005843 Bacteria 7655
366 Ga0068860_100031636 3300005843 Bacteria 5086
367 Ga0068860_100058149 3300005843 Bacteria 3675
368 Ga0068860_100060556 3300005843 Bacteria 3598
369 Ga0068860_100134629 3300005843 Bacteria 2373
370 Ga0068860_100146429 3300005843 Bacteria 2273
371 Ga0068860_100161168 3300005843 Unclassified 2163
372 Ga0068860_100187590 3300005843 Bacteria 2000
373 Ga0068860_100216288 3300005843 Bacteria 1860
374 Ga0068860_100572886 3300005843 Bacteria 1133
375 Ga0068860_100861403 3300005843 Bacteria 921
376 Ga0068860_102280828 3300005843 Bacteria 562
377 Ga0068860_102282564 3300005843 Bacteria 562
378 Ga0068860_102350146 3300005843 Bacteria 553
379 Ga0068862_100120003 3300005844 Bacteria 2317
380 Ga0068862_100853358 3300005844 Bacteria 893
381 Ga0068862_101892228 3300005844 Bacteria 606
382 Ga0081540_1015893 3300005983 Bacteria 4743
383 Ga0081539_10058235 3300005985 Bacteria 2133
384 Ga0070715_10242687 3300006163 Bacteria 937
385 Ga0075366_10004995 3300006195 Bacteria 7158
386 Ga0075366_10009633 3300006195 Bacteria 5399
387 Ga0075366_10033515 3300006195 Bacteria 3026
388 Ga0075366_10534924 3300006195 Bacteria 725
389 Ga0097621_100000027 3300006237 Bacteria 71873
390 Ga0097621_100506876 3300006237 Bacteria 1094
391 Ga0097621_100736323 3300006237 Bacteria 910
392 Ga0097621_100893514 3300006237 Unclassified 827
393 Ga0097621_101558449 3300006237 Bacteria 628
394 Ga0097621_101724099 3300006237 Bacteria 597
395 Ga0097621_102042517 3300006237 Bacteria 548
396 Ga0068871_100000107 3300006358 Bacteria 50575
397 Ga0068871_100011119 3300006358 Bacteria 6598
398 Ga0068871_100160875 3300006358 Bacteria 1920
399 Ga0068871_100219701 3300006358 Bacteria 1646
400 Ga0068871_100224703 3300006358 Bacteria 1628
401 Ga0068871_100348237 3300006358 Bacteria 1310
402 Ga0068871_100515883 3300006358 Bacteria 1079
403 Ga0068871_100598330 3300006358 Bacteria 1003
404 Ga0068871_101150867 3300006358 Unclassified 727
405 Ga0068871_101221424 3300006358 Bacteria 705
406 Ga0068871_102330538 3300006358 Bacteria 510
407 Ga0075428_100497738 3300006844 Bacteria 1304
408 Ga0075430_100640740 3300006846 Bacteria 876
409 Ga0075431_100001800 3300006847 Bacteria 20232
410 Ga0075429_100015792 3300006880 Bacteria 6539
411 Ga0075429_100513647 3300006880 Unclassified 1050
412 Ga0068865_100012268 3300006881 Bacteria 5390
413 Ga0068865_100023713 3300006881 Bacteria 4021
414 Ga0068865_100047038 3300006881 Bacteria 2963
415 Ga0068865_100379893 3300006881 Bacteria 1152
416 Ga0068865_100741006 3300006881 Bacteria 843
417 Ga0097620_100016919 3300006931 Bacteria 7320
418 Ga0097620_100026370 3300006931 Bacteria 5827
419 Ga0097620_100076707 3300006931 Bacteria 3383
420 Ga0097620_100153847 3300006931 Bacteria 2376
421 Ga0097620_100219047 3300006931 Bacteria 1991
422 Ga0097620_100266293 3300006931 Bacteria 1806
423 Ga0097620_100272717 3300006931 Bacteria 1784
424 Ga0097620_102498304 3300006931 Bacteria 569
425 Ga0097620_102674555 3300006931 Bacteria 548
426 Ga0097620_102720788 3300006931 Bacteria 543
427 Ga0097620_102996779 3300006931 Unclassified 516
428 Ga0105251_10354085 3300009011 Bacteria 670
429 Ga0105244_10282407 3300009036 Bacteria 770
430 Ga0105240_10000258 3300009093 Bacteria 105011
431 Ga0105240_10000715 3300009093 Bacteria 60725
432 Ga0105240_10017799 3300009093 Bacteria 9564
433 Ga0105240_10082615 3300009093 Bacteria 3945
434 Ga0105240_10132147 3300009093 Bacteria 2993
435 Ga0105240_10208171 3300009093 Bacteria 2287
436 Ga0105240_10682960 3300009093 Bacteria 1122
437 Ga0105240_10967775 3300009093 Bacteria 912
438 Ga0105240_11846305 3300009093 Bacteria 629
439 Ga0111539_10479134 3300009094 Bacteria 1449
440 Ga0111539_10519125 3300009094 Bacteria 1388
441 Ga0105245_10626041 3300009098 Bacteria 1105
442 Ga0105247_10001631 3300009101 Bacteria 15867
443 Ga0105247_10052842 3300009101 Bacteria 2506
444 Ga0114129_10015867 3300009147 Bacteria 10712
445 Ga0105243_10167162 3300009148 Bacteria 1902
446 Ga0105243_10282805 3300009148 Unclassified 1495
447 Ga0105243_11259227 3300009148 Bacteria 755
448 Ga0105241_10000721 3300009174 Bacteria 25017
449 Ga0105241_10200099 3300009174 Bacteria 1668
450 Ga0105241_10281108 3300009174 Bacteria 1421
451 Ga0105241_10408323 3300009174 Bacteria 1193
452 Ga0105241_10549747 3300009174 Bacteria 1036
453 Ga0105241_10853314 3300009174 Bacteria 842
454 Ga0105241_11002918 3300009174 Bacteria 781
455 Ga0105241_12458113 3300009174 Unclassified 521
456 Ga0105242_10019590 3300009176 Bacteria 5302
457 Ga0105242_10139507 3300009176 Bacteria 2102
458 Ga0105242_10163684 3300009176 Bacteria 1949
459 Ga0105242_10231784 3300009176 Bacteria 1655
460 Ga0105242_10809566 3300009176 Unclassified 928
461 Ga0105242_10991771 3300009176 Bacteria 847
462 Ga0105242_11104122 3300009176 Bacteria 807
463 Ga0105242_12226265 3300009176 Bacteria 594
464 Ga0105242_12226675 3300009176 Bacteria 594
465 Ga0105242_12670042 3300009176 Bacteria 549
466 Ga0105242_12734394 3300009176 Unclassified 543
467 Ga0105242_13254132 3300009176 Bacteria 505
468 Ga0105248_10066633 3300009177 Bacteria 4042
469 Ga0105248_10152482 3300009177 Bacteria 2608
470 Ga0105248_10460370 3300009177 Bacteria 1434
471 Ga0105248_10737308 3300009177 Unclassified 1112
472 Ga0105248_10903822 3300009177 Bacteria 997
473 Ga0105248_10964121 3300009177 Bacteria 963
474 Ga0105248_11127964 3300009177 Bacteria 886
475 Ga0105248_12395203 3300009177 Bacteria 601
476 Ga0105237_10000654 3300009545 Bacteria 48395
477 Ga0105237_10022472 3300009545 Bacteria 6471
478 Ga0105237_10061881 3300009545 Bacteria 3741
479 Ga0105237_10095645 3300009545 Bacteria 2960
480 Ga0105237_10296964 3300009545 Bacteria 1618
481 Ga0105237_10362743 3300009545 Bacteria 1453
482 Ga0105237_10410272 3300009545 Unclassified 1359
483 Ga0105237_10467670 3300009545 Bacteria 1267
484 Ga0105237_10818473 3300009545 Bacteria 938
485 Ga0105237_11148097 3300009545 Bacteria 783
486 Ga0105237_11324581 3300009545 Bacteria 726
487 Ga0105237_12449324 3300009545 Unclassified 532
488 Ga0105238_10006981 3300009551 Bacteria 11286
489 Ga0105238_10060929 3300009551 Bacteria 3777
490 Ga0105238_11080890 3300009551 Unclassified 824
491 Ga0105249_10004870 3300009553 Bacteria 11583
492 Ga0105249_10012686 3300009553 Bacteria 7430
493 Ga0105249_10023081 3300009553 Bacteria 5579
494 Ga0105249_10104818 3300009553 Bacteria 2665
495 Ga0105249_10115110 3300009553 Bacteria 2547
496 Ga0105249_10553664 3300009553 Bacteria 1201
497 Ga0105249_10562396 3300009553 Unclassified 1192
498 Ga0105249_11374299 3300009553 Unclassified 778
499 Ga0105249_12608088 3300009553 Bacteria 578
500 Ga0105249_13581314 3300009553 Unclassified 500
501 Ga0099796_10221589 3300010159 Bacteria 775
502 Ga0105239_10000353 3300010375 Bacteria 67099
503 Ga0105239_10002319 3300010375 Bacteria 24303
504 Ga0105239_10002402 3300010375 Bacteria 23874
505 Ga0105239_10023616 3300010375 Bacteria 6771
506 Ga0105239_10029540 3300010375 Bacteria 6027
507 Ga0105239_10046183 3300010375 Bacteria 4772
508 Ga0105239_10137123 3300010375 Bacteria 2724
509 Ga0105239_10450950 3300010375 Bacteria 1459
510 Ga0105239_10548614 3300010375 Bacteria 1316
511 Ga0105239_10655614 3300010375 Bacteria 1199
512 Ga0105239_11018647 3300010375 Bacteria 952
513 Ga0105246_10064263 3300011119 Bacteria 2563
514 Ga0105246_10109772 3300011119 Bacteria 2024
515 Ga0105246_10176986 3300011119 Unclassified 1639
516 Ga0105246_10580679 3300011119 Bacteria 965
517 Ga0157327_1040044 3300012512 Bacteria 626
518 Ga0157373_10042785 3300013100 Unclassified 3236
519 Ga0157373_10057587 3300013100 Bacteria 2756
520 Ga0157373_10113865 3300013100 Bacteria 1901
521 Ga0157373_10326191 3300013100 Unclassified 1093
522 Ga0157373_10469133 3300013100 Unclassified 907
523 Ga0157371_10011331 3300013102 Bacteria 6878
524 Ga0157371_10048034 3300013102 Bacteria 3034
525 Ga0157371_10053895 3300013102 Bacteria 2856
526 Ga0157371_10109883 3300013102 Bacteria 1957
527 Ga0157371_10269678 3300013102 Bacteria 1228
528 Ga0157371_10395378 3300013102 Bacteria 1011
529 Ga0157371_10820428 3300013102 Bacteria 702
530 Ga0157370_10005886 3300013104 Bacteria 13672
531 Ga0157370_10021094 3300013104 Bacteria 6496
532 Ga0157370_10097938 3300013104 Bacteria 2751
533 Ga0157370_10600531 3300013104 Bacteria 1008
534 Ga0157370_10754425 3300013104 Unclassified 887
535 Ga0157370_10859977 3300013104 Bacteria 824
536 Ga0157370_10918531 3300013104 Bacteria 794
537 Ga0157370_11164858 3300013104 Bacteria 696
538 Ga0157370_11334326 3300013104 Unclassified 646
539 Ga0157369_10060951 3300013105 Bacteria 4068
540 Ga0157369_10256753 3300013105 Bacteria 1823
541 Ga0157369_10338684 3300013105 Bacteria 1562
542 Ga0157369_10466049 3300013105 Bacteria 1308
543 Ga0157369_11006248 3300013105 Bacteria 853
544 Ga0157369_12125885 3300013105 Bacteria 569
545 Ga0157374_10000002 3300013296 Bacteria 1054226
546 Ga0157374_10000841 3300013296 Bacteria 26835
547 Ga0157374_10006478 3300013296 Bacteria 9936
548 Ga0157374_10015281 3300013296 Bacteria 6732
549 Ga0157374_10024723 3300013296 Bacteria 5385
550 Ga0157374_10036109 3300013296 Bacteria 4525
551 Ga0157374_10212713 3300013296 Bacteria 1896
552 Ga0157374_10261668 3300013296 Bacteria 1704
553 Ga0157374_10315603 3300013296 Bacteria 1548
554 Ga0157374_10334544 3300013296 Bacteria 1502
555 Ga0157374_10740734 3300013296 Unclassified 997
556 Ga0157374_10823863 3300013296 Bacteria 944
557 Ga0157378_10002090 3300013297 Bacteria 17837
558 Ga0157378_10004442 3300013297 Bacteria 12335
559 Ga0157378_10012644 3300013297 Bacteria 7387
560 Ga0157378_10022590 3300013297 Bacteria 5535
561 Ga0157378_10023595 3300013297 Bacteria 5411
562 Ga0157378_10038804 3300013297 Bacteria 4223
563 Ga0157378_10222060 3300013297 Unclassified 1797
564 Ga0157378_10613946 3300013297 Bacteria 1100
565 Ga0157378_10702050 3300013297 Unclassified 1031
566 Ga0157378_10710397 3300013297 Bacteria 1025
567 Ga0157378_11584247 3300013297 Bacteria 701
568 Ga0157378_12791720 3300013297 Unclassified 541
569 Ga0163162_10000100 3300013306 Bacteria 78269
570 Ga0163162_10000190 3300013306 Bacteria 56892
571 Ga0163162_10004205 3300013306 Bacteria 13837
572 Ga0163162_10006285 3300013306 Bacteria 11505
573 Ga0163162_10024736 3300013306 Bacteria 5931
574 Ga0163162_10060245 3300013306 Bacteria 3830
575 Ga0163162_10125475 3300013306 Bacteria 2673
576 Ga0163162_10191116 3300013306 Unclassified 2175
577 Ga0163162_10299598 3300013306 Unclassified 1740
578 Ga0163162_10320794 3300013306 Bacteria 1682
579 Ga0163162_10504866 3300013306 Bacteria 1340
580 Ga0163162_10838151 3300013306 Bacteria 1035
581 Ga0163162_11251766 3300013306 Bacteria 843
582 Ga0163162_13058025 3300013306 Bacteria 537
583 Ga0157372_10002276 3300013307 Bacteria 20798
584 Ga0157372_10002704 3300013307 Bacteria 19172
585 Ga0157372_10010700 3300013307 Bacteria 9763
586 Ga0157372_10033620 3300013307 Bacteria 5635
587 Ga0157372_10053877 3300013307 Bacteria 4485
588 Ga0157372_10155951 3300013307 Bacteria 2637
589 Ga0157372_10180343 3300013307 Bacteria 2445
590 Ga0157372_10182645 3300013307 Bacteria 2428
591 Ga0157372_10207420 3300013307 Bacteria 2271
592 Ga0157372_10343570 3300013307 Unclassified 1739
593 Ga0157372_10666226 3300013307 Bacteria 1211
594 Ga0157372_10747764 3300013307 Bacteria 1137
595 Ga0157372_10806846 3300013307 Bacteria 1090
596 Ga0157372_10892147 3300013307 Bacteria 1032
597 Ga0157372_10965339 3300013307 Bacteria 988
598 Ga0157372_11151761 3300013307 Unclassified 897
599 Ga0157372_11257504 3300013307 Bacteria 855
600 Ga0157372_11304431 3300013307 Bacteria 838
601 Ga0157372_11474463 3300013307 Unclassified 784
602 Ga0157372_11638089 3300013307 Bacteria 741
603 Ga0157372_11715134 3300013307 Bacteria 723
604 Ga0157372_11827297 3300013307 Unclassified 699
605 Ga0157375_10000057 3300013308 Bacteria 122654
606 Ga0157375_10000336 3300013308 Bacteria 42479
607 Ga0157375_10010520 3300013308 Bacteria 8143
608 Ga0157375_10018827 3300013308 Bacteria 6267
609 Ga0157375_10050668 3300013308 Bacteria 4073
610 Ga0157375_10069395 3300013308 Bacteria 3531
611 Ga0157375_10246349 3300013308 Bacteria 1947
612 Ga0157375_10606472 3300013308 Unclassified 1253
613 Ga0157375_12011110 3300013308 Bacteria 687
614 Ga0157375_12307958 3300013308 Unclassified 641
615 Ga0157375_12964785 3300013308 Bacteria 567
616 Ga0163163_10000254 3300014325 Bacteria 54049
617 Ga0163163_10002122 3300014325 Bacteria 16737
618 Ga0163163_10009925 3300014325 Bacteria 8537
619 Ga0163163_10014392 3300014325 Bacteria 7273
620 Ga0163163_10056448 3300014325 Bacteria 3881
621 Ga0163163_10143716 3300014325 Bacteria 2429
622 Ga0163163_10147957 3300014325 Unclassified 2393
623 Ga0163163_10288780 3300014325 Bacteria 1692
624 Ga0163163_10375809 3300014325 Bacteria 1478
625 Ga0163163_10899395 3300014325 Bacteria 949
626 Ga0157380_10204970 3300014326 Bacteria 1753
627 Ga0157380_10510024 3300014326 Bacteria 1170
628 Ga0157380_12096366 3300014326 Bacteria 628
629 Ga0157380_12457421 3300014326 Bacteria 587
630 Ga0157380_12755416 3300014326 Bacteria 558
631 Ga0157380_13291951 3300014326 Unclassified 516
632 Ga0157377_10025991 3300014745 Bacteria 3128
633 Ga0157377_10119689 3300014745 Bacteria 1594
634 Ga0157377_10145828 3300014745 Bacteria 1459
635 Ga0157377_10415921 3300014745 Bacteria 919
636 Ga0157379_10000367 3300014968 Bacteria 36246
637 Ga0157379_10017665 3300014968 Bacteria 6283
638 Ga0157379_10072486 3300014968 Bacteria 3081
639 Ga0157379_10121473 3300014968 Bacteria 2350
640 Ga0157379_10301801 3300014968 Bacteria 1460
641 Ga0157379_10306440 3300014968 Bacteria 1448
642 Ga0157379_10387596 3300014968 Bacteria 1283
643 Ga0157379_10736264 3300014968 Bacteria 927
644 Ga0157379_10912218 3300014968 Bacteria 834
645 Ga0157379_11283657 3300014968 Unclassified 706
646 Ga0157376_10000135 3300014969 Bacteria 50667
647 Ga0157376_10002989 3300014969 Bacteria 11593
648 Ga0157376_10004908 3300014969 Bacteria 9323
649 Ga0157376_10007359 3300014969 Bacteria 7849
650 Ga0157376_10145446 3300014969 Bacteria 2131
651 Ga0157376_10864712 3300014969 Bacteria 920
652 Ga0157376_11266781 3300014969 Bacteria 767
653 Ga0157376_11777682 3300014969 Bacteria 652
654 Ga0157376_12124386 3300014969 Bacteria 600
655 Ga0163161_10001091 3300017792 Bacteria 20526
656 Ga0163161_10049399 3300017792 Bacteria 3040
657 Ga0163161_10049900 3300017792 Bacteria 3026
658 Ga0163161_10195228 3300017792 Bacteria 1558
659 Ga0163161_10237726 3300017792 Bacteria 1416
660 Ga0163161_10244328 3300017792 Bacteria 1397
661 Ga0163161_10437549 3300017792 Unclassified 1055
662 Ga0163161_10441963 3300017792 Bacteria 1050
663 Ga0163161_10597784 3300017792 Unclassified 909
664 Ga0163161_11078445 3300017792 Bacteria 689
665 Ga0206352_10358371 3300020078 Bacteria 1001
666 Ga0206352_11274644 3300020078 Bacteria 537
667 Ga0213876_10010098 3300021384 Bacteria 5073
668 Ga0213876_10252876 3300021384 Bacteria 936
669 Ga0224712_10240349 3300022467 Bacteria 834
670 Ga0209436_102820 3300025208 Bacteria 4937
671 Ga0209258_100068 3300025242 Bacteria 286288
672 Ga0209148_1000182 3300025254 Bacteria 123558
673 Ga0209130_1011517 3300025284 Bacteria 2365
674 Ga0209758_1041446 3300025297 Bacteria 1721
675 Ga0207426_1000051 3300025302 Bacteria 391700
676 Ga0209257_1000025 3300025304 Bacteria 724838
677 Ga0207697_10015051 3300025315 Bacteria 3201
678 Ga0207697_10049556 3300025315 Bacteria 1734
679 Ga0207656_10001696 3300025321 Bacteria 7317
680 Ga0207656_10056009 3300025321 Bacteria 1718
681 Ga0207656_10727732 3300025321 Bacteria 508
682 Ga0207682_10055094 3300025893 Bacteria 1653
683 Ga0207682_10204378 3300025893 Bacteria 909
684 Ga0207642_10013123 3300025899 Bacteria 3014
685 Ga0207642_10106315 3300025899 Unclassified 1420
686 Ga0207642_10142840 3300025899 Unclassified 1264
687 Ga0207642_10344450 3300025899 Bacteria 877
688 Ga0207642_10585982 3300025899 Bacteria 693
689 Ga0207710_10004177 3300025900 Bacteria 6337
690 Ga0207710_10037994 3300025900 Bacteria 2128
691 Ga0207688_10011930 3300025901 Bacteria 4730
692 Ga0207688_10038950 3300025901 Bacteria 2640
693 Ga0207680_10003138 3300025903 Bacteria 7759
694 Ga0207680_10007095 3300025903 Bacteria 5445
695 Ga0207680_10046316 3300025903 Bacteria 2570
696 Ga0207680_10082786 3300025903 Bacteria 2020
697 Ga0207680_10151508 3300025903 Bacteria 1546
698 Ga0207680_10441838 3300025903 Bacteria 923
699 Ga0207680_10760628 3300025903 Bacteria 694
700 Ga0207680_10767533 3300025903 Bacteria 691
701 Ga0207647_10001743 3300025904 Bacteria 16673
702 Ga0207647_10064282 3300025904 Unclassified 2230
703 Ga0207647_10150160 3300025904 Bacteria 1362
704 Ga0207647_10370806 3300025904 Unclassified 809
705 Ga0207647_10783084 3300025904 Bacteria 514
706 Ga0207685_10272782 3300025905 Unclassified 827
707 Ga0207645_10000511 3300025907 Bacteria 32164
708 Ga0207645_10008172 3300025907 Bacteria 7327
709 Ga0207645_10012027 3300025907 Bacteria 5885
710 Ga0207645_10388370 3300025907 Bacteria 938
711 Ga0207645_10528136 3300025907 Bacteria 800
712 Ga0207645_10558431 3300025907 Bacteria 777
713 Ga0207643_10026488 3300025908 Bacteria 3210
714 Ga0207643_10056780 3300025908 Bacteria 2227
715 Ga0207643_10081881 3300025908 Bacteria 1871
716 Ga0207643_10297520 3300025908 Bacteria 1004
717 Ga0207705_10036694 3300025909 Bacteria 3507
718 Ga0207705_10570424 3300025909 Bacteria 880
719 Ga0207705_11292748 3300025909 Unclassified 557
720 Ga0207654_10001646 3300025911 Bacteria 11680
721 Ga0207654_10466305 3300025911 Bacteria 888
722 Ga0207707_10273176 3300025912 Unclassified 1465
723 Ga0207695_10000327 3300025913 Bacteria 113436
724 Ga0207695_10008726 3300025913 Bacteria 12639
725 Ga0207695_10014855 3300025913 Bacteria 9194
726 Ga0207695_10038067 3300025913 Bacteria 5184
727 Ga0207695_10091500 3300025913 Bacteria 3056
728 Ga0207695_10253982 3300025913 Bacteria 1657
729 Ga0207695_10513036 3300025913 Unclassified 1081
730 Ga0207695_11461794 3300025913 Bacteria 564
731 Ga0207671_10001643 3300025914 Bacteria 25455
732 Ga0207671_10004018 3300025914 Bacteria 14291
733 Ga0207671_10045170 3300025914 Bacteria 3257
734 Ga0207671_10081617 3300025914 Bacteria 2425
735 Ga0207671_10174218 3300025914 Bacteria 1672
736 Ga0207671_10485760 3300025914 Unclassified 984
737 Ga0207671_10922461 3300025914 Bacteria 690
738 Ga0207662_10054739 3300025918 Bacteria 2380
739 Ga0207662_10310070 3300025918 Bacteria 1051
740 Ga0207662_11178037 3300025918 Unclassified 545
741 Ga0207657_10338621 3300025919 Bacteria 1187
742 Ga0207657_10507349 3300025919 Bacteria 945
743 Ga0207657_11035826 3300025919 Unclassified 629
744 Ga0207649_10006464 3300025920 Bacteria 6364
745 Ga0207649_10071361 3300025920 Bacteria 2218
746 Ga0207649_10184783 3300025920 Bacteria 1462
747 Ga0207649_10344844 3300025920 Bacteria 1101
748 Ga0207649_10418536 3300025920 Bacteria 1006
749 Ga0207649_10478018 3300025920 Bacteria 944
750 Ga0207681_10074867 3300025923 Unclassified 2373
751 Ga0207681_10078607 3300025923 Bacteria 2322
752 Ga0207681_10444946 3300025923 Unclassified 1053
753 Ga0207681_11495350 3300025923 Unclassified 566
754 Ga0207681_11504358 3300025923 Bacteria 564
755 Ga0207694_10131982 3300025924 Bacteria 2003
756 Ga0207694_11282988 3300025924 Bacteria 619
757 Ga0207650_10004888 3300025925 Bacteria 9154
758 Ga0207650_10009769 3300025925 Bacteria 6560
759 Ga0207650_10035323 3300025925 Bacteria 3628
760 Ga0207650_10046883 3300025925 Bacteria 3184
761 Ga0207650_10195957 3300025925 Unclassified 1616
762 Ga0207650_10304815 3300025925 Unclassified 1302
763 Ga0207650_10476708 3300025925 Bacteria 1041
764 Ga0207650_11174515 3300025925 Unclassified 653
765 Ga0207650_11268940 3300025925 Unclassified 627
766 Ga0207650_11379496 3300025925 Unclassified 600
767 Ga0207650_11671015 3300025925 Unclassified 540
768 Ga0207659_10033631 3300025926 Bacteria 3531
769 Ga0207659_10034049 3300025926 Bacteria 3510
770 Ga0207659_10056438 3300025926 Bacteria 2813
771 Ga0207659_10325690 3300025926 Bacteria 1269
772 Ga0207659_10743268 3300025926 Bacteria 841
773 Ga0207659_11405584 3300025926 Bacteria 598
774 Ga0207659_11497129 3300025926 Bacteria 577
775 Ga0207687_11396149 3300025927 Bacteria 602
776 Ga0207644_10005002 3300025931 Bacteria 8653
777 Ga0207644_10062124 3300025931 Bacteria 2708
778 Ga0207644_10946104 3300025931 Bacteria 722
779 Ga0207690_10096270 3300025932 Bacteria 2104
780 Ga0207706_10003803 3300025933 Bacteria 14383
781 Ga0207706_10007905 3300025933 Bacteria 9817
782 Ga0207706_10023224 3300025933 Bacteria 5570
783 Ga0207706_10345305 3300025933 Bacteria 1294
784 Ga0207706_10483715 3300025933 Unclassified 1069
785 Ga0207706_10921640 3300025933 Bacteria 737
786 Ga0207706_11348327 3300025933 Bacteria 588
787 Ga0207686_10058398 3300025934 Bacteria 2432
788 Ga0207686_10118317 3300025934 Bacteria 1799
789 Ga0207686_10146299 3300025934 Bacteria 1639
790 Ga0207686_10694100 3300025934 Bacteria 809
791 Ga0207686_11095800 3300025934 Unclassified 649
792 Ga0207709_10649030 3300025935 Bacteria 840
793 Ga0207670_10004881 3300025936 Bacteria 7291
794 Ga0207670_10459853 3300025936 Bacteria 1027
795 Ga0207670_10613974 3300025936 Unclassified 894
796 Ga0207670_10641953 3300025936 Bacteria 875
797 Ga0207669_10272319 3300025937 Bacteria 1272
798 Ga0207669_10319550 3300025937 Bacteria 1188
799 Ga0207669_10481243 3300025937 Unclassified 989
800 Ga0207669_10602284 3300025937 Bacteria 893
801 Ga0207704_10000484 3300025938 Bacteria 17750
802 Ga0207704_10026162 3300025938 Bacteria 3197
803 Ga0207704_10184786 3300025938 Bacteria 1510
804 Ga0207704_10601514 3300025938 Unclassified 900
805 Ga0207704_11720276 3300025938 Bacteria 539
806 Ga0207665_10160926 3300025939 Bacteria 1615
807 Ga0207691_10002120 3300025940 Bacteria 19396
808 Ga0207691_10012396 3300025940 Bacteria 8172
809 Ga0207691_10049241 3300025940 Bacteria 3860
810 Ga0207691_10093127 3300025940 Bacteria 2698
811 Ga0207691_10165772 3300025940 Bacteria 1936
812 Ga0207691_10166536 3300025940 Bacteria 1931
813 Ga0207691_10281088 3300025940 Unclassified 1432
814 Ga0207691_10322463 3300025940 Bacteria 1324
815 Ga0207691_10331549 3300025940 Bacteria 1304
816 Ga0207691_10450743 3300025940 Unclassified 1095
817 Ga0207691_10811208 3300025940 Bacteria 786
818 Ga0207711_10096985 3300025941 Bacteria 2603
819 Ga0207711_10463167 3300025941 Bacteria 1180
820 Ga0207711_10984058 3300025941 Bacteria 783
821 Ga0207711_11697046 3300025941 Unclassified 575
822 Ga0207689_10002405 3300025942 Bacteria 17429
823 Ga0207689_10010393 3300025942 Bacteria 8016
824 Ga0207689_10015655 3300025942 Bacteria 6422
825 Ga0207689_10019942 3300025942 Bacteria 5646
826 Ga0207689_10021007 3300025942 Bacteria 5487
827 Ga0207689_10021416 3300025942 Bacteria 5435
828 Ga0207689_10050087 3300025942 Bacteria 3445
829 Ga0207689_10073362 3300025942 Unclassified 2811
830 Ga0207689_10268307 3300025942 Bacteria 1413
831 Ga0207689_10333242 3300025942 Bacteria 1260
832 Ga0207689_10486626 3300025942 Unclassified 1033
833 Ga0207689_10781778 3300025942 Bacteria 806
834 Ga0207661_10015999 3300025944 Bacteria 5529
835 Ga0207661_10020712 3300025944 Bacteria 4920
836 Ga0207661_10059632 3300025944 Bacteria 3076
837 Ga0207661_10069730 3300025944 Bacteria 2867
838 Ga0207661_11366855 3300025944 Bacteria 650
839 Ga0207679_10001121 3300025945 Bacteria 17095
840 Ga0207679_10002674 3300025945 Bacteria 11004
841 Ga0207679_10049169 3300025945 Bacteria 3075
842 Ga0207679_10065635 3300025945 Bacteria 2717
843 Ga0207679_10070822 3300025945 Bacteria 2628
844 Ga0207679_10083573 3300025945 Bacteria 2447
845 Ga0207679_10108491 3300025945 Bacteria 2186
846 Ga0207679_10669751 3300025945 Bacteria 940
847 Ga0207679_11092845 3300025945 Unclassified 732
848 Ga0207667_10000340 3300025949 Bacteria 63904
849 Ga0207667_10009409 3300025949 Bacteria 11510
850 Ga0207667_10037270 3300025949 Bacteria 5199
851 Ga0207667_10544960 3300025949 Unclassified 1174
852 Ga0207651_10002824 3300025960 Bacteria 8358
853 Ga0207651_10015789 3300025960 Bacteria 4401
854 Ga0207651_10043110 3300025960 Unclassified 3009
855 Ga0207651_10043279 3300025960 Unclassified 3004
856 Ga0207651_10199654 3300025960 Bacteria 1602
857 Ga0207651_10216028 3300025960 Bacteria 1547
858 Ga0207651_10303453 3300025960 Unclassified 1328
859 Ga0207651_10934214 3300025960 Bacteria 773
860 Ga0207651_11668378 3300025960 Unclassified 574
861 Ga0207651_11798250 3300025960 Bacteria 551
862 Ga0207712_10003520 3300025961 Bacteria 9888
863 Ga0207712_10009397 3300025961 Bacteria 6186
864 Ga0207712_10011683 3300025961 Bacteria 5598
865 Ga0207712_10012015 3300025961 Bacteria 5526
866 Ga0207712_10018240 3300025961 Bacteria 4568
867 Ga0207712_10072670 3300025961 Bacteria 2478
868 Ga0207712_10115094 3300025961 Bacteria 2024
869 Ga0207712_10372915 3300025961 Bacteria 1192
870 Ga0207712_11314512 3300025961 Bacteria 646
871 Ga0207668_10001106 3300025972 Bacteria 16044
872 Ga0207668_10098164 3300025972 Bacteria 2170
873 Ga0207668_10244856 3300025972 Bacteria 1453
874 Ga0207668_10648319 3300025972 Bacteria 924
875 Ga0207668_10943000 3300025972 Bacteria 769
876 Ga0207640_10130502 3300025981 Bacteria 1816
877 Ga0207640_10156691 3300025981 Bacteria 1680
878 Ga0207640_10613137 3300025981 Unclassified 923
879 Ga0207640_11521754 3300025981 Bacteria 601
880 Ga0207640_11695298 3300025981 Bacteria 570
881 Ga0207658_10000847 3300025986 Bacteria 25559
882 Ga0207658_10010360 3300025986 Bacteria 6333
883 Ga0207658_10013966 3300025986 Bacteria 5496
884 Ga0207658_10036244 3300025986 Bacteria 3536
885 Ga0207658_10244463 3300025986 Unclassified 1522
886 Ga0207658_10422049 3300025986 Bacteria 1176
887 Ga0207658_10452056 3300025986 Bacteria 1137
888 Ga0207658_11014068 3300025986 Bacteria 757
889 Ga0207658_11101403 3300025986 Unclassified 725
890 Ga0207658_11332155 3300025986 Bacteria 656
891 Ga0207677_10001136 3300026023 Bacteria 14521
892 Ga0207677_10007895 3300026023 Bacteria 5915
893 Ga0207677_10053438 3300026023 Bacteria 2750
894 Ga0207677_10104847 3300026023 Bacteria 2091
895 Ga0207677_10118524 3300026023 Bacteria 1986
896 Ga0207677_10496489 3300026023 Bacteria 1054
897 Ga0207677_10535892 3300026023 Unclassified 1018
898 Ga0207677_10580982 3300026023 Unclassified 981
899 Ga0207703_10010768 3300026035 Bacteria 7135
900 Ga0207703_10648914 3300026035 Unclassified 1001
901 Ga0207703_10726598 3300026035 Bacteria 945
902 Ga0207703_10804331 3300026035 Bacteria 897
903 Ga0207703_10928050 3300026035 Bacteria 834
904 Ga0207703_11002670 3300026035 Bacteria 801
905 Ga0207703_11140025 3300026035 Bacteria 749
906 Ga0207703_12249299 3300026035 Bacteria 521
907 Ga0207639_10083200 3300026041 Bacteria 2539
908 Ga0207639_10308490 3300026041 Bacteria 1401
909 Ga0207639_10379234 3300026041 Unclassified 1269
910 Ga0207639_10398512 3300026041 Bacteria 1239
911 Ga0207639_10526364 3300026041 Bacteria 1083
912 Ga0207639_10828455 3300026041 Bacteria 863
913 Ga0207639_11032459 3300026041 Bacteria 770
914 Ga0207639_11218910 3300026041 Bacteria 706
915 Ga0207639_11493536 3300026041 Bacteria 634
916 Ga0207639_12132462 3300026041 Bacteria 522
917 Ga0207678_10199143 3300026067 Unclassified 1712
918 Ga0207678_10395394 3300026067 Bacteria 1196
919 Ga0207678_10592582 3300026067 Bacteria 971
920 Ga0207678_10607373 3300026067 Unclassified 959
921 Ga0207678_10685741 3300026067 Bacteria 901
922 Ga0207678_10689552 3300026067 Unclassified 899
923 Ga0207678_11039657 3300026067 Bacteria 725
924 Ga0207678_11300917 3300026067 Bacteria 643
925 Ga0207678_11863662 3300026067 Bacteria 525
926 Ga0207708_10357458 3300026075 Bacteria 1200
927 Ga0207708_10525593 3300026075 Unclassified 995
928 Ga0207702_10417315 3300026078 Bacteria 1297
929 Ga0207702_10748205 3300026078 Bacteria 965
930 Ga0207702_11429131 3300026078 Bacteria 685
931 Ga0207641_10000418 3300026088 Bacteria 49680
932 Ga0207641_10004489 3300026088 Bacteria 12072
933 Ga0207641_10143228 3300026088 Bacteria 2159
934 Ga0207641_10326368 3300026088 Unclassified 1457
935 Ga0207641_10851373 3300026088 Unclassified 904
936 Ga0207641_11122046 3300026088 Bacteria 785
937 Ga0207641_11432600 3300026088 Bacteria 692
938 Ga0207641_11645497 3300026088 Bacteria 644
939 Ga0207641_12038058 3300026088 Unclassified 575
940 Ga0207641_12570089 3300026088 Bacteria 507
941 Ga0207641_12618480 3300026088 Bacteria 502
942 Ga0207648_10001186 3300026089 Bacteria 29157
943 Ga0207648_10013975 3300026089 Bacteria 7442
944 Ga0207648_10051259 3300026089 Bacteria 3607
945 Ga0207648_10059395 3300026089 Bacteria 3335
946 Ga0207648_10086258 3300026089 Bacteria 2739
947 Ga0207648_10160349 3300026089 Bacteria 1986
948 Ga0207648_10308727 3300026089 Unclassified 1420
949 Ga0207648_10397334 3300026089 Bacteria 1248
950 Ga0207648_10537985 3300026089 Unclassified 1072
951 Ga0207648_11453593 3300026089 Bacteria 644
952 Ga0207648_11922026 3300026089 Bacteria 553
953 Ga0207648_12010344 3300026089 Unclassified 539
954 Ga0207676_10013981 3300026095 Bacteria 5762
955 Ga0207676_10184534 3300026095 Bacteria 1830
956 Ga0207676_10299451 3300026095 Bacteria 1468
957 Ga0207676_10332248 3300026095 Bacteria 1399
958 Ga0207676_11364470 3300026095 Bacteria 704
959 Ga0207676_12609778 3300026095 Bacteria 501
960 Ga0207674_10012911 3300026116 Bacteria 9316
961 Ga0207674_10013730 3300026116 Bacteria 8966
962 Ga0207674_10101039 3300026116 Unclassified 2865
963 Ga0207674_10146034 3300026116 Bacteria 2324
964 Ga0207674_10153470 3300026116 Bacteria 2259
965 Ga0207674_10439326 3300026116 Bacteria 1261
966 Ga0207674_10558402 3300026116 Bacteria 1106
967 Ga0207674_11334436 3300026116 Bacteria 687
968 Ga0207675_100018406 3300026118 Bacteria 6513
969 Ga0207675_100073850 3300026118 Unclassified 3191
970 Ga0207675_100083470 3300026118 Bacteria 2996
971 Ga0207675_100106426 3300026118 Bacteria 2644
972 Ga0207675_100229221 3300026118 Bacteria 1792
973 Ga0207675_100293606 3300026118 Bacteria 1582
974 Ga0207675_100578976 3300026118 Unclassified 1124
975 Ga0207675_100605670 3300026118 Bacteria 1099
976 Ga0207675_100826956 3300026118 Unclassified 940
977 Ga0207675_101919330 3300026118 Bacteria 610
978 Ga0207683_10005675 3300026121 Bacteria 10702
979 Ga0207683_10031869 3300026121 Bacteria 4577
980 Ga0207683_10060923 3300026121 Bacteria 3319
981 Ga0207683_10063612 3300026121 Bacteria 3250
982 Ga0207683_10226237 3300026121 Bacteria 1705
983 Ga0207683_10248030 3300026121 Bacteria 1624
984 Ga0207698_10020032 3300026142 Bacteria 4596
985 Ga0207698_10070584 3300026142 Bacteria 2768
986 Ga0207698_10076391 3300026142 Bacteria 2681
987 Ga0207698_10225207 3300026142 Bacteria 1698
988 Ga0207698_10539586 3300026142 Unclassified 1141
989 Ga0207698_10792905 3300026142 Unclassified 949
990 Ga0207698_10832350 3300026142 Bacteria 927
991 Ga0207698_10871467 3300026142 Bacteria 906
992 Ga0207698_11635413 3300026142 Bacteria 659
993 Ga0207698_11955835 3300026142 Bacteria 601
994 Ga0209981_1025019 3300027378 Bacteria 863
995 Ga0209984_1031578 3300027424 Bacteria 749
996 Ga0209995_1011784 3300027471 Bacteria 1423
997 Ga0209968_1056776 3300027526 Unclassified 686
998 Ga0209968_1082126 3300027526 Bacteria 580
999 Ga0209999_1026399 3300027543 Bacteria 1074
1000 Ga0210002_1047950 3300027617 Bacteria 733
1001 Ga0209974_10168124 3300027876 Bacteria 798
1002 Ga0209974_10230101 3300027876 Bacteria 692
1003 Ga0207428_10371385 3300027907 Unclassified 1050
1004 Ga0207428_10640257 3300027907 Bacteria 764
1005 Ga0207428_10715529 3300027907 Bacteria 715
1006 Ga0268266_10000034 3300028379 Bacteria 354251
1007 Ga0268266_10002645 3300028379 Bacteria 18878
1008 Ga0268266_10037874 3300028379 Bacteria 4106
1009 Ga0268266_10041488 3300028379 Bacteria 3927
1010 Ga0268265_10418024 3300028380 Bacteria 1244
1011 Ga0268265_11843614 3300028380 Unclassified 611
1012 Ga0268265_12091992 3300028380 Bacteria 573
1013 Ga0268265_12490657 3300028380 Bacteria 523
1014 Ga0268264_10000117 3300028381 Bacteria 195037
1015 Ga0268264_10000739 3300028381 Bacteria 37219
1016 Ga0268264_10007632 3300028381 Bacteria 9016
1017 Ga0268264_10045709 3300028381 Bacteria 3636
1018 Ga0268264_10125122 3300028381 Bacteria 2271
1019 Ga0268264_10157121 3300028381 Bacteria 2045
1020 Ga0268264_10360793 3300028381 Bacteria 1386
1021 Ga0268264_10537925 3300028381 Unclassified 1144
1022 Ga0268264_10553839 3300028381 Bacteria 1128
1023 Ga0268264_10740900 3300028381 Bacteria 978
1024 Ga0268264_10814069 3300028381 Bacteria 934
1025 Ga0268264_11237682 3300028381 Bacteria 756
1026 Ga0307517_10075365 3300028786 Bacteria 2960
1027 Ga0307517_10097860 3300028786 Bacteria 2339
1028 Ga0307517_10278037 3300028786 Bacteria 957
1029 Ga0265324_10197047 3300029957 Bacteria 684
1030 Ga0307511_10000153 3300030521 Bacteria 65598
1031 Ga0265340_10138071 3300031247 Bacteria 1116
1032 Ga0265327_10220582 3300031251 Bacteria 853
1033 Ga0307513_10337849 3300031456 Bacteria 1258
1034 Ga0307513_10596328 3300031456 Bacteria 814
1035 Ga0307509_10590973 3300031507 Bacteria 784
1036 Ga0307408_100040477 3300031548 Bacteria 3300
1037 Ga0265313_10089316 3300031595 Bacteria 1386
1038 Ga0307516_10013017 3300031730 Bacteria 8908
1039 Ga0307516_10101287 3300031730 Unclassified 2696
1040 Ga0307405_10310771 3300031731 Bacteria 1200
1041 Ga0307405_11333177 3300031731 Bacteria 625
1042 Ga0307413_10267875 3300031824 Bacteria 1277
1043 Ga0307413_10583886 3300031824 Bacteria 912
1044 Ga0307518_10570043 3300031838 Unclassified 553
1045 Ga0307410_10031519 3300031852 Bacteria 3403
1046 Ga0307410_10062277 3300031852 Bacteria 2556
1047 Ga0307406_10305366 3300031901 Bacteria 1224
1048 Ga0307407_10028144 3300031903 Bacteria 3001
1049 Ga0307412_10304404 3300031911 Bacteria 1261
1050 Ga0307409_101743126 3300031995 Bacteria 652
1051 Ga0307416_100031968 3300032002 Bacteria 3970
1052 Ga0307416_100181822 3300032002 Bacteria 1972
1053 Ga0307416_102050099 3300032002 Bacteria 674
1054 Ga0307414_10237961 3300032004 Bacteria 1505
1055 Ga0307414_11328522 3300032004 Bacteria 667
1056 Ga0307411_10650473 3300032005 Bacteria 912
1057 Ga0307411_11348200 3300032005 Bacteria 651
1058 Ga0307415_100120477 3300032126 Bacteria 1966
1059 Ga0307415_102047549 3300032126 Unclassified 558
1060 Ga0307510_10000191 3300033180 Bacteria 53108
1061 Ga0307510_10223308 3300033180 Bacteria 1393
1062 Ga0373934_0284889 3300035086 Bacteria 684
1063 Ga0373936_0156366 3300035113 Bacteria 991
1064 Ga0373945_0296781 3300035116 Bacteria 691
1065 Ga0373953_0170263 3300035117 Bacteria 937
1066 Ga0373953_0240197 3300035117 Bacteria 786
1067 Ga0373954_0212408 3300035118 Bacteria 951
1068 Ga0373954_0661935 3300035118 Bacteria 518
1069 Ga0373956_0098657 3300035119 Bacteria 1353
1070 Ga0373957_0368098 3300035120 Bacteria 615
1071 Ga0373943_0357336 3300035170 Bacteria 838
1072 Ga0373943_0695050 3300035170 Unclassified 602
1073 Ga0373946_0052222 3300035171 Bacteria 1714
1074 Ga0373955_0004303 3300035172 Bacteria 6290
1075 Ga0373955_0141242 3300035172 Bacteria 1412
1076 Ga0373924_0018853 3300035410 Bacteria 2666
1077 Ga0373924_0129571 3300035410 Bacteria 1097
1078 Ga0373935_0101981 3300035692 Bacteria 1893
1079 Ga0373935_0548261 3300035692 Unclassified 843
1080 Ga0373933_0027963 3300035724 Bacteria 3251
1081 Ga0373933_0515849 3300035724 Bacteria 783
1082 Ga0373933_0534008 3300035724 Unclassified 769
1083 Ga0373947_0206812 3300035725 Bacteria 1286
1084 Ga0373937_0100271 3300036401 Bacteria 2687
1085 Ga0373937_0113245 3300036401 Bacteria 2524
1086 Ga0373937_0152449 3300036401 Bacteria 2165
1087 Ga0373937_0267166 3300036401 Bacteria 1614
1088 Ga0373937_1212067 3300036401 Bacteria 703
1089 Ga0265778_056678 3300036457 Bacteria 543
1090 Ga0373925_0863719 3300037068 Bacteria 746
1091 Ga0373925_0876141 3300037068 Bacteria 740
1092 Ga0373925_1713577 3300037068 Bacteria 513
1093 Ga0395899_0533335 3300037312 Bacteria 757
1094 Ga0395898_0202872 3300037466 Bacteria 1893
1095 Ga0395905_0000527 3300037471 Bacteria 52435
1096 Ga0395905_0432429 3300037471 Bacteria 1213
1097 Ga0395905_0595596 3300037471 Unclassified 1007
1098 Ga0395905_1056098 3300037471 Bacteria 715
1099 Ga0395901_0256467 3300038443 Bacteria 1821
1100 Ga0436365_1161343 3300039437 Bacteria 9975
1101 Ga0436365_1410658 3300039437 Bacteria 1467
1102 Ga0436363_1230165 3300039450 Bacteria 570
1103 Ga0439436_0000773 3300041404 Bacteria 8667
1104 Ga0439436_0061468 3300041404 Bacteria 1052
1105 Ga0439436_0084115 3300041404 Bacteria 886
1106 Ga0439439_0016397 3300041406 Bacteria 1814
1107 Ga0439439_0069573 3300041406 Bacteria 941
1108 Ga0439453_0046775 3300041408 Bacteria 864
1109 Ga0439465_0024662 3300041413 Bacteria 1896
1110 Ga0451789_0607989 3300041443 Bacteria 1052
1111 Ga0451789_1128496 3300041443 Bacteria 621
1112 Ga0451790_23413 3300041444 Bacteria 615
1113 Ga0451797_0944792 3300041453 Bacteria 525
1114 Ga0451805_117129 3300041461 Bacteria 753
1115 Ga0451807_1591963 3300041486 Unclassified 629
1116 Ga0451807_2561754 3300041486 Bacteria 872
1117 Ga0451837_1423970 3300041494 Bacteria 506
1118 Ga0451847_0237332 3300041503 Bacteria 655
1119 Ga0451855_0970425 3300041511 Bacteria 580
1120 Ga0451853_1110616 3300041512 Bacteria 815
1121 Ga0451853_2649306 3300041512 Bacteria 1154
1122 Ga0451853_3714240 3300041512 Unclassified 571
1123 Ga0439433_0050987 3300041999 Bacteria 976
1124 Ga0439449_0004545 3300042007 Bacteria 5359
1125 Ga0439449_0015374 3300042007 Bacteria 2875
1126 Ga0439449_0280988 3300042007 Bacteria 627
1127 Ga0439457_000175 3300042014 Bacteria 16689
1128 Ga0439457_003006 3300042014 Bacteria 4686
1129 Ga0439457_027556 3300042014 Bacteria 1258
1130 Ga0439462_0031419 3300042015 Bacteria 1406
1131 Ga0439444_0149920 3300042437 Unclassified 563
1132 Ga0439459_0191789 3300042438 Unclassified 554
1133 Ga0451577_0090941 3300042876 Bacteria 2724
1134 Ga0466969_0064878 3300044656 Bacteria 1767
1135 Ga0466972_0000782 3300044658 Bacteria 15085
1136 Ga0466972_0223006 3300044658 Bacteria 882
1137 Ga0466972_0322658 3300044658 Bacteria 722
1138 Ga0453683_0646177 3300044673 Unclassified 691
1139 Ga0453683_0734579 3300044673 Unclassified 648
1140 Ga0466965_0064770 3300044683 Unclassified 1830
1141 Ga0466965_0536104 3300044683 Unclassified 660
1142 Ga0453684_0130453 3300044712 Bacteria 3016
1143 Ga0453684_0210816 3300044712 Bacteria 2258
1144 Ga0453684_0213439 3300044712 Bacteria 2241
1145 Ga0453684_0579157 3300044712 Unclassified 1233
1146 Ga0453684_1780334 3300044712 Bacteria 627
1147 Ga0466971_0018466 3300044719 Bacteria 3089
1148 Ga0466968_0006371 3300044735 Bacteria 4445
1149 Ga0466970_0097553 3300044765 Bacteria 1599
1150 Ga0466970_0145604 3300044765 Bacteria 1306
1151 Ga0466957_0081791 3300044842 Bacteria 2012
1152 Ga0466957_0863054 3300044842 Bacteria 645
1153 Ga0466959_0004300 3300045049 Bacteria 9505
1154 Ga0466959_0033132 3300045049 Bacteria 3822
1155 Ga0466959_0114695 3300045049 Bacteria 1920
1156 Ga0451576_0579263 3300045051 Bacteria 1179
1157 Ga0451576_1002077 3300045051 Bacteria 875
1158 Ga0451576_1271054 3300045051 Unclassified 768
1159 Ga0451576_2516393 3300045051 Bacteria 526
1160 Ga0466967_2121513 3300045976 Bacteria 558
1161 Ga0495627_035808 3300046453 Bacteria 1545
1162 Ga0495592_0063149 3300046454 Bacteria 2717
1163 Ga0495603_0639279 3300046455 Bacteria 609
1164 Ga0495603_0790340 3300046455 Bacteria 541
1165 Ga0495629_0027491 3300046459 Bacteria 4039
1166 Ga0495638_0616263 3300046460 Bacteria 531
1167 Ga0495651_0446326 3300046462 Bacteria 837
1168 Ga0495653_0101732 3300046463 Bacteria 2081
1169 Ga0495653_0175749 3300046463 Bacteria 1474
1170 Ga0495650_0055028 3300046471 Bacteria 1621
1171 Ga0495580_0102092 3300046472 Bacteria 1994
1172 Ga0495580_0238353 3300046472 Unclassified 1248
1173 Ga0495582_0030486 3300046473 Bacteria 2961
1174 Ga0495639_0228734 3300046475 Unclassified 916
1175 Ga0495594_0530767 3300046499 Bacteria 668
1176 Ga0495606_0164734 3300046507 Bacteria 1290
1177 Ga0495608_0426579 3300046511 Bacteria 809
1178 Ga0495618_0076337 3300046514 Bacteria 2135
1179 Ga0495628_0028725 3300046516 Bacteria 4517
1180 Ga0495628_0851680 3300046516 Bacteria 635
1181 Ga0495630_0019380 3300046517 Bacteria 5000
1182 Ga0495630_0936083 3300046517 Bacteria 659
1183 Ga0495630_0954690 3300046517 Bacteria 652
1184 Ga0495648_0002156 3300046524 Bacteria 18542
1185 Ga0495652_0171524 3300046529 Bacteria 1674
1186 Ga0495652_0209637 3300046529 Bacteria 1472
1187 Ga0495640_0698324 3300046533 Bacteria 609
1188 Ga0495586_0026118 3300046535 Bacteria 3125
1189 Ga0495586_0527390 3300046535 Bacteria 682
1190 Ga0495587_0047198 3300046536 Bacteria 2554
1191 Ga0495587_0051874 3300046536 Bacteria 2423
1192 Ga0495645_0177184 3300046543 Bacteria 1463
1193 Ga0495645_0863827 3300046543 Unclassified 539
1194 Ga0495622_0035324 3300046557 Bacteria 2331
1195 Ga0495622_0054440 3300046557 Bacteria 1856
1196 Ga0495633_0000058 3300046558 Bacteria 147584
1197 Ga0495633_0033010 3300046558 Bacteria 2498
1198 Ga0495667_0137316 3300046559 Bacteria 1576
1199 Ga0495667_0420386 3300046559 Bacteria 841
1200 Ga0495667_0517903 3300046559 Bacteria 746
1201 Ga0495668_0001368 3300046616 Bacteria 23908
1202 Ga0495611_0001667 3300046648 Bacteria 10769
1203 Ga0495625_0547287 3300046660 Bacteria 701
1204 Ga0495635_0053001 3300046663 Bacteria 2795
1205 Ga0495661_0207894 3300046665 Bacteria 1021
1206 Ga0495657_0756930 3300046675 Bacteria 556
1207 Ga0495599_0120173 3300046678 Bacteria 1634
1208 Ga0495623_0328171 3300046679 Bacteria 838
1209 Ga0495646_0515539 3300046680 Unclassified 613
1210 Ga0495647_0009671 3300046681 Bacteria 3271
1211 Ga0495658_0003503 3300046683 Bacteria 7765
1212 Ga0495613_0336152 3300046689 Bacteria 1040
1213 Ga0495613_0860336 3300046689 Unclassified 589
1214 Ga0495613_0872876 3300046689 Bacteria 584
1215 Ga0495670_0108311 3300046691 Bacteria 1436
1216 Ga0495671_0630112 3300046692 Unclassified 510
1217 Ga0495649_0039065 3300046694 Bacteria 2602
1218 Ga0495600_0167120 3300046809 Bacteria 1421
1219 Ga0495600_0350565 3300046809 Unclassified 925
1220 Ga0495660_0313076 3300046810 Bacteria 708
1221 Ga0495581_0634855 3300047315 Unclassified 618
1222 Ga0495604_0402380 3300047317 Bacteria 901
1223 Ga0495674_0030231 3300047319 Bacteria 4927
1224 Ga0495674_0141904 3300047319 Bacteria 2019
1225 Ga0495672_0008108 3300047320 Bacteria 7801
1226 Ga0495680_0045605 3300047322 Bacteria 3461
1227 Ga0495687_000079 3300047443 Bacteria 147704
1228 Ga0495675_0281079 3300047444 Bacteria 992
1229 Ga0495675_0548526 3300047444 Bacteria 659
1230 Ga0495684_0345329 3300047471 Bacteria 1058
1231 Ga0495684_0830947 3300047471 Unclassified 601
1232 Ga0495686_0000041 3300047472 Bacteria 297599
1233 Ga0495686_0163358 3300047472 Bacteria 1300
1234 Ga0495593_0258546 3300047673 Unclassified 872
1235 Ga0495602_0260725 3300048088 Bacteria 1286
1236 Ga0495615_0260881 3300048090 Bacteria 552
1237 Ga0496101_0029522 3300048904 Bacteria 3836
1238 Ga0496101_0086909 3300048904 Bacteria 2320
1239 Ga0496102_1484329 3300048905 Unclassified 597
1240 Ga0496104_0311247 3300048907 Bacteria 1488
1241 Ga0496104_0520494 3300048907 Bacteria 1101
1242 Ga0496104_0564189 3300048907 Bacteria 1049
1243 Ga0496104_0602241 3300048907 Bacteria 1009
1244 Ga0496104_0823960 3300048907 Bacteria 834
1245 Ga0496104_1187524 3300048907 Bacteria 666
1246 Ga0496105_0313901 3300048908 Bacteria 1258
1247 Ga0496105_0636435 3300048908 Bacteria 824
1248 Ga0496105_1023385 3300048908 Unclassified 617
1249 Ga0496106_0192553 3300048909 Bacteria 1622
1250 Ga0496106_0931880 3300048909 Bacteria 685
1251 Ga0496108_0519843 3300048911 Bacteria 1039
1252 Ga0496108_0791172 3300048911 Bacteria 819
1253 Ga0496109_0202796 3300048912 Bacteria 1865
1254 Ga0496110_0579487 3300048913 Unclassified 1019
1255 Ga0496111_0147300 3300048914 Unclassified 1746
1256 Ga0496111_0257821 3300048914 Unclassified 1294
1257 Ga0496114_1551099 3300048917 Unclassified 550
1258 Ga0496114_1671387 3300048917 Bacteria 525
1259 Ga0496115_0111602 3300048918 Bacteria 2247
1260 Ga0496126_0115249 3300048929 Bacteria 2337
1261 Ga0501306_006749 3300049127 Unclassified 1357
1262 Ga0501306_031891 3300049127 Bacteria 787
1263 Ga0501308_005356 3300049128 Unclassified 1274
1264 Ga0501308_023797 3300049128 Bacteria 784
1265 Ga0501309_026641 3300049129 Bacteria 836
1266 Ga0501343_022051 3300049132 Bacteria 566
1267 Ga0501304_006136 3300049160 Bacteria 962
1268 Ga0501304_016374 3300049160 Bacteria 701
1269 Ga0501305_009096 3300049161 Unclassified 1299
1270 Ga0501305_107732 3300049161 Bacteria 524
1271 Ga0501307_023769 3300049162 Bacteria 814
1272 Ga0501292_073265 3300049515 Bacteria 640
1273 Ga0501311_003025 3300049527 Bacteria 1677
1274 Ga0501311_035594 3300049527 Bacteria 737
1275 Ga0501312_042569 3300049528 Bacteria 746
1276 Ga0501312_108295 3300049528 Bacteria 528
1277 Ga0501313_024232 3300049529 Bacteria 763
1278 Ga0501314_033862 3300049530 Bacteria 577
1279 Ga0501314_042373 3300049530 Bacteria 534
1280 Ga0501315_035010 3300049531 Bacteria 739
1281 Ga0501315_055171 3300049531 Bacteria 632
1282 Ga0501316_017821 3300049532 Bacteria 874
1283 Ga0501316_028864 3300049532 Bacteria 734
1284 Ga0501317_024362 3300049533 Bacteria 841
1285 Ga0501317_056761 3300049533 Bacteria 634
1286 Ga0501319_002395 3300049535 Bacteria 1184
1287 Ga0501320_011532 3300049536 Bacteria 917
1288 Ga0501320_049111 3300049536 Bacteria 571
1289 Ga0501320_057587 3300049536 Bacteria 541
1290 Ga0501321_034190 3300049537 Bacteria 692
1291 Ga0501323_073342 3300049539 Unclassified 550
1292 Ga0501323_081965 3300049539 Bacteria 528
1293 Ga0501324_036394 3300049540 Bacteria 552
1294 Ga0501327_17434 3300049543 Bacteria 519
1295 Ga0501329_01188 3300049545 Bacteria 1101
1296 Ga0501335_003859 3300049551 Unclassified 1287
1297 Ga0501335_009515 3300049551 Bacteria 927
1298 Ga0501335_013870 3300049551 Bacteria 809
1299 Ga0501335_026997 3300049551 Bacteria 635
1300 Ga0501336_006401 3300049552 Bacteria 873
1301 Ga0501337_013145 3300049553 Unclassified 623
1302 Ga0501031_0080903 3300049568 Bacteria 2117
1303 Ga0501032_0201676 3300049569 Bacteria 1298
1304 Ga0501032_0354471 3300049569 Bacteria 945
1305 Ga0501034_0002711 3300049571 Bacteria 20864
1306 Ga0501034_0110084 3300049571 Bacteria 2745
1307 Ga0501034_0215449 3300049571 Bacteria 1874
1308 Ga0501034_1637955 3300049571 Bacteria 516
1309 Ga0501036_0042050 3300049572 Bacteria 3868
1310 Ga0501036_0048821 3300049572 Bacteria 3583
1311 Ga0501036_0732853 3300049572 Bacteria 816
1312 Ga0501037_0003876 3300049573 Bacteria 10850
1313 Ga0501037_0076129 3300049573 Unclassified 2437
1314 Ga0501037_0751092 3300049573 Unclassified 646
1315 Ga0501038_0007909 3300049574 Bacteria 9802
1316 Ga0501038_0274287 3300049574 Bacteria 1329
1317 Ga0501039_0016596 3300049575 Bacteria 5640
1318 Ga0501039_0102135 3300049575 Bacteria 2238
1319 Ga0501039_0908984 3300049575 Bacteria 685
1320 Ga0501040_0355901 3300049576 Bacteria 1049
1321 Ga0501040_0499181 3300049576 Unclassified 877
1322 Ga0501043_0002356 3300049579 Bacteria 16018
1323 Ga0501043_0007741 3300049579 Bacteria 8502
1324 Ga0501043_0874158 3300049579 Bacteria 646
1325 Ga0501046_0010797 3300049580 Bacteria 7830
1326 Ga0501046_0083527 3300049580 Bacteria 2465
1327 Ga0501046_0150167 3300049580 Bacteria 1758
1328 Ga0501046_0313485 3300049580 Unclassified 1144
1329 Ga0501047_0002262 3300049581 Bacteria 18429
1330 Ga0501047_0120134 3300049581 Bacteria 2510
1331 Ga0501047_0128751 3300049581 Bacteria 2412
1332 Ga0501048_0052661 3300049582 Bacteria 2897
1333 Ga0501048_0276361 3300049582 Bacteria 1194
1334 Ga0501067_0059523 3300049583 Bacteria 2114
1335 Ga0501067_0338365 3300049583 Bacteria 838
1336 Ga0501068_0030089 3300049584 Bacteria 3219
1337 Ga0501068_0164647 3300049584 Bacteria 1398
1338 Ga0501069_0073669 3300049585 Bacteria 1915
1339 Ga0501070_0068242 3300049586 Bacteria 2944
1340 Ga0501070_0103344 3300049586 Bacteria 2356
1341 Ga0501071_0664783 3300049587 Bacteria 802
1342 Ga0501072_0141946 3300049588 Bacteria 1915
1343 Ga0501073_0000270 3300049589 Bacteria 34510
1344 Ga0501073_0713981 3300049589 Bacteria 691
1345 Ga0501074_0001640 3300049590 Bacteria 15163
1346 Ga0501074_0283631 3300049590 Bacteria 1177
1347 Ga0501075_0394655 3300049591 Bacteria 1055
1348 Ga0501076_0402329 3300049592 Unclassified 1126
1349 Ga0501202_013855 3300049652 Bacteria 1538
1350 Ga0501209_196824 3300049656 Bacteria 619
1351 Ga0501222_048641 3300049662 Bacteria 618
1352 Ga0501227_021307 3300049665 Bacteria 1494
1353 Ga0501225_0332697 3300049705 Bacteria 521
1354 Ga0501079_0079711 3300049741 Bacteria 2532
1355 Ga0501079_0598875 3300049741 Bacteria 867
1356 Ga0501079_1223246 3300049741 Bacteria 592
1357 Ga0501080_0007763 3300049742 Bacteria 9696
1358 Ga0501080_0133978 3300049742 Bacteria 2293
1359 Ga0501080_0205679 3300049742 Bacteria 1805
1360 Ga0501083_0021595 3300049744 Bacteria 4471
1361 Ga0501083_0191833 3300049744 Unclassified 1333
1362 Ga0501241_003385 3300049758 Bacteria 3009
1363 Ga0501241_013722 3300049758 Bacteria 1472
1364 Ga0501272_073127 3300049769 Bacteria 504
1365 Ga0501274_045872 3300049771 Bacteria 537
1366 Ga0501283_045236 3300049779 Bacteria 770
1367 Ga0501035_0020366 3300049822 Bacteria 6090
1368 Ga0501035_0025624 3300049822 Bacteria 5405
1369 Ga0501035_0375294 3300049822 Bacteria 1187
1370 Ga0501044_0009741 3300049823 Bacteria 10452
1371 Ga0501044_0046711 3300049823 Bacteria 4482
1372 Ga0501044_0114882 3300049823 Bacteria 2697
1373 Ga0501044_0138323 3300049823 Bacteria 2425
1374 Ga0501044_0222520 3300049823 Bacteria 1838
1375 Ga0501045_0117942 3300049824 Bacteria 1970
1376 Ga0501284_00023 3300050005 Bacteria 78607
1377 nmdc:mga0k408_12225_c1 3300050493 Bacteria 4691
1378 nmdc:mga0k408_23571_c1 3300050493 Bacteria 3474
1379 nmdc:mga05p37_745128_c1 3300050507 Bacteria 1081
1380 nmdc:mga09592_27033_c1 3300050508 Bacteria 4758
1381 nmdc:mga0qj67_604779_c1 3300050509 Bacteria 877
1382 nmdc:mga06r32_256103_c1 3300050510 Bacteria 1738
1383 nmdc:mga08y16_693577_c1 3300050511 Unclassified 1019
1384 nmdc:mga08y16_735068_c1 3300050511 Bacteria 984
1385 nmdc:mga08y16_894010_c1 3300050511 Bacteria 875
1386 nmdc:mga0rr50_1672052_c1 3300050513 Unclassified 537
1387 Ga0495601_0427249 3300053077 Bacteria 858
1388 Ga0495619_0219968 3300053085 Bacteria 1315
1389 Ga0500578_0476906 3300053086 Bacteria 706
1390 Ga0500643_151082 3300053087 Bacteria 623
1391 Ga0500644_0000176 3300053088 Bacteria 40998
1392 Ga0500644_0154595 3300053088 Bacteria 922
1393 Ga0500581_200430 3300053089 Bacteria 886
1394 Ga0500646_0005852 3300053090 Bacteria 3117
1395 Ga0500646_0009223 3300053090 Bacteria 2526
1396 Ga0500646_0009264 3300053090 Bacteria 2520
1397 Ga0500646_0031751 3300053090 Bacteria 1455
1398 Ga0500583_0002896 3300053092 Bacteria 5277
1399 Ga0500583_0012897 3300053092 Bacteria 3209
1400 Ga0500583_0112135 3300053092 Bacteria 1344
1401 Ga0500651_0036109 3300053093 Bacteria 3114
1402 Ga0500651_0062544 3300053093 Bacteria 2324
1403 Ga0500650_0383475 3300053098 Bacteria 610
1404 Ga0500650_0422779 3300053098 Bacteria 574
1405 Ga0500569_005759 3300053109 Bacteria 2679
1406 Ga0500607_128022 3300053121 Bacteria 1216
1407 Ga0500628_032220 3300053129 Bacteria 1145
1408 Ga0500628_056819 3300053129 Unclassified 945
1409 Ga0500642_0151852 3300053130 Bacteria 1087
1410 Ga0500642_0258992 3300053130 Bacteria 797
1411 Ga0500655_014429 3300053133 Bacteria 1446
1412 Ga0500655_059915 3300053133 Bacteria 766
1413 Ga0500658_0030744 3300053134 Bacteria 2096
1414 Ga0500559_0001550 3300053136 Bacteria 12870
1415 Ga0500561_0045612 3300053137 Bacteria 1176
1416 Ga0500568_0046952 3300053139 Bacteria 1712
1417 Ga0500568_0216598 3300053139 Bacteria 700
1418 Ga0500577_0002125 3300053142 Bacteria 5059
1419 Ga0500577_0551714 3300053142 Unclassified 503
1420 Ga0500588_0167191 3300053146 Bacteria 803
1421 Ga0500588_0414446 3300053146 Bacteria 513
1422 Ga0500589_046079 3300053147 Bacteria 2031
1423 Ga0500590_032046 3300053148 Bacteria 2725
1424 Ga0500616_0118630 3300053153 Bacteria 1267
1425 Ga0500616_0154990 3300053153 Bacteria 1056
1426 Ga0500616_0295553 3300053153 Bacteria 675
1427 Ga0500622_0000258 3300053156 Bacteria 53957
1428 Ga0500622_0001151 3300053156 Bacteria 22018
1429 Ga0500627_0345971 3300053158 Bacteria 642
1430 Ga0500633_0071117 3300053160 Bacteria 1242
1431 Ga0500636_0002485 3300053177 Bacteria 10231
1432 Ga0500637_0118533 3300053178 Bacteria 1536
1433 Ga0500611_000018 3300053727 Bacteria 111023
1434 Ga0500645_212072 3300053730 Bacteria 520
1435 Ga0500656_024752 3300053732 Bacteria 766
1436 Ga0501084_0028117 3300054114 Bacteria 4698
1437 Ga0501084_0418284 3300054114 Bacteria 1133
1438 Ga0500661_001977 3300055283 Bacteria 3871
1439 Ga0587082_192654 3300059504 Unclassified 506
1440 Ga0587090_105454 3300059510 Bacteria 595
1441 Ga0587091_049155 3300059511 Bacteria 860
1442 Ga0587092_020882 3300059512 Bacteria 1012
1443 Ga0587092_090431 3300059512 Unclassified 617
1444 Ga0587106_041022 3300059605 Unclassified 786
1445 Ga0587101_103719 3300059623 Bacteria 569
1446 Ga0587109_202017 3300059624 Bacteria 518
1447 Ga0587117_043313 3300059627 Bacteria 724
1448 Ga0587128_163040 3300059630 Bacteria 515
1449 Ga0587068_094914 3300059641 Unclassified 619
1450 Ga0587072_117445 3300059643 Unclassified 613
1451 Ga0587076_216631 3300059645 Bacteria 500
1452 Ga0587071_084572 3300060344 Bacteria 712
1453 Ga0587071_139652 3300060344 Unclassified 594
1454 Ga0501082_0146151 3300060353 Bacteria 2052
1455 Ga0466962_0306215 3300061719 Bacteria 786
1456 Ga0530510_1392462 3300061734 Bacteria 538
1457 2945981361 2945977869 Bacteria 7777518
1458 2946019240 2946013367 Bacteria 7766675
1459 Ga0068863_100561006
1460 JGI24743J22301_10144941
1461 JGI24744J21845_10020183
1462 JGI25158J39367_1009415
1463 JGI25159J45721_1048087
1464 JGI25406J46586_10056108
1465 rootH2_10009422
1466 rootH2_10054917
1467 rootH2_10101489
1468 rootL2_10127521
1469 rootL2_10160151
1470 rootH1_10013931
1471 rootH1_10135123
1472 JGI25160J50197_1017226
1473 Ga0055531_10000245
1474 Ga0058859_10826476
1475 Ga0058859_11159609
1476 Ga0065714_10037081
1477 Ga0065714_10328222
1478 Ga0065704_10033350
1479 Ga0065704_10191117
1480 Ga0065712_10043039
1481 Ga0065712_10421381
1482 Ga0065715_10400388
1483 Ga0065715_10472634
1484 Ga0065707_10220928
1485 Ga0065707_10761310
1486 Ga0070658_11322238
1487 Ga0070658_11465044
1488 Ga0070676_10000153
1489 Ga0070676_10003325
1490 Ga0070676_10006732
1491 Ga0070676_10491606
1492 Ga0070676_10535035
1493 Ga0070676_10742147
1494 Ga0070683_100023520
1495 Ga0070683_100081462
1496 Ga0070683_101261055
1497 Ga0070690_100021818
1498 Ga0070690_100108133
1499 Ga0070690_101005548
1500 Ga0070670_100007928
1501 Ga0070670_100021684
1502 Ga0070670_100043904
1503 Ga0070670_100124831
1504 Ga0070670_100338882
1505 Ga0070670_100522289
1506 Ga0070670_100615430
1507 Ga0070670_101112968
1508 Ga0070670_101324183
1509 Ga0070670_102192332
1510 Ga0070670_102228269
1511 Ga0070677_10175900
1512 Ga0070677_10520436
1513 Ga0070677_10929689
1514 Ga0068869_100016793
1515 Ga0068869_100020420
1516 Ga0068869_100027564
1517 Ga0068869_100073866
1518 Ga0068869_100088092
1519 Ga0068869_100110634
1520 Ga0068869_100118832
1521 Ga0068869_100273695
1522 Ga0068869_100357704
1523 Ga0068869_100676580
1524 Ga0068869_101215995
1525 Ga0068869_101970654
1526 Ga0070666_10000209
1527 Ga0070666_10011988
1528 Ga0070666_10024603
1529 Ga0070666_10041527
1530 Ga0070666_10185297
1531 Ga0070666_10318560
1532 Ga0070666_10397627
1533 Ga0070666_10420410
1534 Ga0070666_10421262
1535 Ga0070666_10786231
1536 Ga0070680_100301771
1537 Ga0070682_100834561
1538 Ga0070682_100887543
1539 Ga0070682_101109595
1540 Ga0070682_101554308
1541 Ga0068868_100001336
1542 Ga0068868_100002414
1543 Ga0068868_100020102
1544 Ga0068868_100022584
1545 Ga0068868_100023605
1546 Ga0068868_100136042
1547 Ga0068868_100195266
1548 Ga0068868_100272610
1549 Ga0068868_100297356
1550 Ga0068868_100410873
1551 Ga0070660_100573851
1552 Ga0070660_100581730
1553 Ga0070660_100620185
1554 Ga0070660_100987860
1555 Ga0070689_100157874
1556 Ga0070689_100493835
1557 Ga0070689_100688089
1558 Ga0070689_100804037
1559 Ga0070689_101464730
1560 Ga0070689_101825901
1561 Ga0070691_10010461
1562 Ga0070691_10576669
1563 Ga0070687_100002811
1564 Ga0070687_100155279
1565 Ga0070687_101148675
1566 Ga0070661_100130084
1567 Ga0070661_100201421
1568 Ga0070661_100405144
1569 Ga0070661_100455569
1570 Ga0070661_101107798
1571 Ga0070668_100000556
1572 Ga0070668_100032555
1573 Ga0070668_100163333
1574 Ga0070668_100302528
1575 Ga0070668_100510433
1576 Ga0070668_100759615
1577 Ga0070669_100056538
1578 Ga0070669_100089397
1579 Ga0070669_100094730
1580 Ga0070669_100541968
1581 Ga0070669_100686648
1582 Ga0070669_101382906
1583 Ga0070675_100024988
1584 Ga0070675_100028383
1585 Ga0070675_100051669
1586 Ga0070675_100053321
1587 Ga0070675_100087065
1588 Ga0070675_100278735
1589 Ga0070675_100597133
1590 Ga0070671_100001985
1591 Ga0070671_100034628
1592 Ga0070671_100041198
1593 Ga0070671_100385016
1594 Ga0070671_100412863
1595 Ga0070671_100714595
1596 Ga0070671_101035812
1597 Ga0070671_101137528
1598 Ga0070671_101978293
1599 Ga0070674_100062017
1600 Ga0070674_100342171
1601 Ga0070674_100520484
1602 Ga0070674_100572475
1603 Ga0070674_100920875
1604 Ga0070673_100000867
1605 Ga0070673_100006375
1606 Ga0070673_100024895
1607 Ga0070673_100041606
1608 Ga0070673_100060726
1609 Ga0070673_100912603
1610 Ga0070673_101013672
1611 Ga0070673_101180336
1612 Ga0070673_101649871
1613 Ga0070688_100278966
1614 Ga0070688_100356616
1615 Ga0070688_100655418
1616 Ga0070688_100741030
1617 Ga0070688_101606518
1618 Ga0070659_100007187
1619 Ga0070659_100770727
1620 Ga0070667_100000812
1621 Ga0070667_100008930
1622 Ga0070667_100038136
1623 Ga0070667_100040093
1624 Ga0070667_100060648
1625 Ga0070667_100099011
1626 Ga0070667_100117175
1627 Ga0070667_100253860
1628 Ga0070667_100270609
1629 Ga0070667_100562188
1630 Ga0070667_100756177
1631 Ga0070667_100969352
1632 Ga0070667_101344830
1633 Ga0070701_10013206
1634 Ga0070701_10347508
1635 Ga0070705_100215659
1636 Ga0070700_100439346
1637 Ga0070700_100676271
1638 Ga0070708_101399131
1639 Ga0070663_100075874
1640 Ga0070663_100765925
1641 Ga0070663_100770436
1642 Ga0070663_100924549
1643 Ga0070663_101175074
1644 Ga0070678_100023430
1645 Ga0070678_100130837
1646 Ga0070678_100167308
1647 Ga0070678_100326560
1648 Ga0070678_100390860
1649 Ga0070678_100790745
1650 Ga0070662_100001017
1651 Ga0070662_100002918
1652 Ga0070662_100019329
1653 Ga0070662_100292903
1654 Ga0070662_100381670
1655 Ga0070662_100537232
1656 Ga0070662_100840518
1657 Ga0070662_101342622
1658 Ga0070681_10167290
1659 Ga0068867_100036770
1660 Ga0068867_100068327
1661 Ga0068867_100082748
1662 Ga0068867_100136101
1663 Ga0068867_100143037
1664 Ga0068867_100225703
1665 Ga0068867_101212847
1666 Ga0070685_10137269
1667 Ga0070685_10300653
1668 Ga0070685_10322320
1669 Ga0070685_10370073
1670 Ga0070685_10759654
1671 Ga0070706_100936390
1672 Ga0070698_100036892
1673 Ga0070698_100049913
1674 Ga0070684_100001060
1675 Ga0070684_100002383
1676 Ga0070684_100032732
1677 Ga0070684_100376101
1678 Ga0070684_100662580
1679 Ga0070684_102118537
1680 Ga0070684_102282173
1681 Ga0068853_100000520
1682 Ga0068853_100020753
1683 Ga0068853_100065202
1684 Ga0068853_100519567
1685 Ga0068853_100663448
1686 Ga0068853_101186315
1687 Ga0068853_101491117
1688 Ga0068853_101738683
1689 Ga0068853_101821005
1690 Ga0068853_102386995
1691 Ga0070672_100000738
1692 Ga0070672_100048813
1693 Ga0070672_100101769
1694 Ga0070672_100347186
1695 Ga0070672_100597516
1696 Ga0070672_101282081
1697 Ga0070672_101497765
1698 Ga0070686_100107815
1699 Ga0070686_100514885
1700 Ga0070686_100966775
1701 Ga0070693_100250499
1702 Ga0070693_100882055
1703 Ga0070665_100000016
1704 Ga0070665_100000486
1705 Ga0070665_100024894
1706 Ga0070665_100231705
1707 Ga0070665_100454910
1708 Ga0070665_100824961
1709 Ga0070665_101216511
1710 Ga0070665_102622184
1711 Ga0070704_100432572
1712 Ga0070704_100756215
1713 Ga0070704_100811663
1714 Ga0068855_100001195
1715 Ga0068855_100056754
1716 Ga0068855_100147675
1717 Ga0068855_100920202
1718 Ga0070664_100002163
1719 Ga0070664_100034763
1720 Ga0070664_100085373
1721 Ga0070664_100092551
1722 Ga0070664_100100585
1723 Ga0070664_100173719
1724 Ga0070664_100456680
1725 Ga0070664_100672758
1726 Ga0070664_100703265
1727 Ga0070664_100736621
1728 Ga0070664_101958890
1729 Ga0068857_100007533
1730 Ga0068857_100092135
1731 Ga0068857_100116871
1732 Ga0068857_100143969
1733 Ga0068857_100328872
1734 Ga0068857_100410499
1735 Ga0068857_101082230
1736 Ga0068857_102464664
1737 Ga0068854_100075832
1738 Ga0068854_100113006
1739 Ga0068854_100161208
1740 Ga0068854_100228111
1741 Ga0068854_100627264
1742 Ga0068854_101155729
1743 Ga0068854_101973482
1744 Ga0068856_100243724
1745 Ga0070702_100097632
1746 Ga0070702_100520081
1747 Ga0070702_101372019
1748 Ga0068852_100000223
1749 Ga0068852_100005616
1750 Ga0068852_100083763
1751 Ga0068852_100135099
1752 Ga0068852_100460264
1753 Ga0068852_100627285
1754 Ga0068852_101041590
1755 Ga0068852_101374112
1756 Ga0068859_100016918
1757 Ga0068859_100026368
1758 Ga0068859_100076707
1759 Ga0068859_100153847
1760 Ga0068859_100219040
1761 Ga0068859_100266281
1762 Ga0068859_100272729
1763 Ga0068859_102496880
1764 Ga0068859_102674626
1765 Ga0068859_102720851
1766 Ga0068859_102995704
1767 Ga0068864_100002330
1768 Ga0068864_100010946
1769 Ga0068864_100048675
1770 Ga0068864_100282029
1771 Ga0068864_100348728
1772 Ga0068864_100371791
1773 Ga0068864_101231849
1774 Ga0068866_10023161
1775 Ga0068866_10080310
1776 Ga0068866_10164227
1777 Ga0068866_10279609
1778 Ga0068866_10470454
1779 Ga0068866_11114522
1780 Ga0068866_11155476
1781 Ga0068861_100057736
1782 Ga0068861_100118137
1783 Ga0068861_100177987
1784 Ga0068861_100374722
1785 Ga0068861_100533110
1786 Ga0068861_100731899
1787 Ga0068861_100887291
1788 Ga0068861_101281305
1789 Ga0068861_101393409
1790 Ga0068861_102350248
1791 Ga0068861_102482737
1792 Ga0068851_10010493
1793 Ga0068851_10154441
1794 Ga0068851_10489199
1795 Ga0068851_10604440
1796 Ga0068851_10675666
1797 Ga0068851_10714287
1798 Ga0068870_10012476
1799 Ga0068870_10138923
1800 Ga0068870_10149303
1801 Ga0068870_10331047
1802 Ga0068870_10877282
1803 Ga0068863_100000858
1804 Ga0068863_100308391
1805 Ga0068863_100329429
1806 Ga0068863_100372317
1807 Ga0068863_100852382
1808 Ga0068863_101543917
1809 Ga0068863_101838583
1810 Ga0068863_102691392
1811 Ga0068858_100008022
1812 Ga0068858_100050171
1813 Ga0068858_100087035
1814 Ga0068858_100390819
1815 Ga0068858_100502440
1816 Ga0068858_100840137
1817 Ga0068858_101358846
1818 Ga0068858_101566210
1819 Ga0068858_101871069
1820 Ga0068858_102578430
1821 Ga0068860_100000026
1822 Ga0068860_100006630
1823 Ga0068860_100014705
1824 Ga0068860_100031636
1825 Ga0068860_100058149
1826 Ga0068860_100060556
1827 Ga0068860_100134629
1828 Ga0068860_100146429
1829 Ga0068860_100161168
1830 Ga0068860_100187590
1831 Ga0068860_100216288
1832 Ga0068860_100572886
1833 Ga0068860_100861403
1834 Ga0068860_102280828
1835 Ga0068860_102282564
1836 Ga0068860_102350146
1837 Ga0068862_100120003
1838 Ga0068862_100853358
1839 Ga0068862_101892228
1840 Ga0081540_1015893
1841 Ga0081539_10058235
1842 Ga0070715_10242687
1843 Ga0075366_10004995
1844 Ga0075366_10009633
1845 Ga0075366_10033515
1846 Ga0075366_10534924
1847 Ga0097621_100000027
1848 Ga0097621_100506876
1849 Ga0097621_100736323
1850 Ga0097621_100893514
1851 Ga0097621_101558449
1852 Ga0097621_101724099
1853 Ga0097621_102042517
1854 Ga0068871_100000107
1855 Ga0068871_100011119
1856 Ga0068871_100160875
1857 Ga0068871_100219701
1858 Ga0068871_100224703
1859 Ga0068871_100348237
1860 Ga0068871_100515883
1861 Ga0068871_100598330
1862 Ga0068871_101150867
1863 Ga0068871_101221424
1864 Ga0068871_102330538
1865 Ga0075428_100497738
1866 Ga0075430_100640740
1867 Ga0075431_100001800
1868 Ga0075429_100015792
1869 Ga0075429_100513647
1870 Ga0068865_100012268
1871 Ga0068865_100023713
1872 Ga0068865_100047038
1873 Ga0068865_100379893
1874 Ga0068865_100741006
1875 Ga0097620_100016919
1876 Ga0097620_100026370
1877 Ga0097620_100076707
1878 Ga0097620_100153847
1879 Ga0097620_100219047
1880 Ga0097620_100266293
1881 Ga0097620_100272717
1882 Ga0097620_102498304
1883 Ga0097620_102674555
1884 Ga0097620_102720788
1885 Ga0097620_102996779
1886 Ga0105251_10354085
1887 Ga0105244_10282407
1888 Ga0105240_10000258
1889 Ga0105240_10000715
1890 Ga0105240_10017799
1891 Ga0105240_10082615
1892 Ga0105240_10132147
1893 Ga0105240_10208171
1894 Ga0105240_10682960
1895 Ga0105240_10967775
1896 Ga0105240_11846305
1897 Ga0111539_10479134
1898 Ga0111539_10519125
1899 Ga0105245_10626041
1900 Ga0105247_10001631
1901 Ga0105247_10052842
1902 Ga0114129_10015867
1903 Ga0105243_10167162
1904 Ga0105243_10282805
1905 Ga0105243_11259227
1906 Ga0105241_10000721
1907 Ga0105241_10200099
1908 Ga0105241_10281108
1909 Ga0105241_10408323
1910 Ga0105241_10549747
1911 Ga0105241_10853314
1912 Ga0105241_11002918
1913 Ga0105241_12458113
1914 Ga0105242_10019590
1915 Ga0105242_10139507
1916 Ga0105242_10163684
1917 Ga0105242_10231784
1918 Ga0105242_10809566
1919 Ga0105242_10991771
1920 Ga0105242_11104122
1921 Ga0105242_12226265
1922 Ga0105242_12226675
1923 Ga0105242_12670042
1924 Ga0105242_12734394
1925 Ga0105242_13254132
1926 Ga0105248_10066633
1927 Ga0105248_10152482
1928 Ga0105248_10460370
1929 Ga0105248_10737308
1930 Ga0105248_10903822
1931 Ga0105248_10964121
1932 Ga0105248_11127964
1933 Ga0105248_12395203
1934 Ga0105237_10000654
1935 Ga0105237_10022472
1936 Ga0105237_10061881
1937 Ga0105237_10095645
1938 Ga0105237_10296964
1939 Ga0105237_10362743
1940 Ga0105237_10410272
1941 Ga0105237_10467670
1942 Ga0105237_10818473
1943 Ga0105237_11148097
1944 Ga0105237_11324581
1945 Ga0105237_12449324
1946 Ga0105238_10006981
1947 Ga0105238_10060929
1948 Ga0105238_11080890
1949 Ga0105249_10004870
1950 Ga0105249_10012686
1951 Ga0105249_10023081
1952 Ga0105249_10104818
1953 Ga0105249_10115110
1954 Ga0105249_10553664
1955 Ga0105249_10562396
1956 Ga0105249_11374299
1957 Ga0105249_12608088
1958 Ga0105249_13581314
1959 Ga0099796_10221589
1960 Ga0105239_10000353
1961 Ga0105239_10002319
1962 Ga0105239_10002402
1963 Ga0105239_10023616
1964 Ga0105239_10029540
1965 Ga0105239_10046183
1966 Ga0105239_10137123
1967 Ga0105239_10450950
1968 Ga0105239_10548614
1969 Ga0105239_10655614
1970 Ga0105239_11018647
1971 Ga0105246_10064263
1972 Ga0105246_10109772
1973 Ga0105246_10176986
1974 Ga0105246_10580679
1975 Ga0157327_1040044
1976 Ga0157373_10042785
1977 Ga0157373_10057587
1978 Ga0157373_10113865
1979 Ga0157373_10326191
1980 Ga0157373_10469133
1981 Ga0157371_10011331
1982 Ga0157371_10048034
1983 Ga0157371_10053895
1984 Ga0157371_10109883
1985 Ga0157371_10269678
1986 Ga0157371_10395378
1987 Ga0157371_10820428
1988 Ga0157370_10005886
1989 Ga0157370_10021094
1990 Ga0157370_10097938
1991 Ga0157370_10600531
1992 Ga0157370_10754425
1993 Ga0157370_10859977
1994 Ga0157370_10918531
1995 Ga0157370_11164858
1996 Ga0157370_11334326
1997 Ga0157369_10060951
1998 Ga0157369_10256753
1999 Ga0157369_10338684
2000 Ga0157369_10466049
2001 Ga0157369_11006248
2002 Ga0157369_12125885
2003 Ga0157374_10000002
2004 Ga0157374_10000841
2005 Ga0157374_10006478
2006 Ga0157374_10015281
2007 Ga0157374_10024723
2008 Ga0157374_10036109
2009 Ga0157374_10212713
2010 Ga0157374_10261668
2011 Ga0157374_10315603
2012 Ga0157374_10334544
2013 Ga0157374_10740734
2014 Ga0157374_10823863
2015 Ga0157378_10002090
2016 Ga0157378_10004442
2017 Ga0157378_10012644
2018 Ga0157378_10022590
2019 Ga0157378_10023595
2020 Ga0157378_10038804
2021 Ga0157378_10222060
2022 Ga0157378_10613946
2023 Ga0157378_10702050
2024 Ga0157378_10710397
2025 Ga0157378_11584247
2026 Ga0157378_12791720
2027 Ga0163162_10000100
2028 Ga0163162_10000190
2029 Ga0163162_10004205
2030 Ga0163162_10006285
2031 Ga0163162_10024736
2032 Ga0163162_10060245
2033 Ga0163162_10125475
2034 Ga0163162_10191116
2035 Ga0163162_10299598
2036 Ga0163162_10320794
2037 Ga0163162_10504866
2038 Ga0163162_10838151
2039 Ga0163162_11251766
2040 Ga0163162_13058025
2041 Ga0157372_10002276
2042 Ga0157372_10002704
2043 Ga0157372_10010700
2044 Ga0157372_10033620
2045 Ga0157372_10053877
2046 Ga0157372_10155951
2047 Ga0157372_10180343
2048 Ga0157372_10182645
2049 Ga0157372_10207420
2050 Ga0157372_10343570
2051 Ga0157372_10666226
2052 Ga0157372_10747764
2053 Ga0157372_10806846
2054 Ga0157372_10892147
2055 Ga0157372_10965339
2056 Ga0157372_11151761
2057 Ga0157372_11257504
2058 Ga0157372_11304431
2059 Ga0157372_11474463
2060 Ga0157372_11638089
2061 Ga0157372_11715134
2062 Ga0157372_11827297
2063 Ga0157375_10000057
2064 Ga0157375_10000336
2065 Ga0157375_10010520
2066 Ga0157375_10018827
2067 Ga0157375_10050668
2068 Ga0157375_10069395
2069 Ga0157375_10246349
2070 Ga0157375_10606472
2071 Ga0157375_12011110
2072 Ga0157375_12307958
2073 Ga0157375_12964785
2074 Ga0163163_10000254
2075 Ga0163163_10002122
2076 Ga0163163_10009925
2077 Ga0163163_10014392
2078 Ga0163163_10056448
2079 Ga0163163_10143716
2080 Ga0163163_10147957
2081 Ga0163163_10288780
2082 Ga0163163_10375809
2083 Ga0163163_10899395
2084 Ga0157380_10204970
2085 Ga0157380_10510024
2086 Ga0157380_12096366
2087 Ga0157380_12457421
2088 Ga0157380_12755416
2089 Ga0157380_13291951
2090 Ga0157377_10025991
2091 Ga0157377_10119689
2092 Ga0157377_10145828
2093 Ga0157377_10415921
2094 Ga0157379_10000367
2095 Ga0157379_10017665
2096 Ga0157379_10072486
2097 Ga0157379_10121473
2098 Ga0157379_10301801
2099 Ga0157379_10306440
2100 Ga0157379_10387596
2101 Ga0157379_10736264
2102 Ga0157379_10912218
2103 Ga0157379_11283657
2104 Ga0157376_10000135
2105 Ga0157376_10002989
2106 Ga0157376_10004908
2107 Ga0157376_10007359
2108 Ga0157376_10145446
2109 Ga0157376_10864712
2110 Ga0157376_11266781
2111 Ga0157376_11777682
2112 Ga0157376_12124386
2113 Ga0163161_10001091
2114 Ga0163161_10049399
2115 Ga0163161_10049900
2116 Ga0163161_10195228
2117 Ga0163161_10237726
2118 Ga0163161_10244328
2119 Ga0163161_10437549
2120 Ga0163161_10441963
2121 Ga0163161_10597784
2122 Ga0163161_11078445
2123 Ga0206352_10358371
2124 Ga0206352_11274644
2125 Ga0213876_10010098
2126 Ga0213876_10252876
2127 Ga0224712_10240349
2128 Ga0209436_102820
2129 Ga0209258_100068
2130 Ga0209148_1000182
2131 Ga0209130_1011517
2132 Ga0209758_1041446
2133 Ga0207426_1000051
2134 Ga0209257_1000025
2135 Ga0207697_10015051
2136 Ga0207697_10049556
2137 Ga0207656_10001696
2138 Ga0207656_10056009
2139 Ga0207656_10727732
2140 Ga0207682_10055094
2141 Ga0207682_10204378
2142 Ga0207642_10013123
2143 Ga0207642_10106315
2144 Ga0207642_10142840
2145 Ga0207642_10344450
2146 Ga0207642_10585982
2147 Ga0207710_10004177
2148 Ga0207710_10037994
2149 Ga0207688_10011930
2150 Ga0207688_10038950
2151 Ga0207680_10003138
2152 Ga0207680_10007095
2153 Ga0207680_10046316
2154 Ga0207680_10082786
2155 Ga0207680_10151508
2156 Ga0207680_10441838
2157 Ga0207680_10760628
2158 Ga0207680_10767533
2159 Ga0207647_10001743
2160 Ga0207647_10064282
2161 Ga0207647_10150160
2162 Ga0207647_10370806
2163 Ga0207647_10783084
2164 Ga0207685_10272782
2165 Ga0207645_10000511
2166 Ga0207645_10008172
2167 Ga0207645_10012027
2168 Ga0207645_10388370
2169 Ga0207645_10528136
2170 Ga0207645_10558431
2171 Ga0207643_10026488
2172 Ga0207643_10056780
2173 Ga0207643_10081881
2174 Ga0207643_10297520
2175 Ga0207705_10036694
2176 Ga0207705_10570424
2177 Ga0207705_11292748
2178 Ga0207654_10001646
2179 Ga0207654_10466305
2180 Ga0207707_10273176
2181 Ga0207695_10000327
2182 Ga0207695_10008726
2183 Ga0207695_10014855
2184 Ga0207695_10038067
2185 Ga0207695_10091500
2186 Ga0207695_10253982
2187 Ga0207695_10513036
2188 Ga0207695_11461794
2189 Ga0207671_10001643
2190 Ga0207671_10004018
2191 Ga0207671_10045170
2192 Ga0207671_10081617
2193 Ga0207671_10174218
2194 Ga0207671_10485760
2195 Ga0207671_10922461
2196 Ga0207662_10054739
2197 Ga0207662_10310070
2198 Ga0207662_11178037
2199 Ga0207657_10338621
2200 Ga0207657_10507349
2201 Ga0207657_11035826
2202 Ga0207649_10006464
2203 Ga0207649_10071361
2204 Ga0207649_10184783
2205 Ga0207649_10344844
2206 Ga0207649_10418536
2207 Ga0207649_10478018
2208 Ga0207681_10074867
2209 Ga0207681_10078607
2210 Ga0207681_10444946
2211 Ga0207681_11495350
2212 Ga0207681_11504358
2213 Ga0207694_10131982
2214 Ga0207694_11282988
2215 Ga0207650_10004888
2216 Ga0207650_10009769
2217 Ga0207650_10035323
2218 Ga0207650_10046883
2219 Ga0207650_10195957
2220 Ga0207650_10304815
2221 Ga0207650_10476708
2222 Ga0207650_11174515
2223 Ga0207650_11268940
2224 Ga0207650_11379496
2225 Ga0207650_11671015
2226 Ga0207659_10033631
2227 Ga0207659_10034049
2228 Ga0207659_10056438
2229 Ga0207659_10325690
2230 Ga0207659_10743268
2231 Ga0207659_11405584
2232 Ga0207659_11497129
2233 Ga0207687_11396149
2234 Ga0207644_10005002
2235 Ga0207644_10062124
2236 Ga0207644_10946104
2237 Ga0207690_10096270
2238 Ga0207706_10003803
2239 Ga0207706_10007905
2240 Ga0207706_10023224
2241 Ga0207706_10345305
2242 Ga0207706_10483715
2243 Ga0207706_10921640
2244 Ga0207706_11348327
2245 Ga0207686_10058398
2246 Ga0207686_10118317
2247 Ga0207686_10146299
2248 Ga0207686_10694100
2249 Ga0207686_11095800
2250 Ga0207709_10649030
2251 Ga0207670_10004881
2252 Ga0207670_10459853
2253 Ga0207670_10613974
2254 Ga0207670_10641953
2255 Ga0207669_10272319
2256 Ga0207669_10319550
2257 Ga0207669_10481243
2258 Ga0207669_10602284
2259 Ga0207704_10000484
2260 Ga0207704_10026162
2261 Ga0207704_10184786
2262 Ga0207704_10601514
2263 Ga0207704_11720276
2264 Ga0207665_10160926
2265 Ga0207691_10002120
2266 Ga0207691_10012396
2267 Ga0207691_10049241
2268 Ga0207691_10093127
2269 Ga0207691_10165772
2270 Ga0207691_10166536
2271 Ga0207691_10281088
2272 Ga0207691_10322463
2273 Ga0207691_10331549
2274 Ga0207691_10450743
2275 Ga0207691_10811208
2276 Ga0207711_10096985
2277 Ga0207711_10463167
2278 Ga0207711_10984058
2279 Ga0207711_11697046
2280 Ga0207689_10002405
2281 Ga0207689_10010393
2282 Ga0207689_10015655
2283 Ga0207689_10019942
2284 Ga0207689_10021007
2285 Ga0207689_10021416
2286 Ga0207689_10050087
2287 Ga0207689_10073362
2288 Ga0207689_10268307
2289 Ga0207689_10333242
2290 Ga0207689_10486626
2291 Ga0207689_10781778
2292 Ga0207661_10015999
2293 Ga0207661_10020712
2294 Ga0207661_10059632
2295 Ga0207661_10069730
2296 Ga0207661_11366855
2297 Ga0207679_10001121
2298 Ga0207679_10002674
2299 Ga0207679_10049169
2300 Ga0207679_10065635
2301 Ga0207679_10070822
2302 Ga0207679_10083573
2303 Ga0207679_10108491
2304 Ga0207679_10669751
2305 Ga0207679_11092845
2306 Ga0207667_10000340
2307 Ga0207667_10009409
2308 Ga0207667_10037270
2309 Ga0207667_10544960
2310 Ga0207651_10002824
2311 Ga0207651_10015789
2312 Ga0207651_10043110
2313 Ga0207651_10043279
2314 Ga0207651_10199654
2315 Ga0207651_10216028
2316 Ga0207651_10303453
2317 Ga0207651_10934214
2318 Ga0207651_11668378
2319 Ga0207651_11798250
2320 Ga0207712_10003520
2321 Ga0207712_10009397
2322 Ga0207712_10011683
2323 Ga0207712_10012015
2324 Ga0207712_10018240
2325 Ga0207712_10072670
2326 Ga0207712_10115094
2327 Ga0207712_10372915
2328 Ga0207712_11314512
2329 Ga0207668_10001106
2330 Ga0207668_10098164
2331 Ga0207668_10244856
2332 Ga0207668_10648319
2333 Ga0207668_10943000
2334 Ga0207640_10130502
2335 Ga0207640_10156691
2336 Ga0207640_10613137
2337 Ga0207640_11521754
2338 Ga0207640_11695298
2339 Ga0207658_10000847
2340 Ga0207658_10010360
2341 Ga0207658_10013966
2342 Ga0207658_10036244
2343 Ga0207658_10244463
2344 Ga0207658_10422049
2345 Ga0207658_10452056
2346 Ga0207658_11014068
2347 Ga0207658_11101403
2348 Ga0207658_11332155
2349 Ga0207677_10001136
2350 Ga0207677_10007895
2351 Ga0207677_10053438
2352 Ga0207677_10104847
2353 Ga0207677_10118524
2354 Ga0207677_10496489
2355 Ga0207677_10535892
2356 Ga0207677_10580982
2357 Ga0207703_10010768
2358 Ga0207703_10648914
2359 Ga0207703_10726598
2360 Ga0207703_10804331
2361 Ga0207703_10928050
2362 Ga0207703_11002670
2363 Ga0207703_11140025
2364 Ga0207703_12249299
2365 Ga0207639_10083200
2366 Ga0207639_10308490
2367 Ga0207639_10379234
2368 Ga0207639_10398512
2369 Ga0207639_10526364
2370 Ga0207639_10828455
2371 Ga0207639_11032459
2372 Ga0207639_11218910
2373 Ga0207639_11493536
2374 Ga0207639_12132462
2375 Ga0207678_10199143
2376 Ga0207678_10395394
2377 Ga0207678_10592582
2378 Ga0207678_10607373
2379 Ga0207678_10685741
2380 Ga0207678_10689552
2381 Ga0207678_11039657
2382 Ga0207678_11300917
2383 Ga0207678_11863662
2384 Ga0207708_10357458
2385 Ga0207708_10525593
2386 Ga0207702_10417315
2387 Ga0207702_10748205
2388 Ga0207702_11429131
2389 Ga0207641_10000418
2390 Ga0207641_10004489
2391 Ga0207641_10143228
2392 Ga0207641_10326368
2393 Ga0207641_10851373
2394 Ga0207641_11122046
2395 Ga0207641_11432600
2396 Ga0207641_11645497
2397 Ga0207641_12038058
2398 Ga0207641_12570089
2399 Ga0207641_12618480
2400 Ga0207648_10001186
2401 Ga0207648_10013975
2402 Ga0207648_10051259
2403 Ga0207648_10059395
2404 Ga0207648_10086258
2405 Ga0207648_10160349
2406 Ga0207648_10308727
2407 Ga0207648_10397334
2408 Ga0207648_10537985
2409 Ga0207648_11453593
2410 Ga0207648_11922026
2411 Ga0207648_12010344
2412 Ga0207676_10013981
2413 Ga0207676_10184534
2414 Ga0207676_10299451
2415 Ga0207676_10332248
2416 Ga0207676_11364470
2417 Ga0207676_12609778
2418 Ga0207674_10012911
2419 Ga0207674_10013730
2420 Ga0207674_10101039
2421 Ga0207674_10146034
2422 Ga0207674_10153470
2423 Ga0207674_10439326
2424 Ga0207674_10558402
2425 Ga0207674_11334436
2426 Ga0207675_100018406
2427 Ga0207675_100073850
2428 Ga0207675_100083470
2429 Ga0207675_100106426
2430 Ga0207675_100229221
2431 Ga0207675_100293606
2432 Ga0207675_100578976
2433 Ga0207675_100605670
2434 Ga0207675_100826956
2435 Ga0207675_101919330
2436 Ga0207683_10005675
2437 Ga0207683_10031869
2438 Ga0207683_10060923
2439 Ga0207683_10063612
2440 Ga0207683_10226237
2441 Ga0207683_10248030
2442 Ga0207698_10020032
2443 Ga0207698_10070584
2444 Ga0207698_10076391
2445 Ga0207698_10225207
2446 Ga0207698_10539586
2447 Ga0207698_10792905
2448 Ga0207698_10832350
2449 Ga0207698_10871467
2450 Ga0207698_11635413
2451 Ga0207698_11955835
2452 Ga0209981_1025019
2453 Ga0209984_1031578
2454 Ga0209995_1011784
2455 Ga0209968_1056776
2456 Ga0209968_1082126
2457 Ga0209999_1026399
2458 Ga0210002_1047950
2459 Ga0209974_10168124
2460 Ga0209974_10230101
2461 Ga0207428_10371385
2462 Ga0207428_10640257
2463 Ga0207428_10715529
2464 Ga0268266_10000034
2465 Ga0268266_10002645
2466 Ga0268266_10037874
2467 Ga0268266_10041488
2468 Ga0268265_10418024
2469 Ga0268265_11843614
2470 Ga0268265_12091992
2471 Ga0268265_12490657
2472 Ga0268264_10000117
2473 Ga0268264_10000739
2474 Ga0268264_10007632
2475 Ga0268264_10045709
2476 Ga0268264_10125122
2477 Ga0268264_10157121
2478 Ga0268264_10360793
2479 Ga0268264_10537925
2480 Ga0268264_10553839
2481 Ga0268264_10740900
2482 Ga0268264_10814069
2483 Ga0268264_11237682
2484 Ga0307517_10075365
2485 Ga0307517_10097860
2486 Ga0307517_10278037
2487 Ga0265324_10197047
2488 Ga0307511_10000153
2489 Ga0265340_10138071
2490 Ga0265327_10220582
2491 Ga0307513_10337849
2492 Ga0307513_10596328
2493 Ga0307509_10590973
2494 Ga0307408_100040477
2495 Ga0265313_10089316
2496 Ga0307516_10013017
2497 Ga0307516_10101287
2498 Ga0307405_10310771
2499 Ga0307405_11333177
2500 Ga0307413_10267875
2501 Ga0307413_10583886
2502 Ga0307518_10570043
2503 Ga0307410_10031519
2504 Ga0307410_10062277
2505 Ga0307406_10305366
2506 Ga0307407_10028144
2507 Ga0307412_10304404
2508 Ga0307409_101743126
2509 Ga0307416_100031968
2510 Ga0307416_100181822
2511 Ga0307416_102050099
2512 Ga0307414_10237961
2513 Ga0307414_11328522
2514 Ga0307411_10650473
2515 Ga0307411_11348200
2516 Ga0307415_100120477
2517 Ga0307415_102047549
2518 Ga0307510_10000191
2519 Ga0307510_10223308
2520 Ga0373934_0284889
2521 Ga0373936_0156366
2522 Ga0373945_0296781
2523 Ga0373953_0170263
2524 Ga0373953_0240197
2525 Ga0373954_0212408
2526 Ga0373954_0661935
2527 Ga0373956_0098657
2528 Ga0373957_0368098
2529 Ga0373943_0357336
2530 Ga0373943_0695050
2531 Ga0373946_0052222
2532 Ga0373955_0004303
2533 Ga0373955_0141242
2534 Ga0373924_0018853
2535 Ga0373924_0129571
2536 Ga0373935_0101981
2537 Ga0373935_0548261
2538 Ga0373933_0027963
2539 Ga0373933_0515849
2540 Ga0373933_0534008
2541 Ga0373947_0206812
2542 Ga0373937_0100271
2543 Ga0373937_0113245
2544 Ga0373937_0152449
2545 Ga0373937_0267166
2546 Ga0373937_1212067
2547 Ga0265778_056678
2548 Ga0373925_0863719
2549 Ga0373925_0876141
2550 Ga0373925_1713577
2551 Ga0395899_0533335
2552 Ga0395898_0202872
2553 Ga0395905_0000527
2554 Ga0395905_0432429
2555 Ga0395905_0595596
2556 Ga0395905_1056098
2557 Ga0395901_0256467
2558 Ga0436365_1161343
2559 Ga0436365_1410658
2560 Ga0436363_1230165
2561 Ga0439436_0000773
2562 Ga0439436_0061468
2563 Ga0439436_0084115
2564 Ga0439439_0016397
2565 Ga0439439_0069573
2566 Ga0439453_0046775
2567 Ga0439465_0024662
2568 Ga0451789_0607989
2569 Ga0451789_1128496
2570 Ga0451790_23413
2571 Ga0451797_0944792
2572 Ga0451805_117129
2573 Ga0451807_1591963
2574 Ga0451807_2561754
2575 Ga0451837_1423970
2576 Ga0451847_0237332
2577 Ga0451855_0970425
2578 Ga0451853_1110616
2579 Ga0451853_2649306
2580 Ga0451853_3714240
2581 Ga0439433_0050987
2582 Ga0439449_0004545
2583 Ga0439449_0015374
2584 Ga0439449_0280988
2585 Ga0439457_000175
2586 Ga0439457_003006
2587 Ga0439457_027556
2588 Ga0439462_0031419
2589 Ga0439444_0149920
2590 Ga0439459_0191789
2591 Ga0451577_0090941
2592 Ga0466969_0064878
2593 Ga0466972_0000782
2594 Ga0466972_0223006
2595 Ga0466972_0322658
2596 Ga0453683_0646177
2597 Ga0453683_0734579
2598 Ga0466965_0064770
2599 Ga0466965_0536104
2600 Ga0453684_0130453
2601 Ga0453684_0210816
2602 Ga0453684_0213439
2603 Ga0453684_0579157
2604 Ga0453684_1780334
2605 Ga0466971_0018466
2606 Ga0466968_0006371
2607 Ga0466970_0097553
2608 Ga0466970_0145604
2609 Ga0466957_0081791
2610 Ga0466957_0863054
2611 Ga0466959_0004300
2612 Ga0466959_0033132
2613 Ga0466959_0114695
2614 Ga0451576_0579263
2615 Ga0451576_1002077
2616 Ga0451576_1271054
2617 Ga0451576_2516393
2618 Ga0466967_2121513
2619 Ga0495627_035808
2620 Ga0495592_0063149
2621 Ga0495603_0639279
2622 Ga0495603_0790340
2623 Ga0495629_0027491
2624 Ga0495638_0616263
2625 Ga0495651_0446326
2626 Ga0495653_0101732
2627 Ga0495653_0175749
2628 Ga0495650_0055028
2629 Ga0495580_0102092
2630 Ga0495580_0238353
2631 Ga0495582_0030486
2632 Ga0495639_0228734
2633 Ga0495594_0530767
2634 Ga0495606_0164734
2635 Ga0495608_0426579
2636 Ga0495618_0076337
2637 Ga0495628_0028725
2638 Ga0495628_0851680
2639 Ga0495630_0019380
2640 Ga0495630_0936083
2641 Ga0495630_0954690
2642 Ga0495648_0002156
2643 Ga0495652_0171524
2644 Ga0495652_0209637
2645 Ga0495640_0698324
2646 Ga0495586_0026118
2647 Ga0495586_0527390
2648 Ga0495587_0047198
2649 Ga0495587_0051874
2650 Ga0495645_0177184
2651 Ga0495645_0863827
2652 Ga0495622_0035324
2653 Ga0495622_0054440
2654 Ga0495633_0000058
2655 Ga0495633_0033010
2656 Ga0495667_0137316
2657 Ga0495667_0420386
2658 Ga0495667_0517903
2659 Ga0495668_0001368
2660 Ga0495611_0001667
2661 Ga0495625_0547287
2662 Ga0495635_0053001
2663 Ga0495661_0207894
2664 Ga0495657_0756930
2665 Ga0495599_0120173
2666 Ga0495623_0328171
2667 Ga0495646_0515539
2668 Ga0495647_0009671
2669 Ga0495658_0003503
2670 Ga0495613_0336152
2671 Ga0495613_0860336
2672 Ga0495613_0872876
2673 Ga0495670_0108311
2674 Ga0495671_0630112
2675 Ga0495649_0039065
2676 Ga0495600_0167120
2677 Ga0495600_0350565
2678 Ga0495660_0313076
2679 Ga0495581_0634855
2680 Ga0495604_0402380
2681 Ga0495674_0030231
2682 Ga0495674_0141904
2683 Ga0495672_0008108
2684 Ga0495680_0045605
2685 Ga0495687_000079
2686 Ga0495675_0281079
2687 Ga0495675_0548526
2688 Ga0495684_0345329
2689 Ga0495684_0830947
2690 Ga0495686_0000041
2691 Ga0495686_0163358
2692 Ga0495593_0258546
2693 Ga0495602_0260725
2694 Ga0495615_0260881
2695 Ga0496101_0029522
2696 Ga0496101_0086909
2697 Ga0496102_1484329
2698 Ga0496104_0311247
2699 Ga0496104_0520494
2700 Ga0496104_0564189
2701 Ga0496104_0602241
2702 Ga0496104_0823960
2703 Ga0496104_1187524
2704 Ga0496105_0313901
2705 Ga0496105_0636435
2706 Ga0496105_1023385
2707 Ga0496106_0192553
2708 Ga0496106_0931880
2709 Ga0496108_0519843
2710 Ga0496108_0791172
2711 Ga0496109_0202796
2712 Ga0496110_0579487
2713 Ga0496111_0147300
2714 Ga0496111_0257821
2715 Ga0496114_1551099
2716 Ga0496114_1671387
2717 Ga0496115_0111602
2718 Ga0496126_0115249
2719 Ga0501306_006749
2720 Ga0501306_031891
2721 Ga0501308_005356
2722 Ga0501308_023797
2723 Ga0501309_026641
2724 Ga0501343_022051
2725 Ga0501304_006136
2726 Ga0501304_016374
2727 Ga0501305_009096
2728 Ga0501305_107732
2729 Ga0501307_023769
2730 Ga0501292_073265
2731 Ga0501311_003025
2732 Ga0501311_035594
2733 Ga0501312_042569
2734 Ga0501312_108295
2735 Ga0501313_024232
2736 Ga0501314_033862
2737 Ga0501314_042373
2738 Ga0501315_035010
2739 Ga0501315_055171
2740 Ga0501316_017821
2741 Ga0501316_028864
2742 Ga0501317_024362
2743 Ga0501317_056761
2744 Ga0501319_002395
2745 Ga0501320_011532
2746 Ga0501320_049111
2747 Ga0501320_057587
2748 Ga0501321_034190
2749 Ga0501323_073342
2750 Ga0501323_081965
2751 Ga0501324_036394
2752 Ga0501327_17434
2753 Ga0501329_01188
2754 Ga0501335_003859
2755 Ga0501335_009515
2756 Ga0501335_013870
2757 Ga0501335_026997
2758 Ga0501336_006401
2759 Ga0501337_013145
2760 Ga0501031_0080903
2761 Ga0501032_0201676
2762 Ga0501032_0354471
2763 Ga0501034_0002711
2764 Ga0501034_0110084
2765 Ga0501034_0215449
2766 Ga0501034_1637955
2767 Ga0501036_0042050
2768 Ga0501036_0048821
2769 Ga0501036_0732853
2770 Ga0501037_0003876
2771 Ga0501037_0076129
2772 Ga0501037_0751092
2773 Ga0501038_0007909
2774 Ga0501038_0274287
2775 Ga0501039_0016596
2776 Ga0501039_0102135
2777 Ga0501039_0908984
2778 Ga0501040_0355901
2779 Ga0501040_0499181
2780 Ga0501043_0002356
2781 Ga0501043_0007741
2782 Ga0501043_0874158
2783 Ga0501046_0010797
2784 Ga0501046_0083527
2785 Ga0501046_0150167
2786 Ga0501046_0313485
2787 Ga0501047_0002262
2788 Ga0501047_0120134
2789 Ga0501047_0128751
2790 Ga0501048_0052661
2791 Ga0501048_0276361
2792 Ga0501067_0059523
2793 Ga0501067_0338365
2794 Ga0501068_0030089
2795 Ga0501068_0164647
2796 Ga0501069_0073669
2797 Ga0501070_0068242
2798 Ga0501070_0103344
2799 Ga0501071_0664783
2800 Ga0501072_0141946
2801 Ga0501073_0000270
2802 Ga0501073_0713981
2803 Ga0501074_0001640
2804 Ga0501074_0283631
2805 Ga0501075_0394655
2806 Ga0501076_0402329
2807 Ga0501202_013855
2808 Ga0501209_196824
2809 Ga0501222_048641
2810 Ga0501227_021307
2811 Ga0501225_0332697
2812 Ga0501079_0079711
2813 Ga0501079_0598875
2814 Ga0501079_1223246
2815 Ga0501080_0007763
2816 Ga0501080_0133978
2817 Ga0501080_0205679
2818 Ga0501083_0021595
2819 Ga0501083_0191833
2820 Ga0501241_003385
2821 Ga0501241_013722
2822 Ga0501272_073127
2823 Ga0501274_045872
2824 Ga0501283_045236
2825 Ga0501035_0020366
2826 Ga0501035_0025624
2827 Ga0501035_0375294
2828 Ga0501044_0009741
2829 Ga0501044_0046711
2830 Ga0501044_0114882
2831 Ga0501044_0138323
2832 Ga0501044_0222520
2833 Ga0501045_0117942
2834 Ga0501284_00023
2835 nmdc:mga0k408_12225_c1
2836 nmdc:mga0k408_23571_c1
2837 nmdc:mga05p37_745128_c1
2838 nmdc:mga09592_27033_c1
2839 nmdc:mga0qj67_604779_c1
2840 nmdc:mga06r32_256103_c1
2841 nmdc:mga08y16_693577_c1
2842 nmdc:mga08y16_735068_c1
2843 nmdc:mga08y16_894010_c1
2844 nmdc:mga0rr50_1672052_c1
2845 Ga0495601_0427249
2846 Ga0495619_0219968
2847 Ga0500578_0476906
2848 Ga0500643_151082
2849 Ga0500644_0000176
2850 Ga0500644_0154595
2851 Ga0500581_200430
2852 Ga0500646_0005852
2853 Ga0500646_0009223
2854 Ga0500646_0009264
2855 Ga0500646_0031751
2856 Ga0500583_0002896
2857 Ga0500583_0012897
2858 Ga0500583_0112135
2859 Ga0500651_0036109
2860 Ga0500651_0062544
2861 Ga0500650_0383475
2862 Ga0500650_0422779
2863 Ga0500569_005759
2864 Ga0500607_128022
2865 Ga0500628_032220
2866 Ga0500628_056819
2867 Ga0500642_0151852
2868 Ga0500642_0258992
2869 Ga0500655_014429
2870 Ga0500655_059915
2871 Ga0500658_0030744
2872 Ga0500559_0001550
2873 Ga0500561_0045612
2874 Ga0500568_0046952
2875 Ga0500568_0216598
2876 Ga0500577_0002125
2877 Ga0500577_0551714
2878 Ga0500588_0167191
2879 Ga0500588_0414446
2880 Ga0500589_046079
2881 Ga0500590_032046
2882 Ga0500616_0118630
2883 Ga0500616_0154990
2884 Ga0500616_0295553
2885 Ga0500622_0000258
2886 Ga0500622_0001151
2887 Ga0500627_0345971
2888 Ga0500633_0071117
2889 Ga0500636_0002485
2890 Ga0500637_0118533
2891 Ga0500611_000018
2892 Ga0500645_212072
2893 Ga0500656_024752
2894 Ga0501084_0028117
2895 Ga0501084_0418284
2896 Ga0500661_001977
2897 Ga0587082_192654
2898 Ga0587090_105454
2899 Ga0587091_049155
2900 Ga0587092_020882
2901 Ga0587092_090431
2902 Ga0587106_041022
2903 Ga0587101_103719
2904 Ga0587109_202017
2905 Ga0587117_043313
2906 Ga0587128_163040
2907 Ga0587068_094914
2908 Ga0587072_117445
2909 Ga0587076_216631
2910 Ga0587071_084572
2911 Ga0587071_139652
2912 Ga0501082_0146151
2913 Ga0466962_0306215
2914 Ga0530510_1392462
2915 2945981361
2916 2946019240

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00312

Ribosomal_S15

Ribosomal protein S15

7

89

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fmw-assembly1.cif.gz_O the structure of a hibernating ribosome in the lyme disease pathogen 0.9698 4 90
6az1-assembly1.cif.gz_T cryo-em structure of the small subunit of leishmania ribosome bound to paromomycin 0.9655 30 73
8a3w-assembly1.cif.gz_ST cryo-em structure of leishmania major 80s ribosome : wild type 0.9637 30 73
6th6-assembly1.cif.gz_Aq cryo-em structure of t. kodakarensis 70s ribosome 0.9621 30 75
6vwl-assembly1.cif.gz_n 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9587 4 89
ID Description Score Start End Superfamily
6az1T02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9655 30 73 1.10.287.10
5ll6Y02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.965 30 73 1.10.287.10
3jamN02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9572 30 73 1.10.287.10
4uk9O02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9562 30 75 1.10.287.10
4uljO02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.956 30 75 1.10.287.10
ID Description Score Start End GO Terms
AF-A0A432U7P7-F1-model_v4 Small ribosomal subunit protein uS15 0.9808 24 90 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-O83857-F1-model_v4 Small ribosomal subunit protein uS15 (30S ribosomal protein S15) 0.977 4 90 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A2E3C3A7-F1-model_v4 Small ribosomal subunit protein uS15 0.9761 4 90 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-A0A842IGM9-F1-model_v4 Small ribosomal subunit protein uS15 0.9758 3 90 GO:0003735
GO:0006412
GO:0019843
GO:0022627
AF-E3T2X5-F1-model_v4 Small ribosomal subunit protein uS15c 0.9757 23 89 GO:0003735
GO:0005840
GO:0006412
GO:0009507
GO:1990904

Map