F494111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1458 | 526 | 2916 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300048925|Ga0496122_0144263|Ga0496122_0144263_204_1271 |
| Length | 355 |
| Sequence | MGLAQSLWGFSVFECVAREWAAQRCVTCVKRGLTSYSEIGMHPHTPRIGIIGSGAIGGFYGLMLARAGFDVHFLLRSEYQAVREQGLTLDSDVHGALQMQVQAYASAADMPPCDWLLIGAKATSNDQLAPLVVQAAAPGAKVVLLQNGLGVEEQLRPSLRSDMHLLGGLCFICVNRHAPGVIRHQALGAVNLGYHSGPASDGGTGLVDEGVALFKRAGIDSQAMPNLDAARWQKLVWNVPYNGLSVLLGASTTPLMADSHSRDLIQALMAEVVQGAAACGHVLPKGYAEHLFQVTERMPDYWPSMYHDHAFKRPLELQAIYAEPLARARAAGCCLPRMEMLYQALSFLDSNHRPH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 39 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 98 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 99 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 107 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 109 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 110 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 111 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 112 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 124 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 125 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 126 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 127 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 128 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 129 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 130 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 131 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 132 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 133 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 134 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 135 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 136 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 137 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 138 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 139 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 140 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 141 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 142 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 143 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 144 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 145 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 146 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 147 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 148 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 149 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 150 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 151 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 152 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 153 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 154 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 155 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 156 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 251 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 266 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 275 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 276 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 277 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 278 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 279 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 280 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 281 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 282 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 283 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 284 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 285 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 286 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 287 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 288 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 289 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 290 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 291 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 292 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 293 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 294 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 295 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 296 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 297 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 298 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 299 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 300 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 301 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 302 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 303 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 304 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 305 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 306 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 307 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 308 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 309 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 310 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 311 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 312 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 313 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 314 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 315 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 316 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 317 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 318 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 319 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 320 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 321 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 322 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 323 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 324 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 325 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 326 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 327 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 328 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 329 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 330 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 331 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 332 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 333 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 334 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 335 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 336 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 337 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 338 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 339 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 340 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 341 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 342 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 343 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 344 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 345 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 346 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 347 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 348 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 349 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 350 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 351 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 352 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 353 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 354 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 355 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 356 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 357 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 358 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 359 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 360 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 361 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 362 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 363 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 364 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 365 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 366 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 367 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 368 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 369 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 370 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 371 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 372 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 373 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 374 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 375 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 376 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 377 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 378 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 379 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 380 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 381 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 382 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 383 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 384 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 385 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 386 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 387 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 388 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 389 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 390 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 391 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 392 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 393 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 394 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 395 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 396 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 397 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 398 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 399 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 400 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 401 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 402 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 403 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 404 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 405 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 406 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 407 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 408 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 409 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 410 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 411 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 412 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 413 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 414 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 415 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 416 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 417 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 418 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 419 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 420 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 421 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 422 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 423 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 424 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 425 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 426 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 427 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 428 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 429 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 430 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 431 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 432 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 433 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 434 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 435 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 436 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 437 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 438 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 439 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 440 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 441 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 442 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 443 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 444 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 445 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 446 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 447 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 448 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 449 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 450 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 451 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 452 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 453 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 454 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 455 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 456 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 457 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 458 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 459 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 460 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 461 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 462 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 463 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 464 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 465 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 466 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 467 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 468 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 469 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 470 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 471 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 472 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 473 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 474 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 475 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 476 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 477 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 478 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 479 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 480 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 481 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 482 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 483 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 484 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 485 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 486 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 487 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 488 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 489 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 490 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 491 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 492 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 493 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 494 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 495 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 496 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 497 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 498 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 499 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 500 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 501 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 502 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 503 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 504 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 505 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 506 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 507 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 508 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 509 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 510 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 511 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 512 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 513 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 514 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 515 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 516 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 517 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 518 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 519 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 520 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 521 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 522 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 523 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 524 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 525 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 526 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.85 |
| Metatranscriptomes | 0 |
| Isolates | 17.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.66 |
| Nodule | 1.92 |
| Rhizoplane | 6.1 |
| Rhizosphere | 75.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496122_0144263 | 3300048925 | Bacteria | 1483 |
| 2 | MRS2a_Contig_23 | 2124908027 | Bacteria | 55080 |
| 3 | SwRhRL2b_contig_1956582 | 2162886007 | Bacteria | 3565 |
| 4 | SwRhRL2b_contig_487690 | 2162886007 | Bacteria | 1808 |
| 5 | JGI25162J39368_1000212 | 3300002737 | Bacteria | 61036 |
| 6 | JGI25162J39368_1001980 | 3300002737 | Bacteria | 9178 |
| 7 | JGI25154J39366_1004030 | 3300002738 | Bacteria | 2788 |
| 8 | JGI25163J39215_1000915 | 3300002771 | Bacteria | 6768 |
| 9 | JGI25163J39215_1001532 | 3300002771 | Bacteria | 3590 |
| 10 | JGI25164J39214_1000051 | 3300002772 | Bacteria | 122377 |
| 11 | JGI25164J39214_1000968 | 3300002772 | Bacteria | 9177 |
| 12 | JGI25165J46597_1000091 | 3300003214 | Bacteria | 167941 |
| 13 | JGI25165J46597_1000362 | 3300003214 | Bacteria | 50814 |
| 14 | Ga0055538_1000090 | 3300003751 | Bacteria | 78300 |
| 15 | Ga0055539_1000134 | 3300003752 | Bacteria | 78300 |
| 16 | Ga0055533_1000138 | 3300003756 | Bacteria | 78275 |
| 17 | Ga0055532_1000142 | 3300003758 | Bacteria | 69999 |
| 18 | Ga0055525_1000183 | 3300003759 | Bacteria | 78300 |
| 19 | Ga0055536_1003164 | 3300003781 | Bacteria | 8924 |
| 20 | Ga0055536_1003707 | 3300003781 | Bacteria | 8103 |
| 21 | Ga0055536_1006059 | 3300003781 | Bacteria | 5733 |
| 22 | Ga0055530_10001052 | 3300003791 | Bacteria | 21886 |
| 23 | Ga0055530_10005782 | 3300003791 | Bacteria | 5742 |
| 24 | Ga0055530_10008091 | 3300003791 | Bacteria | 4281 |
| 25 | Ga0055530_10008522 | 3300003791 | Bacteria | 4091 |
| 26 | Ga0055540_1000761 | 3300003792 | Bacteria | 21886 |
| 27 | Ga0055540_1003543 | 3300003792 | Bacteria | 7476 |
| 28 | Ga0055540_1005018 | 3300003792 | Bacteria | 5748 |
| 29 | Ga0055531_10000155 | 3300003794 | Bacteria | 79002 |
| 30 | Ga0055541_1000089 | 3300003841 | Bacteria | 78275 |
| 31 | Ga0058692_1011241 | 3300003856 | Bacteria | 2172 |
| 32 | Ga0065714_10015950 | 3300005288 | Bacteria | 1548 |
| 33 | Ga0065714_10065661 | 3300005288 | Bacteria | 8972 |
| 34 | Ga0065714_10071039 | 3300005288 | Bacteria | 3690 |
| 35 | Ga0065714_10074186 | 3300005288 | Bacteria | 3070 |
| 36 | Ga0065714_10075251 | 3300005288 | Bacteria | 2929 |
| 37 | Ga0065714_10080165 | 3300005288 | Bacteria | 2459 |
| 38 | Ga0065714_10087068 | 3300005288 | Bacteria | 2075 |
| 39 | Ga0065714_10088161 | 3300005288 | Bacteria | 2028 |
| 40 | Ga0065704_10082309 | 3300005289 | Bacteria | 3621 |
| 41 | Ga0065704_10116021 | 3300005289 | Bacteria | 1861 |
| 42 | Ga0065712_10069003 | 3300005290 | Bacteria | 8311 |
| 43 | Ga0065712_10074271 | 3300005290 | Bacteria | 4139 |
| 44 | Ga0065715_10009547 | 3300005293 | Bacteria | 3788 |
| 45 | Ga0070670_100001904 | 3300005331 | Bacteria | 17072 |
| 46 | Ga0070670_100028185 | 3300005331 | Bacteria | 4833 |
| 47 | Ga0070666_10283346 | 3300005335 | Bacteria | 1178 |
| 48 | Ga0070661_100001382 | 3300005344 | Bacteria | 16961 |
| 49 | Ga0070669_100014474 | 3300005353 | Bacteria | 5613 |
| 50 | Ga0070662_100004011 | 3300005457 | Bacteria | 9231 |
| 51 | Ga0068853_100041377 | 3300005539 | Bacteria | 3936 |
| 52 | Ga0070665_100340348 | 3300005548 | Bacteria | 1505 |
| 53 | Ga0070664_100048684 | 3300005564 | Bacteria | 3582 |
| 54 | Ga0068854_100050643 | 3300005578 | Bacteria | 2973 |
| 55 | Ga0068851_10000270 | 3300005834 | Bacteria | 24310 |
| 56 | Ga0075364_10058896 | 3300006051 | Bacteria | 2518 |
| 57 | Ga0075364_10273768 | 3300006051 | Bacteria | 1148 |
| 58 | Ga0075432_10001936 | 3300006058 | Bacteria | 6873 |
| 59 | Ga0075432_10020863 | 3300006058 | Bacteria | 2240 |
| 60 | Ga0075432_10035805 | 3300006058 | Bacteria | 1724 |
| 61 | Ga0075432_10037037 | 3300006058 | Bacteria | 1697 |
| 62 | Ga0075362_10149442 | 3300006177 | Bacteria | 1120 |
| 63 | Ga0075369_10011307 | 3300006186 | Bacteria | 3510 |
| 64 | Ga0075436_100044737 | 3300006914 | Bacteria | 3053 |
| 65 | Ga0075436_100118565 | 3300006914 | Bacteria | 1850 |
| 66 | Ga0099823_1025634 | 3300006944 | Bacteria | 5260 |
| 67 | Ga0079104_1000124 | 3300006946 | Bacteria | 110752 |
| 68 | Ga0079104_1000346 | 3300006946 | Bacteria | 55624 |
| 69 | Ga0079104_1036220 | 3300006946 | Bacteria | 1186 |
| 70 | Ga0105251_10001086 | 3300009011 | Bacteria | 23692 |
| 71 | Ga0105251_10007770 | 3300009011 | Bacteria | 6537 |
| 72 | Ga0105251_10010898 | 3300009011 | Bacteria | 5231 |
| 73 | Ga0105251_10011710 | 3300009011 | Bacteria | 4997 |
| 74 | Ga0105251_10013936 | 3300009011 | Bacteria | 4471 |
| 75 | Ga0105251_10014962 | 3300009011 | Bacteria | 4259 |
| 76 | Ga0105251_10016094 | 3300009011 | Bacteria | 4055 |
| 77 | Ga0105251_10037125 | 3300009011 | Bacteria | 2393 |
| 78 | Ga0105251_10048943 | 3300009011 | Bacteria | 2025 |
| 79 | Ga0105251_10079967 | 3300009011 | Bacteria | 1512 |
| 80 | Ga0105251_10091597 | 3300009011 | Bacteria | 1396 |
| 81 | Ga0105251_10131838 | 3300009011 | Bacteria | 1132 |
| 82 | Ga0105244_10001463 | 3300009036 | Bacteria | 19065 |
| 83 | Ga0105244_10001906 | 3300009036 | Bacteria | 16204 |
| 84 | Ga0105244_10016257 | 3300009036 | Bacteria | 4242 |
| 85 | Ga0105244_10020060 | 3300009036 | Bacteria | 3717 |
| 86 | Ga0105244_10020995 | 3300009036 | Bacteria | 3619 |
| 87 | Ga0105244_10022792 | 3300009036 | Bacteria | 3443 |
| 88 | Ga0105244_10025803 | 3300009036 | Bacteria | 3188 |
| 89 | Ga0105244_10035892 | 3300009036 | Bacteria | 2601 |
| 90 | Ga0105244_10059634 | 3300009036 | Bacteria | 1923 |
| 91 | Ga0105244_10079174 | 3300009036 | Bacteria | 1629 |
| 92 | Ga0105244_10113392 | 3300009036 | Bacteria | 1317 |
| 93 | Ga0105250_10002971 | 3300009092 | Bacteria | 8243 |
| 94 | Ga0105250_10010454 | 3300009092 | Bacteria | 3867 |
| 95 | Ga0105250_10023751 | 3300009092 | Bacteria | 2471 |
| 96 | Ga0105250_10036496 | 3300009092 | Bacteria | 1973 |
| 97 | Ga0105250_10079966 | 3300009092 | Bacteria | 1324 |
| 98 | Ga0105250_10093430 | 3300009092 | Bacteria | 1225 |
| 99 | Ga0105243_10006610 | 3300009148 | Bacteria | 8953 |
| 100 | Ga0105243_10020166 | 3300009148 | Bacteria | 5054 |
| 101 | Ga0105243_10039758 | 3300009148 | Bacteria | 3669 |
| 102 | Ga0105243_10178584 | 3300009148 | Bacteria | 1844 |
| 103 | Ga0105243_10343075 | 3300009148 | Bacteria | 1369 |
| 104 | Ga0105242_10000806 | 3300009176 | Bacteria | 24302 |
| 105 | Ga0105248_10051491 | 3300009177 | Bacteria | 4620 |
| 106 | Ga0105237_10001117 | 3300009545 | Bacteria | 35949 |
| 107 | Ga0105246_10000955 | 3300011119 | Bacteria | 16543 |
| 108 | Ga0105246_10013949 | 3300011119 | Bacteria | 5045 |
| 109 | Ga0105246_10017697 | 3300011119 | Bacteria | 4532 |
| 110 | Ga0157345_1000373 | 3300012498 | Bacteria | 4959 |
| 111 | Ga0157373_10008126 | 3300013100 | Bacteria | 7802 |
| 112 | Ga0157373_10014225 | 3300013100 | Bacteria | 5836 |
| 113 | Ga0157373_10038396 | 3300013100 | Bacteria | 3432 |
| 114 | Ga0157373_10040410 | 3300013100 | Bacteria | 3338 |
| 115 | Ga0157373_10048024 | 3300013100 | Bacteria | 3043 |
| 116 | Ga0157373_10053698 | 3300013100 | Bacteria | 2865 |
| 117 | Ga0157373_10057643 | 3300013100 | Bacteria | 2755 |
| 118 | Ga0157373_10058053 | 3300013100 | Bacteria | 2744 |
| 119 | Ga0157371_10000539 | 3300013102 | Bacteria | 45066 |
| 120 | Ga0157371_10031615 | 3300013102 | Bacteria | 3814 |
| 121 | Ga0157371_10046483 | 3300013102 | Bacteria | 3087 |
| 122 | Ga0157370_10000898 | 3300013104 | Bacteria | 37747 |
| 123 | Ga0157370_10011567 | 3300013104 | Bacteria | 9213 |
| 124 | Ga0157370_10062076 | 3300013104 | Bacteria | 3545 |
| 125 | Ga0157370_10065776 | 3300013104 | Bacteria | 3429 |
| 126 | Ga0157370_10070770 | 3300013104 | Bacteria | 3292 |
| 127 | Ga0157370_10172419 | 3300013104 | Bacteria | 2011 |
| 128 | Ga0157370_10181109 | 3300013104 | Bacteria | 1958 |
| 129 | Ga0157370_10191978 | 3300013104 | Bacteria | 1896 |
| 130 | Ga0157370_10381100 | 3300013104 | Bacteria | 1299 |
| 131 | Ga0157370_10434233 | 3300013104 | Bacteria | 1208 |
| 132 | Ga0157369_10024274 | 3300013105 | Bacteria | 6747 |
| 133 | Ga0157369_10040608 | 3300013105 | Bacteria | 5079 |
| 134 | Ga0157369_10075729 | 3300013105 | Bacteria | 3607 |
| 135 | Ga0157369_10101787 | 3300013105 | Bacteria | 3061 |
| 136 | Ga0157369_10127285 | 3300013105 | Bacteria | 2699 |
| 137 | Ga0157369_10221937 | 3300013105 | Bacteria | 1978 |
| 138 | Ga0157369_10249738 | 3300013105 | Bacteria | 1852 |
| 139 | Ga0163162_10001711 | 3300013306 | Bacteria | 20568 |
| 140 | Ga0163162_10068222 | 3300013306 | Bacteria | 3607 |
| 141 | Ga0163162_10590839 | 3300013306 | Bacteria | 1237 |
| 142 | Ga0157372_10003837 | 3300013307 | Bacteria | 16155 |
| 143 | Ga0157372_10064792 | 3300013307 | Bacteria | 4101 |
| 144 | Ga0157375_10014826 | 3300013308 | Bacteria | 6965 |
| 145 | Ga0157375_10066899 | 3300013308 | Bacteria | 3589 |
| 146 | Ga0157375_10152419 | 3300013308 | Bacteria | 2448 |
| 147 | Ga0157375_10226066 | 3300013308 | Bacteria | 2030 |
| 148 | Ga0157375_10304754 | 3300013308 | Bacteria | 1757 |
| 149 | Ga0182008_10000220 | 3300014497 | Bacteria | 44813 |
| 150 | Ga0182008_10012275 | 3300014497 | Bacteria | 4523 |
| 151 | Ga0182008_10018268 | 3300014497 | Bacteria | 3631 |
| 152 | Ga0182008_10018497 | 3300014497 | Bacteria | 3607 |
| 153 | Ga0182008_10018951 | 3300014497 | Bacteria | 3557 |
| 154 | Ga0182008_10026399 | 3300014497 | Bacteria | 2945 |
| 155 | Ga0182008_10026408 | 3300014497 | Bacteria | 2945 |
| 156 | Ga0182008_10029604 | 3300014497 | Bacteria | 2766 |
| 157 | Ga0182008_10029652 | 3300014497 | Bacteria | 2763 |
| 158 | Ga0182006_1006014 | 3300015261 | Bacteria | 5684 |
| 159 | Ga0182006_1012783 | 3300015261 | Bacteria | 3664 |
| 160 | Ga0182006_1013548 | 3300015261 | Bacteria | 3536 |
| 161 | Ga0182006_1021236 | 3300015261 | Bacteria | 2709 |
| 162 | Ga0182006_1024467 | 3300015261 | Bacteria | 2490 |
| 163 | Ga0182006_1031212 | 3300015261 | Bacteria | 2149 |
| 164 | Ga0182006_1077419 | 3300015261 | Bacteria | 1220 |
| 165 | Ga0182007_10008644 | 3300015262 | Bacteria | 4167 |
| 166 | Ga0182007_10015170 | 3300015262 | Bacteria | 2881 |
| 167 | Ga0182005_1006302 | 3300015265 | Bacteria | 3639 |
| 168 | Ga0182005_1014124 | 3300015265 | Bacteria | 2240 |
| 169 | Ga0182005_1014361 | 3300015265 | Bacteria | 2216 |
| 170 | Ga0182005_1023058 | 3300015265 | Bacteria | 1704 |
| 171 | Ga0182005_1030589 | 3300015265 | Bacteria | 1467 |
| 172 | Ga0163161_10033767 | 3300017792 | Bacteria | 3656 |
| 173 | Ga0163161_10035439 | 3300017792 | Bacteria | 3572 |
| 174 | Ga0163161_10036141 | 3300017792 | Bacteria | 3537 |
| 175 | Ga0163161_10042656 | 3300017792 | Bacteria | 3264 |
| 176 | Ga0163161_10057211 | 3300017792 | Bacteria | 2833 |
| 177 | Ga0163161_10077733 | 3300017792 | Bacteria | 2438 |
| 178 | Ga0163161_10190008 | 3300017792 | Bacteria | 1578 |
| 179 | Ga0163161_10192177 | 3300017792 | Bacteria | 1570 |
| 180 | Ga0163161_10286002 | 3300017792 | Bacteria | 1295 |
| 181 | Ga0163161_10298421 | 3300017792 | Bacteria | 1268 |
| 182 | Ga0209435_100860 | 3300025206 | Bacteria | 4693 |
| 183 | Ga0209760_100043 | 3300025207 | Bacteria | 113964 |
| 184 | Ga0209760_100266 | 3300025207 | Bacteria | 19495 |
| 185 | Ga0209784_100040 | 3300025224 | Bacteria | 231812 |
| 186 | Ga0209566_100051 | 3300025225 | Bacteria | 231920 |
| 187 | Ga0209674_100072 | 3300025226 | Bacteria | 231812 |
| 188 | Ga0209147_100067 | 3300025229 | Bacteria | 231812 |
| 189 | Ga0209563_100073 | 3300025230 | Bacteria | 231920 |
| 190 | Ga0209563_100986 | 3300025230 | Bacteria | 8338 |
| 191 | Ga0207427_100047 | 3300025231 | Bacteria | 240409 |
| 192 | Ga0207427_100074 | 3300025231 | Bacteria | 153455 |
| 193 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 194 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 195 | Ga0209258_100585 | 3300025242 | Bacteria | 30446 |
| 196 | Ga0209646_1000325 | 3300025246 | Bacteria | 36642 |
| 197 | Ga0209677_100121 | 3300025253 | Bacteria | 80378 |
| 198 | Ga0209759_1005254 | 3300025256 | Bacteria | 4592 |
| 199 | Ga0209759_1016975 | 3300025256 | Bacteria | 1812 |
| 200 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 201 | Ga0209233_1000105 | 3300025261 | Bacteria | 272035 |
| 202 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 203 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 204 | Ga0209676_1000223 | 3300025292 | Bacteria | 124359 |
| 205 | Ga0209676_1000697 | 3300025292 | Bacteria | 47244 |
| 206 | Ga0209676_1008685 | 3300025292 | Bacteria | 4490 |
| 207 | Ga0209676_1014110 | 3300025292 | Bacteria | 3025 |
| 208 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 209 | Ga0209050_1000081 | 3300025298 | Bacteria | 267533 |
| 210 | Ga0209050_1000214 | 3300025298 | Bacteria | 129270 |
| 211 | Ga0209050_1004712 | 3300025298 | Bacteria | 9042 |
| 212 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 213 | Ga0209051_1000104 | 3300025303 | Bacteria | 161001 |
| 214 | Ga0209051_1000163 | 3300025303 | Bacteria | 124249 |
| 215 | Ga0209257_1000040 | 3300025304 | Bacteria | 538759 |
| 216 | Ga0209257_1010723 | 3300025304 | Bacteria | 4567 |
| 217 | Ga0207656_10000155 | 3300025321 | Bacteria | 25331 |
| 218 | Ga0207696_1000023 | 3300025711 | Bacteria | 422195 |
| 219 | Ga0207696_1000097 | 3300025711 | Bacteria | 175696 |
| 220 | Ga0207696_1000171 | 3300025711 | Bacteria | 102599 |
| 221 | Ga0207696_1006861 | 3300025711 | Bacteria | 4531 |
| 222 | Ga0207696_1010580 | 3300025711 | Bacteria | 3373 |
| 223 | Ga0207696_1011801 | 3300025711 | Bacteria | 3126 |
| 224 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 225 | Ga0207655_1000286 | 3300025728 | Bacteria | 77168 |
| 226 | Ga0207655_1000654 | 3300025728 | Bacteria | 41218 |
| 227 | Ga0207655_1002408 | 3300025728 | Bacteria | 15232 |
| 228 | Ga0207655_1002485 | 3300025728 | Bacteria | 14924 |
| 229 | Ga0207655_1002775 | 3300025728 | Bacteria | 13638 |
| 230 | Ga0207655_1004224 | 3300025728 | Bacteria | 10295 |
| 231 | Ga0207655_1005310 | 3300025728 | Bacteria | 8814 |
| 232 | Ga0207655_1008889 | 3300025728 | Bacteria | 6312 |
| 233 | Ga0207655_1011696 | 3300025728 | Bacteria | 5198 |
| 234 | Ga0207655_1017604 | 3300025728 | Bacteria | 3845 |
| 235 | Ga0207655_1018017 | 3300025728 | Bacteria | 3774 |
| 236 | Ga0207655_1031047 | 3300025728 | Bacteria | 2471 |
| 237 | Ga0207655_1047383 | 3300025728 | Bacteria | 1774 |
| 238 | Ga0207655_1062903 | 3300025728 | Bacteria | 1425 |
| 239 | Ga0207713_1000482 | 3300025735 | Bacteria | 41325 |
| 240 | Ga0207713_1000530 | 3300025735 | Bacteria | 38258 |
| 241 | Ga0207713_1001461 | 3300025735 | Bacteria | 18798 |
| 242 | Ga0207713_1002221 | 3300025735 | Bacteria | 14387 |
| 243 | Ga0207713_1005180 | 3300025735 | Bacteria | 8236 |
| 244 | Ga0207713_1005193 | 3300025735 | Bacteria | 8222 |
| 245 | Ga0207713_1007061 | 3300025735 | Bacteria | 6726 |
| 246 | Ga0207713_1010578 | 3300025735 | Bacteria | 5096 |
| 247 | Ga0207713_1015187 | 3300025735 | Bacteria | 3965 |
| 248 | Ga0207713_1015463 | 3300025735 | Bacteria | 3915 |
| 249 | Ga0207713_1017765 | 3300025735 | Bacteria | 3546 |
| 250 | Ga0207713_1020189 | 3300025735 | Bacteria | 3236 |
| 251 | Ga0207713_1059555 | 3300025735 | Bacteria | 1465 |
| 252 | Ga0207671_10000989 | 3300025914 | Bacteria | 35031 |
| 253 | Ga0207649_10000041 | 3300025920 | Bacteria | 117781 |
| 254 | Ga0207681_10001672 | 3300025923 | Bacteria | 14282 |
| 255 | Ga0207681_10010641 | 3300025923 | Bacteria | 5641 |
| 256 | Ga0207650_10001409 | 3300025925 | Bacteria | 17327 |
| 257 | Ga0207650_10037320 | 3300025925 | Bacteria | 3540 |
| 258 | Ga0207706_10024092 | 3300025933 | Bacteria | 5458 |
| 259 | Ga0207686_10006378 | 3300025934 | Bacteria | 6346 |
| 260 | Ga0207709_10000035 | 3300025935 | Bacteria | 300968 |
| 261 | Ga0207709_10000821 | 3300025935 | Bacteria | 24022 |
| 262 | Ga0207711_10045895 | 3300025941 | Bacteria | 3733 |
| 263 | Ga0207679_10000018 | 3300025945 | Bacteria | 238375 |
| 264 | Ga0207640_10039908 | 3300025981 | Bacteria | 2974 |
| 265 | Ga0207658_10075143 | 3300025986 | Bacteria | 2570 |
| 266 | Ga0207639_10007037 | 3300026041 | Bacteria | 7670 |
| 267 | Ga0207678_10175953 | 3300026067 | Bacteria | 1827 |
| 268 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 269 | Ga0209281_1000077 | 3300027111 | Bacteria | 262887 |
| 270 | Ga0209281_1008349 | 3300027111 | Bacteria | 2522 |
| 271 | Ga0209281_1009302 | 3300027111 | Bacteria | 2314 |
| 272 | Ga0209389_1000078 | 3300027296 | Bacteria | 90574 |
| 273 | Ga0209371_1000523 | 3300027312 | Bacteria | 36608 |
| 274 | Ga0209999_1004680 | 3300027543 | Bacteria | 2456 |
| 275 | Ga0209982_1000266 | 3300027552 | Bacteria | 6345 |
| 276 | Ga0209983_1000169 | 3300027665 | Bacteria | 12341 |
| 277 | Ga0209974_10004883 | 3300027876 | Bacteria | 4745 |
| 278 | Ga0207428_10040376 | 3300027907 | Bacteria | 3786 |
| 279 | Ga0207428_10104958 | 3300027907 | Bacteria | 2180 |
| 280 | Ga0268266_10081176 | 3300028379 | Bacteria | 2827 |
| 281 | Ga0307517_10166685 | 3300028786 | Bacteria | 1461 |
| 282 | Ga0268256_1000435 | 3300030500 | Bacteria | 37307 |
| 283 | Ga0307511_10117276 | 3300030521 | Bacteria | 1664 |
| 284 | Ga0316178_1126744 | 3300030735 | Bacteria | 26718 |
| 285 | Ga0316183_1027011 | 3300030742 | Bacteria | 2423 |
| 286 | Ga0316183_1108964 | 3300030742 | Bacteria | 2265 |
| 287 | Ga0316181_1020959 | 3300030744 | Bacteria | 1669 |
| 288 | Ga0316181_1243951 | 3300030744 | Bacteria | 1949 |
| 289 | Ga0307509_10101691 | 3300031507 | Bacteria | 2908 |
| 290 | Ga0307408_100000004 | 3300031548 | Bacteria | 572889 |
| 291 | Ga0307408_100022328 | 3300031548 | Bacteria | 4298 |
| 292 | Ga0307408_100024028 | 3300031548 | Bacteria | 4156 |
| 293 | Ga0307408_100051672 | 3300031548 | Bacteria | 2961 |
| 294 | Ga0307408_100055724 | 3300031548 | Bacteria | 2863 |
| 295 | Ga0307405_10003193 | 3300031731 | Bacteria | 7464 |
| 296 | Ga0307405_10026403 | 3300031731 | Bacteria | 3349 |
| 297 | Ga0307405_10035767 | 3300031731 | Bacteria | 2970 |
| 298 | Ga0307413_10128044 | 3300031824 | Bacteria | 1732 |
| 299 | Ga0307413_10129031 | 3300031824 | Bacteria | 1727 |
| 300 | Ga0307406_10009019 | 3300031901 | Bacteria | 5578 |
| 301 | Ga0307412_10018971 | 3300031911 | Bacteria | 4152 |
| 302 | Ga0307412_10038204 | 3300031911 | Bacteria | 3089 |
| 303 | Ga0307412_10043291 | 3300031911 | Bacteria | 2930 |
| 304 | Ga0307412_10081230 | 3300031911 | Bacteria | 2241 |
| 305 | Ga0307412_10194272 | 3300031911 | Bacteria | 1536 |
| 306 | Ga0307416_100096082 | 3300032002 | Bacteria | 2561 |
| 307 | Ga0307416_100240226 | 3300032002 | Bacteria | 1754 |
| 308 | Ga0307414_10108775 | 3300032004 | Bacteria | 2104 |
| 309 | Ga0307414_10284991 | 3300032004 | Bacteria | 1390 |
| 310 | Ga0307411_10012048 | 3300032005 | Bacteria | 4697 |
| 311 | Ga0307411_10043657 | 3300032005 | Bacteria | 2869 |
| 312 | Ga0307510_10065677 | 3300033180 | Bacteria | 3671 |
| 313 | Ga0307510_10129647 | 3300033180 | Bacteria | 2200 |
| 314 | Ga0395905_0103490 | 3300037471 | Bacteria | 2673 |
| 315 | Ga0439436_0003290 | 3300041404 | Bacteria | 4901 |
| 316 | Ga0439438_003561 | 3300041405 | Bacteria | 6250 |
| 317 | Ga0439438_003697 | 3300041405 | Bacteria | 6086 |
| 318 | Ga0439438_004126 | 3300041405 | Bacteria | 5670 |
| 319 | Ga0439438_006083 | 3300041405 | Bacteria | 4322 |
| 320 | Ga0439438_006841 | 3300041405 | Bacteria | 3975 |
| 321 | Ga0439438_007752 | 3300041405 | Bacteria | 3633 |
| 322 | Ga0439438_010178 | 3300041405 | Bacteria | 2988 |
| 323 | Ga0439438_010309 | 3300041405 | Bacteria | 2959 |
| 324 | Ga0439438_011658 | 3300041405 | Bacteria | 2727 |
| 325 | Ga0439438_012775 | 3300041405 | Bacteria | 2560 |
| 326 | Ga0439438_013630 | 3300041405 | Bacteria | 2446 |
| 327 | Ga0439438_015864 | 3300041405 | Bacteria | 2203 |
| 328 | Ga0439447_004923 | 3300041407 | Bacteria | 4517 |
| 329 | Ga0439447_004954 | 3300041407 | Bacteria | 4500 |
| 330 | Ga0439447_005638 | 3300041407 | Bacteria | 4143 |
| 331 | Ga0439447_007432 | 3300041407 | Bacteria | 3479 |
| 332 | Ga0439447_009069 | 3300041407 | Bacteria | 3036 |
| 333 | Ga0439447_010505 | 3300041407 | Bacteria | 2743 |
| 334 | Ga0439447_035234 | 3300041407 | Bacteria | 1241 |
| 335 | Ga0439447_037560 | 3300041407 | Bacteria | 1193 |
| 336 | Ga0439466_0002783 | 3300041411 | Bacteria | 6845 |
| 337 | Ga0439466_0003656 | 3300041411 | Bacteria | 5936 |
| 338 | Ga0439466_0004071 | 3300041411 | Bacteria | 5649 |
| 339 | Ga0439466_0004606 | 3300041411 | Bacteria | 5298 |
| 340 | Ga0439466_0006152 | 3300041411 | Bacteria | 4571 |
| 341 | Ga0439466_0007214 | 3300041411 | Bacteria | 4207 |
| 342 | Ga0439466_0007710 | 3300041411 | Bacteria | 4067 |
| 343 | Ga0439466_0008146 | 3300041411 | Bacteria | 3951 |
| 344 | Ga0439466_0012617 | 3300041411 | Bacteria | 3107 |
| 345 | Ga0439466_0013919 | 3300041411 | Bacteria | 2938 |
| 346 | Ga0439466_0017128 | 3300041411 | Bacteria | 2612 |
| 347 | Ga0439465_0057524 | 3300041413 | Bacteria | 1283 |
| 348 | Ga0439431_0004892 | 3300041997 | Bacteria | 2953 |
| 349 | Ga0439445_0006188 | 3300042004 | Bacteria | 2747 |
| 350 | Ga0439445_0019109 | 3300042004 | Bacteria | 1705 |
| 351 | Ga0439432_003233 | 3300042006 | Bacteria | 6064 |
| 352 | Ga0439432_003656 | 3300042006 | Bacteria | 5685 |
| 353 | Ga0439432_003695 | 3300042006 | Bacteria | 5660 |
| 354 | Ga0439432_005575 | 3300042006 | Bacteria | 4525 |
| 355 | Ga0439432_006290 | 3300042006 | Bacteria | 4246 |
| 356 | Ga0439432_007166 | 3300042006 | Bacteria | 3962 |
| 357 | Ga0439432_008692 | 3300042006 | Bacteria | 3559 |
| 358 | Ga0439432_021400 | 3300042006 | Bacteria | 2144 |
| 359 | Ga0439432_031598 | 3300042006 | Bacteria | 1711 |
| 360 | Ga0439432_054558 | 3300042006 | Bacteria | 1241 |
| 361 | Ga0439432_086244 | 3300042006 | Bacteria | 947 |
| 362 | Ga0439451_002373 | 3300042009 | Bacteria | 3813 |
| 363 | Ga0439451_004086 | 3300042009 | Bacteria | 2964 |
| 364 | Ga0439451_005307 | 3300042009 | Bacteria | 2625 |
| 365 | Ga0439451_025241 | 3300042009 | Bacteria | 1197 |
| 366 | Ga0439452_001600 | 3300042010 | Bacteria | 8942 |
| 367 | Ga0439452_002058 | 3300042010 | Bacteria | 7642 |
| 368 | Ga0439452_003163 | 3300042010 | Bacteria | 5830 |
| 369 | Ga0439452_003228 | 3300042010 | Bacteria | 5768 |
| 370 | Ga0439452_004619 | 3300042010 | Bacteria | 4576 |
| 371 | Ga0439452_005219 | 3300042010 | Bacteria | 4217 |
| 372 | Ga0439452_005695 | 3300042010 | Bacteria | 3983 |
| 373 | Ga0439452_020287 | 3300042010 | Bacteria | 1746 |
| 374 | Ga0439452_021242 | 3300042010 | Bacteria | 1694 |
| 375 | Ga0439456_000063 | 3300042013 | Bacteria | 38227 |
| 376 | Ga0439456_007269 | 3300042013 | Bacteria | 2269 |
| 377 | Ga0439456_019984 | 3300042013 | Bacteria | 1411 |
| 378 | Ga0439463_000743 | 3300042016 | Bacteria | 9024 |
| 379 | Ga0439463_001279 | 3300042016 | Bacteria | 6715 |
| 380 | Ga0439463_027241 | 3300042016 | Bacteria | 1438 |
| 381 | Ga0439463_029054 | 3300042016 | Bacteria | 1393 |
| 382 | Ga0450911_000001 | 3300042115 | Bacteria | 311012 |
| 383 | Ga0450911_000890 | 3300042115 | Bacteria | 8036 |
| 384 | Ga0450911_001929 | 3300042115 | Bacteria | 4347 |
| 385 | Ga0450911_003645 | 3300042115 | Bacteria | 2672 |
| 386 | Ga0450911_011899 | 3300042115 | Bacteria | 1182 |
| 387 | Ga0450920_002436 | 3300042122 | Bacteria | 3165 |
| 388 | Ga0450922_000421 | 3300042124 | Bacteria | 4551 |
| 389 | Ga0450890_000787 | 3300042127 | Bacteria | 4587 |
| 390 | Ga0450891_001948 | 3300042129 | Bacteria | 2113 |
| 391 | Ga0450900_002637 | 3300042136 | Bacteria | 1922 |
| 392 | Ga0450902_013351 | 3300042137 | Bacteria | 1323 |
| 393 | Ga0450903_001824 | 3300042138 | Bacteria | 3887 |
| 394 | Ga0450903_002073 | 3300042138 | Bacteria | 3606 |
| 395 | Ga0450903_003385 | 3300042138 | Bacteria | 2762 |
| 396 | Ga0450903_005803 | 3300042138 | Bacteria | 2061 |
| 397 | Ga0450904_000014 | 3300042139 | Bacteria | 41423 |
| 398 | Ga0450904_001675 | 3300042139 | Bacteria | 2961 |
| 399 | Ga0450904_002907 | 3300042139 | Bacteria | 1933 |
| 400 | Ga0450904_011419 | 3300042139 | Bacteria | 878 |
| 401 | Ga0450905_002102 | 3300042142 | Bacteria | 2546 |
| 402 | Ga0450905_002296 | 3300042142 | Bacteria | 2453 |
| 403 | Ga0450906_001168 | 3300042145 | Bacteria | 5808 |
| 404 | Ga0450906_009726 | 3300042145 | Bacteria | 1827 |
| 405 | Ga0450907_001048 | 3300042146 | Bacteria | 6460 |
| 406 | Ga0450907_001714 | 3300042146 | Bacteria | 4562 |
| 407 | Ga0450907_001853 | 3300042146 | Bacteria | 4340 |
| 408 | Ga0439446_0000095 | 3300042156 | Bacteria | 15054 |
| 409 | Ga0439446_0004205 | 3300042156 | Bacteria | 3634 |
| 410 | Ga0439446_0014427 | 3300042156 | Bacteria | 2181 |
| 411 | Ga0450908_002774 | 3300042184 | Bacteria | 3412 |
| 412 | Ga0450909_000126 | 3300042185 | Bacteria | 7798 |
| 413 | Ga0450909_002105 | 3300042185 | Bacteria | 2809 |
| 414 | Ga0450909_004635 | 3300042185 | Bacteria | 1964 |
| 415 | Ga0439434_0000449 | 3300042435 | Bacteria | 11741 |
| 416 | Ga0439434_0002370 | 3300042435 | Bacteria | 5473 |
| 417 | Ga0439460_0004229 | 3300042461 | Bacteria | 3496 |
| 418 | Ga0439460_0004727 | 3300042461 | Bacteria | 3322 |
| 419 | Ga0450916_000233 | 3300042530 | Bacteria | 4342 |
| 420 | Ga0450918_007003 | 3300042531 | Bacteria | 2004 |
| 421 | Ga0450901_000729 | 3300042533 | Bacteria | 3841 |
| 422 | Ga0450901_001466 | 3300042533 | Bacteria | 2683 |
| 423 | Ga0439440_0004576 | 3300042993 | Bacteria | 2721 |
| 424 | Ga0439440_0004831 | 3300042993 | Bacteria | 2658 |
| 425 | Ga0439440_0020699 | 3300042993 | Bacteria | 1477 |
| 426 | Ga0495617_004971 | 3300046452 | Bacteria | 4780 |
| 427 | Ga0495617_007793 | 3300046452 | Bacteria | 3705 |
| 428 | Ga0495617_008104 | 3300046452 | Bacteria | 3630 |
| 429 | Ga0495617_013457 | 3300046452 | Bacteria | 2785 |
| 430 | Ga0495617_016132 | 3300046452 | Bacteria | 2526 |
| 431 | Ga0495617_030098 | 3300046452 | Bacteria | 1825 |
| 432 | Ga0495617_042981 | 3300046452 | Bacteria | 1509 |
| 433 | Ga0495617_051088 | 3300046452 | Bacteria | 1374 |
| 434 | Ga0495617_057044 | 3300046452 | Bacteria | 1294 |
| 435 | Ga0495617_075689 | 3300046452 | Bacteria | 1104 |
| 436 | Ga0495627_000032 | 3300046453 | Bacteria | 224665 |
| 437 | Ga0495627_002374 | 3300046453 | Bacteria | 9173 |
| 438 | Ga0495627_006922 | 3300046453 | Bacteria | 4402 |
| 439 | Ga0495627_009358 | 3300046453 | Bacteria | 3611 |
| 440 | Ga0495627_011229 | 3300046453 | Bacteria | 3221 |
| 441 | Ga0495627_011614 | 3300046453 | Bacteria | 3154 |
| 442 | Ga0495627_012781 | 3300046453 | Bacteria | 2968 |
| 443 | Ga0495627_016358 | 3300046453 | Bacteria | 2540 |
| 444 | Ga0495627_025278 | 3300046453 | Bacteria | 1927 |
| 445 | Ga0495627_033159 | 3300046453 | Bacteria | 1620 |
| 446 | Ga0495627_039373 | 3300046453 | Bacteria | 1458 |
| 447 | Ga0495627_048018 | 3300046453 | Bacteria | 1293 |
| 448 | Ga0495603_0018622 | 3300046455 | Bacteria | 4201 |
| 449 | Ga0495603_0026577 | 3300046455 | Bacteria | 3496 |
| 450 | Ga0495603_0046090 | 3300046455 | Bacteria | 2598 |
| 451 | Ga0495590_0003806 | 3300046457 | Bacteria | 6138 |
| 452 | Ga0495590_0008257 | 3300046457 | Bacteria | 3980 |
| 453 | Ga0495590_0010563 | 3300046457 | Bacteria | 3465 |
| 454 | Ga0495590_0013440 | 3300046457 | Bacteria | 3009 |
| 455 | Ga0495590_0015802 | 3300046457 | Bacteria | 2732 |
| 456 | Ga0495590_0026213 | 3300046457 | Bacteria | 2047 |
| 457 | Ga0495590_0063741 | 3300046457 | Bacteria | 1290 |
| 458 | Ga0495590_0069750 | 3300046457 | Bacteria | 1232 |
| 459 | Ga0495591_000009 | 3300046458 | Bacteria | 331626 |
| 460 | Ga0495591_001087 | 3300046458 | Bacteria | 18097 |
| 461 | Ga0495591_003049 | 3300046458 | Bacteria | 8898 |
| 462 | Ga0495591_005865 | 3300046458 | Bacteria | 5572 |
| 463 | Ga0495591_007475 | 3300046458 | Bacteria | 4639 |
| 464 | Ga0495591_009201 | 3300046458 | Bacteria | 3948 |
| 465 | Ga0495591_009993 | 3300046458 | Bacteria | 3720 |
| 466 | Ga0495591_010250 | 3300046458 | Bacteria | 3647 |
| 467 | Ga0495591_010459 | 3300046458 | Bacteria | 3595 |
| 468 | Ga0495591_011394 | 3300046458 | Bacteria | 3370 |
| 469 | Ga0495591_013464 | 3300046458 | Bacteria | 2990 |
| 470 | Ga0495591_013752 | 3300046458 | Bacteria | 2943 |
| 471 | Ga0495591_014218 | 3300046458 | Bacteria | 2871 |
| 472 | Ga0495591_020272 | 3300046458 | Bacteria | 2200 |
| 473 | Ga0495591_021156 | 3300046458 | Bacteria | 2130 |
| 474 | Ga0495591_021634 | 3300046458 | Bacteria | 2094 |
| 475 | Ga0495591_032551 | 3300046458 | Bacteria | 1550 |
| 476 | Ga0495591_046204 | 3300046458 | Bacteria | 1210 |
| 477 | Ga0495629_0014345 | 3300046459 | Bacteria | 5701 |
| 478 | Ga0495638_0007628 | 3300046460 | Bacteria | 7733 |
| 479 | Ga0495638_0007670 | 3300046460 | Bacteria | 7713 |
| 480 | Ga0495638_0028347 | 3300046460 | Bacteria | 3616 |
| 481 | Ga0495638_0029468 | 3300046460 | Bacteria | 3539 |
| 482 | Ga0495638_0033299 | 3300046460 | Bacteria | 3296 |
| 483 | Ga0495638_0039459 | 3300046460 | Bacteria | 2997 |
| 484 | Ga0495638_0042207 | 3300046460 | Bacteria | 2882 |
| 485 | Ga0495638_0042639 | 3300046460 | Bacteria | 2865 |
| 486 | Ga0495638_0048000 | 3300046460 | Bacteria | 2674 |
| 487 | Ga0495638_0049896 | 3300046460 | Bacteria | 2615 |
| 488 | Ga0495638_0051271 | 3300046460 | Bacteria | 2574 |
| 489 | Ga0495638_0052160 | 3300046460 | Bacteria | 2548 |
| 490 | Ga0495638_0128456 | 3300046460 | Bacteria | 1491 |
| 491 | Ga0495638_0161890 | 3300046460 | Bacteria | 1290 |
| 492 | Ga0495638_0185779 | 3300046460 | Bacteria | 1182 |
| 493 | Ga0495638_0185999 | 3300046460 | Bacteria | 1181 |
| 494 | Ga0495653_0018093 | 3300046463 | Bacteria | 5728 |
| 495 | Ga0495653_0040963 | 3300046463 | Bacteria | 3617 |
| 496 | Ga0495653_0057799 | 3300046463 | Bacteria | 2950 |
| 497 | Ga0495653_0121233 | 3300046463 | Bacteria | 1863 |
| 498 | Ga0495650_0001495 | 3300046471 | Bacteria | 22288 |
| 499 | Ga0495650_0009011 | 3300046471 | Bacteria | 5733 |
| 500 | Ga0495650_0009892 | 3300046471 | Bacteria | 5377 |
| 501 | Ga0495650_0011012 | 3300046471 | Bacteria | 4998 |
| 502 | Ga0495650_0014338 | 3300046471 | Bacteria | 4132 |
| 503 | Ga0495650_0016469 | 3300046471 | Bacteria | 3743 |
| 504 | Ga0495650_0017151 | 3300046471 | Bacteria | 3639 |
| 505 | Ga0495650_0023529 | 3300046471 | Bacteria | 2930 |
| 506 | Ga0495582_0019788 | 3300046473 | Bacteria | 3680 |
| 507 | Ga0495605_0000026 | 3300046474 | Bacteria | 221832 |
| 508 | Ga0495605_0000074 | 3300046474 | Bacteria | 128736 |
| 509 | Ga0495605_0000666 | 3300046474 | Bacteria | 26104 |
| 510 | Ga0495605_0001002 | 3300046474 | Bacteria | 19067 |
| 511 | Ga0495605_0002775 | 3300046474 | Bacteria | 10676 |
| 512 | Ga0495605_0008123 | 3300046474 | Bacteria | 5935 |
| 513 | Ga0495605_0009099 | 3300046474 | Bacteria | 5589 |
| 514 | Ga0495605_0020361 | 3300046474 | Bacteria | 3526 |
| 515 | Ga0495605_0031202 | 3300046474 | Bacteria | 2723 |
| 516 | Ga0495605_0033138 | 3300046474 | Bacteria | 2625 |
| 517 | Ga0495605_0034275 | 3300046474 | Bacteria | 2571 |
| 518 | Ga0495605_0042509 | 3300046474 | Bacteria | 2258 |
| 519 | Ga0495605_0048202 | 3300046474 | Bacteria | 2086 |
| 520 | Ga0495605_0061886 | 3300046474 | Bacteria | 1789 |
| 521 | Ga0495605_0088906 | 3300046474 | Bacteria | 1434 |
| 522 | Ga0495605_0117955 | 3300046474 | Bacteria | 1205 |
| 523 | Ga0495605_0119566 | 3300046474 | Bacteria | 1195 |
| 524 | Ga0495639_0001985 | 3300046475 | Bacteria | 9063 |
| 525 | Ga0495639_0025156 | 3300046475 | Bacteria | 2624 |
| 526 | Ga0495584_0007452 | 3300046491 | Bacteria | 5706 |
| 527 | Ga0495584_0012022 | 3300046491 | Bacteria | 4425 |
| 528 | Ga0495584_0012065 | 3300046491 | Bacteria | 4417 |
| 529 | Ga0495584_0013340 | 3300046491 | Bacteria | 4195 |
| 530 | Ga0495584_0014717 | 3300046491 | Bacteria | 3985 |
| 531 | Ga0495584_0015792 | 3300046491 | Bacteria | 3850 |
| 532 | Ga0495584_0017606 | 3300046491 | Bacteria | 3635 |
| 533 | Ga0495584_0027099 | 3300046491 | Bacteria | 2904 |
| 534 | Ga0495584_0040062 | 3300046491 | Bacteria | 2366 |
| 535 | Ga0495584_0049633 | 3300046491 | Bacteria | 2114 |
| 536 | Ga0495584_0085350 | 3300046491 | Bacteria | 1590 |
| 537 | Ga0495584_0137084 | 3300046491 | Bacteria | 1242 |
| 538 | Ga0495585_0004189 | 3300046492 | Bacteria | 9414 |
| 539 | Ga0495585_0013872 | 3300046492 | Bacteria | 4708 |
| 540 | Ga0495585_0018622 | 3300046492 | Bacteria | 4004 |
| 541 | Ga0495585_0022528 | 3300046492 | Bacteria | 3615 |
| 542 | Ga0495585_0022845 | 3300046492 | Bacteria | 3590 |
| 543 | Ga0495585_0028098 | 3300046492 | Bacteria | 3209 |
| 544 | Ga0495585_0033144 | 3300046492 | Bacteria | 2925 |
| 545 | Ga0495585_0036673 | 3300046492 | Bacteria | 2763 |
| 546 | Ga0495585_0045278 | 3300046492 | Bacteria | 2456 |
| 547 | Ga0495585_0047921 | 3300046492 | Bacteria | 2377 |
| 548 | Ga0495585_0105733 | 3300046492 | Bacteria | 1501 |
| 549 | Ga0495585_0145475 | 3300046492 | Bacteria | 1239 |
| 550 | Ga0495585_0189124 | 3300046492 | Bacteria | 1054 |
| 551 | Ga0495594_0004528 | 3300046499 | Bacteria | 7151 |
| 552 | Ga0495594_0010728 | 3300046499 | Bacteria | 4754 |
| 553 | Ga0495594_0021116 | 3300046499 | Bacteria | 3474 |
| 554 | Ga0495594_0027366 | 3300046499 | Bacteria | 3072 |
| 555 | Ga0495594_0034332 | 3300046499 | Bacteria | 2759 |
| 556 | Ga0495596_0002947 | 3300046500 | Bacteria | 8830 |
| 557 | Ga0495596_0024113 | 3300046500 | Bacteria | 2466 |
| 558 | Ga0495607_0000283 | 3300046501 | Bacteria | 54438 |
| 559 | Ga0495607_0001200 | 3300046501 | Bacteria | 23400 |
| 560 | Ga0495607_0001643 | 3300046501 | Bacteria | 19379 |
| 561 | Ga0495607_0012412 | 3300046501 | Bacteria | 5626 |
| 562 | Ga0495607_0016047 | 3300046501 | Bacteria | 4839 |
| 563 | Ga0495607_0022216 | 3300046501 | Bacteria | 3988 |
| 564 | Ga0495607_0023107 | 3300046501 | Bacteria | 3895 |
| 565 | Ga0495607_0024009 | 3300046501 | Bacteria | 3807 |
| 566 | Ga0495607_0025897 | 3300046501 | Bacteria | 3643 |
| 567 | Ga0495607_0026826 | 3300046501 | Bacteria | 3570 |
| 568 | Ga0495607_0036565 | 3300046501 | Bacteria | 2956 |
| 569 | Ga0495607_0040057 | 3300046501 | Bacteria | 2792 |
| 570 | Ga0495607_0040452 | 3300046501 | Bacteria | 2775 |
| 571 | Ga0495607_0049386 | 3300046501 | Bacteria | 2453 |
| 572 | Ga0495607_0050076 | 3300046501 | Bacteria | 2433 |
| 573 | Ga0495607_0055794 | 3300046501 | Bacteria | 2270 |
| 574 | Ga0495607_0065553 | 3300046501 | Bacteria | 2047 |
| 575 | Ga0495607_0082161 | 3300046501 | Bacteria | 1768 |
| 576 | Ga0495607_0121798 | 3300046501 | Bacteria | 1368 |
| 577 | Ga0495607_0122924 | 3300046501 | Bacteria | 1360 |
| 578 | Ga0495607_0132994 | 3300046501 | Bacteria | 1292 |
| 579 | Ga0495607_0136826 | 3300046501 | Bacteria | 1268 |
| 580 | Ga0495583_0000043 | 3300046506 | Bacteria | 230804 |
| 581 | Ga0495583_0002007 | 3300046506 | Bacteria | 18583 |
| 582 | Ga0495583_0004859 | 3300046506 | Bacteria | 9391 |
| 583 | Ga0495583_0012235 | 3300046506 | Bacteria | 4871 |
| 584 | Ga0495583_0013154 | 3300046506 | Bacteria | 4635 |
| 585 | Ga0495583_0018263 | 3300046506 | Bacteria | 3695 |
| 586 | Ga0495583_0018949 | 3300046506 | Bacteria | 3606 |
| 587 | Ga0495583_0019065 | 3300046506 | Bacteria | 3591 |
| 588 | Ga0495583_0021551 | 3300046506 | Bacteria | 3312 |
| 589 | Ga0495583_0022650 | 3300046506 | Bacteria | 3198 |
| 590 | Ga0495583_0037539 | 3300046506 | Bacteria | 2296 |
| 591 | Ga0495583_0040503 | 3300046506 | Bacteria | 2188 |
| 592 | Ga0495583_0042225 | 3300046506 | Bacteria | 2131 |
| 593 | Ga0495583_0070846 | 3300046506 | Bacteria | 1532 |
| 594 | Ga0495583_0104041 | 3300046506 | Bacteria | 1209 |
| 595 | Ga0495606_0000206 | 3300046507 | Bacteria | 103708 |
| 596 | Ga0495606_0000561 | 3300046507 | Bacteria | 59085 |
| 597 | Ga0495606_0004416 | 3300046507 | Bacteria | 14070 |
| 598 | Ga0495606_0012586 | 3300046507 | Bacteria | 6769 |
| 599 | Ga0495606_0032752 | 3300046507 | Bacteria | 3595 |
| 600 | Ga0495606_0033998 | 3300046507 | Bacteria | 3506 |
| 601 | Ga0495606_0046870 | 3300046507 | Bacteria | 2853 |
| 602 | Ga0495606_0047627 | 3300046507 | Bacteria | 2824 |
| 603 | Ga0495606_0049746 | 3300046507 | Bacteria | 2746 |
| 604 | Ga0495606_0057268 | 3300046507 | Bacteria | 2510 |
| 605 | Ga0495606_0115621 | 3300046507 | Bacteria | 1612 |
| 606 | Ga0495606_0154928 | 3300046507 | Bacteria | 1341 |
| 607 | Ga0495606_0195383 | 3300046507 | Bacteria | 1157 |
| 608 | Ga0495610_0005965 | 3300046512 | Bacteria | 8526 |
| 609 | Ga0495610_0008078 | 3300046512 | Bacteria | 6884 |
| 610 | Ga0495610_0008516 | 3300046512 | Bacteria | 6625 |
| 611 | Ga0495610_0015649 | 3300046512 | Bacteria | 4398 |
| 612 | Ga0495610_0020673 | 3300046512 | Bacteria | 3648 |
| 613 | Ga0495610_0023596 | 3300046512 | Bacteria | 3338 |
| 614 | Ga0495610_0023692 | 3300046512 | Bacteria | 3329 |
| 615 | Ga0495610_0027374 | 3300046512 | Bacteria | 3030 |
| 616 | Ga0495610_0028775 | 3300046512 | Bacteria | 2934 |
| 617 | Ga0495610_0034336 | 3300046512 | Bacteria | 2613 |
| 618 | Ga0495610_0038776 | 3300046512 | Bacteria | 2415 |
| 619 | Ga0495610_0040942 | 3300046512 | Bacteria | 2330 |
| 620 | Ga0495610_0059603 | 3300046512 | Bacteria | 1821 |
| 621 | Ga0495610_0062398 | 3300046512 | Bacteria | 1768 |
| 622 | Ga0495616_0002292 | 3300046513 | Bacteria | 12801 |
| 623 | Ga0495616_0008007 | 3300046513 | Bacteria | 6294 |
| 624 | Ga0495616_0016873 | 3300046513 | Bacteria | 4033 |
| 625 | Ga0495616_0020537 | 3300046513 | Bacteria | 3590 |
| 626 | Ga0495616_0020879 | 3300046513 | Bacteria | 3556 |
| 627 | Ga0495616_0027899 | 3300046513 | Bacteria | 2992 |
| 628 | Ga0495616_0028029 | 3300046513 | Bacteria | 2984 |
| 629 | Ga0495616_0038057 | 3300046513 | Bacteria | 2471 |
| 630 | Ga0495616_0041169 | 3300046513 | Bacteria | 2357 |
| 631 | Ga0495616_0053815 | 3300046513 | Bacteria | 1999 |
| 632 | Ga0495616_0054083 | 3300046513 | Bacteria | 1992 |
| 633 | Ga0495620_0000004 | 3300046515 | Bacteria | 344148 |
| 634 | Ga0495620_0000160 | 3300046515 | Bacteria | 53936 |
| 635 | Ga0495620_0000839 | 3300046515 | Bacteria | 18995 |
| 636 | Ga0495620_0008800 | 3300046515 | Bacteria | 5402 |
| 637 | Ga0495620_0016185 | 3300046515 | Bacteria | 3749 |
| 638 | Ga0495620_0017421 | 3300046515 | Bacteria | 3581 |
| 639 | Ga0495620_0017696 | 3300046515 | Bacteria | 3545 |
| 640 | Ga0495620_0023218 | 3300046515 | Bacteria | 2970 |
| 641 | Ga0495620_0028941 | 3300046515 | Bacteria | 2569 |
| 642 | Ga0495620_0031881 | 3300046515 | Bacteria | 2408 |
| 643 | Ga0495620_0037895 | 3300046515 | Bacteria | 2143 |
| 644 | Ga0495620_0037917 | 3300046515 | Bacteria | 2142 |
| 645 | Ga0495628_0163710 | 3300046516 | Bacteria | 1689 |
| 646 | Ga0495630_0034572 | 3300046517 | Bacteria | 3774 |
| 647 | Ga0495630_0043244 | 3300046517 | Bacteria | 3364 |
| 648 | Ga0495631_0010983 | 3300046518 | Bacteria | 4470 |
| 649 | Ga0495631_0011144 | 3300046518 | Bacteria | 4431 |
| 650 | Ga0495631_0011760 | 3300046518 | Bacteria | 4293 |
| 651 | Ga0495631_0015839 | 3300046518 | Bacteria | 3603 |
| 652 | Ga0495631_0018705 | 3300046518 | Bacteria | 3258 |
| 653 | Ga0495631_0019565 | 3300046518 | Bacteria | 3173 |
| 654 | Ga0495631_0037292 | 3300046518 | Bacteria | 2166 |
| 655 | Ga0495631_0037835 | 3300046518 | Bacteria | 2148 |
| 656 | Ga0495631_0039759 | 3300046518 | Bacteria | 2085 |
| 657 | Ga0495632_0001711 | 3300046519 | Bacteria | 17838 |
| 658 | Ga0495632_0006673 | 3300046519 | Bacteria | 7381 |
| 659 | Ga0495632_0013273 | 3300046519 | Bacteria | 4709 |
| 660 | Ga0495632_0013379 | 3300046519 | Bacteria | 4684 |
| 661 | Ga0495632_0013917 | 3300046519 | Bacteria | 4570 |
| 662 | Ga0495632_0018118 | 3300046519 | Bacteria | 3870 |
| 663 | Ga0495632_0018319 | 3300046519 | Bacteria | 3844 |
| 664 | Ga0495632_0018935 | 3300046519 | Bacteria | 3760 |
| 665 | Ga0495632_0024415 | 3300046519 | Bacteria | 3211 |
| 666 | Ga0495632_0026988 | 3300046519 | Bacteria | 3014 |
| 667 | Ga0495632_0029211 | 3300046519 | Bacteria | 2872 |
| 668 | Ga0495632_0039642 | 3300046519 | Bacteria | 2376 |
| 669 | Ga0495632_0040114 | 3300046519 | Bacteria | 2359 |
| 670 | Ga0495632_0092371 | 3300046519 | Bacteria | 1433 |
| 671 | Ga0495632_0167509 | 3300046519 | Bacteria | 1010 |
| 672 | Ga0495637_0001319 | 3300046520 | Bacteria | 14884 |
| 673 | Ga0495637_0002012 | 3300046520 | Bacteria | 11472 |
| 674 | Ga0495637_0005487 | 3300046520 | Bacteria | 6447 |
| 675 | Ga0495637_0010460 | 3300046520 | Bacteria | 4484 |
| 676 | Ga0495637_0010480 | 3300046520 | Bacteria | 4479 |
| 677 | Ga0495637_0010980 | 3300046520 | Bacteria | 4363 |
| 678 | Ga0495637_0011694 | 3300046520 | Bacteria | 4212 |
| 679 | Ga0495637_0015522 | 3300046520 | Bacteria | 3572 |
| 680 | Ga0495637_0016446 | 3300046520 | Bacteria | 3457 |
| 681 | Ga0495637_0016810 | 3300046520 | Bacteria | 3417 |
| 682 | Ga0495637_0020303 | 3300046520 | Bacteria | 3058 |
| 683 | Ga0495637_0021686 | 3300046520 | Bacteria | 2941 |
| 684 | Ga0495637_0023001 | 3300046520 | Bacteria | 2837 |
| 685 | Ga0495637_0031131 | 3300046520 | Bacteria | 2361 |
| 686 | Ga0495637_0031493 | 3300046520 | Bacteria | 2345 |
| 687 | Ga0495637_0032136 | 3300046520 | Bacteria | 2314 |
| 688 | Ga0495637_0041486 | 3300046520 | Bacteria | 1973 |
| 689 | Ga0495643_0000705 | 3300046522 | Bacteria | 38375 |
| 690 | Ga0495643_0006733 | 3300046522 | Bacteria | 7520 |
| 691 | Ga0495643_0007191 | 3300046522 | Bacteria | 7214 |
| 692 | Ga0495643_0009520 | 3300046522 | Bacteria | 6035 |
| 693 | Ga0495643_0013092 | 3300046522 | Bacteria | 4981 |
| 694 | Ga0495643_0016267 | 3300046522 | Bacteria | 4372 |
| 695 | Ga0495643_0016714 | 3300046522 | Bacteria | 4307 |
| 696 | Ga0495643_0022883 | 3300046522 | Bacteria | 3558 |
| 697 | Ga0495643_0036751 | 3300046522 | Bacteria | 2689 |
| 698 | Ga0495643_0039680 | 3300046522 | Bacteria | 2574 |
| 699 | Ga0495643_0080889 | 3300046522 | Bacteria | 1690 |
| 700 | Ga0495643_0097859 | 3300046522 | Bacteria | 1507 |
| 701 | Ga0495643_0134254 | 3300046522 | Bacteria | 1240 |
| 702 | Ga0495643_0145966 | 3300046522 | Bacteria | 1175 |
| 703 | Ga0495644_0001649 | 3300046523 | Bacteria | 9064 |
| 704 | Ga0495644_0008024 | 3300046523 | Bacteria | 4059 |
| 705 | Ga0495644_0014279 | 3300046523 | Bacteria | 3043 |
| 706 | Ga0495644_0014314 | 3300046523 | Bacteria | 3040 |
| 707 | Ga0495644_0042172 | 3300046523 | Bacteria | 1718 |
| 708 | Ga0495644_0081427 | 3300046523 | Bacteria | 1220 |
| 709 | Ga0495648_0002198 | 3300046524 | Bacteria | 18273 |
| 710 | Ga0495648_0002316 | 3300046524 | Bacteria | 17733 |
| 711 | Ga0495648_0007236 | 3300046524 | Bacteria | 8913 |
| 712 | Ga0495648_0010500 | 3300046524 | Bacteria | 7046 |
| 713 | Ga0495648_0012038 | 3300046524 | Bacteria | 6480 |
| 714 | Ga0495648_0015271 | 3300046524 | Bacteria | 5584 |
| 715 | Ga0495648_0019920 | 3300046524 | Bacteria | 4696 |
| 716 | Ga0495648_0022047 | 3300046524 | Bacteria | 4395 |
| 717 | Ga0495648_0028570 | 3300046524 | Bacteria | 3713 |
| 718 | Ga0495648_0029282 | 3300046524 | Bacteria | 3656 |
| 719 | Ga0495648_0030050 | 3300046524 | Bacteria | 3599 |
| 720 | Ga0495648_0030684 | 3300046524 | Bacteria | 3550 |
| 721 | Ga0495648_0043612 | 3300046524 | Bacteria | 2809 |
| 722 | Ga0495648_0045628 | 3300046524 | Bacteria | 2724 |
| 723 | Ga0495648_0050297 | 3300046524 | Bacteria | 2547 |
| 724 | Ga0495648_0055131 | 3300046524 | Bacteria | 2397 |
| 725 | Ga0495648_0057749 | 3300046524 | Bacteria | 2325 |
| 726 | Ga0495648_0059745 | 3300046524 | Bacteria | 2272 |
| 727 | Ga0495648_0106157 | 3300046524 | Bacteria | 1538 |
| 728 | Ga0495648_0113042 | 3300046524 | Bacteria | 1473 |
| 729 | Ga0495648_0113047 | 3300046524 | Bacteria | 1473 |
| 730 | Ga0495648_0142579 | 3300046524 | Bacteria | 1259 |
| 731 | Ga0495666_0006883 | 3300046526 | Bacteria | 5710 |
| 732 | Ga0495666_0015162 | 3300046526 | Bacteria | 3837 |
| 733 | Ga0495666_0034054 | 3300046526 | Bacteria | 2486 |
| 734 | Ga0495666_0035756 | 3300046526 | Bacteria | 2420 |
| 735 | Ga0495666_0040956 | 3300046526 | Bacteria | 2244 |
| 736 | Ga0495642_0003901 | 3300046528 | Bacteria | 5844 |
| 737 | Ga0495642_0005960 | 3300046528 | Bacteria | 4677 |
| 738 | Ga0495642_0006641 | 3300046528 | Bacteria | 4441 |
| 739 | Ga0495654_0004113 | 3300046530 | Bacteria | 8729 |
| 740 | Ga0495654_0009470 | 3300046530 | Bacteria | 5338 |
| 741 | Ga0495654_0013370 | 3300046530 | Bacteria | 4393 |
| 742 | Ga0495654_0014756 | 3300046530 | Bacteria | 4154 |
| 743 | Ga0495654_0017464 | 3300046530 | Bacteria | 3774 |
| 744 | Ga0495654_0018232 | 3300046530 | Bacteria | 3681 |
| 745 | Ga0495654_0018473 | 3300046530 | Bacteria | 3652 |
| 746 | Ga0495654_0019641 | 3300046530 | Bacteria | 3532 |
| 747 | Ga0495654_0020215 | 3300046530 | Bacteria | 3471 |
| 748 | Ga0495654_0021927 | 3300046530 | Bacteria | 3320 |
| 749 | Ga0495654_0022919 | 3300046530 | Bacteria | 3237 |
| 750 | Ga0495654_0026744 | 3300046530 | Bacteria | 2963 |
| 751 | Ga0495654_0027059 | 3300046530 | Bacteria | 2943 |
| 752 | Ga0495654_0028667 | 3300046530 | Bacteria | 2845 |
| 753 | Ga0495654_0040265 | 3300046530 | Bacteria | 2329 |
| 754 | Ga0495654_0075496 | 3300046530 | Bacteria | 1590 |
| 755 | Ga0495654_0082327 | 3300046530 | Bacteria | 1506 |
| 756 | Ga0495654_0113547 | 3300046530 | Bacteria | 1233 |
| 757 | Ga0495654_0133280 | 3300046530 | Bacteria | 1113 |
| 758 | Ga0495586_0017847 | 3300046535 | Bacteria | 3776 |
| 759 | Ga0495587_0011708 | 3300046536 | Bacteria | 5552 |
| 760 | Ga0495587_0019991 | 3300046536 | Bacteria | 4139 |
| 761 | Ga0495609_0000036 | 3300046538 | Bacteria | 186358 |
| 762 | Ga0495609_0000049 | 3300046538 | Bacteria | 155608 |
| 763 | Ga0495609_0001805 | 3300046538 | Bacteria | 13747 |
| 764 | Ga0495609_0006248 | 3300046538 | Bacteria | 6114 |
| 765 | Ga0495609_0021159 | 3300046538 | Bacteria | 3000 |
| 766 | Ga0495609_0036253 | 3300046538 | Bacteria | 2227 |
| 767 | Ga0495609_0083856 | 3300046538 | Bacteria | 1391 |
| 768 | Ga0495609_0105836 | 3300046538 | Bacteria | 1216 |
| 769 | Ga0495597_0009852 | 3300046542 | Bacteria | 4701 |
| 770 | Ga0495597_0011995 | 3300046542 | Bacteria | 4188 |
| 771 | Ga0495597_0012695 | 3300046542 | Bacteria | 4056 |
| 772 | Ga0495597_0013817 | 3300046542 | Bacteria | 3859 |
| 773 | Ga0495597_0014699 | 3300046542 | Bacteria | 3724 |
| 774 | Ga0495597_0015192 | 3300046542 | Bacteria | 3647 |
| 775 | Ga0495597_0028270 | 3300046542 | Bacteria | 2566 |
| 776 | Ga0495597_0029466 | 3300046542 | Bacteria | 2505 |
| 777 | Ga0495597_0047493 | 3300046542 | Bacteria | 1900 |
| 778 | Ga0495597_0047787 | 3300046542 | Bacteria | 1894 |
| 779 | Ga0495597_0049969 | 3300046542 | Bacteria | 1847 |
| 780 | Ga0495597_0099269 | 3300046542 | Bacteria | 1229 |
| 781 | Ga0495645_0026158 | 3300046543 | Bacteria | 4235 |
| 782 | Ga0495645_0107948 | 3300046543 | Bacteria | 1972 |
| 783 | Ga0495622_0005899 | 3300046557 | Bacteria | 5689 |
| 784 | Ga0495622_0008595 | 3300046557 | Bacteria | 4735 |
| 785 | Ga0495622_0021817 | 3300046557 | Bacteria | 2982 |
| 786 | Ga0495622_0022490 | 3300046557 | Bacteria | 2938 |
| 787 | Ga0495622_0029379 | 3300046557 | Bacteria | 2568 |
| 788 | Ga0495633_0000143 | 3300046558 | Bacteria | 95292 |
| 789 | Ga0495633_0013132 | 3300046558 | Bacteria | 4377 |
| 790 | Ga0495633_0022837 | 3300046558 | Bacteria | 3106 |
| 791 | Ga0495633_0038015 | 3300046558 | Bacteria | 2300 |
| 792 | Ga0495633_0057535 | 3300046558 | Bacteria | 1826 |
| 793 | Ga0495656_0006177 | 3300046615 | Bacteria | 4189 |
| 794 | Ga0495656_0042225 | 3300046615 | Bacteria | 1909 |
| 795 | Ga0495656_0066256 | 3300046615 | Bacteria | 1590 |
| 796 | Ga0495668_0015501 | 3300046616 | Bacteria | 4448 |
| 797 | Ga0495668_0017887 | 3300046616 | Bacteria | 4106 |
| 798 | Ga0495668_0020709 | 3300046616 | Bacteria | 3781 |
| 799 | Ga0495668_0025799 | 3300046616 | Bacteria | 3337 |
| 800 | Ga0495668_0038174 | 3300046616 | Bacteria | 2685 |
| 801 | Ga0495668_0044110 | 3300046616 | Bacteria | 2478 |
| 802 | Ga0495668_0104625 | 3300046616 | Bacteria | 1548 |
| 803 | Ga0495634_0018758 | 3300046642 | Bacteria | 4920 |
| 804 | Ga0495634_0081237 | 3300046642 | Bacteria | 2120 |
| 805 | Ga0495634_0189259 | 3300046642 | Bacteria | 1284 |
| 806 | Ga0495611_0001125 | 3300046648 | Bacteria | 14009 |
| 807 | Ga0495611_0010373 | 3300046648 | Bacteria | 3942 |
| 808 | Ga0495611_0010906 | 3300046648 | Bacteria | 3849 |
| 809 | Ga0495611_0011320 | 3300046648 | Bacteria | 3782 |
| 810 | Ga0495611_0013346 | 3300046648 | Bacteria | 3497 |
| 811 | Ga0495611_0029152 | 3300046648 | Bacteria | 2419 |
| 812 | Ga0495625_0030321 | 3300046660 | Bacteria | 4037 |
| 813 | Ga0495625_0033501 | 3300046660 | Bacteria | 3798 |
| 814 | Ga0495625_0048347 | 3300046660 | Bacteria | 3063 |
| 815 | Ga0495625_0064481 | 3300046660 | Bacteria | 2584 |
| 816 | Ga0495625_0081538 | 3300046660 | Bacteria | 2251 |
| 817 | Ga0495625_0092180 | 3300046660 | Bacteria | 2093 |
| 818 | Ga0495625_0096747 | 3300046660 | Bacteria | 2033 |
| 819 | Ga0495625_0153009 | 3300046660 | Bacteria | 1549 |
| 820 | Ga0495625_0229944 | 3300046660 | Bacteria | 1211 |
| 821 | Ga0495635_0037165 | 3300046663 | Bacteria | 3371 |
| 822 | Ga0495659_0005021 | 3300046664 | Bacteria | 4159 |
| 823 | Ga0495659_0008184 | 3300046664 | Bacteria | 3325 |
| 824 | Ga0495659_0008632 | 3300046664 | Bacteria | 3243 |
| 825 | Ga0495661_0000121 | 3300046665 | Bacteria | 93554 |
| 826 | Ga0495661_0000123 | 3300046665 | Bacteria | 93482 |
| 827 | Ga0495661_0000373 | 3300046665 | Bacteria | 48433 |
| 828 | Ga0495661_0009655 | 3300046665 | Bacteria | 6610 |
| 829 | Ga0495661_0012590 | 3300046665 | Bacteria | 5709 |
| 830 | Ga0495661_0021014 | 3300046665 | Bacteria | 4258 |
| 831 | Ga0495661_0025420 | 3300046665 | Bacteria | 3824 |
| 832 | Ga0495661_0028441 | 3300046665 | Bacteria | 3578 |
| 833 | Ga0495661_0029082 | 3300046665 | Bacteria | 3530 |
| 834 | Ga0495661_0035798 | 3300046665 | Bacteria | 3113 |
| 835 | Ga0495661_0039328 | 3300046665 | Bacteria | 2939 |
| 836 | Ga0495661_0079296 | 3300046665 | Bacteria | 1897 |
| 837 | Ga0495661_0138348 | 3300046665 | Bacteria | 1327 |
| 838 | Ga0495661_0165485 | 3300046665 | Bacteria | 1183 |
| 839 | Ga0495588_0018586 | 3300046674 | Bacteria | 3391 |
| 840 | Ga0495657_0068312 | 3300046675 | Bacteria | 2329 |
| 841 | Ga0495623_0029886 | 3300046679 | Bacteria | 3506 |
| 842 | Ga0495646_0020518 | 3300046680 | Bacteria | 4180 |
| 843 | Ga0495646_0026911 | 3300046680 | Bacteria | 3610 |
| 844 | Ga0495669_0001706 | 3300046684 | Bacteria | 9006 |
| 845 | Ga0495669_0006819 | 3300046684 | Bacteria | 4779 |
| 846 | Ga0495669_0017295 | 3300046684 | Bacteria | 3093 |
| 847 | Ga0495613_0037568 | 3300046689 | Bacteria | 3590 |
| 848 | Ga0495613_0051873 | 3300046689 | Bacteria | 3022 |
| 849 | Ga0495613_0174860 | 3300046689 | Bacteria | 1522 |
| 850 | Ga0495624_0024565 | 3300046690 | Bacteria | 3963 |
| 851 | Ga0495670_0015192 | 3300046691 | Bacteria | 3787 |
| 852 | Ga0495670_0016244 | 3300046691 | Bacteria | 3658 |
| 853 | Ga0495670_0016279 | 3300046691 | Bacteria | 3653 |
| 854 | Ga0495670_0017333 | 3300046691 | Bacteria | 3543 |
| 855 | Ga0495670_0018586 | 3300046691 | Bacteria | 3422 |
| 856 | Ga0495670_0020135 | 3300046691 | Bacteria | 3288 |
| 857 | Ga0495670_0038068 | 3300046691 | Bacteria | 2397 |
| 858 | Ga0495670_0051316 | 3300046691 | Bacteria | 2064 |
| 859 | Ga0495671_0006572 | 3300046692 | Bacteria | 6704 |
| 860 | Ga0495671_0013124 | 3300046692 | Bacteria | 4500 |
| 861 | Ga0495671_0013278 | 3300046692 | Bacteria | 4468 |
| 862 | Ga0495671_0025598 | 3300046692 | Bacteria | 3065 |
| 863 | Ga0495671_0026846 | 3300046692 | Bacteria | 2980 |
| 864 | Ga0495671_0028283 | 3300046692 | Bacteria | 2890 |
| 865 | Ga0495671_0028510 | 3300046692 | Bacteria | 2874 |
| 866 | Ga0495671_0029951 | 3300046692 | Bacteria | 2790 |
| 867 | Ga0495671_0030691 | 3300046692 | Bacteria | 2751 |
| 868 | Ga0495671_0032095 | 3300046692 | Bacteria | 2682 |
| 869 | Ga0495671_0038406 | 3300046692 | Bacteria | 2419 |
| 870 | Ga0495671_0046794 | 3300046692 | Bacteria | 2162 |
| 871 | Ga0495671_0046811 | 3300046692 | Bacteria | 2162 |
| 872 | Ga0495671_0058199 | 3300046692 | Bacteria | 1912 |
| 873 | Ga0495671_0064682 | 3300046692 | Bacteria | 1800 |
| 874 | Ga0495671_0107013 | 3300046692 | Bacteria | 1365 |
| 875 | Ga0495649_0014130 | 3300046694 | Bacteria | 4584 |
| 876 | Ga0495649_0014733 | 3300046694 | Bacteria | 4469 |
| 877 | Ga0495649_0015321 | 3300046694 | Bacteria | 4365 |
| 878 | Ga0495649_0021682 | 3300046694 | Bacteria | 3598 |
| 879 | Ga0495649_0034113 | 3300046694 | Bacteria | 2801 |
| 880 | Ga0495649_0046605 | 3300046694 | Bacteria | 2361 |
| 881 | Ga0495649_0046900 | 3300046694 | Bacteria | 2351 |
| 882 | Ga0495649_0047097 | 3300046694 | Bacteria | 2345 |
| 883 | Ga0495649_0047207 | 3300046694 | Bacteria | 2342 |
| 884 | Ga0495649_0050672 | 3300046694 | Bacteria | 2252 |
| 885 | Ga0495649_0090489 | 3300046694 | Bacteria | 1631 |
| 886 | Ga0495649_0169117 | 3300046694 | Bacteria | 1144 |
| 887 | Ga0495649_0200957 | 3300046694 | Bacteria | 1035 |
| 888 | Ga0495589_0002617 | 3300046794 | Bacteria | 9992 |
| 889 | Ga0495589_0003758 | 3300046794 | Bacteria | 8168 |
| 890 | Ga0495589_0005456 | 3300046794 | Bacteria | 6710 |
| 891 | Ga0495589_0017140 | 3300046794 | Bacteria | 3719 |
| 892 | Ga0495589_0018156 | 3300046794 | Bacteria | 3608 |
| 893 | Ga0495589_0018413 | 3300046794 | Bacteria | 3580 |
| 894 | Ga0495589_0018754 | 3300046794 | Bacteria | 3546 |
| 895 | Ga0495589_0018853 | 3300046794 | Bacteria | 3538 |
| 896 | Ga0495589_0020239 | 3300046794 | Bacteria | 3404 |
| 897 | Ga0495589_0029779 | 3300046794 | Bacteria | 2752 |
| 898 | Ga0495589_0050099 | 3300046794 | Bacteria | 2066 |
| 899 | Ga0495589_0085099 | 3300046794 | Bacteria | 1536 |
| 900 | Ga0495589_0112440 | 3300046794 | Bacteria | 1314 |
| 901 | Ga0495589_0122703 | 3300046794 | Bacteria | 1250 |
| 902 | Ga0495600_0065606 | 3300046809 | Bacteria | 2373 |
| 903 | Ga0495600_0127789 | 3300046809 | Bacteria | 1652 |
| 904 | Ga0495660_0000390 | 3300046810 | Bacteria | 37896 |
| 905 | Ga0495660_0022201 | 3300046810 | Bacteria | 3626 |
| 906 | Ga0495660_0023598 | 3300046810 | Bacteria | 3508 |
| 907 | Ga0495660_0025602 | 3300046810 | Bacteria | 3349 |
| 908 | Ga0495660_0026466 | 3300046810 | Bacteria | 3288 |
| 909 | Ga0495660_0030133 | 3300046810 | Bacteria | 3058 |
| 910 | Ga0495660_0031621 | 3300046810 | Bacteria | 2975 |
| 911 | Ga0495660_0035658 | 3300046810 | Bacteria | 2778 |
| 912 | Ga0495660_0037781 | 3300046810 | Bacteria | 2688 |
| 913 | Ga0495660_0038017 | 3300046810 | Bacteria | 2678 |
| 914 | Ga0495660_0040546 | 3300046810 | Bacteria | 2579 |
| 915 | Ga0495660_0041876 | 3300046810 | Bacteria | 2532 |
| 916 | Ga0495660_0042912 | 3300046810 | Bacteria | 2496 |
| 917 | Ga0495660_0047451 | 3300046810 | Bacteria | 2351 |
| 918 | Ga0495660_0048075 | 3300046810 | Bacteria | 2333 |
| 919 | Ga0495660_0056827 | 3300046810 | Bacteria | 2113 |
| 920 | Ga0495660_0059751 | 3300046810 | Bacteria | 2049 |
| 921 | Ga0495660_0114591 | 3300046810 | Bacteria | 1371 |
| 922 | Ga0495660_0123325 | 3300046810 | Bacteria | 1308 |
| 923 | Ga0495660_0143101 | 3300046810 | Bacteria | 1187 |
| 924 | Ga0495660_0161485 | 3300046810 | Bacteria | 1098 |
| 925 | Ga0495581_0037300 | 3300047315 | Bacteria | 2812 |
| 926 | Ga0495604_0018092 | 3300047317 | Bacteria | 5640 |
| 927 | Ga0495604_0103098 | 3300047317 | Bacteria | 2093 |
| 928 | Ga0495636_0017168 | 3300047318 | Bacteria | 2896 |
| 929 | Ga0495674_0042126 | 3300047319 | Bacteria | 4074 |
| 930 | Ga0495674_0346759 | 3300047319 | Bacteria | 1206 |
| 931 | Ga0495672_0006371 | 3300047320 | Bacteria | 9167 |
| 932 | Ga0495672_0013351 | 3300047320 | Bacteria | 5672 |
| 933 | Ga0495672_0023125 | 3300047320 | Bacteria | 4029 |
| 934 | Ga0495672_0023186 | 3300047320 | Bacteria | 4022 |
| 935 | Ga0495672_0026730 | 3300047320 | Bacteria | 3677 |
| 936 | Ga0495672_0027445 | 3300047320 | Bacteria | 3617 |
| 937 | Ga0495672_0029177 | 3300047320 | Bacteria | 3478 |
| 938 | Ga0495672_0032306 | 3300047320 | Bacteria | 3258 |
| 939 | Ga0495672_0038132 | 3300047320 | Bacteria | 2933 |
| 940 | Ga0495672_0039331 | 3300047320 | Bacteria | 2875 |
| 941 | Ga0495672_0041266 | 3300047320 | Bacteria | 2791 |
| 942 | Ga0495672_0041652 | 3300047320 | Bacteria | 2775 |
| 943 | Ga0495672_0045457 | 3300047320 | Bacteria | 2626 |
| 944 | Ga0495672_0045638 | 3300047320 | Bacteria | 2620 |
| 945 | Ga0495672_0046824 | 3300047320 | Bacteria | 2576 |
| 946 | Ga0495672_0145394 | 3300047320 | Bacteria | 1234 |
| 947 | Ga0495676_0000042 | 3300047321 | Bacteria | 103741 |
| 948 | Ga0495676_0044496 | 3300047321 | Bacteria | 3623 |
| 949 | Ga0495676_0060702 | 3300047321 | Bacteria | 2961 |
| 950 | Ga0495680_0009294 | 3300047322 | Bacteria | 8855 |
| 951 | Ga0495680_0020364 | 3300047322 | Bacteria | 5582 |
| 952 | Ga0495680_0036406 | 3300047322 | Bacteria | 3950 |
| 953 | Ga0495680_0045393 | 3300047322 | Bacteria | 3470 |
| 954 | Ga0495680_0049962 | 3300047322 | Bacteria | 3272 |
| 955 | Ga0495683_0000003 | 3300047323 | Bacteria | 383992 |
| 956 | Ga0495683_0008022 | 3300047323 | Bacteria | 5670 |
| 957 | Ga0495683_0011357 | 3300047323 | Bacteria | 4689 |
| 958 | Ga0495683_0026783 | 3300047323 | Bacteria | 2950 |
| 959 | Ga0495683_0051226 | 3300047323 | Bacteria | 2065 |
| 960 | Ga0495683_0052646 | 3300047323 | Bacteria | 2031 |
| 961 | Ga0495683_0069072 | 3300047323 | Bacteria | 1736 |
| 962 | Ga0495683_0086672 | 3300047323 | Bacteria | 1521 |
| 963 | Ga0495687_008709 | 3300047443 | Bacteria | 5765 |
| 964 | Ga0495687_016113 | 3300047443 | Bacteria | 3769 |
| 965 | Ga0495687_023693 | 3300047443 | Bacteria | 2929 |
| 966 | Ga0495687_035380 | 3300047443 | Bacteria | 2246 |
| 967 | Ga0495675_0010786 | 3300047444 | Bacteria | 5725 |
| 968 | Ga0495675_0195158 | 3300047444 | Bacteria | 1234 |
| 969 | Ga0495677_0005628 | 3300047445 | Bacteria | 4747 |
| 970 | Ga0495679_000027 | 3300047446 | Bacteria | 193794 |
| 971 | Ga0495679_001094 | 3300047446 | Bacteria | 16379 |
| 972 | Ga0495679_004078 | 3300047446 | Bacteria | 6846 |
| 973 | Ga0495679_010109 | 3300047446 | Bacteria | 3727 |
| 974 | Ga0495679_011114 | 3300047446 | Bacteria | 3495 |
| 975 | Ga0495679_011369 | 3300047446 | Bacteria | 3438 |
| 976 | Ga0495679_011522 | 3300047446 | Bacteria | 3408 |
| 977 | Ga0495679_013143 | 3300047446 | Bacteria | 3121 |
| 978 | Ga0495679_015472 | 3300047446 | Bacteria | 2789 |
| 979 | Ga0495679_019892 | 3300047446 | Bacteria | 2348 |
| 980 | Ga0495685_007294 | 3300047447 | Bacteria | 3646 |
| 981 | Ga0495673_0001888 | 3300047469 | Bacteria | 15728 |
| 982 | Ga0495673_0007096 | 3300047469 | Bacteria | 6493 |
| 983 | Ga0495673_0007780 | 3300047469 | Bacteria | 6108 |
| 984 | Ga0495673_0010928 | 3300047469 | Bacteria | 4911 |
| 985 | Ga0495673_0012754 | 3300047469 | Bacteria | 4438 |
| 986 | Ga0495673_0014426 | 3300047469 | Bacteria | 4109 |
| 987 | Ga0495673_0015150 | 3300047469 | Bacteria | 3982 |
| 988 | Ga0495673_0017560 | 3300047469 | Bacteria | 3627 |
| 989 | Ga0495673_0017646 | 3300047469 | Bacteria | 3616 |
| 990 | Ga0495673_0017957 | 3300047469 | Bacteria | 3578 |
| 991 | Ga0495673_0018009 | 3300047469 | Bacteria | 3572 |
| 992 | Ga0495673_0018412 | 3300047469 | Bacteria | 3521 |
| 993 | Ga0495673_0021628 | 3300047469 | Bacteria | 3171 |
| 994 | Ga0495673_0021907 | 3300047469 | Bacteria | 3143 |
| 995 | Ga0495673_0024202 | 3300047469 | Bacteria | 2939 |
| 996 | Ga0495673_0030073 | 3300047469 | Bacteria | 2556 |
| 997 | Ga0495673_0034519 | 3300047469 | Bacteria | 2337 |
| 998 | Ga0495673_0063584 | 3300047469 | Bacteria | 1573 |
| 999 | Ga0495673_0075021 | 3300047469 | Bacteria | 1413 |
| 1000 | Ga0495681_0006487 | 3300047470 | Bacteria | 7684 |
| 1001 | Ga0495681_0007314 | 3300047470 | Bacteria | 7074 |
| 1002 | Ga0495681_0010220 | 3300047470 | Bacteria | 5696 |
| 1003 | Ga0495681_0014911 | 3300047470 | Bacteria | 4427 |
| 1004 | Ga0495681_0016902 | 3300047470 | Bacteria | 4069 |
| 1005 | Ga0495681_0019931 | 3300047470 | Bacteria | 3648 |
| 1006 | Ga0495681_0020146 | 3300047470 | Bacteria | 3624 |
| 1007 | Ga0495681_0020655 | 3300047470 | Bacteria | 3569 |
| 1008 | Ga0495681_0020702 | 3300047470 | Bacteria | 3562 |
| 1009 | Ga0495681_0021089 | 3300047470 | Bacteria | 3518 |
| 1010 | Ga0495681_0021369 | 3300047470 | Bacteria | 3490 |
| 1011 | Ga0495681_0021466 | 3300047470 | Bacteria | 3478 |
| 1012 | Ga0495681_0030940 | 3300047470 | Bacteria | 2717 |
| 1013 | Ga0495681_0039000 | 3300047470 | Bacteria | 2323 |
| 1014 | Ga0495681_0039806 | 3300047470 | Bacteria | 2292 |
| 1015 | Ga0495681_0041338 | 3300047470 | Bacteria | 2238 |
| 1016 | Ga0495681_0043221 | 3300047470 | Bacteria | 2174 |
| 1017 | Ga0495681_0115042 | 3300047470 | Bacteria | 1160 |
| 1018 | Ga0495684_0054821 | 3300047471 | Bacteria | 3040 |
| 1019 | Ga0495684_0083116 | 3300047471 | Bacteria | 2429 |
| 1020 | Ga0495686_0018971 | 3300047472 | Bacteria | 4602 |
| 1021 | Ga0495686_0022071 | 3300047472 | Bacteria | 4215 |
| 1022 | Ga0495686_0031318 | 3300047472 | Bacteria | 3450 |
| 1023 | Ga0495686_0058022 | 3300047472 | Bacteria | 2414 |
| 1024 | Ga0495686_0199937 | 3300047472 | Bacteria | 1147 |
| 1025 | Ga0495686_0216133 | 3300047472 | Bacteria | 1093 |
| 1026 | Ga0495593_0009419 | 3300047673 | Bacteria | 5666 |
| 1027 | Ga0495593_0021049 | 3300047673 | Bacteria | 3646 |
| 1028 | Ga0495593_0047358 | 3300047673 | Bacteria | 2287 |
| 1029 | Ga0495593_0061120 | 3300047673 | Bacteria | 1970 |
| 1030 | Ga0495602_0046501 | 3300048088 | Bacteria | 3919 |
| 1031 | Ga0495602_0259783 | 3300048088 | Bacteria | 1289 |
| 1032 | Ga0495626_0000062 | 3300048091 | Bacteria | 143269 |
| 1033 | Ga0495626_0004242 | 3300048091 | Bacteria | 8859 |
| 1034 | Ga0495626_0005262 | 3300048091 | Bacteria | 7647 |
| 1035 | Ga0495626_0006656 | 3300048091 | Bacteria | 6552 |
| 1036 | Ga0495626_0007735 | 3300048091 | Bacteria | 5956 |
| 1037 | Ga0495626_0010069 | 3300048091 | Bacteria | 5074 |
| 1038 | Ga0495626_0011063 | 3300048091 | Bacteria | 4785 |
| 1039 | Ga0495626_0015770 | 3300048091 | Bacteria | 3857 |
| 1040 | Ga0495626_0017696 | 3300048091 | Bacteria | 3593 |
| 1041 | Ga0495626_0022577 | 3300048091 | Bacteria | 3105 |
| 1042 | Ga0495626_0027862 | 3300048091 | Bacteria | 2743 |
| 1043 | Ga0495626_0038456 | 3300048091 | Bacteria | 2268 |
| 1044 | Ga0495626_0041085 | 3300048091 | Bacteria | 2181 |
| 1045 | Ga0495626_0048880 | 3300048091 | Bacteria | 1961 |
| 1046 | Ga0495626_0079563 | 3300048091 | Bacteria | 1458 |
| 1047 | Ga0495626_0085413 | 3300048091 | Bacteria | 1395 |
| 1048 | Ga0495626_0091227 | 3300048091 | Bacteria | 1339 |
| 1049 | Ga0495626_0096542 | 3300048091 | Bacteria | 1293 |
| 1050 | Ga0496100_0092477 | 3300048903 | Bacteria | 2067 |
| 1051 | Ga0496100_0658213 | 3300048903 | Bacteria | 816 |
| 1052 | Ga0496102_0014161 | 3300048905 | Bacteria | 6929 |
| 1053 | Ga0496102_0022187 | 3300048905 | Bacteria | 5622 |
| 1054 | Ga0496102_0047116 | 3300048905 | Bacteria | 3916 |
| 1055 | Ga0496103_0022222 | 3300048906 | Bacteria | 3819 |
| 1056 | Ga0496103_0087431 | 3300048906 | Bacteria | 1965 |
| 1057 | Ga0496103_0090504 | 3300048906 | Bacteria | 1931 |
| 1058 | Ga0496105_0124195 | 3300048908 | Bacteria | 2128 |
| 1059 | Ga0496106_0000001 | 3300048909 | Bacteria | 497458 |
| 1060 | Ga0496110_0078445 | 3300048913 | Bacteria | 2940 |
| 1061 | Ga0496110_0120984 | 3300048913 | Bacteria | 2358 |
| 1062 | Ga0496110_0144254 | 3300048913 | Bacteria | 2153 |
| 1063 | Ga0496110_0204544 | 3300048913 | Bacteria | 1794 |
| 1064 | Ga0496112_0067646 | 3300048915 | Bacteria | 3526 |
| 1065 | Ga0496112_0166715 | 3300048915 | Bacteria | 2169 |
| 1066 | Ga0496114_0054236 | 3300048917 | Bacteria | 3343 |
| 1067 | Ga0496114_0314815 | 3300048917 | Bacteria | 1383 |
| 1068 | Ga0496115_0061087 | 3300048918 | Bacteria | 3038 |
| 1069 | Ga0496115_0128893 | 3300048918 | Bacteria | 2084 |
| 1070 | Ga0496116_0000532 | 3300048919 | Bacteria | 51124 |
| 1071 | Ga0496116_0008407 | 3300048919 | Bacteria | 8960 |
| 1072 | Ga0496116_0026645 | 3300048919 | Bacteria | 4221 |
| 1073 | Ga0496116_0032917 | 3300048919 | Bacteria | 3687 |
| 1074 | Ga0496116_0038266 | 3300048919 | Bacteria | 3334 |
| 1075 | Ga0496116_0040368 | 3300048919 | Bacteria | 3214 |
| 1076 | Ga0496116_0042675 | 3300048919 | Bacteria | 3098 |
| 1077 | Ga0496117_0009614 | 3300048920 | Bacteria | 8953 |
| 1078 | Ga0496117_0009811 | 3300048920 | Bacteria | 8823 |
| 1079 | Ga0496117_0016920 | 3300048920 | Bacteria | 6115 |
| 1080 | Ga0496117_0017078 | 3300048920 | Bacteria | 6077 |
| 1081 | Ga0496117_0025556 | 3300048920 | Bacteria | 4640 |
| 1082 | Ga0496117_0033319 | 3300048920 | Bacteria | 3897 |
| 1083 | Ga0496117_0042330 | 3300048920 | Bacteria | 3324 |
| 1084 | Ga0496117_0049502 | 3300048920 | Bacteria | 2989 |
| 1085 | Ga0496117_0051444 | 3300048920 | Bacteria | 2912 |
| 1086 | Ga0496117_0069800 | 3300048920 | Bacteria | 2364 |
| 1087 | Ga0496117_0071311 | 3300048920 | Bacteria | 2329 |
| 1088 | Ga0496118_0015165 | 3300048921 | Bacteria | 7156 |
| 1089 | Ga0496118_0018535 | 3300048921 | Bacteria | 6274 |
| 1090 | Ga0496118_0026273 | 3300048921 | Bacteria | 4966 |
| 1091 | Ga0496118_0028931 | 3300048921 | Bacteria | 4656 |
| 1092 | Ga0496118_0044948 | 3300048921 | Bacteria | 3452 |
| 1093 | Ga0496118_0048952 | 3300048921 | Bacteria | 3258 |
| 1094 | Ga0496118_0056327 | 3300048921 | Bacteria | 2956 |
| 1095 | Ga0496118_0064178 | 3300048921 | Bacteria | 2696 |
| 1096 | Ga0496118_0082406 | 3300048921 | Bacteria | 2254 |
| 1097 | Ga0496118_0099551 | 3300048921 | Bacteria | 1970 |
| 1098 | Ga0496118_0112466 | 3300048921 | Bacteria | 1802 |
| 1099 | Ga0496119_0000046 | 3300048922 | Bacteria | 190003 |
| 1100 | Ga0496120_0001097 | 3300048923 | Bacteria | 35341 |
| 1101 | Ga0496120_0213832 | 3300048923 | Bacteria | 925 |
| 1102 | Ga0496121_0001218 | 3300048924 | Bacteria | 44832 |
| 1103 | Ga0496121_0005237 | 3300048924 | Bacteria | 16781 |
| 1104 | Ga0496121_0009322 | 3300048924 | Bacteria | 11320 |
| 1105 | Ga0496121_0015004 | 3300048924 | Bacteria | 8157 |
| 1106 | Ga0496121_0049932 | 3300048924 | Bacteria | 3540 |
| 1107 | Ga0496121_0057362 | 3300048924 | Bacteria | 3228 |
| 1108 | Ga0496121_0064222 | 3300048924 | Bacteria | 2994 |
| 1109 | Ga0496121_0073641 | 3300048924 | Bacteria | 2736 |
| 1110 | Ga0496121_0087666 | 3300048924 | Bacteria | 2442 |
| 1111 | Ga0496121_0091553 | 3300048924 | Bacteria | 2374 |
| 1112 | Ga0496121_0196902 | 3300048924 | Bacteria | 1439 |
| 1113 | Ga0496121_0201502 | 3300048924 | Bacteria | 1418 |
| 1114 | Ga0496122_0000916 | 3300048925 | Bacteria | 54018 |
| 1115 | Ga0496122_0007953 | 3300048925 | Bacteria | 11593 |
| 1116 | Ga0496122_0011822 | 3300048925 | Bacteria | 8777 |
| 1117 | Ga0496122_0029529 | 3300048925 | Bacteria | 4622 |
| 1118 | Ga0496122_0029853 | 3300048925 | Bacteria | 4585 |
| 1119 | Ga0496122_0049661 | 3300048925 | Bacteria | 3208 |
| 1120 | Ga0496122_0050951 | 3300048925 | Bacteria | 3152 |
| 1121 | Ga0496122_0055731 | 3300048925 | Bacteria | 2954 |
| 1122 | Ga0496122_0055891 | 3300048925 | Bacteria | 2948 |
| 1123 | Ga0496123_0000163 | 3300048926 | Bacteria | 133536 |
| 1124 | Ga0496123_0000240 | 3300048926 | Bacteria | 110383 |
| 1125 | Ga0496123_0009410 | 3300048926 | Bacteria | 8801 |
| 1126 | Ga0496123_0025037 | 3300048926 | Bacteria | 4511 |
| 1127 | Ga0496123_0041569 | 3300048926 | Bacteria | 3184 |
| 1128 | Ga0496123_0046574 | 3300048926 | Bacteria | 2939 |
| 1129 | Ga0496123_0087564 | 3300048926 | Bacteria | 1862 |
| 1130 | Ga0496123_0117532 | 3300048926 | Bacteria | 1503 |
| 1131 | Ga0496124_0001281 | 3300048927 | Bacteria | 38177 |
| 1132 | Ga0496124_0005783 | 3300048927 | Bacteria | 13758 |
| 1133 | Ga0496124_0015829 | 3300048927 | Bacteria | 7205 |
| 1134 | Ga0496124_0017179 | 3300048927 | Bacteria | 6833 |
| 1135 | Ga0496124_0036437 | 3300048927 | Bacteria | 4290 |
| 1136 | Ga0496124_0038533 | 3300048927 | Bacteria | 4150 |
| 1137 | Ga0496124_0041397 | 3300048927 | Bacteria | 3975 |
| 1138 | Ga0496124_0053426 | 3300048927 | Bacteria | 3424 |
| 1139 | Ga0496124_0054638 | 3300048927 | Bacteria | 3379 |
| 1140 | Ga0496124_0061568 | 3300048927 | Bacteria | 3145 |
| 1141 | Ga0496124_0063790 | 3300048927 | Bacteria | 3077 |
| 1142 | Ga0496124_0071238 | 3300048927 | Bacteria | 2882 |
| 1143 | Ga0496124_0075639 | 3300048927 | Bacteria | 2781 |
| 1144 | Ga0496124_0080178 | 3300048927 | Bacteria | 2686 |
| 1145 | Ga0496124_0118627 | 3300048927 | Bacteria | 2118 |
| 1146 | Ga0496124_0137222 | 3300048927 | Bacteria | 1935 |
| 1147 | Ga0496124_0220967 | 3300048927 | Bacteria | 1424 |
| 1148 | Ga0496124_0241699 | 3300048927 | Bacteria | 1342 |
| 1149 | Ga0496124_0262944 | 3300048927 | Bacteria | 1268 |
| 1150 | Ga0496124_0355001 | 3300048927 | Bacteria | 1035 |
| 1151 | Ga0496125_0004921 | 3300048928 | Bacteria | 15120 |
| 1152 | Ga0496125_0011496 | 3300048928 | Bacteria | 8849 |
| 1153 | Ga0496125_0018304 | 3300048928 | Bacteria | 6656 |
| 1154 | Ga0496125_0018409 | 3300048928 | Bacteria | 6634 |
| 1155 | Ga0496125_0046116 | 3300048928 | Bacteria | 3660 |
| 1156 | Ga0496125_0050050 | 3300048928 | Bacteria | 3464 |
| 1157 | Ga0496125_0068579 | 3300048928 | Bacteria | 2789 |
| 1158 | Ga0496125_0070456 | 3300048928 | Bacteria | 2737 |
| 1159 | Ga0496125_0086766 | 3300048928 | Bacteria | 2365 |
| 1160 | Ga0496126_0000065 | 3300048929 | Bacteria | 252549 |
| 1161 | Ga0496126_0015575 | 3300048929 | Bacteria | 7640 |
| 1162 | Ga0496126_0063332 | 3300048929 | Bacteria | 3315 |
| 1163 | Ga0496126_0068242 | 3300048929 | Bacteria | 3175 |
| 1164 | Ga0495678_000007 | 3300049459 | Bacteria | 448039 |
| 1165 | Ga0495678_000052 | 3300049459 | Bacteria | 157731 |
| 1166 | Ga0495678_006798 | 3300049459 | Bacteria | 6018 |
| 1167 | Ga0495678_011169 | 3300049459 | Bacteria | 4315 |
| 1168 | Ga0495678_013270 | 3300049459 | Bacteria | 3875 |
| 1169 | Ga0495678_013403 | 3300049459 | Bacteria | 3851 |
| 1170 | Ga0495678_014179 | 3300049459 | Bacteria | 3714 |
| 1171 | Ga0495678_015409 | 3300049459 | Bacteria | 3517 |
| 1172 | Ga0495678_016004 | 3300049459 | Bacteria | 3442 |
| 1173 | Ga0495678_016698 | 3300049459 | Bacteria | 3347 |
| 1174 | Ga0495678_021794 | 3300049459 | Bacteria | 2815 |
| 1175 | Ga0495678_025130 | 3300049459 | Bacteria | 2562 |
| 1176 | Ga0495678_029642 | 3300049459 | Bacteria | 2295 |
| 1177 | Ga0495678_032411 | 3300049459 | Bacteria | 2167 |
| 1178 | Ga0495678_034670 | 3300049459 | Bacteria | 2074 |
| 1179 | Ga0495678_053972 | 3300049459 | Bacteria | 1540 |
| 1180 | Ga0495682_0000096 | 3300049460 | Bacteria | 77498 |
| 1181 | Ga0495682_0010640 | 3300049460 | Bacteria | 3554 |
| 1182 | Ga0495682_0013438 | 3300049460 | Bacteria | 3118 |
| 1183 | Ga0495682_0013644 | 3300049460 | Bacteria | 3091 |
| 1184 | Ga0495682_0023501 | 3300049460 | Bacteria | 2300 |
| 1185 | Ga0495682_0044280 | 3300049460 | Bacteria | 1628 |
| 1186 | Ga0501032_0022775 | 3300049569 | Bacteria | 4339 |
| 1187 | Ga0501033_0006655 | 3300049570 | Bacteria | 9036 |
| 1188 | Ga0501034_0000045 | 3300049571 | Bacteria | 226186 |
| 1189 | Ga0501034_0048749 | 3300049571 | Bacteria | 4275 |
| 1190 | Ga0501034_0246756 | 3300049571 | Bacteria | 1731 |
| 1191 | Ga0501038_0284535 | 3300049574 | Unclassified | 1301 |
| 1192 | Ga0501039_0140055 | 3300049575 | Bacteria | 1900 |
| 1193 | Ga0501043_0137519 | 3300049579 | Bacteria | 1914 |
| 1194 | Ga0501047_0003676 | 3300049581 | Bacteria | 14460 |
| 1195 | Ga0501222_003719 | 3300049662 | Bacteria | 2073 |
| 1196 | Ga0501241_002793 | 3300049758 | Bacteria | 3355 |
| 1197 | Ga0501035_0005107 | 3300049822 | Bacteria | 12433 |
| 1198 | Ga0501044_0001082 | 3300049823 | Bacteria | 32531 |
| 1199 | Ga0501226_000003 | 3300049853 | Bacteria | 358977 |
| 1200 | nmdc:mga03683_69680_c1 | 3300050489 | Bacteria | 1501 |
| 1201 | nmdc:mga00v17_171489_c1 | 3300050491 | Bacteria | 1399 |
| 1202 | nmdc:mga00v17_28884_c1 | 3300050491 | Bacteria | 3251 |
| 1203 | nmdc:mga08x19_190250_c1 | 3300050514 | Bacteria | 1404 |
| 1204 | nmdc:mga0sz30_32681_c1 | 3300050516 | Bacteria | 2159 |
| 1205 | Ga0500572_037660 | 3300053111 | Bacteria | 1387 |
| 1206 | Ga0500659_0000579 | 3300053135 | Bacteria | 23906 |
| 1207 | Ga0500577_0015728 | 3300053142 | Bacteria | 2370 |
| 1208 | Ga0500634_0025265 | 3300053161 | Bacteria | 3233 |
| 1209 | 2511255052 | 2511231004 | Bacteria | 6669789 |
| 1210 | 2511268415 | 2511231006 | Bacteria | 6794709 |
| 1211 | 2511273061 | 2511231007 | Bacteria | 6306603 |
| 1212 | 2511276044 | 2511231008 | Bacteria | 6624100 |
| 1213 | 2511290564 | 2511231010 | Bacteria | 6373152 |
| 1214 | 2511295942 | 2511231011 | Bacteria | 6149768 |
| 1215 | 2511301110 | 2511231012 | Bacteria | 6738011 |
| 1216 | 2511312293 | 2511231014 | Bacteria | 6462302 |
| 1217 | 2511320280 | 2511231015 | Bacteria | 6598026 |
| 1218 | 2511326196 | 2511231016 | Bacteria | 6704427 |
| 1219 | 2511335413 | 2511231017 | Bacteria | 6503007 |
| 1220 | 2511339581 | 2511231018 | Bacteria | 6436256 |
| 1221 | 2511344654 | 2511231019 | Bacteria | 6520662 |
| 1222 | 2511349816 | 2511231020 | Bacteria | 6115223 |
| 1223 | 2511365759 | 2511231022 | Bacteria | 6719296 |
| 1224 | 2511368132 | 2511231023 | Bacteria | 6808468 |
| 1225 | 2511375817 | 2511231024 | Bacteria | 5835885 |
| 1226 | 2511410841 | 2511231031 | Bacteria | 6558529 |
| 1227 | 2511823677 | 2511231156 | Bacteria | 6845832 |
| 1228 | 2512324018 | 2512047018 | Bacteria | 6663241 |
| 1229 | 2554815954 | 2554235132 | Bacteria | 6772433 |
| 1230 | 2555249360 | 2554235231 | Bacteria | 5215788 |
| 1231 | 2555671281 | 2554235341 | Bacteria | 6867980 |
| 1232 | 2583793690 | 2582580891 | Bacteria | 6800976 |
| 1233 | 2597859350 | 2597489887 | Bacteria | 6666321 |
| 1234 | 2597862993 | 2597489888 | Bacteria | 6179543 |
| 1235 | 2597868785 | 2597489889 | Bacteria | 6297495 |
| 1236 | 2599326717 | 2599185155 | Bacteria | 5827168 |
| 1237 | 2599354560 | 2599185160 | Bacteria | 6844013 |
| 1238 | 2599359727 | 2599185161 | Bacteria | 6960462 |
| 1239 | 2599366049 | 2599185162 | Bacteria | 6957254 |
| 1240 | 2599372839 | 2599185163 | Bacteria | 6995158 |
| 1241 | 2599379667 | 2599185164 | Bacteria | 6841688 |
| 1242 | 2599385354 | 2599185165 | Bacteria | 6843250 |
| 1243 | 2599391698 | 2599185166 | Bacteria | 6959206 |
| 1244 | 2599401572 | 2599185167 | Bacteria | 6353609 |
| 1245 | 2599403464 | 2599185168 | Bacteria | 6997636 |
| 1246 | 2599451887 | 2599185179 | Bacteria | 6611171 |
| 1247 | 2599461394 | 2599185181 | Bacteria | 6844519 |
| 1248 | 2599469937 | 2599185182 | Bacteria | 6883168 |
| 1249 | 2599482180 | 2599185185 | Bacteria | 6652270 |
| 1250 | 2599490413 | 2599185186 | Bacteria | 6831633 |
| 1251 | 2599504470 | 2599185188 | Bacteria | 6164180 |
| 1252 | 2599509654 | 2599185189 | Bacteria | 5862825 |
| 1253 | 2599514816 | 2599185190 | Bacteria | 6285678 |
| 1254 | 2599520914 | 2599185191 | Bacteria | 6297582 |
| 1255 | 2599611635 | 2599185212 | Bacteria | 6765997 |
| 1256 | 2599770270 | 2599185248 | Bacteria | 6696816 |
| 1257 | 2599804102 | 2599185257 | Bacteria | 6492581 |
| 1258 | 2599882161 | 2599185288 | Bacteria | 6666191 |
| 1259 | 2599887521 | 2599185289 | Bacteria | 6778765 |
| 1260 | 2599894387 | 2599185290 | Bacteria | 6289611 |
| 1261 | 2599900000 | 2599185291 | Bacteria | 6775623 |
| 1262 | 2599932132 | 2599185300 | Bacteria | 6062622 |
| 1263 | 2599941795 | 2599185302 | Bacteria | 5954930 |
| 1264 | 2599951595 | 2599185303 | Bacteria | 6512725 |
| 1265 | 2599952685 | 2599185304 | Bacteria | 5951361 |
| 1266 | 2599960576 | 2599185305 | Bacteria | 6748700 |
| 1267 | 2599964870 | 2599185306 | Bacteria | 6637356 |
| 1268 | 2599973603 | 2599185307 | Bacteria | 6194719 |
| 1269 | 2599976017 | 2599185308 | Bacteria | 6621546 |
| 1270 | 2599981964 | 2599185309 | Bacteria | 5969593 |
| 1271 | 2599987873 | 2599185310 | Bacteria | 6014457 |
| 1272 | 2599995576 | 2599185311 | Bacteria | 6354990 |
| 1273 | 2599998235 | 2599185312 | Bacteria | 5912071 |
| 1274 | 2600005399 | 2599185313 | Bacteria | 6658188 |
| 1275 | 2600010102 | 2599185314 | Bacteria | 6621749 |
| 1276 | 2600017383 | 2599185315 | Bacteria | 6771107 |
| 1277 | 2600022606 | 2599185316 | Bacteria | 6320029 |
| 1278 | 2600027626 | 2599185317 | Bacteria | 6435722 |
| 1279 | 2600034410 | 2599185318 | Bacteria | 6961590 |
| 1280 | 2600039906 | 2599185319 | Bacteria | 6637840 |
| 1281 | 2600046203 | 2599185320 | Bacteria | 5963263 |
| 1282 | 2600052206 | 2599185321 | Bacteria | 6764560 |
| 1283 | 2600057583 | 2599185322 | Bacteria | 6763055 |
| 1284 | 2600068817 | 2599185323 | Bacteria | 6688755 |
| 1285 | 2600072321 | 2599185324 | Bacteria | 6590677 |
| 1286 | 2600075881 | 2599185325 | Bacteria | 6324919 |
| 1287 | 2600214012 | 2599185356 | Bacteria | 6843884 |
| 1288 | 2600356665 | 2600254930 | Bacteria | 6431253 |
| 1289 | 2600364258 | 2600254931 | Bacteria | 6734225 |
| 1290 | 2600444523 | 2600254954 | Bacteria | 5100516 |
| 1291 | 2601623903 | 2600255283 | Bacteria | 6061572 |
| 1292 | 2601694298 | 2600255296 | Bacteria | 5784754 |
| 1293 | 2601774178 | 2600255313 | Bacteria | 6842543 |
| 1294 | 2601796266 | 2600255318 | Bacteria | 6383414 |
| 1295 | 2602011597 | 2600255389 | Bacteria | 5275336 |
| 1296 | 2606073415 | 2603880185 | Bacteria | 6379190 |
| 1297 | 2606126939 | 2603880199 | Bacteria | 6377649 |
| 1298 | 2608382328 | 2606217733 | Bacteria | 6360972 |
| 1299 | 2621300936 | 2619619299 | Bacteria | 6649820 |
| 1300 | 2624481915 | 2623620443 | Bacteria | 6427864 |
| 1301 | 2624490999 | 2623620446 | Bacteria | 6500345 |
| 1302 | 2643845617 | 2643221565 | Bacteria | 6216018 |
| 1303 | 2643871671 | 2643221571 | Bacteria | 6228673 |
| 1304 | 2643956494 | 2643221589 | Bacteria | 6250934 |
| 1305 | 2644025464 | 2643221602 | Bacteria | 6249926 |
| 1306 | 2644185485 | 2643221633 | Bacteria | 6733554 |
| 1307 | 2644284855 | 2643221650 | Bacteria | 7029547 |
| 1308 | 2644623547 | 2643221713 | Bacteria | 6554480 |
| 1309 | 2652543844 | 2651869719 | Bacteria | 6047974 |
| 1310 | 2671090180 | 2667528170 | Bacteria | 6786960 |
| 1311 | 2671097141 | 2667528171 | Bacteria | 6900659 |
| 1312 | 2671126004 | 2667528176 | Bacteria | 6724917 |
| 1313 | 2671770330 | 2671180172 | Bacteria | 6495783 |
| 1314 | 2677896830 | 2675903420 | Bacteria | 6247433 |
| 1315 | 2678262609 | 2675903515 | Bacteria | 6580491 |
| 1316 | 2715751218 | 2713897148 | Bacteria | 5883533 |
| 1317 | 2715758218 | 2713897149 | Bacteria | 6506249 |
| 1318 | 2718635166 | 2718217725 | Bacteria | 5758958 |
| 1319 | 2723247809 | 2721755607 | Bacteria | 5841722 |
| 1320 | 2729148766 | 2728369097 | Bacteria | 4333476 |
| 1321 | 2738670439 | 2738541265 | Bacteria | 6594665 |
| 1322 | 2738688775 | 2738541271 | Bacteria | 5657310 |
| 1323 | 2738748832 | 2738541282 | Bacteria | 6593925 |
| 1324 | 2738810814 | 2738541294 | Bacteria | 6925949 |
| 1325 | 2738857874 | 2738541303 | Bacteria | 6591772 |
| 1326 | 2738898174 | 2738541309 | Bacteria | 6926455 |
| 1327 | 2739201954 | 2738543004 | Bacteria | 6381073 |
| 1328 | 2739259243 | 2738543015 | Bacteria | 6750701 |
| 1329 | 2739264914 | 2738543016 | Bacteria | 5657564 |
| 1330 | 2739287463 | 2738543020 | Bacteria | 5718238 |
| 1331 | 2739292776 | 2738543021 | Bacteria | 5718241 |
| 1332 | 2739314073 | 2738543025 | Bacteria | 6600348 |
| 1333 | 2743738882 | 2740892503 | Bacteria | 6855563 |
| 1334 | 2745008949 | 2744054620 | Bacteria | 6551379 |
| 1335 | 2765585016 | 2765235841 | Bacteria | 6137024 |
| 1336 | 2774119190 | 2773857670 | Bacteria | 6407454 |
| 1337 | 2774132825 | 2773857673 | Bacteria | 6513460 |
| 1338 | 2784263363 | 2784132063 | Bacteria | 6262788 |
| 1339 | 2784314840 | 2784132072 | Bacteria | 6596533 |
| 1340 | 2794596413 | 2791355520 | Bacteria | 5948615 |
| 1341 | 2807409081 | 2806310737 | Bacteria | 5751088 |
| 1342 | 2807457417 | 2806310745 | Bacteria | 5742165 |
| 1343 | 2808855078 | 2808606361 | Bacteria | 6136259 |
| 1344 | 2808903904 | 2808606373 | Bacteria | 4423627 |
| 1345 | 2808924355 | 2808606376 | Bacteria | 6248667 |
| 1346 | 2808930610 | 2808606377 | Bacteria | 6646337 |
| 1347 | 2808935734 | 2808606378 | Bacteria | 6177535 |
| 1348 | 2808941370 | 2808606379 | Bacteria | 5022697 |
| 1349 | 2808946547 | 2808606380 | Bacteria | 6248705 |
| 1350 | 2808952732 | 2808606381 | Bacteria | 6646461 |
| 1351 | 2808958983 | 2808606382 | Bacteria | 6841132 |
| 1352 | 2808963571 | 2808606383 | Bacteria | 6138645 |
| 1353 | 2808979472 | 2808606385 | Bacteria | 6711065 |
| 1354 | 2808995396 | 2808606388 | Bacteria | 6706662 |
| 1355 | 2808998471 | 2808606389 | Bacteria | 6138126 |
| 1356 | 2809218768 | 2808606445 | Bacteria | 6057339 |
| 1357 | 2812367865 | 2811994881 | Bacteria | 6298475 |
| 1358 | 2817489763 | 2816332298 | Bacteria | 6852809 |
| 1359 | 2819655659 | 2818991456 | Bacteria | 6123676 |
| 1360 | 2819702238 | 2818991464 | Bacteria | 6907494 |
| 1361 | 2823423555 | 2823421272 | Bacteria | 5372474 |
| 1362 | 2825653026 | 2825651385 | Bacteria | 6715909 |
| 1363 | 2826584608 | 2826581358 | Bacteria | 5963467 |
| 1364 | 2834029640 | 2834028612 | Bacteria | 6354979 |
| 1365 | 2842806052 | 2842805378 | Bacteria | 5385175 |
| 1366 | 2842820179 | 2842815866 | Bacteria | 5947510 |
| 1367 | 2842831996 | 2842826826 | Bacteria | 5974129 |
| 1368 | 2842836510 | 2842832357 | Bacteria | 5959113 |
| 1369 | 2842841580 | 2842837860 | Bacteria | 6066181 |
| 1370 | 2842844623 | 2842843487 | Bacteria | 6004777 |
| 1371 | 2842850770 | 2842849001 | Bacteria | 5924277 |
| 1372 | 2842854663 | 2842854478 | Bacteria | 6143501 |
| 1373 | 2844671805 | 2844665904 | Bacteria | 6817974 |
| 1374 | 2852618479 | 2852612431 | Bacteria | 6885235 |
| 1375 | 2852663159 | 2852657418 | Bacteria | 6472974 |
| 1376 | 2852673385 | 2852667396 | Bacteria | 6885555 |
| 1377 | 2860340795 | 2860339153 | Bacteria | 6846989 |
| 1378 | 2860869634 | 2860867994 | Bacteria | 5645326 |
| 1379 | 2878033899 | 2878029506 | Bacteria | 6418441 |
| 1380 | 2880234524 | 2880230671 | Bacteria | 6140320 |
| 1381 | 2904521335 | 2904518522 | Bacteria | 6068986 |
| 1382 | 2904555117 | 2904550169 | Bacteria | 6221258 |
| 1383 | 2908448555 | 2908446538 | Bacteria | 6829095 |
| 1384 | 2912967282 | 2912963787 | Bacteria | 5646108 |
| 1385 | 2913038588 | 2913036834 | Bacteria | 6704877 |
| 1386 | 2917075142 | 2917070673 | Bacteria | 6868303 |
| 1387 | 2919068885 | 2919063839 | Bacteria | 6302690 |
| 1388 | 2919156964 | 2919155634 | Bacteria | 4860545 |
| 1389 | 2919387992 | 2919385768 | Bacteria | 5897293 |
| 1390 | 2919461073 | 2919456309 | Bacteria | 6586567 |
| 1391 | 2919481863 | 2919481497 | Bacteria | 6907839 |
| 1392 | 2919489826 | 2919487758 | Bacteria | 5929766 |
| 1393 | 2919503264 | 2919501602 | Bacteria | 5286340 |
| 1394 | 2919702014 | 2919697872 | Bacteria | 6553725 |
| 1395 | 2923157955 | 2923153595 | Bacteria | 6870622 |
| 1396 | 2923521916 | 2923519811 | Bacteria | 6298479 |
| 1397 | 2923587300 | 2923586266 | Bacteria | 6565975 |
| 1398 | 2926066165 | 2926063275 | Bacteria | 5285848 |
| 1399 | 2929146040 | 2929144301 | Bacteria | 6622272 |
| 1400 | 2929191610 | 2929189879 | Bacteria | 5930554 |
| 1401 | 2931370622 | 2931369376 | Bacteria | 6847892 |
| 1402 | 2931392707 | 2931390751 | Bacteria | 6273349 |
| 1403 | 2931403348 | 2931396565 | Bacteria | 7251677 |
| 1404 | 2935356130 | 2935353572 | Unclassified | 6955622 |
| 1405 | 2939637628 | 2939636861 | Bacteria | 6297853 |
| 1406 | 2939654844 | 2939651529 | Bacteria | 5895393 |
| 1407 | 2945928958 | 2945928738 | Bacteria | 6053221 |
| 1408 | 2945962245 | 2945961074 | Bacteria | 7342064 |
| 1409 | 2946011181 | 2946006987 | Bacteria | 6705746 |
| 1410 | 2946029892 | 2946027586 | Bacteria | 6049274 |
| 1411 | 2947236462 | 2947233263 | Bacteria | 6439278 |
| 1412 | 2969308674 | 2969304461 | Bacteria | 6601805 |
| 1413 | 2974289952 | 2974289157 | Bacteria | 6080362 |
| 1414 | 2984288218 | 2984286254 | Bacteria | 6702062 |
| 1415 | 2988733572 | 2988728565 | Bacteria | 6124362 |
| 1416 | 2990199270 | 2990196909 | Bacteria | 4054280 |
| 1417 | 2998143979 | 2998139840 | Bacteria | 6073514 |
| 1418 | 3007397264 | 3007395558 | Bacteria | 6755444 |
| 1419 | 3007424467 | 3007419365 | Bacteria | 7026924 |
| 1420 | 3007424468 | 3007419365 | Bacteria | 7026924 |
| 1421 | 3007515327 | 3007511990 | Bacteria | 6481491 |
| 1422 | 3007616873 | 3007614139 | Bacteria | 6053559 |
| 1423 | 3007620083 | 3007619802 | Bacteria | 6411688 |
| 1424 | 3007718905 | 3007718800 | Bacteria | 5971527 |
| 1425 | 3007806114 | 3007803356 | Bacteria | 5931491 |
| 1426 | 3007857885 | 3007855910 | Bacteria | 5637581 |
| 1427 | 3007865409 | 3007861166 | Bacteria | 6045338 |
| 1428 | 3007870261 | 3007866637 | Bacteria | 5899198 |
| 1429 | 3007874338 | 3007872151 | Bacteria | 5268868 |
| 1430 | 637321608 | 637000220 | Bacteria | 7074893 |
| 1431 | 640487975 | 640427133 | Bacteria | 4567418 |
| 1432 | 651175926 | 651053060 | Bacteria | 4689946 |
| 1433 | 8011353134 | 8011350971 | Bacteria | 6158957 |
| 1434 | 8015692053 | 8015687852 | Bacteria | 6613826 |
| 1435 | 8019775167 | 8019769354 | Bacteria | 6924660 |
| 1436 | 8019780982 | 8019775933 | Bacteria | 6858656 |
| 1437 | 8029996898 | 8029995093 | Bacteria | 5990776 |
| 1438 | 8034964889 | 8034962539 | Bacteria | 4884839 |
| 1439 | 8052496488 | 8052494512 | Bacteria | 5765634 |
| 1440 | 8054288264 | 8054285046 | Bacteria | 6919322 |
| 1441 | 8054352072 | 8054347763 | Bacteria | 5901107 |
| 1442 | 8054505211 | 8054503363 | Bacteria | 6101651 |
| 1443 | 8054932405 | 8054929484 | Bacteria | 5599761 |
| 1444 | 8055775262 | 8055770955 | Bacteria | 6827675 |
| 1445 | 8056119447 | 8056115690 | Bacteria | 5527654 |
| 1446 | 8056122625 | 8056120720 | Bacteria | 5758328 |
| 1447 | 8056127579 | 8056125926 | Bacteria | 6228218 |
| 1448 | 8056133537 | 8056131705 | Bacteria | 6107031 |
| 1449 | 8056139400 | 8056137416 | Bacteria | 6147080 |
| 1450 | 8056147251 | 8056143049 | Bacteria | 6307666 |
| 1451 | 8056150444 | 8056148874 | Bacteria | 6479865 |
| 1452 | 8056157359 | 8056155041 | Bacteria | 6486948 |
| 1453 | 8056164960 | 8056161164 | Bacteria | 6106669 |
| 1454 | 8056167296 | 8056166840 | Bacteria | 5820959 |
| 1455 | 8056173281 | 8056172158 | Bacteria | 6133900 |
| 1456 | 8056179474 | 8056177738 | Bacteria | 6748268 |
| 1457 | 8056572721 | 8056569372 | Bacteria | 5997322 |
| 1458 | 8057804090 | 8057798959 | Bacteria | 6713499 |
| 1459 | Ga0496122_0144263 | |||
| 1460 | MRS2a_Contig_23 | |||
| 1461 | SwRhRL2b_contig_1956582 | |||
| 1462 | SwRhRL2b_contig_487690 | |||
| 1463 | JGI25162J39368_1000212 | |||
| 1464 | JGI25162J39368_1001980 | |||
| 1465 | JGI25154J39366_1004030 | |||
| 1466 | JGI25163J39215_1000915 | |||
| 1467 | JGI25163J39215_1001532 | |||
| 1468 | JGI25164J39214_1000051 | |||
| 1469 | JGI25164J39214_1000968 | |||
| 1470 | JGI25165J46597_1000091 | |||
| 1471 | JGI25165J46597_1000362 | |||
| 1472 | Ga0055538_1000090 | |||
| 1473 | Ga0055539_1000134 | |||
| 1474 | Ga0055533_1000138 | |||
| 1475 | Ga0055532_1000142 | |||
| 1476 | Ga0055525_1000183 | |||
| 1477 | Ga0055536_1003164 | |||
| 1478 | Ga0055536_1003707 | |||
| 1479 | Ga0055536_1006059 | |||
| 1480 | Ga0055530_10001052 | |||
| 1481 | Ga0055530_10005782 | |||
| 1482 | Ga0055530_10008091 | |||
| 1483 | Ga0055530_10008522 | |||
| 1484 | Ga0055540_1000761 | |||
| 1485 | Ga0055540_1003543 | |||
| 1486 | Ga0055540_1005018 | |||
| 1487 | Ga0055531_10000155 | |||
| 1488 | Ga0055541_1000089 | |||
| 1489 | Ga0058692_1011241 | |||
| 1490 | Ga0065714_10015950 | |||
| 1491 | Ga0065714_10065661 | |||
| 1492 | Ga0065714_10071039 | |||
| 1493 | Ga0065714_10074186 | |||
| 1494 | Ga0065714_10075251 | |||
| 1495 | Ga0065714_10080165 | |||
| 1496 | Ga0065714_10087068 | |||
| 1497 | Ga0065714_10088161 | |||
| 1498 | Ga0065704_10082309 | |||
| 1499 | Ga0065704_10116021 | |||
| 1500 | Ga0065712_10069003 | |||
| 1501 | Ga0065712_10074271 | |||
| 1502 | Ga0065715_10009547 | |||
| 1503 | Ga0070670_100001904 | |||
| 1504 | Ga0070670_100028185 | |||
| 1505 | Ga0070666_10283346 | |||
| 1506 | Ga0070661_100001382 | |||
| 1507 | Ga0070669_100014474 | |||
| 1508 | Ga0070662_100004011 | |||
| 1509 | Ga0068853_100041377 | |||
| 1510 | Ga0070665_100340348 | |||
| 1511 | Ga0070664_100048684 | |||
| 1512 | Ga0068854_100050643 | |||
| 1513 | Ga0068851_10000270 | |||
| 1514 | Ga0075364_10058896 | |||
| 1515 | Ga0075364_10273768 | |||
| 1516 | Ga0075432_10001936 | |||
| 1517 | Ga0075432_10020863 | |||
| 1518 | Ga0075432_10035805 | |||
| 1519 | Ga0075432_10037037 | |||
| 1520 | Ga0075362_10149442 | |||
| 1521 | Ga0075369_10011307 | |||
| 1522 | Ga0075436_100044737 | |||
| 1523 | Ga0075436_100118565 | |||
| 1524 | Ga0099823_1025634 | |||
| 1525 | Ga0079104_1000124 | |||
| 1526 | Ga0079104_1000346 | |||
| 1527 | Ga0079104_1036220 | |||
| 1528 | Ga0105251_10001086 | |||
| 1529 | Ga0105251_10007770 | |||
| 1530 | Ga0105251_10010898 | |||
| 1531 | Ga0105251_10011710 | |||
| 1532 | Ga0105251_10013936 | |||
| 1533 | Ga0105251_10014962 | |||
| 1534 | Ga0105251_10016094 | |||
| 1535 | Ga0105251_10037125 | |||
| 1536 | Ga0105251_10048943 | |||
| 1537 | Ga0105251_10079967 | |||
| 1538 | Ga0105251_10091597 | |||
| 1539 | Ga0105251_10131838 | |||
| 1540 | Ga0105244_10001463 | |||
| 1541 | Ga0105244_10001906 | |||
| 1542 | Ga0105244_10016257 | |||
| 1543 | Ga0105244_10020060 | |||
| 1544 | Ga0105244_10020995 | |||
| 1545 | Ga0105244_10022792 | |||
| 1546 | Ga0105244_10025803 | |||
| 1547 | Ga0105244_10035892 | |||
| 1548 | Ga0105244_10059634 | |||
| 1549 | Ga0105244_10079174 | |||
| 1550 | Ga0105244_10113392 | |||
| 1551 | Ga0105250_10002971 | |||
| 1552 | Ga0105250_10010454 | |||
| 1553 | Ga0105250_10023751 | |||
| 1554 | Ga0105250_10036496 | |||
| 1555 | Ga0105250_10079966 | |||
| 1556 | Ga0105250_10093430 | |||
| 1557 | Ga0105243_10006610 | |||
| 1558 | Ga0105243_10020166 | |||
| 1559 | Ga0105243_10039758 | |||
| 1560 | Ga0105243_10178584 | |||
| 1561 | Ga0105243_10343075 | |||
| 1562 | Ga0105242_10000806 | |||
| 1563 | Ga0105248_10051491 | |||
| 1564 | Ga0105237_10001117 | |||
| 1565 | Ga0105246_10000955 | |||
| 1566 | Ga0105246_10013949 | |||
| 1567 | Ga0105246_10017697 | |||
| 1568 | Ga0157345_1000373 | |||
| 1569 | Ga0157373_10008126 | |||
| 1570 | Ga0157373_10014225 | |||
| 1571 | Ga0157373_10038396 | |||
| 1572 | Ga0157373_10040410 | |||
| 1573 | Ga0157373_10048024 | |||
| 1574 | Ga0157373_10053698 | |||
| 1575 | Ga0157373_10057643 | |||
| 1576 | Ga0157373_10058053 | |||
| 1577 | Ga0157371_10000539 | |||
| 1578 | Ga0157371_10031615 | |||
| 1579 | Ga0157371_10046483 | |||
| 1580 | Ga0157370_10000898 | |||
| 1581 | Ga0157370_10011567 | |||
| 1582 | Ga0157370_10062076 | |||
| 1583 | Ga0157370_10065776 | |||
| 1584 | Ga0157370_10070770 | |||
| 1585 | Ga0157370_10172419 | |||
| 1586 | Ga0157370_10181109 | |||
| 1587 | Ga0157370_10191978 | |||
| 1588 | Ga0157370_10381100 | |||
| 1589 | Ga0157370_10434233 | |||
| 1590 | Ga0157369_10024274 | |||
| 1591 | Ga0157369_10040608 | |||
| 1592 | Ga0157369_10075729 | |||
| 1593 | Ga0157369_10101787 | |||
| 1594 | Ga0157369_10127285 | |||
| 1595 | Ga0157369_10221937 | |||
| 1596 | Ga0157369_10249738 | |||
| 1597 | Ga0163162_10001711 | |||
| 1598 | Ga0163162_10068222 | |||
| 1599 | Ga0163162_10590839 | |||
| 1600 | Ga0157372_10003837 | |||
| 1601 | Ga0157372_10064792 | |||
| 1602 | Ga0157375_10014826 | |||
| 1603 | Ga0157375_10066899 | |||
| 1604 | Ga0157375_10152419 | |||
| 1605 | Ga0157375_10226066 | |||
| 1606 | Ga0157375_10304754 | |||
| 1607 | Ga0182008_10000220 | |||
| 1608 | Ga0182008_10012275 | |||
| 1609 | Ga0182008_10018268 | |||
| 1610 | Ga0182008_10018497 | |||
| 1611 | Ga0182008_10018951 | |||
| 1612 | Ga0182008_10026399 | |||
| 1613 | Ga0182008_10026408 | |||
| 1614 | Ga0182008_10029604 | |||
| 1615 | Ga0182008_10029652 | |||
| 1616 | Ga0182006_1006014 | |||
| 1617 | Ga0182006_1012783 | |||
| 1618 | Ga0182006_1013548 | |||
| 1619 | Ga0182006_1021236 | |||
| 1620 | Ga0182006_1024467 | |||
| 1621 | Ga0182006_1031212 | |||
| 1622 | Ga0182006_1077419 | |||
| 1623 | Ga0182007_10008644 | |||
| 1624 | Ga0182007_10015170 | |||
| 1625 | Ga0182005_1006302 | |||
| 1626 | Ga0182005_1014124 | |||
| 1627 | Ga0182005_1014361 | |||
| 1628 | Ga0182005_1023058 | |||
| 1629 | Ga0182005_1030589 | |||
| 1630 | Ga0163161_10033767 | |||
| 1631 | Ga0163161_10035439 | |||
| 1632 | Ga0163161_10036141 | |||
| 1633 | Ga0163161_10042656 | |||
| 1634 | Ga0163161_10057211 | |||
| 1635 | Ga0163161_10077733 | |||
| 1636 | Ga0163161_10190008 | |||
| 1637 | Ga0163161_10192177 | |||
| 1638 | Ga0163161_10286002 | |||
| 1639 | Ga0163161_10298421 | |||
| 1640 | Ga0209435_100860 | |||
| 1641 | Ga0209760_100043 | |||
| 1642 | Ga0209760_100266 | |||
| 1643 | Ga0209784_100040 | |||
| 1644 | Ga0209566_100051 | |||
| 1645 | Ga0209674_100072 | |||
| 1646 | Ga0209147_100067 | |||
| 1647 | Ga0209563_100073 | |||
| 1648 | Ga0209563_100986 | |||
| 1649 | Ga0207427_100047 | |||
| 1650 | Ga0207427_100074 | |||
| 1651 | Ga0209437_100006 | |||
| 1652 | Ga0209437_100009 | |||
| 1653 | Ga0209258_100585 | |||
| 1654 | Ga0209646_1000325 | |||
| 1655 | Ga0209677_100121 | |||
| 1656 | Ga0209759_1005254 | |||
| 1657 | Ga0209759_1016975 | |||
| 1658 | Ga0209233_1000032 | |||
| 1659 | Ga0209233_1000105 | |||
| 1660 | Ga0209676_1000006 | |||
| 1661 | Ga0209676_1000010 | |||
| 1662 | Ga0209676_1000223 | |||
| 1663 | Ga0209676_1000697 | |||
| 1664 | Ga0209676_1008685 | |||
| 1665 | Ga0209676_1014110 | |||
| 1666 | Ga0209050_1000009 | |||
| 1667 | Ga0209050_1000081 | |||
| 1668 | Ga0209050_1000214 | |||
| 1669 | Ga0209050_1004712 | |||
| 1670 | Ga0209051_1000008 | |||
| 1671 | Ga0209051_1000104 | |||
| 1672 | Ga0209051_1000163 | |||
| 1673 | Ga0209257_1000040 | |||
| 1674 | Ga0209257_1010723 | |||
| 1675 | Ga0207656_10000155 | |||
| 1676 | Ga0207696_1000023 | |||
| 1677 | Ga0207696_1000097 | |||
| 1678 | Ga0207696_1000171 | |||
| 1679 | Ga0207696_1006861 | |||
| 1680 | Ga0207696_1010580 | |||
| 1681 | Ga0207696_1011801 | |||
| 1682 | Ga0207655_1000005 | |||
| 1683 | Ga0207655_1000286 | |||
| 1684 | Ga0207655_1000654 | |||
| 1685 | Ga0207655_1002408 | |||
| 1686 | Ga0207655_1002485 | |||
| 1687 | Ga0207655_1002775 | |||
| 1688 | Ga0207655_1004224 | |||
| 1689 | Ga0207655_1005310 | |||
| 1690 | Ga0207655_1008889 | |||
| 1691 | Ga0207655_1011696 | |||
| 1692 | Ga0207655_1017604 | |||
| 1693 | Ga0207655_1018017 | |||
| 1694 | Ga0207655_1031047 | |||
| 1695 | Ga0207655_1047383 | |||
| 1696 | Ga0207655_1062903 | |||
| 1697 | Ga0207713_1000482 | |||
| 1698 | Ga0207713_1000530 | |||
| 1699 | Ga0207713_1001461 | |||
| 1700 | Ga0207713_1002221 | |||
| 1701 | Ga0207713_1005180 | |||
| 1702 | Ga0207713_1005193 | |||
| 1703 | Ga0207713_1007061 | |||
| 1704 | Ga0207713_1010578 | |||
| 1705 | Ga0207713_1015187 | |||
| 1706 | Ga0207713_1015463 | |||
| 1707 | Ga0207713_1017765 | |||
| 1708 | Ga0207713_1020189 | |||
| 1709 | Ga0207713_1059555 | |||
| 1710 | Ga0207671_10000989 | |||
| 1711 | Ga0207649_10000041 | |||
| 1712 | Ga0207681_10001672 | |||
| 1713 | Ga0207681_10010641 | |||
| 1714 | Ga0207650_10001409 | |||
| 1715 | Ga0207650_10037320 | |||
| 1716 | Ga0207706_10024092 | |||
| 1717 | Ga0207686_10006378 | |||
| 1718 | Ga0207709_10000035 | |||
| 1719 | Ga0207709_10000821 | |||
| 1720 | Ga0207711_10045895 | |||
| 1721 | Ga0207679_10000018 | |||
| 1722 | Ga0207640_10039908 | |||
| 1723 | Ga0207658_10075143 | |||
| 1724 | Ga0207639_10007037 | |||
| 1725 | Ga0207678_10175953 | |||
| 1726 | Ga0209281_1000018 | |||
| 1727 | Ga0209281_1000077 | |||
| 1728 | Ga0209281_1008349 | |||
| 1729 | Ga0209281_1009302 | |||
| 1730 | Ga0209389_1000078 | |||
| 1731 | Ga0209371_1000523 | |||
| 1732 | Ga0209999_1004680 | |||
| 1733 | Ga0209982_1000266 | |||
| 1734 | Ga0209983_1000169 | |||
| 1735 | Ga0209974_10004883 | |||
| 1736 | Ga0207428_10040376 | |||
| 1737 | Ga0207428_10104958 | |||
| 1738 | Ga0268266_10081176 | |||
| 1739 | Ga0307517_10166685 | |||
| 1740 | Ga0268256_1000435 | |||
| 1741 | Ga0307511_10117276 | |||
| 1742 | Ga0316178_1126744 | |||
| 1743 | Ga0316183_1027011 | |||
| 1744 | Ga0316183_1108964 | |||
| 1745 | Ga0316181_1020959 | |||
| 1746 | Ga0316181_1243951 | |||
| 1747 | Ga0307509_10101691 | |||
| 1748 | Ga0307408_100000004 | |||
| 1749 | Ga0307408_100022328 | |||
| 1750 | Ga0307408_100024028 | |||
| 1751 | Ga0307408_100051672 | |||
| 1752 | Ga0307408_100055724 | |||
| 1753 | Ga0307405_10003193 | |||
| 1754 | Ga0307405_10026403 | |||
| 1755 | Ga0307405_10035767 | |||
| 1756 | Ga0307413_10128044 | |||
| 1757 | Ga0307413_10129031 | |||
| 1758 | Ga0307406_10009019 | |||
| 1759 | Ga0307412_10018971 | |||
| 1760 | Ga0307412_10038204 | |||
| 1761 | Ga0307412_10043291 | |||
| 1762 | Ga0307412_10081230 | |||
| 1763 | Ga0307412_10194272 | |||
| 1764 | Ga0307416_100096082 | |||
| 1765 | Ga0307416_100240226 | |||
| 1766 | Ga0307414_10108775 | |||
| 1767 | Ga0307414_10284991 | |||
| 1768 | Ga0307411_10012048 | |||
| 1769 | Ga0307411_10043657 | |||
| 1770 | Ga0307510_10065677 | |||
| 1771 | Ga0307510_10129647 | |||
| 1772 | Ga0395905_0103490 | |||
| 1773 | Ga0439436_0003290 | |||
| 1774 | Ga0439438_003561 | |||
| 1775 | Ga0439438_003697 | |||
| 1776 | Ga0439438_004126 | |||
| 1777 | Ga0439438_006083 | |||
| 1778 | Ga0439438_006841 | |||
| 1779 | Ga0439438_007752 | |||
| 1780 | Ga0439438_010178 | |||
| 1781 | Ga0439438_010309 | |||
| 1782 | Ga0439438_011658 | |||
| 1783 | Ga0439438_012775 | |||
| 1784 | Ga0439438_013630 | |||
| 1785 | Ga0439438_015864 | |||
| 1786 | Ga0439447_004923 | |||
| 1787 | Ga0439447_004954 | |||
| 1788 | Ga0439447_005638 | |||
| 1789 | Ga0439447_007432 | |||
| 1790 | Ga0439447_009069 | |||
| 1791 | Ga0439447_010505 | |||
| 1792 | Ga0439447_035234 | |||
| 1793 | Ga0439447_037560 | |||
| 1794 | Ga0439466_0002783 | |||
| 1795 | Ga0439466_0003656 | |||
| 1796 | Ga0439466_0004071 | |||
| 1797 | Ga0439466_0004606 | |||
| 1798 | Ga0439466_0006152 | |||
| 1799 | Ga0439466_0007214 | |||
| 1800 | Ga0439466_0007710 | |||
| 1801 | Ga0439466_0008146 | |||
| 1802 | Ga0439466_0012617 | |||
| 1803 | Ga0439466_0013919 | |||
| 1804 | Ga0439466_0017128 | |||
| 1805 | Ga0439465_0057524 | |||
| 1806 | Ga0439431_0004892 | |||
| 1807 | Ga0439445_0006188 | |||
| 1808 | Ga0439445_0019109 | |||
| 1809 | Ga0439432_003233 | |||
| 1810 | Ga0439432_003656 | |||
| 1811 | Ga0439432_003695 | |||
| 1812 | Ga0439432_005575 | |||
| 1813 | Ga0439432_006290 | |||
| 1814 | Ga0439432_007166 | |||
| 1815 | Ga0439432_008692 | |||
| 1816 | Ga0439432_021400 | |||
| 1817 | Ga0439432_031598 | |||
| 1818 | Ga0439432_054558 | |||
| 1819 | Ga0439432_086244 | |||
| 1820 | Ga0439451_002373 | |||
| 1821 | Ga0439451_004086 | |||
| 1822 | Ga0439451_005307 | |||
| 1823 | Ga0439451_025241 | |||
| 1824 | Ga0439452_001600 | |||
| 1825 | Ga0439452_002058 | |||
| 1826 | Ga0439452_003163 | |||
| 1827 | Ga0439452_003228 | |||
| 1828 | Ga0439452_004619 | |||
| 1829 | Ga0439452_005219 | |||
| 1830 | Ga0439452_005695 | |||
| 1831 | Ga0439452_020287 | |||
| 1832 | Ga0439452_021242 | |||
| 1833 | Ga0439456_000063 | |||
| 1834 | Ga0439456_007269 | |||
| 1835 | Ga0439456_019984 | |||
| 1836 | Ga0439463_000743 | |||
| 1837 | Ga0439463_001279 | |||
| 1838 | Ga0439463_027241 | |||
| 1839 | Ga0439463_029054 | |||
| 1840 | Ga0450911_000001 | |||
| 1841 | Ga0450911_000890 | |||
| 1842 | Ga0450911_001929 | |||
| 1843 | Ga0450911_003645 | |||
| 1844 | Ga0450911_011899 | |||
| 1845 | Ga0450920_002436 | |||
| 1846 | Ga0450922_000421 | |||
| 1847 | Ga0450890_000787 | |||
| 1848 | Ga0450891_001948 | |||
| 1849 | Ga0450900_002637 | |||
| 1850 | Ga0450902_013351 | |||
| 1851 | Ga0450903_001824 | |||
| 1852 | Ga0450903_002073 | |||
| 1853 | Ga0450903_003385 | |||
| 1854 | Ga0450903_005803 | |||
| 1855 | Ga0450904_000014 | |||
| 1856 | Ga0450904_001675 | |||
| 1857 | Ga0450904_002907 | |||
| 1858 | Ga0450904_011419 | |||
| 1859 | Ga0450905_002102 | |||
| 1860 | Ga0450905_002296 | |||
| 1861 | Ga0450906_001168 | |||
| 1862 | Ga0450906_009726 | |||
| 1863 | Ga0450907_001048 | |||
| 1864 | Ga0450907_001714 | |||
| 1865 | Ga0450907_001853 | |||
| 1866 | Ga0439446_0000095 | |||
| 1867 | Ga0439446_0004205 | |||
| 1868 | Ga0439446_0014427 | |||
| 1869 | Ga0450908_002774 | |||
| 1870 | Ga0450909_000126 | |||
| 1871 | Ga0450909_002105 | |||
| 1872 | Ga0450909_004635 | |||
| 1873 | Ga0439434_0000449 | |||
| 1874 | Ga0439434_0002370 | |||
| 1875 | Ga0439460_0004229 | |||
| 1876 | Ga0439460_0004727 | |||
| 1877 | Ga0450916_000233 | |||
| 1878 | Ga0450918_007003 | |||
| 1879 | Ga0450901_000729 | |||
| 1880 | Ga0450901_001466 | |||
| 1881 | Ga0439440_0004576 | |||
| 1882 | Ga0439440_0004831 | |||
| 1883 | Ga0439440_0020699 | |||
| 1884 | Ga0495617_004971 | |||
| 1885 | Ga0495617_007793 | |||
| 1886 | Ga0495617_008104 | |||
| 1887 | Ga0495617_013457 | |||
| 1888 | Ga0495617_016132 | |||
| 1889 | Ga0495617_030098 | |||
| 1890 | Ga0495617_042981 | |||
| 1891 | Ga0495617_051088 | |||
| 1892 | Ga0495617_057044 | |||
| 1893 | Ga0495617_075689 | |||
| 1894 | Ga0495627_000032 | |||
| 1895 | Ga0495627_002374 | |||
| 1896 | Ga0495627_006922 | |||
| 1897 | Ga0495627_009358 | |||
| 1898 | Ga0495627_011229 | |||
| 1899 | Ga0495627_011614 | |||
| 1900 | Ga0495627_012781 | |||
| 1901 | Ga0495627_016358 | |||
| 1902 | Ga0495627_025278 | |||
| 1903 | Ga0495627_033159 | |||
| 1904 | Ga0495627_039373 | |||
| 1905 | Ga0495627_048018 | |||
| 1906 | Ga0495603_0018622 | |||
| 1907 | Ga0495603_0026577 | |||
| 1908 | Ga0495603_0046090 | |||
| 1909 | Ga0495590_0003806 | |||
| 1910 | Ga0495590_0008257 | |||
| 1911 | Ga0495590_0010563 | |||
| 1912 | Ga0495590_0013440 | |||
| 1913 | Ga0495590_0015802 | |||
| 1914 | Ga0495590_0026213 | |||
| 1915 | Ga0495590_0063741 | |||
| 1916 | Ga0495590_0069750 | |||
| 1917 | Ga0495591_000009 | |||
| 1918 | Ga0495591_001087 | |||
| 1919 | Ga0495591_003049 | |||
| 1920 | Ga0495591_005865 | |||
| 1921 | Ga0495591_007475 | |||
| 1922 | Ga0495591_009201 | |||
| 1923 | Ga0495591_009993 | |||
| 1924 | Ga0495591_010250 | |||
| 1925 | Ga0495591_010459 | |||
| 1926 | Ga0495591_011394 | |||
| 1927 | Ga0495591_013464 | |||
| 1928 | Ga0495591_013752 | |||
| 1929 | Ga0495591_014218 | |||
| 1930 | Ga0495591_020272 | |||
| 1931 | Ga0495591_021156 | |||
| 1932 | Ga0495591_021634 | |||
| 1933 | Ga0495591_032551 | |||
| 1934 | Ga0495591_046204 | |||
| 1935 | Ga0495629_0014345 | |||
| 1936 | Ga0495638_0007628 | |||
| 1937 | Ga0495638_0007670 | |||
| 1938 | Ga0495638_0028347 | |||
| 1939 | Ga0495638_0029468 | |||
| 1940 | Ga0495638_0033299 | |||
| 1941 | Ga0495638_0039459 | |||
| 1942 | Ga0495638_0042207 | |||
| 1943 | Ga0495638_0042639 | |||
| 1944 | Ga0495638_0048000 | |||
| 1945 | Ga0495638_0049896 | |||
| 1946 | Ga0495638_0051271 | |||
| 1947 | Ga0495638_0052160 | |||
| 1948 | Ga0495638_0128456 | |||
| 1949 | Ga0495638_0161890 | |||
| 1950 | Ga0495638_0185779 | |||
| 1951 | Ga0495638_0185999 | |||
| 1952 | Ga0495653_0018093 | |||
| 1953 | Ga0495653_0040963 | |||
| 1954 | Ga0495653_0057799 | |||
| 1955 | Ga0495653_0121233 | |||
| 1956 | Ga0495650_0001495 | |||
| 1957 | Ga0495650_0009011 | |||
| 1958 | Ga0495650_0009892 | |||
| 1959 | Ga0495650_0011012 | |||
| 1960 | Ga0495650_0014338 | |||
| 1961 | Ga0495650_0016469 | |||
| 1962 | Ga0495650_0017151 | |||
| 1963 | Ga0495650_0023529 | |||
| 1964 | Ga0495582_0019788 | |||
| 1965 | Ga0495605_0000026 | |||
| 1966 | Ga0495605_0000074 | |||
| 1967 | Ga0495605_0000666 | |||
| 1968 | Ga0495605_0001002 | |||
| 1969 | Ga0495605_0002775 | |||
| 1970 | Ga0495605_0008123 | |||
| 1971 | Ga0495605_0009099 | |||
| 1972 | Ga0495605_0020361 | |||
| 1973 | Ga0495605_0031202 | |||
| 1974 | Ga0495605_0033138 | |||
| 1975 | Ga0495605_0034275 | |||
| 1976 | Ga0495605_0042509 | |||
| 1977 | Ga0495605_0048202 | |||
| 1978 | Ga0495605_0061886 | |||
| 1979 | Ga0495605_0088906 | |||
| 1980 | Ga0495605_0117955 | |||
| 1981 | Ga0495605_0119566 | |||
| 1982 | Ga0495639_0001985 | |||
| 1983 | Ga0495639_0025156 | |||
| 1984 | Ga0495584_0007452 | |||
| 1985 | Ga0495584_0012022 | |||
| 1986 | Ga0495584_0012065 | |||
| 1987 | Ga0495584_0013340 | |||
| 1988 | Ga0495584_0014717 | |||
| 1989 | Ga0495584_0015792 | |||
| 1990 | Ga0495584_0017606 | |||
| 1991 | Ga0495584_0027099 | |||
| 1992 | Ga0495584_0040062 | |||
| 1993 | Ga0495584_0049633 | |||
| 1994 | Ga0495584_0085350 | |||
| 1995 | Ga0495584_0137084 | |||
| 1996 | Ga0495585_0004189 | |||
| 1997 | Ga0495585_0013872 | |||
| 1998 | Ga0495585_0018622 | |||
| 1999 | Ga0495585_0022528 | |||
| 2000 | Ga0495585_0022845 | |||
| 2001 | Ga0495585_0028098 | |||
| 2002 | Ga0495585_0033144 | |||
| 2003 | Ga0495585_0036673 | |||
| 2004 | Ga0495585_0045278 | |||
| 2005 | Ga0495585_0047921 | |||
| 2006 | Ga0495585_0105733 | |||
| 2007 | Ga0495585_0145475 | |||
| 2008 | Ga0495585_0189124 | |||
| 2009 | Ga0495594_0004528 | |||
| 2010 | Ga0495594_0010728 | |||
| 2011 | Ga0495594_0021116 | |||
| 2012 | Ga0495594_0027366 | |||
| 2013 | Ga0495594_0034332 | |||
| 2014 | Ga0495596_0002947 | |||
| 2015 | Ga0495596_0024113 | |||
| 2016 | Ga0495607_0000283 | |||
| 2017 | Ga0495607_0001200 | |||
| 2018 | Ga0495607_0001643 | |||
| 2019 | Ga0495607_0012412 | |||
| 2020 | Ga0495607_0016047 | |||
| 2021 | Ga0495607_0022216 | |||
| 2022 | Ga0495607_0023107 | |||
| 2023 | Ga0495607_0024009 | |||
| 2024 | Ga0495607_0025897 | |||
| 2025 | Ga0495607_0026826 | |||
| 2026 | Ga0495607_0036565 | |||
| 2027 | Ga0495607_0040057 | |||
| 2028 | Ga0495607_0040452 | |||
| 2029 | Ga0495607_0049386 | |||
| 2030 | Ga0495607_0050076 | |||
| 2031 | Ga0495607_0055794 | |||
| 2032 | Ga0495607_0065553 | |||
| 2033 | Ga0495607_0082161 | |||
| 2034 | Ga0495607_0121798 | |||
| 2035 | Ga0495607_0122924 | |||
| 2036 | Ga0495607_0132994 | |||
| 2037 | Ga0495607_0136826 | |||
| 2038 | Ga0495583_0000043 | |||
| 2039 | Ga0495583_0002007 | |||
| 2040 | Ga0495583_0004859 | |||
| 2041 | Ga0495583_0012235 | |||
| 2042 | Ga0495583_0013154 | |||
| 2043 | Ga0495583_0018263 | |||
| 2044 | Ga0495583_0018949 | |||
| 2045 | Ga0495583_0019065 | |||
| 2046 | Ga0495583_0021551 | |||
| 2047 | Ga0495583_0022650 | |||
| 2048 | Ga0495583_0037539 | |||
| 2049 | Ga0495583_0040503 | |||
| 2050 | Ga0495583_0042225 | |||
| 2051 | Ga0495583_0070846 | |||
| 2052 | Ga0495583_0104041 | |||
| 2053 | Ga0495606_0000206 | |||
| 2054 | Ga0495606_0000561 | |||
| 2055 | Ga0495606_0004416 | |||
| 2056 | Ga0495606_0012586 | |||
| 2057 | Ga0495606_0032752 | |||
| 2058 | Ga0495606_0033998 | |||
| 2059 | Ga0495606_0046870 | |||
| 2060 | Ga0495606_0047627 | |||
| 2061 | Ga0495606_0049746 | |||
| 2062 | Ga0495606_0057268 | |||
| 2063 | Ga0495606_0115621 | |||
| 2064 | Ga0495606_0154928 | |||
| 2065 | Ga0495606_0195383 | |||
| 2066 | Ga0495610_0005965 | |||
| 2067 | Ga0495610_0008078 | |||
| 2068 | Ga0495610_0008516 | |||
| 2069 | Ga0495610_0015649 | |||
| 2070 | Ga0495610_0020673 | |||
| 2071 | Ga0495610_0023596 | |||
| 2072 | Ga0495610_0023692 | |||
| 2073 | Ga0495610_0027374 | |||
| 2074 | Ga0495610_0028775 | |||
| 2075 | Ga0495610_0034336 | |||
| 2076 | Ga0495610_0038776 | |||
| 2077 | Ga0495610_0040942 | |||
| 2078 | Ga0495610_0059603 | |||
| 2079 | Ga0495610_0062398 | |||
| 2080 | Ga0495616_0002292 | |||
| 2081 | Ga0495616_0008007 | |||
| 2082 | Ga0495616_0016873 | |||
| 2083 | Ga0495616_0020537 | |||
| 2084 | Ga0495616_0020879 | |||
| 2085 | Ga0495616_0027899 | |||
| 2086 | Ga0495616_0028029 | |||
| 2087 | Ga0495616_0038057 | |||
| 2088 | Ga0495616_0041169 | |||
| 2089 | Ga0495616_0053815 | |||
| 2090 | Ga0495616_0054083 | |||
| 2091 | Ga0495620_0000004 | |||
| 2092 | Ga0495620_0000160 | |||
| 2093 | Ga0495620_0000839 | |||
| 2094 | Ga0495620_0008800 | |||
| 2095 | Ga0495620_0016185 | |||
| 2096 | Ga0495620_0017421 | |||
| 2097 | Ga0495620_0017696 | |||
| 2098 | Ga0495620_0023218 | |||
| 2099 | Ga0495620_0028941 | |||
| 2100 | Ga0495620_0031881 | |||
| 2101 | Ga0495620_0037895 | |||
| 2102 | Ga0495620_0037917 | |||
| 2103 | Ga0495628_0163710 | |||
| 2104 | Ga0495630_0034572 | |||
| 2105 | Ga0495630_0043244 | |||
| 2106 | Ga0495631_0010983 | |||
| 2107 | Ga0495631_0011144 | |||
| 2108 | Ga0495631_0011760 | |||
| 2109 | Ga0495631_0015839 | |||
| 2110 | Ga0495631_0018705 | |||
| 2111 | Ga0495631_0019565 | |||
| 2112 | Ga0495631_0037292 | |||
| 2113 | Ga0495631_0037835 | |||
| 2114 | Ga0495631_0039759 | |||
| 2115 | Ga0495632_0001711 | |||
| 2116 | Ga0495632_0006673 | |||
| 2117 | Ga0495632_0013273 | |||
| 2118 | Ga0495632_0013379 | |||
| 2119 | Ga0495632_0013917 | |||
| 2120 | Ga0495632_0018118 | |||
| 2121 | Ga0495632_0018319 | |||
| 2122 | Ga0495632_0018935 | |||
| 2123 | Ga0495632_0024415 | |||
| 2124 | Ga0495632_0026988 | |||
| 2125 | Ga0495632_0029211 | |||
| 2126 | Ga0495632_0039642 | |||
| 2127 | Ga0495632_0040114 | |||
| 2128 | Ga0495632_0092371 | |||
| 2129 | Ga0495632_0167509 | |||
| 2130 | Ga0495637_0001319 | |||
| 2131 | Ga0495637_0002012 | |||
| 2132 | Ga0495637_0005487 | |||
| 2133 | Ga0495637_0010460 | |||
| 2134 | Ga0495637_0010480 | |||
| 2135 | Ga0495637_0010980 | |||
| 2136 | Ga0495637_0011694 | |||
| 2137 | Ga0495637_0015522 | |||
| 2138 | Ga0495637_0016446 | |||
| 2139 | Ga0495637_0016810 | |||
| 2140 | Ga0495637_0020303 | |||
| 2141 | Ga0495637_0021686 | |||
| 2142 | Ga0495637_0023001 | |||
| 2143 | Ga0495637_0031131 | |||
| 2144 | Ga0495637_0031493 | |||
| 2145 | Ga0495637_0032136 | |||
| 2146 | Ga0495637_0041486 | |||
| 2147 | Ga0495643_0000705 | |||
| 2148 | Ga0495643_0006733 | |||
| 2149 | Ga0495643_0007191 | |||
| 2150 | Ga0495643_0009520 | |||
| 2151 | Ga0495643_0013092 | |||
| 2152 | Ga0495643_0016267 | |||
| 2153 | Ga0495643_0016714 | |||
| 2154 | Ga0495643_0022883 | |||
| 2155 | Ga0495643_0036751 | |||
| 2156 | Ga0495643_0039680 | |||
| 2157 | Ga0495643_0080889 | |||
| 2158 | Ga0495643_0097859 | |||
| 2159 | Ga0495643_0134254 | |||
| 2160 | Ga0495643_0145966 | |||
| 2161 | Ga0495644_0001649 | |||
| 2162 | Ga0495644_0008024 | |||
| 2163 | Ga0495644_0014279 | |||
| 2164 | Ga0495644_0014314 | |||
| 2165 | Ga0495644_0042172 | |||
| 2166 | Ga0495644_0081427 | |||
| 2167 | Ga0495648_0002198 | |||
| 2168 | Ga0495648_0002316 | |||
| 2169 | Ga0495648_0007236 | |||
| 2170 | Ga0495648_0010500 | |||
| 2171 | Ga0495648_0012038 | |||
| 2172 | Ga0495648_0015271 | |||
| 2173 | Ga0495648_0019920 | |||
| 2174 | Ga0495648_0022047 | |||
| 2175 | Ga0495648_0028570 | |||
| 2176 | Ga0495648_0029282 | |||
| 2177 | Ga0495648_0030050 | |||
| 2178 | Ga0495648_0030684 | |||
| 2179 | Ga0495648_0043612 | |||
| 2180 | Ga0495648_0045628 | |||
| 2181 | Ga0495648_0050297 | |||
| 2182 | Ga0495648_0055131 | |||
| 2183 | Ga0495648_0057749 | |||
| 2184 | Ga0495648_0059745 | |||
| 2185 | Ga0495648_0106157 | |||
| 2186 | Ga0495648_0113042 | |||
| 2187 | Ga0495648_0113047 | |||
| 2188 | Ga0495648_0142579 | |||
| 2189 | Ga0495666_0006883 | |||
| 2190 | Ga0495666_0015162 | |||
| 2191 | Ga0495666_0034054 | |||
| 2192 | Ga0495666_0035756 | |||
| 2193 | Ga0495666_0040956 | |||
| 2194 | Ga0495642_0003901 | |||
| 2195 | Ga0495642_0005960 | |||
| 2196 | Ga0495642_0006641 | |||
| 2197 | Ga0495654_0004113 | |||
| 2198 | Ga0495654_0009470 | |||
| 2199 | Ga0495654_0013370 | |||
| 2200 | Ga0495654_0014756 | |||
| 2201 | Ga0495654_0017464 | |||
| 2202 | Ga0495654_0018232 | |||
| 2203 | Ga0495654_0018473 | |||
| 2204 | Ga0495654_0019641 | |||
| 2205 | Ga0495654_0020215 | |||
| 2206 | Ga0495654_0021927 | |||
| 2207 | Ga0495654_0022919 | |||
| 2208 | Ga0495654_0026744 | |||
| 2209 | Ga0495654_0027059 | |||
| 2210 | Ga0495654_0028667 | |||
| 2211 | Ga0495654_0040265 | |||
| 2212 | Ga0495654_0075496 | |||
| 2213 | Ga0495654_0082327 | |||
| 2214 | Ga0495654_0113547 | |||
| 2215 | Ga0495654_0133280 | |||
| 2216 | Ga0495586_0017847 | |||
| 2217 | Ga0495587_0011708 | |||
| 2218 | Ga0495587_0019991 | |||
| 2219 | Ga0495609_0000036 | |||
| 2220 | Ga0495609_0000049 | |||
| 2221 | Ga0495609_0001805 | |||
| 2222 | Ga0495609_0006248 | |||
| 2223 | Ga0495609_0021159 | |||
| 2224 | Ga0495609_0036253 | |||
| 2225 | Ga0495609_0083856 | |||
| 2226 | Ga0495609_0105836 | |||
| 2227 | Ga0495597_0009852 | |||
| 2228 | Ga0495597_0011995 | |||
| 2229 | Ga0495597_0012695 | |||
| 2230 | Ga0495597_0013817 | |||
| 2231 | Ga0495597_0014699 | |||
| 2232 | Ga0495597_0015192 | |||
| 2233 | Ga0495597_0028270 | |||
| 2234 | Ga0495597_0029466 | |||
| 2235 | Ga0495597_0047493 | |||
| 2236 | Ga0495597_0047787 | |||
| 2237 | Ga0495597_0049969 | |||
| 2238 | Ga0495597_0099269 | |||
| 2239 | Ga0495645_0026158 | |||
| 2240 | Ga0495645_0107948 | |||
| 2241 | Ga0495622_0005899 | |||
| 2242 | Ga0495622_0008595 | |||
| 2243 | Ga0495622_0021817 | |||
| 2244 | Ga0495622_0022490 | |||
| 2245 | Ga0495622_0029379 | |||
| 2246 | Ga0495633_0000143 | |||
| 2247 | Ga0495633_0013132 | |||
| 2248 | Ga0495633_0022837 | |||
| 2249 | Ga0495633_0038015 | |||
| 2250 | Ga0495633_0057535 | |||
| 2251 | Ga0495656_0006177 | |||
| 2252 | Ga0495656_0042225 | |||
| 2253 | Ga0495656_0066256 | |||
| 2254 | Ga0495668_0015501 | |||
| 2255 | Ga0495668_0017887 | |||
| 2256 | Ga0495668_0020709 | |||
| 2257 | Ga0495668_0025799 | |||
| 2258 | Ga0495668_0038174 | |||
| 2259 | Ga0495668_0044110 | |||
| 2260 | Ga0495668_0104625 | |||
| 2261 | Ga0495634_0018758 | |||
| 2262 | Ga0495634_0081237 | |||
| 2263 | Ga0495634_0189259 | |||
| 2264 | Ga0495611_0001125 | |||
| 2265 | Ga0495611_0010373 | |||
| 2266 | Ga0495611_0010906 | |||
| 2267 | Ga0495611_0011320 | |||
| 2268 | Ga0495611_0013346 | |||
| 2269 | Ga0495611_0029152 | |||
| 2270 | Ga0495625_0030321 | |||
| 2271 | Ga0495625_0033501 | |||
| 2272 | Ga0495625_0048347 | |||
| 2273 | Ga0495625_0064481 | |||
| 2274 | Ga0495625_0081538 | |||
| 2275 | Ga0495625_0092180 | |||
| 2276 | Ga0495625_0096747 | |||
| 2277 | Ga0495625_0153009 | |||
| 2278 | Ga0495625_0229944 | |||
| 2279 | Ga0495635_0037165 | |||
| 2280 | Ga0495659_0005021 | |||
| 2281 | Ga0495659_0008184 | |||
| 2282 | Ga0495659_0008632 | |||
| 2283 | Ga0495661_0000121 | |||
| 2284 | Ga0495661_0000123 | |||
| 2285 | Ga0495661_0000373 | |||
| 2286 | Ga0495661_0009655 | |||
| 2287 | Ga0495661_0012590 | |||
| 2288 | Ga0495661_0021014 | |||
| 2289 | Ga0495661_0025420 | |||
| 2290 | Ga0495661_0028441 | |||
| 2291 | Ga0495661_0029082 | |||
| 2292 | Ga0495661_0035798 | |||
| 2293 | Ga0495661_0039328 | |||
| 2294 | Ga0495661_0079296 | |||
| 2295 | Ga0495661_0138348 | |||
| 2296 | Ga0495661_0165485 | |||
| 2297 | Ga0495588_0018586 | |||
| 2298 | Ga0495657_0068312 | |||
| 2299 | Ga0495623_0029886 | |||
| 2300 | Ga0495646_0020518 | |||
| 2301 | Ga0495646_0026911 | |||
| 2302 | Ga0495669_0001706 | |||
| 2303 | Ga0495669_0006819 | |||
| 2304 | Ga0495669_0017295 | |||
| 2305 | Ga0495613_0037568 | |||
| 2306 | Ga0495613_0051873 | |||
| 2307 | Ga0495613_0174860 | |||
| 2308 | Ga0495624_0024565 | |||
| 2309 | Ga0495670_0015192 | |||
| 2310 | Ga0495670_0016244 | |||
| 2311 | Ga0495670_0016279 | |||
| 2312 | Ga0495670_0017333 | |||
| 2313 | Ga0495670_0018586 | |||
| 2314 | Ga0495670_0020135 | |||
| 2315 | Ga0495670_0038068 | |||
| 2316 | Ga0495670_0051316 | |||
| 2317 | Ga0495671_0006572 | |||
| 2318 | Ga0495671_0013124 | |||
| 2319 | Ga0495671_0013278 | |||
| 2320 | Ga0495671_0025598 | |||
| 2321 | Ga0495671_0026846 | |||
| 2322 | Ga0495671_0028283 | |||
| 2323 | Ga0495671_0028510 | |||
| 2324 | Ga0495671_0029951 | |||
| 2325 | Ga0495671_0030691 | |||
| 2326 | Ga0495671_0032095 | |||
| 2327 | Ga0495671_0038406 | |||
| 2328 | Ga0495671_0046794 | |||
| 2329 | Ga0495671_0046811 | |||
| 2330 | Ga0495671_0058199 | |||
| 2331 | Ga0495671_0064682 | |||
| 2332 | Ga0495671_0107013 | |||
| 2333 | Ga0495649_0014130 | |||
| 2334 | Ga0495649_0014733 | |||
| 2335 | Ga0495649_0015321 | |||
| 2336 | Ga0495649_0021682 | |||
| 2337 | Ga0495649_0034113 | |||
| 2338 | Ga0495649_0046605 | |||
| 2339 | Ga0495649_0046900 | |||
| 2340 | Ga0495649_0047097 | |||
| 2341 | Ga0495649_0047207 | |||
| 2342 | Ga0495649_0050672 | |||
| 2343 | Ga0495649_0090489 | |||
| 2344 | Ga0495649_0169117 | |||
| 2345 | Ga0495649_0200957 | |||
| 2346 | Ga0495589_0002617 | |||
| 2347 | Ga0495589_0003758 | |||
| 2348 | Ga0495589_0005456 | |||
| 2349 | Ga0495589_0017140 | |||
| 2350 | Ga0495589_0018156 | |||
| 2351 | Ga0495589_0018413 | |||
| 2352 | Ga0495589_0018754 | |||
| 2353 | Ga0495589_0018853 | |||
| 2354 | Ga0495589_0020239 | |||
| 2355 | Ga0495589_0029779 | |||
| 2356 | Ga0495589_0050099 | |||
| 2357 | Ga0495589_0085099 | |||
| 2358 | Ga0495589_0112440 | |||
| 2359 | Ga0495589_0122703 | |||
| 2360 | Ga0495600_0065606 | |||
| 2361 | Ga0495600_0127789 | |||
| 2362 | Ga0495660_0000390 | |||
| 2363 | Ga0495660_0022201 | |||
| 2364 | Ga0495660_0023598 | |||
| 2365 | Ga0495660_0025602 | |||
| 2366 | Ga0495660_0026466 | |||
| 2367 | Ga0495660_0030133 | |||
| 2368 | Ga0495660_0031621 | |||
| 2369 | Ga0495660_0035658 | |||
| 2370 | Ga0495660_0037781 | |||
| 2371 | Ga0495660_0038017 | |||
| 2372 | Ga0495660_0040546 | |||
| 2373 | Ga0495660_0041876 | |||
| 2374 | Ga0495660_0042912 | |||
| 2375 | Ga0495660_0047451 | |||
| 2376 | Ga0495660_0048075 | |||
| 2377 | Ga0495660_0056827 | |||
| 2378 | Ga0495660_0059751 | |||
| 2379 | Ga0495660_0114591 | |||
| 2380 | Ga0495660_0123325 | |||
| 2381 | Ga0495660_0143101 | |||
| 2382 | Ga0495660_0161485 | |||
| 2383 | Ga0495581_0037300 | |||
| 2384 | Ga0495604_0018092 | |||
| 2385 | Ga0495604_0103098 | |||
| 2386 | Ga0495636_0017168 | |||
| 2387 | Ga0495674_0042126 | |||
| 2388 | Ga0495674_0346759 | |||
| 2389 | Ga0495672_0006371 | |||
| 2390 | Ga0495672_0013351 | |||
| 2391 | Ga0495672_0023125 | |||
| 2392 | Ga0495672_0023186 | |||
| 2393 | Ga0495672_0026730 | |||
| 2394 | Ga0495672_0027445 | |||
| 2395 | Ga0495672_0029177 | |||
| 2396 | Ga0495672_0032306 | |||
| 2397 | Ga0495672_0038132 | |||
| 2398 | Ga0495672_0039331 | |||
| 2399 | Ga0495672_0041266 | |||
| 2400 | Ga0495672_0041652 | |||
| 2401 | Ga0495672_0045457 | |||
| 2402 | Ga0495672_0045638 | |||
| 2403 | Ga0495672_0046824 | |||
| 2404 | Ga0495672_0145394 | |||
| 2405 | Ga0495676_0000042 | |||
| 2406 | Ga0495676_0044496 | |||
| 2407 | Ga0495676_0060702 | |||
| 2408 | Ga0495680_0009294 | |||
| 2409 | Ga0495680_0020364 | |||
| 2410 | Ga0495680_0036406 | |||
| 2411 | Ga0495680_0045393 | |||
| 2412 | Ga0495680_0049962 | |||
| 2413 | Ga0495683_0000003 | |||
| 2414 | Ga0495683_0008022 | |||
| 2415 | Ga0495683_0011357 | |||
| 2416 | Ga0495683_0026783 | |||
| 2417 | Ga0495683_0051226 | |||
| 2418 | Ga0495683_0052646 | |||
| 2419 | Ga0495683_0069072 | |||
| 2420 | Ga0495683_0086672 | |||
| 2421 | Ga0495687_008709 | |||
| 2422 | Ga0495687_016113 | |||
| 2423 | Ga0495687_023693 | |||
| 2424 | Ga0495687_035380 | |||
| 2425 | Ga0495675_0010786 | |||
| 2426 | Ga0495675_0195158 | |||
| 2427 | Ga0495677_0005628 | |||
| 2428 | Ga0495679_000027 | |||
| 2429 | Ga0495679_001094 | |||
| 2430 | Ga0495679_004078 | |||
| 2431 | Ga0495679_010109 | |||
| 2432 | Ga0495679_011114 | |||
| 2433 | Ga0495679_011369 | |||
| 2434 | Ga0495679_011522 | |||
| 2435 | Ga0495679_013143 | |||
| 2436 | Ga0495679_015472 | |||
| 2437 | Ga0495679_019892 | |||
| 2438 | Ga0495685_007294 | |||
| 2439 | Ga0495673_0001888 | |||
| 2440 | Ga0495673_0007096 | |||
| 2441 | Ga0495673_0007780 | |||
| 2442 | Ga0495673_0010928 | |||
| 2443 | Ga0495673_0012754 | |||
| 2444 | Ga0495673_0014426 | |||
| 2445 | Ga0495673_0015150 | |||
| 2446 | Ga0495673_0017560 | |||
| 2447 | Ga0495673_0017646 | |||
| 2448 | Ga0495673_0017957 | |||
| 2449 | Ga0495673_0018009 | |||
| 2450 | Ga0495673_0018412 | |||
| 2451 | Ga0495673_0021628 | |||
| 2452 | Ga0495673_0021907 | |||
| 2453 | Ga0495673_0024202 | |||
| 2454 | Ga0495673_0030073 | |||
| 2455 | Ga0495673_0034519 | |||
| 2456 | Ga0495673_0063584 | |||
| 2457 | Ga0495673_0075021 | |||
| 2458 | Ga0495681_0006487 | |||
| 2459 | Ga0495681_0007314 | |||
| 2460 | Ga0495681_0010220 | |||
| 2461 | Ga0495681_0014911 | |||
| 2462 | Ga0495681_0016902 | |||
| 2463 | Ga0495681_0019931 | |||
| 2464 | Ga0495681_0020146 | |||
| 2465 | Ga0495681_0020655 | |||
| 2466 | Ga0495681_0020702 | |||
| 2467 | Ga0495681_0021089 | |||
| 2468 | Ga0495681_0021369 | |||
| 2469 | Ga0495681_0021466 | |||
| 2470 | Ga0495681_0030940 | |||
| 2471 | Ga0495681_0039000 | |||
| 2472 | Ga0495681_0039806 | |||
| 2473 | Ga0495681_0041338 | |||
| 2474 | Ga0495681_0043221 | |||
| 2475 | Ga0495681_0115042 | |||
| 2476 | Ga0495684_0054821 | |||
| 2477 | Ga0495684_0083116 | |||
| 2478 | Ga0495686_0018971 | |||
| 2479 | Ga0495686_0022071 | |||
| 2480 | Ga0495686_0031318 | |||
| 2481 | Ga0495686_0058022 | |||
| 2482 | Ga0495686_0199937 | |||
| 2483 | Ga0495686_0216133 | |||
| 2484 | Ga0495593_0009419 | |||
| 2485 | Ga0495593_0021049 | |||
| 2486 | Ga0495593_0047358 | |||
| 2487 | Ga0495593_0061120 | |||
| 2488 | Ga0495602_0046501 | |||
| 2489 | Ga0495602_0259783 | |||
| 2490 | Ga0495626_0000062 | |||
| 2491 | Ga0495626_0004242 | |||
| 2492 | Ga0495626_0005262 | |||
| 2493 | Ga0495626_0006656 | |||
| 2494 | Ga0495626_0007735 | |||
| 2495 | Ga0495626_0010069 | |||
| 2496 | Ga0495626_0011063 | |||
| 2497 | Ga0495626_0015770 | |||
| 2498 | Ga0495626_0017696 | |||
| 2499 | Ga0495626_0022577 | |||
| 2500 | Ga0495626_0027862 | |||
| 2501 | Ga0495626_0038456 | |||
| 2502 | Ga0495626_0041085 | |||
| 2503 | Ga0495626_0048880 | |||
| 2504 | Ga0495626_0079563 | |||
| 2505 | Ga0495626_0085413 | |||
| 2506 | Ga0495626_0091227 | |||
| 2507 | Ga0495626_0096542 | |||
| 2508 | Ga0496100_0092477 | |||
| 2509 | Ga0496100_0658213 | |||
| 2510 | Ga0496102_0014161 | |||
| 2511 | Ga0496102_0022187 | |||
| 2512 | Ga0496102_0047116 | |||
| 2513 | Ga0496103_0022222 | |||
| 2514 | Ga0496103_0087431 | |||
| 2515 | Ga0496103_0090504 | |||
| 2516 | Ga0496105_0124195 | |||
| 2517 | Ga0496106_0000001 | |||
| 2518 | Ga0496110_0078445 | |||
| 2519 | Ga0496110_0120984 | |||
| 2520 | Ga0496110_0144254 | |||
| 2521 | Ga0496110_0204544 | |||
| 2522 | Ga0496112_0067646 | |||
| 2523 | Ga0496112_0166715 | |||
| 2524 | Ga0496114_0054236 | |||
| 2525 | Ga0496114_0314815 | |||
| 2526 | Ga0496115_0061087 | |||
| 2527 | Ga0496115_0128893 | |||
| 2528 | Ga0496116_0000532 | |||
| 2529 | Ga0496116_0008407 | |||
| 2530 | Ga0496116_0026645 | |||
| 2531 | Ga0496116_0032917 | |||
| 2532 | Ga0496116_0038266 | |||
| 2533 | Ga0496116_0040368 | |||
| 2534 | Ga0496116_0042675 | |||
| 2535 | Ga0496117_0009614 | |||
| 2536 | Ga0496117_0009811 | |||
| 2537 | Ga0496117_0016920 | |||
| 2538 | Ga0496117_0017078 | |||
| 2539 | Ga0496117_0025556 | |||
| 2540 | Ga0496117_0033319 | |||
| 2541 | Ga0496117_0042330 | |||
| 2542 | Ga0496117_0049502 | |||
| 2543 | Ga0496117_0051444 | |||
| 2544 | Ga0496117_0069800 | |||
| 2545 | Ga0496117_0071311 | |||
| 2546 | Ga0496118_0015165 | |||
| 2547 | Ga0496118_0018535 | |||
| 2548 | Ga0496118_0026273 | |||
| 2549 | Ga0496118_0028931 | |||
| 2550 | Ga0496118_0044948 | |||
| 2551 | Ga0496118_0048952 | |||
| 2552 | Ga0496118_0056327 | |||
| 2553 | Ga0496118_0064178 | |||
| 2554 | Ga0496118_0082406 | |||
| 2555 | Ga0496118_0099551 | |||
| 2556 | Ga0496118_0112466 | |||
| 2557 | Ga0496119_0000046 | |||
| 2558 | Ga0496120_0001097 | |||
| 2559 | Ga0496120_0213832 | |||
| 2560 | Ga0496121_0001218 | |||
| 2561 | Ga0496121_0005237 | |||
| 2562 | Ga0496121_0009322 | |||
| 2563 | Ga0496121_0015004 | |||
| 2564 | Ga0496121_0049932 | |||
| 2565 | Ga0496121_0057362 | |||
| 2566 | Ga0496121_0064222 | |||
| 2567 | Ga0496121_0073641 | |||
| 2568 | Ga0496121_0087666 | |||
| 2569 | Ga0496121_0091553 | |||
| 2570 | Ga0496121_0196902 | |||
| 2571 | Ga0496121_0201502 | |||
| 2572 | Ga0496122_0000916 | |||
| 2573 | Ga0496122_0007953 | |||
| 2574 | Ga0496122_0011822 | |||
| 2575 | Ga0496122_0029529 | |||
| 2576 | Ga0496122_0029853 | |||
| 2577 | Ga0496122_0049661 | |||
| 2578 | Ga0496122_0050951 | |||
| 2579 | Ga0496122_0055731 | |||
| 2580 | Ga0496122_0055891 | |||
| 2581 | Ga0496123_0000163 | |||
| 2582 | Ga0496123_0000240 | |||
| 2583 | Ga0496123_0009410 | |||
| 2584 | Ga0496123_0025037 | |||
| 2585 | Ga0496123_0041569 | |||
| 2586 | Ga0496123_0046574 | |||
| 2587 | Ga0496123_0087564 | |||
| 2588 | Ga0496123_0117532 | |||
| 2589 | Ga0496124_0001281 | |||
| 2590 | Ga0496124_0005783 | |||
| 2591 | Ga0496124_0015829 | |||
| 2592 | Ga0496124_0017179 | |||
| 2593 | Ga0496124_0036437 | |||
| 2594 | Ga0496124_0038533 | |||
| 2595 | Ga0496124_0041397 | |||
| 2596 | Ga0496124_0053426 | |||
| 2597 | Ga0496124_0054638 | |||
| 2598 | Ga0496124_0061568 | |||
| 2599 | Ga0496124_0063790 | |||
| 2600 | Ga0496124_0071238 | |||
| 2601 | Ga0496124_0075639 | |||
| 2602 | Ga0496124_0080178 | |||
| 2603 | Ga0496124_0118627 | |||
| 2604 | Ga0496124_0137222 | |||
| 2605 | Ga0496124_0220967 | |||
| 2606 | Ga0496124_0241699 | |||
| 2607 | Ga0496124_0262944 | |||
| 2608 | Ga0496124_0355001 | |||
| 2609 | Ga0496125_0004921 | |||
| 2610 | Ga0496125_0011496 | |||
| 2611 | Ga0496125_0018304 | |||
| 2612 | Ga0496125_0018409 | |||
| 2613 | Ga0496125_0046116 | |||
| 2614 | Ga0496125_0050050 | |||
| 2615 | Ga0496125_0068579 | |||
| 2616 | Ga0496125_0070456 | |||
| 2617 | Ga0496125_0086766 | |||
| 2618 | Ga0496126_0000065 | |||
| 2619 | Ga0496126_0015575 | |||
| 2620 | Ga0496126_0063332 | |||
| 2621 | Ga0496126_0068242 | |||
| 2622 | Ga0495678_000007 | |||
| 2623 | Ga0495678_000052 | |||
| 2624 | Ga0495678_006798 | |||
| 2625 | Ga0495678_011169 | |||
| 2626 | Ga0495678_013270 | |||
| 2627 | Ga0495678_013403 | |||
| 2628 | Ga0495678_014179 | |||
| 2629 | Ga0495678_015409 | |||
| 2630 | Ga0495678_016004 | |||
| 2631 | Ga0495678_016698 | |||
| 2632 | Ga0495678_021794 | |||
| 2633 | Ga0495678_025130 | |||
| 2634 | Ga0495678_029642 | |||
| 2635 | Ga0495678_032411 | |||
| 2636 | Ga0495678_034670 | |||
| 2637 | Ga0495678_053972 | |||
| 2638 | Ga0495682_0000096 | |||
| 2639 | Ga0495682_0010640 | |||
| 2640 | Ga0495682_0013438 | |||
| 2641 | Ga0495682_0013644 | |||
| 2642 | Ga0495682_0023501 | |||
| 2643 | Ga0495682_0044280 | |||
| 2644 | Ga0501032_0022775 | |||
| 2645 | Ga0501033_0006655 | |||
| 2646 | Ga0501034_0000045 | |||
| 2647 | Ga0501034_0048749 | |||
| 2648 | Ga0501034_0246756 | |||
| 2649 | Ga0501038_0284535 | |||
| 2650 | Ga0501039_0140055 | |||
| 2651 | Ga0501043_0137519 | |||
| 2652 | Ga0501047_0003676 | |||
| 2653 | Ga0501222_003719 | |||
| 2654 | Ga0501241_002793 | |||
| 2655 | Ga0501035_0005107 | |||
| 2656 | Ga0501044_0001082 | |||
| 2657 | Ga0501226_000003 | |||
| 2658 | nmdc:mga03683_69680_c1 | |||
| 2659 | nmdc:mga00v17_171489_c1 | |||
| 2660 | nmdc:mga00v17_28884_c1 | |||
| 2661 | nmdc:mga08x19_190250_c1 | |||
| 2662 | nmdc:mga0sz30_32681_c1 | |||
| 2663 | Ga0500572_037660 | |||
| 2664 | Ga0500659_0000579 | |||
| 2665 | Ga0500577_0015728 | |||
| 2666 | Ga0500634_0025265 | |||
| 2667 | 2511255052 | |||
| 2668 | 2511268415 | |||
| 2669 | 2511273061 | |||
| 2670 | 2511276044 | |||
| 2671 | 2511290564 | |||
| 2672 | 2511295942 | |||
| 2673 | 2511301110 | |||
| 2674 | 2511312293 | |||
| 2675 | 2511320280 | |||
| 2676 | 2511326196 | |||
| 2677 | 2511335413 | |||
| 2678 | 2511339581 | |||
| 2679 | 2511344654 | |||
| 2680 | 2511349816 | |||
| 2681 | 2511365759 | |||
| 2682 | 2511368132 | |||
| 2683 | 2511375817 | |||
| 2684 | 2511410841 | |||
| 2685 | 2511823677 | |||
| 2686 | 2512324018 | |||
| 2687 | 2554815954 | |||
| 2688 | 2555249360 | |||
| 2689 | 2555671281 | |||
| 2690 | 2583793690 | |||
| 2691 | 2597859350 | |||
| 2692 | 2597862993 | |||
| 2693 | 2597868785 | |||
| 2694 | 2599326717 | |||
| 2695 | 2599354560 | |||
| 2696 | 2599359727 | |||
| 2697 | 2599366049 | |||
| 2698 | 2599372839 | |||
| 2699 | 2599379667 | |||
| 2700 | 2599385354 | |||
| 2701 | 2599391698 | |||
| 2702 | 2599401572 | |||
| 2703 | 2599403464 | |||
| 2704 | 2599451887 | |||
| 2705 | 2599461394 | |||
| 2706 | 2599469937 | |||
| 2707 | 2599482180 | |||
| 2708 | 2599490413 | |||
| 2709 | 2599504470 | |||
| 2710 | 2599509654 | |||
| 2711 | 2599514816 | |||
| 2712 | 2599520914 | |||
| 2713 | 2599611635 | |||
| 2714 | 2599770270 | |||
| 2715 | 2599804102 | |||
| 2716 | 2599882161 | |||
| 2717 | 2599887521 | |||
| 2718 | 2599894387 | |||
| 2719 | 2599900000 | |||
| 2720 | 2599932132 | |||
| 2721 | 2599941795 | |||
| 2722 | 2599951595 | |||
| 2723 | 2599952685 | |||
| 2724 | 2599960576 | |||
| 2725 | 2599964870 | |||
| 2726 | 2599973603 | |||
| 2727 | 2599976017 | |||
| 2728 | 2599981964 | |||
| 2729 | 2599987873 | |||
| 2730 | 2599995576 | |||
| 2731 | 2599998235 | |||
| 2732 | 2600005399 | |||
| 2733 | 2600010102 | |||
| 2734 | 2600017383 | |||
| 2735 | 2600022606 | |||
| 2736 | 2600027626 | |||
| 2737 | 2600034410 | |||
| 2738 | 2600039906 | |||
| 2739 | 2600046203 | |||
| 2740 | 2600052206 | |||
| 2741 | 2600057583 | |||
| 2742 | 2600068817 | |||
| 2743 | 2600072321 | |||
| 2744 | 2600075881 | |||
| 2745 | 2600214012 | |||
| 2746 | 2600356665 | |||
| 2747 | 2600364258 | |||
| 2748 | 2600444523 | |||
| 2749 | 2601623903 | |||
| 2750 | 2601694298 | |||
| 2751 | 2601774178 | |||
| 2752 | 2601796266 | |||
| 2753 | 2602011597 | |||
| 2754 | 2606073415 | |||
| 2755 | 2606126939 | |||
| 2756 | 2608382328 | |||
| 2757 | 2621300936 | |||
| 2758 | 2624481915 | |||
| 2759 | 2624490999 | |||
| 2760 | 2643845617 | |||
| 2761 | 2643871671 | |||
| 2762 | 2643956494 | |||
| 2763 | 2644025464 | |||
| 2764 | 2644185485 | |||
| 2765 | 2644284855 | |||
| 2766 | 2644623547 | |||
| 2767 | 2652543844 | |||
| 2768 | 2671090180 | |||
| 2769 | 2671097141 | |||
| 2770 | 2671126004 | |||
| 2771 | 2671770330 | |||
| 2772 | 2677896830 | |||
| 2773 | 2678262609 | |||
| 2774 | 2715751218 | |||
| 2775 | 2715758218 | |||
| 2776 | 2718635166 | |||
| 2777 | 2723247809 | |||
| 2778 | 2729148766 | |||
| 2779 | 2738670439 | |||
| 2780 | 2738688775 | |||
| 2781 | 2738748832 | |||
| 2782 | 2738810814 | |||
| 2783 | 2738857874 | |||
| 2784 | 2738898174 | |||
| 2785 | 2739201954 | |||
| 2786 | 2739259243 | |||
| 2787 | 2739264914 | |||
| 2788 | 2739287463 | |||
| 2789 | 2739292776 | |||
| 2790 | 2739314073 | |||
| 2791 | 2743738882 | |||
| 2792 | 2745008949 | |||
| 2793 | 2765585016 | |||
| 2794 | 2774119190 | |||
| 2795 | 2774132825 | |||
| 2796 | 2784263363 | |||
| 2797 | 2784314840 | |||
| 2798 | 2794596413 | |||
| 2799 | 2807409081 | |||
| 2800 | 2807457417 | |||
| 2801 | 2808855078 | |||
| 2802 | 2808903904 | |||
| 2803 | 2808924355 | |||
| 2804 | 2808930610 | |||
| 2805 | 2808935734 | |||
| 2806 | 2808941370 | |||
| 2807 | 2808946547 | |||
| 2808 | 2808952732 | |||
| 2809 | 2808958983 | |||
| 2810 | 2808963571 | |||
| 2811 | 2808979472 | |||
| 2812 | 2808995396 | |||
| 2813 | 2808998471 | |||
| 2814 | 2809218768 | |||
| 2815 | 2812367865 | |||
| 2816 | 2817489763 | |||
| 2817 | 2819655659 | |||
| 2818 | 2819702238 | |||
| 2819 | 2823423555 | |||
| 2820 | 2825653026 | |||
| 2821 | 2826584608 | |||
| 2822 | 2834029640 | |||
| 2823 | 2842806052 | |||
| 2824 | 2842820179 | |||
| 2825 | 2842831996 | |||
| 2826 | 2842836510 | |||
| 2827 | 2842841580 | |||
| 2828 | 2842844623 | |||
| 2829 | 2842850770 | |||
| 2830 | 2842854663 | |||
| 2831 | 2844671805 | |||
| 2832 | 2852618479 | |||
| 2833 | 2852663159 | |||
| 2834 | 2852673385 | |||
| 2835 | 2860340795 | |||
| 2836 | 2860869634 | |||
| 2837 | 2878033899 | |||
| 2838 | 2880234524 | |||
| 2839 | 2904521335 | |||
| 2840 | 2904555117 | |||
| 2841 | 2908448555 | |||
| 2842 | 2912967282 | |||
| 2843 | 2913038588 | |||
| 2844 | 2917075142 | |||
| 2845 | 2919068885 | |||
| 2846 | 2919156964 | |||
| 2847 | 2919387992 | |||
| 2848 | 2919461073 | |||
| 2849 | 2919481863 | |||
| 2850 | 2919489826 | |||
| 2851 | 2919503264 | |||
| 2852 | 2919702014 | |||
| 2853 | 2923157955 | |||
| 2854 | 2923521916 | |||
| 2855 | 2923587300 | |||
| 2856 | 2926066165 | |||
| 2857 | 2929146040 | |||
| 2858 | 2929191610 | |||
| 2859 | 2931370622 | |||
| 2860 | 2931392707 | |||
| 2861 | 2931403348 | |||
| 2862 | 2935356130 | |||
| 2863 | 2939637628 | |||
| 2864 | 2939654844 | |||
| 2865 | 2945928958 | |||
| 2866 | 2945962245 | |||
| 2867 | 2946011181 | |||
| 2868 | 2946029892 | |||
| 2869 | 2947236462 | |||
| 2870 | 2969308674 | |||
| 2871 | 2974289952 | |||
| 2872 | 2984288218 | |||
| 2873 | 2988733572 | |||
| 2874 | 2990199270 | |||
| 2875 | 2998143979 | |||
| 2876 | 3007397264 | |||
| 2877 | 3007424467 | |||
| 2878 | 3007424468 | |||
| 2879 | 3007515327 | |||
| 2880 | 3007616873 | |||
| 2881 | 3007620083 | |||
| 2882 | 3007718905 | |||
| 2883 | 3007806114 | |||
| 2884 | 3007857885 | |||
| 2885 | 3007865409 | |||
| 2886 | 3007870261 | |||
| 2887 | 3007874338 | |||
| 2888 | 637321608 | |||
| 2889 | 640487975 | |||
| 2890 | 651175926 | |||
| 2891 | 8011353134 | |||
| 2892 | 8015692053 | |||
| 2893 | 8019775167 | |||
| 2894 | 8019780982 | |||
| 2895 | 8029996898 | |||
| 2896 | 8034964889 | |||
| 2897 | 8052496488 | |||
| 2898 | 8054288264 | |||
| 2899 | 8054352072 | |||
| 2900 | 8054505211 | |||
| 2901 | 8054932405 | |||
| 2902 | 8055775262 | |||
| 2903 | 8056119447 | |||
| 2904 | 8056122625 | |||
| 2905 | 8056127579 | |||
| 2906 | 8056133537 | |||
| 2907 | 8056139400 | |||
| 2908 | 8056147251 | |||
| 2909 | 8056150444 | |||
| 2910 | 8056157359 | |||
| 2911 | 8056164960 | |||
| 2912 | 8056167296 | |||
| 2913 | 8056173281 | |||
| 2914 | 8056179474 | |||
| 2915 | 8056572721 | |||
| 2916 | 8057804090 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ivd-assembly2.cif.gz_B | structure of protoporphyrinogen oxidase from myxococcus xanthus with acifluorfen | 0.9261 | 9 | 39 |
| 3hn2-assembly2.cif.gz_D | crystal structure of 2-dehydropantoate 2-reductase from geobacter metallireducens gs-15 | 0.9169 | 9 | 317 |
| 7fgp-assembly1.cif.gz_B | crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) | 0.9162 | 7 | 39 |
| 3hn2-assembly2.cif.gz_D | crystal structure of 2-dehydropantoate 2-reductase from geobacter metallireducens gs-15 | 0.9111 | 9 | 317 |
| 5eow-assembly1.cif.gz_A | crystal structure of 6-hydroxynicotinic acid 3-monooxygenase from pseudomonas putida kt2440 | 0.911 | 9 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i83B02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9477 | 190 | 317 | 1.10.1040.10 |
| 2r9zB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9392 | 10 | 37 | 3.50.50.60 |
| af_Q5AA38_198_328_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9306 | 190 | 316 | 1.10.1040.10 |
| 3hn2C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9209 | 9 | 188 | 3.40.50.720 |
| af_Q07589_208_348_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9167 | 193 | 316 | 1.10.1040.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M5RJ72-F1-model_v4 | deleted | 0.9952 | 34 | 174 |
|
| AF-A0A2N8RZW1-F1-model_v4 | 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) | 0.9804 | 4 | 315 |
GO:0005737
GO:0008677 GO:0015940 |
| AF-A0A7X1H5D8-F1-model_v4 | Ketopantoate reductase C-terminal domain-containing protein | 0.9763 | 222 | 313 |
GO:0005737
|
| AF-A0A3M5RJ72-F1-model_v4 | deleted | 0.9678 | 34 | 174 |
|
| AF-A0A6J5E3H5-F1-model_v4 | 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) | 0.9657 | 4 | 316 |
GO:0005737
GO:0008677 GO:0015940 |