F494121

General Info

Members Datasets Scaffolds Average Seq Length
1459 559 2918 151

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0071434|Ga0501079_0071434_1413_1961
Length 182
Sequence VPNDPGMHALGDMNVQLPRKKADDFPVDVEIVRLPHGADLPLPAYQSAGAAGLDLVAAVGADEMTVAPGATAIVPTGIAVAIPQGFEGQVRPRSGLAARHAVTVLNAPGTIDADYRGEISVLLINHGRESFSVTRGMRIAQLVIAPVAYAQLHPVEKLSETRRGAGGFGSTGIQDDVSYTKR

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
104 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
120 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
143 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
144 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
145 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
212 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
213 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
214 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
224 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
225 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
226 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
227 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
228 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
229 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
230 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
240 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
254 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
255 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
256 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
279 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
282 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
283 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
284 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
285 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
286 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
287 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
288 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
289 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
290 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
291 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
292 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
293 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
294 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
297 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
298 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
299 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
300 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
301 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
302 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
314 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
324 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
325 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
326 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
327 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
328 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
331 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
337 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
338 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
339 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
340 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
341 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
342 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
343 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
344 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
345 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
346 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
347 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
348 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
351 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
383 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
384 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
385 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
386 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
387 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
388 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
389 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
390 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
391 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
392 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
415 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
416 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
417 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
418 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
419 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
420 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
421 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
422 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
425 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
426 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
429 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
430 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
431 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
432 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
433 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
434 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
435 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
436 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
437 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
438 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
439 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
440 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
441 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
442 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
445 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
446 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
447 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
448 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
449 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
450 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
451 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
452 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
453 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
456 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
457 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
461 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
462 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
463 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
464 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
465 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
466 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
467 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
468 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
469 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
470 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
471 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
472 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
473 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
474 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
475 2773857925 Microvirga vignae BR3299 Isolate Unclassified
476 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
477 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
478 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
479 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
480 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
481 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
482 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
483 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
484 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
485 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
486 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
487 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
488 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
489 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
490 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
491 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
492 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
493 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
494 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
495 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
496 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
497 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
498 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
499 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
500 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
501 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
502 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
503 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
504 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
505 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
506 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
507 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
508 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
509 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
510 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
511 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
512 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
513 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
514 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
515 2922368715
516 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
517 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
518 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
519 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
520 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
521 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
522 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
523 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
524 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
525 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
526 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
527 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
528 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
529 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
530 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
531 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
532 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
533 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
534 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
535 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
536 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
537 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
538 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
539 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
540 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
541 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
542 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
543 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
544 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
545 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
546 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
547 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
548 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
549 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
550 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
551 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
552 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
553 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
554 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
555 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
556 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
557 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
558 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
559 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.94
Metatranscriptomes 0.34
Isolates 6.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 4.8
Rhizoplane 4.59
Rhizosphere 80.19
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0071434 3300049741 Bacteria 2682
2 JGI24738J21930_10036415 3300002075 Bacteria 1001
3 JGI25151J46595_10000672 3300003187 Bacteria 28951
4 JGI25153J46596_10002958 3300003215 Bacteria 9622
5 JGI25153J46596_10010245 3300003215 Bacteria 4258
6 JGI25153J46596_10055504 3300003215 Bacteria 1108
7 rootH1_10131172 3300003323 Bacteria 1285
8 JGI25404J52841_10005557 3300003659 Bacteria 2604
9 Ga0055526_1000242 3300003771 Bacteria 46203
10 Ga0065707_10782720 3300005295 Bacteria 606
11 Ga0065707_10904611 3300005295 Bacteria 565
12 Ga0070658_10098641 3300005327 Bacteria 2413
13 Ga0070658_10526772 3300005327 Bacteria 1022
14 Ga0070683_100981220 3300005329 Bacteria 811
15 Ga0070690_100020110 3300005330 Bacteria 4064
16 Ga0070690_100059637 3300005330 Bacteria 2454
17 Ga0070670_100061445 3300005331 Bacteria 3225
18 Ga0068869_100886695 3300005334 Unclassified 771
19 Ga0070666_10000427 3300005335 Bacteria 25874
20 Ga0070666_10000567 3300005335 Bacteria 22394
21 Ga0070666_10245988 3300005335 Bacteria 1265
22 Ga0070666_10480075 3300005335 Bacteria 900
23 Ga0070680_100015618 3300005336 Bacteria 5956
24 Ga0070680_100030550 3300005336 Bacteria 4328
25 Ga0070680_100044994 3300005336 Bacteria 3587
26 Ga0070680_100153996 3300005336 Bacteria 1930
27 Ga0070680_100193888 3300005336 Bacteria 1712
28 Ga0070680_100696725 3300005336 Bacteria 874
29 Ga0070682_100000566 3300005337 Bacteria 22787
30 Ga0070682_100182236 3300005337 Bacteria 1468
31 Ga0070682_100515762 3300005337 Bacteria 929
32 Ga0070682_101286701 3300005337 Bacteria 621
33 Ga0068868_100217133 3300005338 Bacteria 1600
34 Ga0068868_100365685 3300005338 Bacteria 1238
35 Ga0068868_101476849 3300005338 Bacteria 636
36 Ga0070660_100029124 3300005339 Bacteria 4136
37 Ga0070660_100046559 3300005339 Bacteria 3324
38 Ga0070660_100093976 3300005339 Bacteria 2369
39 Ga0070660_100194309 3300005339 Bacteria 1644
40 Ga0070660_101433024 3300005339 Bacteria 587
41 Ga0070689_100007812 3300005340 Bacteria 7495
42 Ga0070689_100040488 3300005340 Bacteria 3573
43 Ga0070689_100439576 3300005340 Bacteria 1108
44 Ga0070691_10152839 3300005341 Unclassified 1184
45 Ga0070687_100132948 3300005343 Bacteria 1438
46 Ga0070687_100443475 3300005343 Bacteria 862
47 Ga0070687_101033922 3300005343 Bacteria 597
48 Ga0070661_100004323 3300005344 Bacteria 9801
49 Ga0070661_100017626 3300005344 Bacteria 5068
50 Ga0070661_100054574 3300005344 Bacteria 2927
51 Ga0070661_100234568 3300005344 Bacteria 1411
52 Ga0070661_100358170 3300005344 Bacteria 1146
53 Ga0070661_101059665 3300005344 Bacteria 674
54 Ga0070668_100040477 3300005347 Bacteria 3566
55 Ga0070668_100050793 3300005347 Bacteria 3194
56 Ga0070668_100058223 3300005347 Bacteria 2989
57 Ga0070668_100059275 3300005347 Bacteria 2962
58 Ga0070669_101279258 3300005353 Bacteria 635
59 Ga0070675_100080365 3300005354 Bacteria 2717
60 Ga0070675_100197144 3300005354 Bacteria 1747
61 Ga0070675_100416774 3300005354 Bacteria 1200
62 Ga0070671_100001825 3300005355 Bacteria 16209
63 Ga0070671_100007171 3300005355 Bacteria 8911
64 Ga0070671_100699533 3300005355 Bacteria 879
65 Ga0070674_100000514 3300005356 Bacteria 19393
66 Ga0070674_100049648 3300005356 Bacteria 2885
67 Ga0070673_100126656 3300005364 Bacteria 2138
68 Ga0070688_100156993 3300005365 Bacteria 1560
69 Ga0070659_100030507 3300005366 Bacteria 4173
70 Ga0070659_100041927 3300005366 Bacteria 3578
71 Ga0070659_100297498 3300005366 Bacteria 1345
72 Ga0070659_100471298 3300005366 Bacteria 1067
73 Ga0070659_101078646 3300005366 Bacteria 707
74 Ga0070667_100143072 3300005367 Bacteria 2096
75 Ga0070667_101271617 3300005367 Bacteria 689
76 Ga0070703_10278016 3300005406 Bacteria 690
77 Ga0070709_10048529 3300005434 Bacteria 2650
78 Ga0070709_10056754 3300005434 Bacteria 2477
79 Ga0070709_10147938 3300005434 Unclassified 1620
80 Ga0070714_100020675 3300005435 Bacteria 5379
81 Ga0070714_100063509 3300005435 Bacteria 3176
82 Ga0070714_100092690 3300005435 Bacteria 2648
83 Ga0070714_100195101 3300005435 Bacteria 1850
84 Ga0070714_100322508 3300005435 Bacteria 1445
85 Ga0070714_100634996 3300005435 Bacteria 1027
86 Ga0070713_100612680 3300005436 Bacteria 1035
87 Ga0070713_100668837 3300005436 Bacteria 990
88 Ga0070713_100879509 3300005436 Bacteria 861
89 Ga0070713_101285827 3300005436 Bacteria 709
90 Ga0070710_10146699 3300005437 Bacteria 1452
91 Ga0070710_10237772 3300005437 Bacteria 1166
92 Ga0070710_10505562 3300005437 Bacteria 828
93 Ga0070710_10900511 3300005437 Bacteria 639
94 Ga0070711_100010787 3300005439 Bacteria 5666
95 Ga0070711_100130906 3300005439 Bacteria 1868
96 Ga0070711_100422608 3300005439 Bacteria 1086
97 Ga0070711_100450785 3300005439 Bacteria 1053
98 Ga0070711_100659423 3300005439 Bacteria 878
99 Ga0070711_100681415 3300005439 Bacteria 864
100 Ga0070711_101871128 3300005439 Bacteria 527
101 Ga0070705_100040425 3300005440 Bacteria 2652
102 Ga0070705_100570284 3300005440 Bacteria 871
103 Ga0070694_100307162 3300005444 Bacteria 1217
104 Ga0070694_100979855 3300005444 Bacteria 701
105 Ga0070708_100195621 3300005445 Bacteria 1892
106 Ga0070663_100052113 3300005455 Bacteria 2918
107 Ga0070663_100057957 3300005455 Bacteria 2780
108 Ga0070663_100096836 3300005455 Bacteria 2195
109 Ga0070663_101087590 3300005455 Bacteria 699
110 Ga0070678_100007656 3300005456 Bacteria 6420
111 Ga0070678_100353111 3300005456 Bacteria 1265
112 Ga0070662_100125116 3300005457 Bacteria 1975
113 Ga0070662_100135141 3300005457 Bacteria 1906
114 Ga0070662_100159207 3300005457 Bacteria 1765
115 Ga0070662_100643089 3300005457 Bacteria 894
116 Ga0070662_100665282 3300005457 Bacteria 879
117 Ga0070662_100730396 3300005457 Unclassified 839
118 Ga0070681_10001010 3300005458 Bacteria 23785
119 Ga0070681_10026663 3300005458 Bacteria 5808
120 Ga0070681_10199077 3300005458 Bacteria 1922
121 Ga0070681_10204214 3300005458 Bacteria 1894
122 Ga0070681_10213879 3300005458 Bacteria 1844
123 Ga0070681_10713904 3300005458 Bacteria 918
124 Ga0070681_10714249 3300005458 Bacteria 918
125 Ga0070681_11220321 3300005458 Bacteria 674
126 Ga0068867_100927980 3300005459 Bacteria 785
127 Ga0070685_10198636 3300005466 Bacteria 1302
128 Ga0070685_10253702 3300005466 Bacteria 1166
129 Ga0070706_100080593 3300005467 Bacteria 3015
130 Ga0070707_100202890 3300005468 Bacteria 1933
131 Ga0070707_100409651 3300005468 Bacteria 1316
132 Ga0070698_100007707 3300005471 Bacteria 11644
133 Ga0070698_101035554 3300005471 Bacteria 768
134 Ga0070699_100003726 3300005518 Bacteria 13463
135 Ga0070699_100563500 3300005518 Bacteria 1037
136 Ga0070679_100004669 3300005530 Bacteria 12642
137 Ga0070679_100009814 3300005530 Bacteria 9056
138 Ga0070679_100031168 3300005530 Bacteria 5267
139 Ga0070679_100119253 3300005530 Bacteria 2623
140 Ga0070679_100154394 3300005530 Bacteria 2271
141 Ga0070679_100253863 3300005530 Bacteria 1714
142 Ga0070679_100340918 3300005530 Bacteria 1447
143 Ga0070679_100895030 3300005530 Bacteria 831
144 Ga0070684_100228615 3300005535 Bacteria 1698
145 Ga0070697_100001362 3300005536 Bacteria 18486
146 Ga0070697_100752344 3300005536 Bacteria 861
147 Ga0068853_100000543 3300005539 Bacteria 25678
148 Ga0068853_100013377 3300005539 Bacteria 6698
149 Ga0068853_100076877 3300005539 Bacteria 2916
150 Ga0068853_100146617 3300005539 Bacteria 2122
151 Ga0068853_100893927 3300005539 Bacteria 853
152 Ga0070672_100308279 3300005543 Bacteria 1343
153 Ga0070672_100621512 3300005543 Bacteria 942
154 Ga0070686_100003363 3300005544 Bacteria 8761
155 Ga0070686_101178486 3300005544 Bacteria 635
156 Ga0070695_100023948 3300005545 Bacteria 3758
157 Ga0070695_100255834 3300005545 Bacteria 1277
158 Ga0070696_100019455 3300005546 Bacteria 4598
159 Ga0070696_100341772 3300005546 Bacteria 1157
160 Ga0070696_100676865 3300005546 Bacteria 839
161 Ga0070693_100018605 3300005547 Bacteria 3633
162 Ga0070693_100025551 3300005547 Bacteria 3181
163 Ga0070693_100330805 3300005547 Bacteria 1037
164 Ga0070693_100421577 3300005547 Bacteria 930
165 Ga0070693_100688445 3300005547 Unclassified 747
166 Ga0070665_100040141 3300005548 Bacteria 4705
167 Ga0070665_100054503 3300005548 Bacteria 4010
168 Ga0070665_100638343 3300005548 Bacteria 1078
169 Ga0070665_100962053 3300005548 Bacteria 866
170 Ga0070704_100007544 3300005549 Bacteria 6478
171 Ga0070704_100164635 3300005549 Bacteria 1757
172 Ga0070704_101559596 3300005549 Bacteria 608
173 Ga0068855_100021259 3300005563 Bacteria 7779
174 Ga0068855_100080314 3300005563 Bacteria 3781
175 Ga0068855_100116359 3300005563 Bacteria 3064
176 Ga0068855_100138421 3300005563 Bacteria 2776
177 Ga0068855_100163742 3300005563 Bacteria 2523
178 Ga0068855_100199467 3300005563 Bacteria 2253
179 Ga0068855_100251629 3300005563 Bacteria 1971
180 Ga0068855_100513304 3300005563 Bacteria 1301
181 Ga0068855_100529368 3300005563 Bacteria 1278
182 Ga0070664_100197992 3300005564 Bacteria 1791
183 Ga0068857_100002988 3300005577 Bacteria 13941
184 Ga0068857_100146925 3300005577 Bacteria 2133
185 Ga0068857_100315094 3300005577 Bacteria 1444
186 Ga0068857_100793236 3300005577 Bacteria 904
187 Ga0068854_100023530 3300005578 Bacteria 4209
188 Ga0068854_100096434 3300005578 Bacteria 2210
189 Ga0068856_100004408 3300005614 Bacteria 14028
190 Ga0068856_100030605 3300005614 Bacteria 5261
191 Ga0068856_100079823 3300005614 Bacteria 3245
192 Ga0068856_100145504 3300005614 Bacteria 2378
193 Ga0068856_100147233 3300005614 Bacteria 2363
194 Ga0068856_100919459 3300005614 Bacteria 894
195 Ga0068856_101149126 3300005614 Bacteria 793
196 Ga0068856_101400174 3300005614 Bacteria 714
197 Ga0068852_100029027 3300005616 Bacteria 4537
198 Ga0068852_100049845 3300005616 Bacteria 3584
199 Ga0068852_100053455 3300005616 Bacteria 3476
200 Ga0068852_100102394 3300005616 Bacteria 2587
201 Ga0068852_100144959 3300005616 Bacteria 2202
202 Ga0068852_100522725 3300005616 Unclassified 1184
203 Ga0068852_100631091 3300005616 Bacteria 1078
204 Ga0068859_100071633 3300005617 Bacteria 3502
205 Ga0068859_100364638 3300005617 Bacteria 1540
206 Ga0068859_100396387 3300005617 Bacteria 1476
207 Ga0068859_100569320 3300005617 Bacteria 1227
208 Ga0068859_100740472 3300005617 Bacteria 1072
209 Ga0068859_100775941 3300005617 Bacteria 1047
210 Ga0068866_10181410 3300005718 Bacteria 1244
211 Ga0068866_10621773 3300005718 Bacteria 732
212 Ga0068861_100145993 3300005719 Bacteria 1936
213 Ga0068861_100463220 3300005719 Bacteria 1138
214 Ga0068861_100538940 3300005719 Bacteria 1061
215 Ga0068851_10001949 3300005834 Bacteria 9068
216 Ga0068851_10085393 3300005834 Bacteria 1654
217 Ga0068870_10474519 3300005840 Bacteria 829
218 Ga0068863_100321222 3300005841 Bacteria 1504
219 Ga0068858_100041503 3300005842 Bacteria 4265
220 Ga0068858_100056156 3300005842 Bacteria 3640
221 Ga0068858_100338486 3300005842 Bacteria 1440
222 Ga0068858_101008921 3300005842 Bacteria 816
223 Ga0068860_100043881 3300005843 Bacteria 4263
224 Ga0068860_100297942 3300005843 Bacteria 1579
225 Ga0068860_100491272 3300005843 Bacteria 1224
226 Ga0068860_100536397 3300005843 Bacteria 1171
227 Ga0068860_101038605 3300005843 Bacteria 838
228 Ga0068862_101113548 3300005844 Unclassified 785
229 Ga0068862_101272267 3300005844 Bacteria 736
230 Ga0068862_101868830 3300005844 Unclassified 610
231 Ga0081455_10036141 3300005937 Bacteria 4403
232 Ga0081455_10109224 3300005937 Bacteria 2201
233 Ga0081455_10256396 3300005937 Bacteria 1276
234 Ga0081455_10477406 3300005937 Bacteria 844
235 Ga0081538_10012021 3300005981 Bacteria 6971
236 Ga0081540_1000038 3300005983 Bacteria 138179
237 Ga0081540_1012758 3300005983 Bacteria 5503
238 Ga0081540_1015430 3300005983 Bacteria 4839
239 Ga0081540_1035483 3300005983 Bacteria 2673
240 Ga0081540_1056340 3300005983 Bacteria 1909
241 Ga0070717_10037644 3300006028 Bacteria 3929
242 Ga0070717_10051046 3300006028 Bacteria 3402
243 Ga0070717_10090531 3300006028 Bacteria 2582
244 Ga0070717_10523349 3300006028 Bacteria 1073
245 Ga0070717_10812500 3300006028 Bacteria 851
246 Ga0070717_11410383 3300006028 Unclassified 632
247 Ga0075365_10026857 3300006038 Bacteria 3658
248 Ga0075365_10063627 3300006038 Bacteria 2470
249 Ga0075365_10065825 3300006038 Bacteria 2430
250 Ga0075365_10137355 3300006038 Bacteria 1695
251 Ga0075368_10019526 3300006042 Bacteria 2559
252 Ga0075368_10042005 3300006042 Bacteria 1798
253 Ga0075368_10105341 3300006042 Bacteria 1160
254 Ga0075432_10000166 3300006058 Bacteria 16279
255 Ga0070715_10048556 3300006163 Bacteria 1815
256 Ga0070716_100122565 3300006173 Bacteria 1630
257 Ga0070716_100248980 3300006173 Bacteria 1209
258 Ga0070716_100295883 3300006173 Bacteria 1124
259 Ga0070716_101061176 3300006173 Bacteria 644
260 Ga0070712_100001297 3300006175 Bacteria 15118
261 Ga0070712_100037305 3300006175 Bacteria 3312
262 Ga0070712_100084520 3300006175 Bacteria 2308
263 Ga0070712_100161490 3300006175 Bacteria 1730
264 Ga0070712_100264142 3300006175 Bacteria 1380
265 Ga0070712_100584919 3300006175 Bacteria 943
266 Ga0075362_10009261 3300006177 Bacteria 3801
267 Ga0075362_10395832 3300006177 Bacteria 696
268 Ga0075367_10056691 3300006178 Bacteria 2328
269 Ga0075367_10072065 3300006178 Bacteria 2079
270 Ga0075367_10285315 3300006178 Bacteria 1038
271 Ga0075369_10050225 3300006186 Bacteria 1803
272 Ga0075369_10105788 3300006186 Bacteria 1265
273 Ga0075369_10154980 3300006186 Bacteria 1048
274 Ga0075369_10203664 3300006186 Bacteria 913
275 Ga0075427_10001991 3300006194 Bacteria 2692
276 Ga0075366_10079338 3300006195 Bacteria 1959
277 Ga0075366_10418832 3300006195 Bacteria 825
278 Ga0075366_10502546 3300006195 Bacteria 749
279 Ga0097621_100079011 3300006237 Bacteria 2734
280 Ga0097621_100110848 3300006237 Bacteria 2318
281 Ga0075370_10016199 3300006353 Bacteria 4007
282 Ga0075370_10046241 3300006353 Bacteria 2463
283 Ga0075428_100001888 3300006844 Bacteria 22478
284 Ga0075428_100955280 3300006844 Bacteria 908
285 Ga0075428_101872298 3300006844 Bacteria 624
286 Ga0075430_100000129 3300006846 Bacteria 47714
287 Ga0075430_100195286 3300006846 Bacteria 1681
288 Ga0075431_100000948 3300006847 Bacteria 25623
289 Ga0075431_100358764 3300006847 Bacteria 1464
290 Ga0075433_10000100 3300006852 Bacteria 41448
291 Ga0075434_100001229 3300006871 Bacteria 21306
292 Ga0075434_100029045 3300006871 Bacteria 5438
293 Ga0075434_100072578 3300006871 Bacteria 3434
294 Ga0075434_100632412 3300006871 Bacteria 1089
295 Ga0075429_100000278 3300006880 Bacteria 36057
296 Ga0075429_100293227 3300006880 Bacteria 1424
297 Ga0068865_100991629 3300006881 Bacteria 735
298 Ga0075436_100058342 3300006914 Bacteria 2665
299 Ga0075436_100082766 3300006914 Bacteria 2226
300 Ga0075436_100254919 3300006914 Bacteria 1250
301 Ga0075436_100331970 3300006914 Bacteria 1094
302 Ga0075436_100851347 3300006914 Bacteria 681
303 Ga0097620_100071633 3300006931 Bacteria 3502
304 Ga0097620_100364630 3300006931 Bacteria 1540
305 Ga0097620_100396360 3300006931 Bacteria 1476
306 Ga0097620_100569356 3300006931 Bacteria 1227
307 Ga0097620_100740473 3300006931 Bacteria 1072
308 Ga0097620_100775966 3300006931 Bacteria 1047
309 Ga0097620_101836044 3300006931 Bacteria 669
310 Ga0099824_1013934 3300006942 Bacteria 8170
311 Ga0099822_1064350 3300006943 Bacteria 1140
312 Ga0075435_100017187 3300007076 Bacteria 5468
313 Ga0075435_100045435 3300007076 Bacteria 3521
314 Ga0075435_100046079 3300007076 Bacteria 3496
315 Ga0075435_100254917 3300007076 Bacteria 1494
316 Ga0075435_100568898 3300007076 Bacteria 982
317 Ga0075435_101307811 3300007076 Bacteria 635
318 Ga0099794_10040343 3300007265 Bacteria 2219
319 Ga0099795_10017377 3300007788 Bacteria 2292
320 Ga0099795_10074430 3300007788 Bacteria 1287
321 Ga0105240_10115106 3300009093 Bacteria 3247
322 Ga0105240_10127337 3300009093 Bacteria 3058
323 Ga0105240_10237186 3300009093 Bacteria 2116
324 Ga0105240_10387976 3300009093 Bacteria 1576
325 Ga0105240_10465532 3300009093 Bacteria 1412
326 Ga0105240_10829261 3300009093 Bacteria 1000
327 Ga0105240_11217584 3300009093 Bacteria 797
328 Ga0111539_10001748 3300009094 Bacteria 28854
329 Ga0111539_10593087 3300009094 Bacteria 1290
330 Ga0111539_11586565 3300009094 Bacteria 759
331 Ga0105245_10069786 3300009098 Bacteria 3187
332 Ga0105245_10189071 3300009098 Bacteria 1971
333 Ga0105245_10209074 3300009098 Bacteria 1877
334 Ga0105245_10286819 3300009098 Bacteria 1611
335 Ga0105245_10504493 3300009098 Bacteria 1226
336 Ga0114129_10002143 3300009147 Bacteria 27207
337 Ga0114129_10057915 3300009147 Bacteria 5421
338 Ga0105243_10230495 3300009148 Bacteria 1643
339 Ga0105243_10240816 3300009148 Bacteria 1610
340 Ga0105243_10420513 3300009148 Unclassified 1246
341 Ga0105243_10717939 3300009148 Bacteria 976
342 Ga0105243_12781599 3300009148 Bacteria 530
343 Ga0105241_10033096 3300009174 Bacteria 3879
344 Ga0105241_10301517 3300009174 Bacteria 1375
345 Ga0105241_10593000 3300009174 Bacteria 1000
346 Ga0105241_10751379 3300009174 Bacteria 894
347 Ga0105241_10818770 3300009174 Bacteria 859
348 Ga0105242_10268820 3300009176 Bacteria 1543
349 Ga0105248_10055367 3300009177 Bacteria 4448
350 Ga0105248_10173605 3300009177 Bacteria 2429
351 Ga0105248_10267301 3300009177 Bacteria 1925
352 Ga0105237_10049382 3300009545 Bacteria 4230
353 Ga0105237_10203047 3300009545 Bacteria 1982
354 Ga0105237_10207610 3300009545 Bacteria 1959
355 Ga0105237_10276860 3300009545 Bacteria 1680
356 Ga0105237_10374239 3300009545 Bacteria 1429
357 Ga0105237_10675639 3300009545 Bacteria 1039
358 Ga0105238_10120341 3300009551 Bacteria 2605
359 Ga0105238_10126420 3300009551 Bacteria 2535
360 Ga0105238_10285802 3300009551 Bacteria 1631
361 Ga0105238_10292085 3300009551 Bacteria 1612
362 Ga0105238_10305449 3300009551 Bacteria 1575
363 Ga0105249_10108769 3300009553 Bacteria 2617
364 Ga0105249_10632159 3300009553 Bacteria 1127
365 Ga0105033_105541 3300009986 Bacteria 1086
366 Ga0099796_10046619 3300010159 Bacteria 1488
367 Ga0099796_10103469 3300010159 Bacteria 1074
368 Ga0105239_10029085 3300010375 Bacteria 6075
369 Ga0105239_10033765 3300010375 Bacteria 5617
370 Ga0105239_10161811 3300010375 Bacteria 2501
371 Ga0105239_10655577 3300010375 Bacteria 1199
372 Ga0105239_11655131 3300010375 Bacteria 740
373 Ga0105246_10146763 3300011119 Bacteria 1781
374 Ga0105246_10381893 3300011119 Bacteria 1164
375 Ga0157342_1061617 3300012507 Bacteria 552
376 Ga0157373_10064966 3300013100 Bacteria 2583
377 Ga0157373_10769828 3300013100 Bacteria 708
378 Ga0157371_10111750 3300013102 Bacteria 1939
379 Ga0157371_10338740 3300013102 Bacteria 1094
380 Ga0157371_10354101 3300013102 Bacteria 1069
381 Ga0157371_11086995 3300013102 Bacteria 613
382 Ga0157370_10076215 3300013104 Bacteria 3160
383 Ga0157370_10165458 3300013104 Bacteria 2057
384 Ga0157370_10185132 3300013104 Bacteria 1934
385 Ga0157370_10651879 3300013104 Bacteria 962
386 Ga0157369_10073444 3300013105 Bacteria 3670
387 Ga0157369_10314460 3300013105 Bacteria 1628
388 Ga0157369_10580971 3300013105 Bacteria 1157
389 Ga0157369_11214724 3300013105 Bacteria 769
390 Ga0157369_11228487 3300013105 Bacteria 765
391 Ga0157369_11663565 3300013105 Bacteria 649
392 Ga0157374_10136489 3300013296 Bacteria 2378
393 Ga0157374_10577297 3300013296 Bacteria 1133
394 Ga0157374_12376768 3300013296 Bacteria 557
395 Ga0157378_10404000 3300013297 Bacteria 1347
396 Ga0163162_10070190 3300013306 Bacteria 3555
397 Ga0163162_10310667 3300013306 Bacteria 1709
398 Ga0157372_10017231 3300013307 Bacteria 7754
399 Ga0157372_10442927 3300013307 Bacteria 1514
400 Ga0157372_10996703 3300013307 Bacteria 970
401 Ga0157372_11017697 3300013307 Bacteria 959
402 Ga0157375_10081426 3300013308 Bacteria 3277
403 Ga0157375_10867132 3300013308 Bacteria 1048
404 Ga0163163_10056801 3300014325 Bacteria 3868
405 Ga0163163_10162558 3300014325 Bacteria 2278
406 Ga0163163_10584716 3300014325 Bacteria 1180
407 Ga0163163_12142851 3300014325 Bacteria 618
408 Ga0157380_10157590 3300014326 Bacteria 1969
409 Ga0157380_10188434 3300014326 Bacteria 1819
410 Ga0157380_10215561 3300014326 Bacteria 1714
411 Ga0157380_11512140 3300014326 Bacteria 725
412 Ga0157379_10101532 3300014968 Bacteria 2582
413 Ga0157379_10190243 3300014968 Bacteria 1855
414 Ga0157379_10743915 3300014968 Bacteria 923
415 Ga0157376_11089811 3300014969 Bacteria 824
416 Ga0163161_10321014 3300017792 Bacteria 1224
417 Ga0206356_11838946 3300020070 Bacteria 876
418 Ga0206352_10997270 3300020078 Bacteria 967
419 Ga0206354_10085180 3300020081 Bacteria 2537
420 Ga0206353_11856768 3300020082 Bacteria 1083
421 Ga0206353_12068506 3300020082 Bacteria 737
422 Ga0214544_1000056 3300021320 Bacteria 132760
423 Ga0214542_1000071 3300021321 Bacteria 124568
424 Ga0214545_1000033 3300021324 Bacteria 124568
425 Ga0214543_1000105 3300021327 Bacteria 108404
426 Ga0213876_10000257 3300021384 Bacteria 49797
427 Ga0213876_10013908 3300021384 Bacteria 4266
428 Ga0213876_10033347 3300021384 Bacteria 2715
429 Ga0209233_1038629 3300025261 Bacteria 1052
430 Ga0209673_1017880 3300025273 Bacteria 2600
431 Ga0209130_1001182 3300025284 Bacteria 18663
432 Ga0209025_1000636 3300025294 Bacteria 62083
433 Ga0209025_1118533 3300025294 Bacteria 795
434 Ga0209564_1000043 3300025295 Bacteria 388153
435 Ga0209564_1009031 3300025295 Bacteria 4807
436 Ga0209758_1000634 3300025297 Bacteria 53757
437 Ga0209758_1003408 3300025297 Bacteria 14521
438 Ga0209758_1048174 3300025297 Bacteria 1517
439 Ga0207426_1000088 3300025302 Bacteria 287526
440 Ga0209257_1014909 3300025304 Bacteria 3289
441 Ga0207692_10078063 3300025898 Bacteria 1763
442 Ga0207692_10237854 3300025898 Bacteria 1086
443 Ga0207692_10287856 3300025898 Bacteria 996
444 Ga0207692_10293496 3300025898 Bacteria 987
445 Ga0207688_10097542 3300025901 Bacteria 1694
446 Ga0207688_10149266 3300025901 Bacteria 1380
447 Ga0207688_10345333 3300025901 Bacteria 916
448 Ga0207680_10057620 3300025903 Bacteria 2351
449 Ga0207680_10306945 3300025903 Bacteria 1107
450 Ga0207647_10055372 3300025904 Bacteria 2437
451 Ga0207685_10025337 3300025905 Bacteria 2046
452 Ga0207685_10268886 3300025905 Bacteria 832
453 Ga0207699_10020390 3300025906 Bacteria 3552
454 Ga0207699_10125758 3300025906 Bacteria 1664
455 Ga0207699_10327738 3300025906 Bacteria 1076
456 Ga0207705_10345597 3300025909 Bacteria 1145
457 Ga0207654_10016506 3300025911 Bacteria 3846
458 Ga0207654_10121122 3300025911 Bacteria 1643
459 Ga0207654_10260219 3300025911 Bacteria 1166
460 Ga0207654_10573183 3300025911 Bacteria 803
461 Ga0207654_11016634 3300025911 Bacteria 603
462 Ga0207707_10002294 3300025912 Bacteria 17254
463 Ga0207707_10065074 3300025912 Bacteria 3176
464 Ga0207707_10094957 3300025912 Bacteria 2606
465 Ga0207707_10109342 3300025912 Bacteria 2416
466 Ga0207707_10290012 3300025912 Bacteria 1416
467 Ga0207695_10095017 3300025913 Bacteria 2986
468 Ga0207695_10654217 3300025913 Bacteria 932
469 Ga0207695_10689678 3300025913 Bacteria 902
470 Ga0207695_10807574 3300025913 Bacteria 818
471 Ga0207695_11075340 3300025913 Bacteria 684
472 Ga0207671_10049984 3300025914 Bacteria 3096
473 Ga0207671_11116321 3300025914 Bacteria 619
474 Ga0207693_10003011 3300025915 Bacteria 14575
475 Ga0207693_10004816 3300025915 Bacteria 11347
476 Ga0207693_10018001 3300025915 Bacteria 5630
477 Ga0207693_10051140 3300025915 Bacteria 3244
478 Ga0207693_10069716 3300025915 Bacteria 2751
479 Ga0207693_10125170 3300025915 Bacteria 2020
480 Ga0207693_10452571 3300025915 Bacteria 1003
481 Ga0207663_10050127 3300025916 Bacteria 2593
482 Ga0207663_10073084 3300025916 Bacteria 2218
483 Ga0207663_10119319 3300025916 Bacteria 1803
484 Ga0207663_10159942 3300025916 Bacteria 1589
485 Ga0207663_10209701 3300025916 Bacteria 1411
486 Ga0207663_10706925 3300025916 Bacteria 798
487 Ga0207663_10737393 3300025916 Bacteria 782
488 Ga0207660_10035495 3300025917 Bacteria 3463
489 Ga0207660_10041415 3300025917 Bacteria 3227
490 Ga0207660_10156408 3300025917 Bacteria 1755
491 Ga0207660_10280144 3300025917 Bacteria 1323
492 Ga0207660_10691899 3300025917 Bacteria 832
493 Ga0207660_10978272 3300025917 Bacteria 690
494 Ga0207662_10080927 3300025918 Bacteria 1982
495 Ga0207662_10239988 3300025918 Bacteria 1186
496 Ga0207662_10521743 3300025918 Bacteria 820
497 Ga0207657_10011982 3300025919 Bacteria 8578
498 Ga0207657_10013583 3300025919 Bacteria 7988
499 Ga0207657_10050240 3300025919 Bacteria 3629
500 Ga0207657_10075353 3300025919 Bacteria 2847
501 Ga0207649_10000037 3300025920 Bacteria 131159
502 Ga0207649_10130703 3300025920 Bacteria 1705
503 Ga0207649_10144696 3300025920 Bacteria 1630
504 Ga0207652_10005368 3300025921 Bacteria 10395
505 Ga0207652_10049414 3300025921 Bacteria 3600
506 Ga0207652_10133158 3300025921 Bacteria 2218
507 Ga0207652_10137183 3300025921 Bacteria 2185
508 Ga0207652_10248208 3300025921 Bacteria 1605
509 Ga0207652_10285073 3300025921 Bacteria 1490
510 Ga0207652_10585443 3300025921 Bacteria 1001
511 Ga0207652_11042337 3300025921 Bacteria 717
512 Ga0207652_11102517 3300025921 Bacteria 694
513 Ga0207652_11207187 3300025921 Bacteria 658
514 Ga0207646_10213598 3300025922 Bacteria 1742
515 Ga0207646_10573651 3300025922 Bacteria 1013
516 Ga0207646_10660045 3300025922 Bacteria 936
517 Ga0207681_11383240 3300025923 Bacteria 591
518 Ga0207694_10053425 3300025924 Bacteria 3132
519 Ga0207694_10153039 3300025924 Bacteria 1859
520 Ga0207694_10187113 3300025924 Bacteria 1681
521 Ga0207694_10224281 3300025924 Bacteria 1534
522 Ga0207694_10703475 3300025924 Bacteria 852
523 Ga0207650_10057033 3300025925 Bacteria 2904
524 Ga0207650_10098186 3300025925 Bacteria 2250
525 Ga0207659_10366146 3300025926 Bacteria 1199
526 Ga0207659_10418878 3300025926 Bacteria 1123
527 Ga0207687_10008311 3300025927 Bacteria 6791
528 Ga0207687_10198907 3300025927 Bacteria 1565
529 Ga0207687_10510705 3300025927 Bacteria 1004
530 Ga0207700_10138888 3300025928 Bacteria 1994
531 Ga0207700_10141145 3300025928 Bacteria 1979
532 Ga0207700_10256654 3300025928 Bacteria 1495
533 Ga0207700_10453091 3300025928 Bacteria 1131
534 Ga0207700_10609934 3300025928 Bacteria 972
535 Ga0207700_11266070 3300025928 Bacteria 657
536 Ga0207664_10034755 3300025929 Bacteria 3885
537 Ga0207664_10075476 3300025929 Bacteria 2726
538 Ga0207664_10118736 3300025929 Bacteria 2210
539 Ga0207664_10325272 3300025929 Bacteria 1357
540 Ga0207664_10380638 3300025929 Bacteria 1253
541 Ga0207664_10873404 3300025929 Bacteria 808
542 Ga0207664_11648760 3300025929 Bacteria 563
543 Ga0207644_10027239 3300025931 Bacteria 3948
544 Ga0207644_10075274 3300025931 Bacteria 2480
545 Ga0207690_10011004 3300025932 Bacteria 5394
546 Ga0207690_10120400 3300025932 Bacteria 1905
547 Ga0207690_10314336 3300025932 Bacteria 1229
548 Ga0207690_11224134 3300025932 Bacteria 627
549 Ga0207706_10142359 3300025933 Bacteria 2110
550 Ga0207706_10375777 3300025933 Bacteria 1234
551 Ga0207706_10684169 3300025933 Bacteria 877
552 Ga0207706_10822448 3300025933 Unclassified 788
553 Ga0207686_10406171 3300025934 Bacteria 1039
554 Ga0207709_10690455 3300025935 Bacteria 816
555 Ga0207670_10003625 3300025936 Bacteria 8190
556 Ga0207670_10184432 3300025936 Bacteria 1574
557 Ga0207670_10546695 3300025936 Bacteria 946
558 Ga0207669_10006197 3300025937 Bacteria 5444
559 Ga0207704_10850443 3300025938 Bacteria 765
560 Ga0207704_11046278 3300025938 Bacteria 692
561 Ga0207665_10174853 3300025939 Bacteria 1552
562 Ga0207665_10177441 3300025939 Bacteria 1541
563 Ga0207665_10325289 3300025939 Bacteria 1155
564 Ga0207665_10510885 3300025939 Bacteria 929
565 Ga0207691_10303021 3300025940 Bacteria 1372
566 Ga0207711_10094448 3300025941 Bacteria 2635
567 Ga0207689_10688044 3300025942 Bacteria 862
568 Ga0207661_10093866 3300025944 Bacteria 2505
569 Ga0207661_10555363 3300025944 Bacteria 1052
570 Ga0207679_10356402 3300025945 Bacteria 1276
571 Ga0207679_10804074 3300025945 Bacteria 857
572 Ga0207667_10004998 3300025949 Bacteria 16203
573 Ga0207667_10008893 3300025949 Bacteria 11887
574 Ga0207667_10018467 3300025949 Bacteria 7818
575 Ga0207667_10027306 3300025949 Bacteria 6216
576 Ga0207667_10028917 3300025949 Bacteria 6017
577 Ga0207667_10066850 3300025949 Bacteria 3746
578 Ga0207667_10289341 3300025949 Bacteria 1674
579 Ga0207667_10327051 3300025949 Bacteria 1565
580 Ga0207667_10712457 3300025949 Unclassified 1005
581 Ga0207667_10860357 3300025949 Bacteria 900
582 Ga0207667_10996323 3300025949 Bacteria 825
583 Ga0207651_10669990 3300025960 Bacteria 912
584 Ga0207668_10018472 3300025972 Bacteria 4389
585 Ga0207668_10583235 3300025972 Bacteria 972
586 Ga0207640_10063686 3300025981 Bacteria 2451
587 Ga0207640_10076390 3300025981 Bacteria 2273
588 Ga0207658_11154552 3300025986 Bacteria 708
589 Ga0207677_11610963 3300026023 Bacteria 601
590 Ga0207703_10056902 3300026035 Bacteria 3187
591 Ga0207703_10129074 3300026035 Bacteria 2181
592 Ga0207639_10009672 3300026041 Bacteria 6660
593 Ga0207639_10197365 3300026041 Bacteria 1723
594 Ga0207639_10341609 3300026041 Bacteria 1335
595 Ga0207639_10846725 3300026041 Bacteria 853
596 Ga0207678_10028473 3300026067 Bacteria 4878
597 Ga0207678_10042026 3300026067 Bacteria 3962
598 Ga0207678_10068916 3300026067 Bacteria 3034
599 Ga0207678_10179616 3300026067 Bacteria 1807
600 Ga0207702_10042240 3300026078 Bacteria 3824
601 Ga0207702_10049700 3300026078 Bacteria 3539
602 Ga0207702_10179869 3300026078 Bacteria 1947
603 Ga0207702_10704434 3300026078 Bacteria 995
604 Ga0207702_10758366 3300026078 Bacteria 958
605 Ga0207702_10793540 3300026078 Bacteria 936
606 Ga0207702_11180438 3300026078 Bacteria 760
607 Ga0207641_10199723 3300026088 Bacteria 1843
608 Ga0207641_10604207 3300026088 Bacteria 1074
609 Ga0207641_11063742 3300026088 Bacteria 807
610 Ga0207648_10183269 3300026089 Bacteria 1853
611 Ga0207648_10419907 3300026089 Bacteria 1214
612 Ga0207648_10785185 3300026089 Bacteria 886
613 Ga0207674_10140299 3300026116 Bacteria 2376
614 Ga0207674_10225628 3300026116 Bacteria 1821
615 Ga0207674_10424332 3300026116 Bacteria 1285
616 Ga0207674_10553962 3300026116 Bacteria 1111
617 Ga0207675_100542055 3300026118 Bacteria 1162
618 Ga0207675_100880694 3300026118 Unclassified 911
619 Ga0207675_100923017 3300026118 Bacteria 890
620 Ga0207683_10027851 3300026121 Bacteria 4883
621 Ga0207683_10037115 3300026121 Bacteria 4244
622 Ga0207683_10514776 3300026121 Bacteria 1106
623 Ga0207683_10851260 3300026121 Bacteria 846
624 Ga0207698_10019486 3300026142 Bacteria 4646
625 Ga0207698_10057661 3300026142 Bacteria 3006
626 Ga0207698_10084844 3300026142 Bacteria 2569
627 Ga0207698_10139571 3300026142 Bacteria 2085
628 Ga0207698_10144391 3300026142 Bacteria 2055
629 Ga0207698_11007838 3300026142 Bacteria 844
630 Ga0207698_11107348 3300026142 Bacteria 805
631 Ga0209389_1000217 3300027296 Bacteria 39758
632 Ga0209589_1000032 3300027357 Bacteria 141881
633 Ga0209489_102214 3300027361 Bacteria 39758
634 Ga0209179_1007976 3300027512 Bacteria 1767
635 Ga0209179_1023360 3300027512 Bacteria 1220
636 Ga0209588_1080308 3300027671 Bacteria 1053
637 Ga0209971_1058728 3300027682 Bacteria 931
638 Ga0209998_10009517 3300027717 Bacteria 2017
639 Ga0209813_10001838 3300027866 Bacteria 4781
640 Ga0209813_10022222 3300027866 Bacteria 1791
641 Ga0207428_10000146 3300027907 Bacteria 95417
642 Ga0268266_10017005 3300028379 Bacteria 6213
643 Ga0268266_10018110 3300028379 Bacteria 6004
644 Ga0268266_10127264 3300028379 Bacteria 2275
645 Ga0268266_10164509 3300028379 Bacteria 2009
646 Ga0268265_10400768 3300028380 Bacteria 1268
647 Ga0268265_10500705 3300028380 Bacteria 1145
648 Ga0268264_10025170 3300028381 Bacteria 4862
649 Ga0268264_10447615 3300028381 Bacteria 1251
650 Ga0268264_12538064 3300028381 Unclassified 517
651 Ga0265334_10025268 3300028573 Bacteria 2405
652 Ga0265318_10063383 3300028577 Bacteria 1376
653 Ga0307515_10148541 3300028794 Bacteria 2465
654 Ga0265338_10037092 3300028800 Bacteria 4647
655 Ga0265328_10108204 3300031239 Bacteria 1032
656 Ga0265325_10000095 3300031241 Bacteria 62028
657 Ga0265325_10011620 3300031241 Bacteria 5057
658 Ga0265325_10015223 3300031241 Bacteria 4329
659 Ga0265325_10138590 3300031241 Bacteria 1159
660 Ga0265329_10207818 3300031242 Bacteria 646
661 Ga0265340_10017915 3300031247 Bacteria 3662
662 Ga0265340_10127836 3300031247 Bacteria 1167
663 Ga0265340_10226730 3300031247 Bacteria 836
664 Ga0265339_10012948 3300031249 Bacteria 5070
665 Ga0265339_10085809 3300031249 Bacteria 1657
666 Ga0265339_10274870 3300031249 Bacteria 809
667 Ga0265331_10000129 3300031250 Bacteria 99170
668 Ga0265331_10000770 3300031250 Bacteria 26753
669 Ga0265331_10001366 3300031250 Bacteria 17937
670 Ga0265331_10055392 3300031250 Bacteria 1886
671 Ga0265331_10076964 3300031250 Bacteria 1555
672 Ga0265327_10000615 3300031251 Bacteria 58807
673 Ga0265327_10000909 3300031251 Bacteria 43446
674 Ga0265316_10076030 3300031344 Bacteria 2581
675 Ga0307513_10155129 3300031456 Bacteria 2191
676 Ga0307408_100284605 3300031548 Bacteria 1378
677 Ga0265313_10005313 3300031595 Bacteria 9523
678 Ga0265313_10006252 3300031595 Bacteria 8492
679 Ga0265313_10055934 3300031595 Bacteria 1867
680 Ga0265313_10093507 3300031595 Bacteria 1345
681 Ga0307508_10007133 3300031616 Bacteria 10410
682 Ga0307508_10018417 3300031616 Bacteria 6348
683 Ga0265314_10000391 3300031711 Bacteria 59630
684 Ga0265314_10000899 3300031711 Bacteria 35324
685 Ga0265314_10002393 3300031711 Bacteria 19299
686 Ga0265314_10019998 3300031711 Bacteria 5176
687 Ga0265314_10081965 3300031711 Bacteria 2123
688 Ga0265314_10164037 3300031711 Bacteria 1349
689 Ga0265314_10185019 3300031711 Bacteria 1244
690 Ga0265314_10209199 3300031711 Bacteria 1147
691 Ga0265314_10450328 3300031711 Bacteria 686
692 Ga0265314_10500638 3300031711 Bacteria 639
693 Ga0265342_10012530 3300031712 Bacteria 5739
694 Ga0265342_10116522 3300031712 Bacteria 1507
695 Ga0265342_10154865 3300031712 Bacteria 1270
696 Ga0265342_10189352 3300031712 Bacteria 1123
697 Ga0307406_10377808 3300031901 Bacteria 1116
698 Ga0307412_11308684 3300031911 Bacteria 653
699 Ga0307416_100245455 3300032002 Bacteria 1739
700 Ga0307416_101125583 3300032002 Bacteria 890
701 Ga0307510_10089726 3300033180 Bacteria 2925
702 Ga0307510_10227823 3300033180 Bacteria 1369
703 Ga0307510_10271724 3300033180 Bacteria 1171
704 Ga0373959_0177621 3300034820 Unclassified 552
705 Ga0373926_0103450 3300035083 Bacteria 1066
706 Ga0373928_0025591 3300035084 Bacteria 1273
707 Ga0373934_0011211 3300035086 Bacteria 3374
708 Ga0373944_0058463 3300035089 Bacteria 1231
709 Ga0373952_0098256 3300035092 Bacteria 769
710 Ga0373923_0003905 3300035111 Bacteria 4863
711 Ga0373923_0058105 3300035111 Bacteria 1637
712 Ga0373923_0106329 3300035111 Bacteria 1242
713 Ga0373936_0007803 3300035113 Bacteria 4020
714 Ga0373936_0064295 3300035113 Bacteria 1503
715 Ga0373936_0080752 3300035113 Unclassified 1353
716 Ga0373939_0040977 3300035114 Bacteria 1394
717 Ga0373939_0470980 3300035114 Bacteria 532
718 Ga0373941_0078068 3300035115 Bacteria 1113
719 Ga0373945_0102059 3300035116 Bacteria 1123
720 Ga0373945_0222853 3300035116 Bacteria 789
721 Ga0373953_0022123 3300035117 Bacteria 2394
722 Ga0373953_0150440 3300035117 Unclassified 998
723 Ga0373954_0000942 3300035118 Bacteria 11339
724 Ga0373954_0058794 3300035118 Bacteria 1811
725 Ga0373954_0448345 3300035118 Bacteria 639
726 Ga0373956_0038256 3300035119 Bacteria 2122
727 Ga0373956_0105347 3300035119 Bacteria 1310
728 Ga0373956_0143651 3300035119 Bacteria 1121
729 Ga0373956_0351046 3300035119 Bacteria 703
730 Ga0373957_0005484 3300035120 Bacteria 3934
731 Ga0373957_0080442 3300035120 Bacteria 1286
732 Ga0373957_0145965 3300035120 Bacteria 969
733 Ga0373957_0155400 3300035120 Unclassified 940
734 Ga0373943_0000251 3300035170 Bacteria 21974
735 Ga0373943_0024783 3300035170 Bacteria 2800
736 Ga0373943_0083785 3300035170 Bacteria 1639
737 Ga0373946_0001454 3300035171 Bacteria 8240
738 Ga0373946_0001560 3300035171 Bacteria 7979
739 Ga0373946_0117312 3300035171 Bacteria 1211
740 Ga0373946_0598721 3300035171 Bacteria 571
741 Ga0373955_0000243 3300035172 Bacteria 22516
742 Ga0373955_0061464 3300035172 Bacteria 2075
743 Ga0373955_0061807 3300035172 Bacteria 2069
744 Ga0373955_0234140 3300035172 Unclassified 1099
745 Ga0373955_0242863 3300035172 Bacteria 1079
746 Ga0373955_0537411 3300035172 Bacteria 715
747 Ga0373942_0058271 3300035207 Bacteria 1101
748 Ga0373961_0004259 3300035241 Bacteria 3470
749 Ga0373962_0080260 3300035242 Unclassified 989
750 Ga0373924_0001309 3300035410 Bacteria 7997
751 Ga0373924_0066470 3300035410 Bacteria 1516
752 Ga0373931_0736273 3300035691 Bacteria 653
753 Ga0373935_0000143 3300035692 Bacteria 32670
754 Ga0373935_0017600 3300035692 Bacteria 4339
755 Ga0373935_0255029 3300035692 Bacteria 1228
756 Ga0373935_0553990 3300035692 Bacteria 838
757 Ga0373935_1067187 3300035692 Bacteria 601
758 Ga0373927_0013285 3300035695 Bacteria 5474
759 Ga0373927_0056156 3300035695 Bacteria 2545
760 Ga0373933_0001562 3300035724 Bacteria 13410
761 Ga0373933_0002062 3300035724 Bacteria 11545
762 Ga0373933_0074778 3300035724 Bacteria 2067
763 Ga0373933_0369860 3300035724 Bacteria 933
764 Ga0373933_1095965 3300035724 Bacteria 525
765 Ga0373947_0000626 3300035725 Bacteria 20918
766 Ga0373947_0130262 3300035725 Bacteria 1605
767 Ga0373947_0135519 3300035725 Bacteria 1575
768 Ga0373947_0295966 3300035725 Bacteria 1078
769 Ga0373947_0619699 3300035725 Bacteria 737
770 Ga0373937_0000081 3300036401 Bacteria 88009
771 Ga0373937_0008826 3300036401 Bacteria 8745
772 Ga0373937_0044736 3300036401 Bacteria 4044
773 Ga0373937_0150438 3300036401 Bacteria 2180
774 Ga0373937_0367139 3300036401 Bacteria 1365
775 Ga0373937_0596487 3300036401 Bacteria 1049
776 Ga0373925_0000285 3300037068 Bacteria 53117
777 Ga0373925_0029488 3300037068 Bacteria 4026
778 Ga0373925_0206208 3300037068 Bacteria 1565
779 Ga0373925_0236977 3300037068 Bacteria 1460
780 Ga0373925_0302031 3300037068 Bacteria 1292
781 Ga0373925_1173245 3300037068 Bacteria 631
782 Ga0395899_0031737 3300037312 Bacteria 3969
783 Ga0395900_0025602 3300037418 Bacteria 6039
784 Ga0395898_0024245 3300037466 Bacteria 6119
785 Ga0395905_0404457 3300037471 Bacteria 1260
786 Ga0436364_0216902 3300037853 Bacteria 1017
787 Ga0436364_0537761 3300037853 Bacteria 2725
788 Ga0436364_0860419 3300037853 Bacteria 1603
789 Ga0436364_1051300 3300037853 Bacteria 800
790 Ga0395901_0007803 3300038443 Bacteria 10799
791 Ga0395901_0029774 3300038443 Bacteria 5623
792 Ga0395901_0164337 3300038443 Bacteria 2331
793 Ga0436365_0439594 3300039437 Bacteria 58263
794 Ga0436365_1023570 3300039437 Bacteria 3499
795 Ga0436365_1038179 3300039437 Bacteria 17296
796 Ga0436365_1219382 3300039437 Bacteria 988
797 Ga0436365_1263318 3300039437 Bacteria 1166
798 Ga0436360_1030632 3300039438 Bacteria 685
799 Ga0436360_1263396 3300039438 Bacteria 871
800 Ga0436363_1220864 3300039450 Bacteria 9316
801 Ga0436363_1603453 3300039450 Bacteria 616
802 Ga0436362_0129899 3300039453 Bacteria 1258
803 Ga0436362_1152292 3300039453 Bacteria 658
804 Ga0439438_071152 3300041405 Bacteria 861
805 Ga0439465_0261438 3300041413 Bacteria 642
806 Ga0439465_0267110 3300041413 Bacteria 635
807 Ga0451800_0192145 3300041459 Bacteria 579
808 Ga0451849_0065596 3300041505 Bacteria 805
809 Ga0450894_000932 3300042131 Bacteria 4613
810 Ga0450894_022336 3300042131 Bacteria 857
811 Ga0450895_003928 3300042132 Bacteria 1161
812 Ga0450896_003419 3300042133 Bacteria 2108
813 Ga0450899_033975 3300042135 Bacteria 626
814 Ga0450908_023140 3300042184 Bacteria 1088
815 Ga0450918_000788 3300042531 Bacteria 6669
816 Ga0466966_0263758 3300044684 Bacteria 1037
817 Ga0466966_0891849 3300044684 Bacteria 536
818 Ga0466963_0226279 3300044694 Bacteria 1310
819 Ga0466963_0256732 3300044694 Bacteria 1227
820 Ga0466963_0303217 3300044694 Bacteria 1124
821 Ga0466963_0462849 3300044694 Bacteria 895
822 Ga0453684_0277944 3300044712 Bacteria 1911
823 Ga0466957_0156359 3300044842 Bacteria 1478
824 Ga0466959_0132621 3300045049 Bacteria 1765
825 Ga0466967_0142813 3300045976 Bacteria 2231
826 Ga0466967_1243417 3300045976 Bacteria 742
827 Ga0466967_1585878 3300045976 Bacteria 652
828 Ga0495592_0000107 3300046454 Bacteria 74318
829 Ga0495603_0012117 3300046455 Bacteria 5222
830 Ga0495603_0065557 3300046455 Bacteria 2141
831 Ga0495629_0009664 3300046459 Bacteria 7045
832 Ga0495629_0051907 3300046459 Bacteria 2869
833 Ga0495629_0108411 3300046459 Bacteria 1937
834 Ga0495629_0177528 3300046459 Bacteria 1477
835 Ga0495651_0000331 3300046462 Bacteria 36765
836 Ga0495651_0118928 3300046462 Bacteria 1944
837 Ga0495651_0224153 3300046462 Bacteria 1299
838 Ga0495651_0280476 3300046462 Bacteria 1126
839 Ga0495653_0000054 3300046463 Bacteria 102885
840 Ga0495653_0087729 3300046463 Bacteria 2284
841 Ga0495653_0700445 3300046463 Bacteria 615
842 Ga0495580_0069682 3300046472 Bacteria 2457
843 Ga0495580_0255181 3300046472 Bacteria 1200
844 Ga0495580_1024059 3300046472 Unclassified 525
845 Ga0495582_0032869 3300046473 Bacteria 2851
846 Ga0495582_0073171 3300046473 Bacteria 1897
847 Ga0495582_0104623 3300046473 Bacteria 1587
848 Ga0495582_0187134 3300046473 Bacteria 1180
849 Ga0495582_0313061 3300046473 Bacteria 903
850 Ga0495582_0758342 3300046473 Bacteria 561
851 Ga0495605_0175691 3300046474 Bacteria 944
852 Ga0495605_0204991 3300046474 Bacteria 858
853 Ga0495639_0051621 3300046475 Bacteria 1870
854 Ga0495639_0279396 3300046475 Unclassified 830
855 Ga0495662_0001433 3300046476 Bacteria 11807
856 Ga0495662_0168524 3300046476 Bacteria 1079
857 Ga0495662_0219360 3300046476 Bacteria 937
858 Ga0495664_0000020 3300046477 Bacteria 150749
859 Ga0495664_0012358 3300046477 Bacteria 4834
860 Ga0495664_0185946 3300046477 Bacteria 1259
861 Ga0495664_0304617 3300046477 Bacteria 962
862 Ga0495664_0778116 3300046477 Bacteria 563
863 Ga0495584_0180161 3300046491 Bacteria 1074
864 Ga0495584_0226186 3300046491 Bacteria 951
865 Ga0495584_0612516 3300046491 Bacteria 555
866 Ga0495594_0178295 3300046499 Bacteria 1209
867 Ga0495606_0361997 3300046507 Bacteria 766
868 Ga0495608_0000024 3300046511 Bacteria 159429
869 Ga0495608_0023056 3300046511 Bacteria 4268
870 Ga0495610_0018235 3300046512 Bacteria 3971
871 Ga0495610_0039434 3300046512 Bacteria 2388
872 Ga0495616_0050929 3300046513 Bacteria 2068
873 Ga0495618_0000020 3300046514 Bacteria 130661
874 Ga0495618_0129968 3300046514 Bacteria 1611
875 Ga0495618_0230688 3300046514 Bacteria 1166
876 Ga0495618_0280178 3300046514 Bacteria 1040
877 Ga0495620_0038859 3300046515 Bacteria 2109
878 Ga0495628_0000015 3300046516 Bacteria 198912
879 Ga0495628_0089853 3300046516 Bacteria 2378
880 Ga0495630_0011812 3300046517 Bacteria 6329
881 Ga0495630_0253097 3300046517 Unclassified 1346
882 Ga0495630_0273173 3300046517 Bacteria 1291
883 Ga0495632_0314865 3300046519 Bacteria 692
884 Ga0495643_0006363 3300046522 Bacteria 7798
885 Ga0495648_0034896 3300046524 Bacteria 3267
886 Ga0495666_0204366 3300046526 Bacteria 907
887 Ga0495642_0177132 3300046528 Bacteria 927
888 Ga0495652_0000006 3300046529 Bacteria 459709
889 Ga0495652_0067731 3300046529 Bacteria 2992
890 Ga0495652_0216457 3300046529 Bacteria 1442
891 Ga0495652_0563479 3300046529 Bacteria 782
892 Ga0495640_0000002 3300046533 Bacteria 646434
893 Ga0495640_0013118 3300046533 Bacteria 6307
894 Ga0495640_0152815 3300046533 Bacteria 1482
895 Ga0495586_0026231 3300046535 Bacteria 3118
896 Ga0495586_0374985 3300046535 Bacteria 818
897 Ga0495587_0000001 3300046536 Bacteria 724132
898 Ga0495587_0193020 3300046536 Bacteria 1153
899 Ga0495587_0272974 3300046536 Bacteria 948
900 Ga0495645_0000013 3300046543 Bacteria 186399
901 Ga0495645_0010183 3300046543 Bacteria 6587
902 Ga0495645_0116921 3300046543 Bacteria 1882
903 Ga0495645_0191498 3300046543 Unclassified 1393
904 Ga0495645_0224994 3300046543 Bacteria 1260
905 Ga0495667_0000030 3300046559 Bacteria 147898
906 Ga0495667_0012257 3300046559 Bacteria 5811
907 Ga0495667_0150764 3300046559 Bacteria 1497
908 Ga0495668_0043116 3300046616 Bacteria 2510
909 Ga0495634_0000264 3300046642 Bacteria 49608
910 Ga0495634_0073894 3300046642 Bacteria 2241
911 Ga0495625_0200297 3300046660 Bacteria 1318
912 Ga0495635_0000001 3300046663 Bacteria 704901
913 Ga0495635_0037699 3300046663 Bacteria 3346
914 Ga0495635_0127476 3300046663 Bacteria 1735
915 Ga0495635_0473870 3300046663 Bacteria 826
916 Ga0495588_0073678 3300046674 Bacteria 1778
917 Ga0495657_0000028 3300046675 Bacteria 131008
918 Ga0495657_0025226 3300046675 Bacteria 4225
919 Ga0495599_0000056 3300046678 Bacteria 76761
920 Ga0495599_0098063 3300046678 Bacteria 1827
921 Ga0495599_0732596 3300046678 Bacteria 568
922 Ga0495623_0023321 3300046679 Bacteria 3994
923 Ga0495623_0091908 3300046679 Bacteria 1861
924 Ga0495646_0000003 3300046680 Bacteria 287773
925 Ga0495646_0386544 3300046680 Bacteria 729
926 Ga0495647_0046028 3300046681 Bacteria 1679
927 Ga0495647_0105542 3300046681 Bacteria 1170
928 Ga0495658_0010673 3300046683 Bacteria 4600
929 Ga0495658_0073111 3300046683 Bacteria 1995
930 Ga0495658_0226541 3300046683 Bacteria 1171
931 Ga0495669_0000007 3300046684 Bacteria 180797
932 Ga0495669_0232900 3300046684 Bacteria 884
933 Ga0495613_0055103 3300046689 Bacteria 2922
934 Ga0495613_0213007 3300046689 Bacteria 1358
935 Ga0495613_0832531 3300046689 Bacteria 601
936 Ga0495624_0141206 3300046690 Bacteria 1475
937 Ga0495624_0213039 3300046690 Bacteria 1171
938 Ga0495624_0484268 3300046690 Unclassified 740
939 Ga0495670_0188068 3300046691 Bacteria 1092
940 Ga0495671_0435133 3300046692 Bacteria 627
941 Ga0495649_0107431 3300046694 Bacteria 1481
942 Ga0495649_0213025 3300046694 Bacteria 1001
943 Ga0495649_0231722 3300046694 Bacteria 953
944 Ga0495600_0000002 3300046809 Bacteria 186597
945 Ga0495600_0135825 3300046809 Bacteria 1598
946 Ga0495600_0264381 3300046809 Bacteria 1092
947 Ga0495600_0309178 3300046809 Bacteria 996
948 Ga0495600_0441210 3300046809 Unclassified 806
949 Ga0495581_0118644 3300047315 Bacteria 1539
950 Ga0495604_0000001 3300047317 Bacteria 708627
951 Ga0495604_0036462 3300047317 Bacteria 3877
952 Ga0495674_0000018 3300047319 Bacteria 204024
953 Ga0495674_0011191 3300047319 Bacteria 8472
954 Ga0495674_0103957 3300047319 Bacteria 2415
955 Ga0495674_0182711 3300047319 Bacteria 1746
956 Ga0495672_0288509 3300047320 Bacteria 782
957 Ga0495676_0868794 3300047321 Bacteria 579
958 Ga0495680_0000628 3300047322 Bacteria 39637
959 Ga0495680_0028341 3300047322 Bacteria 4593
960 Ga0495680_0061929 3300047322 Bacteria 2877
961 Ga0495683_0022855 3300047323 Bacteria 3215
962 Ga0495687_004768 3300047443 Bacteria 8959
963 Ga0495675_0000430 3300047444 Bacteria 28082
964 Ga0495675_0043885 3300047444 Bacteria 2847
965 Ga0495675_0087398 3300047444 Bacteria 1959
966 Ga0495677_0083549 3300047445 Bacteria 1199
967 Ga0495673_0062575 3300047469 Bacteria 1589
968 Ga0495673_0240902 3300047469 Bacteria 663
969 Ga0495684_0000010 3300047471 Bacteria 198915
970 Ga0495684_0157119 3300047471 Bacteria 1698
971 Ga0495684_0297743 3300047471 Bacteria 1159
972 Ga0495593_0000335 3300047673 Bacteria 26108
973 Ga0495602_0000016 3300048088 Bacteria 190311
974 Ga0495602_0110959 3300048088 Bacteria 2228
975 Ga0495602_0217636 3300048088 Unclassified 1444
976 Ga0495602_0523221 3300048088 Bacteria 826
977 Ga0495614_0054775 3300048089 Bacteria 1711
978 Ga0495626_0135425 3300048091 Bacteria 1048
979 Ga0496100_0034206 3300048903 Bacteria 3187
980 Ga0496100_0134171 3300048903 Bacteria 1747
981 Ga0496100_0208083 3300048903 Bacteria 1429
982 Ga0496101_0093800 3300048904 Bacteria 2236
983 Ga0496101_0108062 3300048904 Bacteria 2091
984 Ga0496101_0181218 3300048904 Bacteria 1622
985 Ga0496101_0269757 3300048904 Bacteria 1328
986 Ga0496101_0299168 3300048904 Bacteria 1260
987 Ga0496102_0188309 3300048905 Bacteria 1945
988 Ga0496102_0315321 3300048905 Unclassified 1473
989 Ga0496102_0328140 3300048905 Bacteria 1441
990 Ga0496102_0846480 3300048905 Bacteria 837
991 Ga0496103_0007828 3300048906 Bacteria 6350
992 Ga0496103_0020702 3300048906 Bacteria 3954
993 Ga0496103_0168044 3300048906 Bacteria 1408
994 Ga0496103_0198936 3300048906 Bacteria 1289
995 Ga0496104_0001340 3300048907 Bacteria 21306
996 Ga0496104_0022668 3300048907 Bacteria 5769
997 Ga0496104_0048030 3300048907 Bacteria 4025
998 Ga0496104_0082268 3300048907 Bacteria 3070
999 Ga0496104_0375782 3300048907 Bacteria 1334
1000 Ga0496104_0541748 3300048907 Bacteria 1075
1001 Ga0496104_1554370 3300048907 Bacteria 564
1002 Ga0496105_0012459 3300048908 Bacteria 6733
1003 Ga0496105_0016192 3300048908 Bacteria 5948
1004 Ga0496105_0581734 3300048908 Unclassified 871
1005 Ga0496106_0154378 3300048909 Bacteria 1812
1006 Ga0496106_0169919 3300048909 Bacteria 1728
1007 Ga0496106_0179742 3300048909 Bacteria 1679
1008 Ga0496106_0371539 3300048909 Bacteria 1149
1009 Ga0496107_0050110 3300048910 Bacteria 3009
1010 Ga0496107_0051084 3300048910 Bacteria 2981
1011 Ga0496107_0101040 3300048910 Bacteria 2115
1012 Ga0496107_0126785 3300048910 Bacteria 1883
1013 Ga0496108_0002266 3300048911 Bacteria 15414
1014 Ga0496108_0140902 3300048911 Bacteria 2077
1015 Ga0496108_0148122 3300048911 Bacteria 2025
1016 Ga0496109_0022509 3300048912 Bacteria 5583
1017 Ga0496109_0061610 3300048912 Bacteria 3430
1018 Ga0496109_0082627 3300048912 Bacteria 2961
1019 Ga0496109_0108139 3300048912 Bacteria 2584
1020 Ga0496109_0355023 3300048912 Bacteria 1385
1021 Ga0496110_0061347 3300048913 Bacteria 3318
1022 Ga0496110_0078450 3300048913 Bacteria 2940
1023 Ga0496110_0202187 3300048913 Bacteria 1805
1024 Ga0496111_0026356 3300048914 Bacteria 4104
1025 Ga0496111_0218775 3300048914 Bacteria 1415
1026 Ga0496111_0357190 3300048914 Bacteria 1081
1027 Ga0496112_0004145 3300048915 Bacteria 12203
1028 Ga0496112_0033618 3300048915 Bacteria 4986
1029 Ga0496112_0114347 3300048915 Bacteria 2669
1030 Ga0496112_0216430 3300048915 Bacteria 1872
1031 Ga0496112_0248497 3300048915 Bacteria 1730
1032 Ga0496112_0456088 3300048915 Bacteria 1216
1033 Ga0496112_0611394 3300048915 Bacteria 1021
1034 Ga0496112_0764980 3300048915 Bacteria 891
1035 Ga0496112_1325189 3300048915 Bacteria 635
1036 Ga0496113_0010192 3300048916 Bacteria 6204
1037 Ga0496113_0629039 3300048916 Bacteria 859
1038 Ga0496113_0647436 3300048916 Bacteria 845
1039 Ga0496114_0004610 3300048917 Bacteria 10707
1040 Ga0496115_0262704 3300048918 Bacteria 1419
1041 Ga0496115_0320198 3300048918 Bacteria 1268
1042 Ga0496115_0563632 3300048918 Bacteria 909
1043 Ga0496116_0228312 3300048919 Bacteria 946
1044 Ga0496117_0098022 3300048920 Bacteria 1865
1045 Ga0496118_0314108 3300048921 Bacteria 853
1046 Ga0496119_0028782 3300048922 Bacteria 3784
1047 Ga0496119_0145487 3300048922 Bacteria 1275
1048 Ga0496119_0272900 3300048922 Bacteria 844
1049 Ga0496121_0007191 3300048924 Bacteria 13481
1050 Ga0496121_0032236 3300048924 Bacteria 4768
1051 Ga0496121_0508116 3300048924 Bacteria 763
1052 Ga0496123_0233677 3300048926 Bacteria 918
1053 Ga0496124_0379152 3300048927 Bacteria 990
1054 Ga0496125_0019407 3300048928 Bacteria 6413
1055 Ga0496125_0071691 3300048928 Bacteria 2705
1056 Ga0496125_0144021 3300048928 Bacteria 1651
1057 Ga0496126_0044110 3300048929 Bacteria 4109
1058 Ga0496126_0543178 3300048929 Bacteria 923
1059 Ga0496126_0553678 3300048929 Bacteria 912
1060 Ga0495682_0113806 3300049460 Bacteria 969
1061 Ga0501031_0008636 3300049568 Bacteria 6624
1062 Ga0501031_0068564 3300049568 Bacteria 2311
1063 Ga0501032_0008005 3300049569 Bacteria 7703
1064 Ga0501032_0122581 3300049569 Bacteria 1718
1065 Ga0501032_0182018 3300049569 Bacteria 1375
1066 Ga0501032_0242750 3300049569 Bacteria 1170
1067 Ga0501032_0537287 3300049569 Bacteria 746
1068 Ga0501033_0007648 3300049570 Bacteria 8398
1069 Ga0501033_0034014 3300049570 Bacteria 3824
1070 Ga0501033_0138683 3300049570 Bacteria 1759
1071 Ga0501033_0492164 3300049570 Bacteria 849
1072 Ga0501033_0518555 3300049570 Bacteria 823
1073 Ga0501034_0000565 3300049571 Bacteria 58696
1074 Ga0501034_0009306 3300049571 Bacteria 10291
1075 Ga0501034_0018134 3300049571 Bacteria 7221
1076 Ga0501034_0028815 3300049571 Bacteria 5649
1077 Ga0501034_0028996 3300049571 Bacteria 5628
1078 Ga0501034_0042650 3300049571 Bacteria 4593
1079 Ga0501034_0135248 3300049571 Bacteria 2446
1080 Ga0501034_0533291 3300049571 Bacteria 1084
1081 Ga0501034_0553798 3300049571 Bacteria 1059
1082 Ga0501036_0023279 3300049572 Bacteria 5216
1083 Ga0501036_0094094 3300049572 Bacteria 2532
1084 Ga0501036_0161181 3300049572 Bacteria 1891
1085 Ga0501036_0191639 3300049572 Bacteria 1720
1086 Ga0501036_0340933 3300049572 Bacteria 1252
1087 Ga0501036_0455796 3300049572 Bacteria 1065
1088 Ga0501036_0573790 3300049572 Bacteria 937
1089 Ga0501036_0973226 3300049572 Bacteria 695
1090 Ga0501037_0002282 3300049573 Bacteria 13841
1091 Ga0501037_0002770 3300049573 Bacteria 12681
1092 Ga0501037_0063419 3300049573 Bacteria 2694
1093 Ga0501037_0111051 3300049573 Bacteria 1975
1094 Ga0501037_0202345 3300049573 Bacteria 1403
1095 Ga0501037_0925111 3300049573 Bacteria 571
1096 Ga0501038_0000096 3300049574 Bacteria 74090
1097 Ga0501038_0008207 3300049574 Bacteria 9605
1098 Ga0501038_0009120 3300049574 Bacteria 9100
1099 Ga0501038_0040756 3300049574 Bacteria 4052
1100 Ga0501038_0089589 3300049574 Bacteria 2580
1101 Ga0501038_0293587 3300049574 Bacteria 1277
1102 Ga0501038_0444646 3300049574 Bacteria 997
1103 Ga0501038_0704879 3300049574 Bacteria 756
1104 Ga0501039_0007355 3300049575 Bacteria 8393
1105 Ga0501039_0009126 3300049575 Bacteria 7557
1106 Ga0501039_0363677 3300049575 Bacteria 1137
1107 Ga0501039_0446412 3300049575 Bacteria 1016
1108 Ga0501039_1214715 3300049575 Bacteria 583
1109 Ga0501040_0243673 3300049576 Bacteria 1282
1110 Ga0501040_0618480 3300049576 Bacteria 783
1111 Ga0501041_0398103 3300049577 Bacteria 872
1112 Ga0501041_0398310 3300049577 Bacteria 872
1113 Ga0501042_0012513 3300049578 Bacteria 5750
1114 Ga0501042_0953267 3300049578 Bacteria 625
1115 Ga0501043_0008319 3300049579 Bacteria 8168
1116 Ga0501043_0010070 3300049579 Bacteria 7412
1117 Ga0501043_0016283 3300049579 Bacteria 5831
1118 Ga0501043_0024321 3300049579 Bacteria 4753
1119 Ga0501043_0028999 3300049579 Bacteria 4345
1120 Ga0501043_0070366 3300049579 Bacteria 2748
1121 Ga0501043_0584926 3300049579 Bacteria 826
1122 Ga0501046_0000346 3300049580 Bacteria 46722
1123 Ga0501046_0008546 3300049580 Bacteria 8907
1124 Ga0501046_0118436 3300049580 Bacteria 2017
1125 Ga0501046_0315325 3300049580 Bacteria 1140
1126 Ga0501046_0404094 3300049580 Bacteria 986
1127 Ga0501046_0543378 3300049580 Bacteria 829
1128 Ga0501047_0011691 3300049581 Bacteria 8299
1129 Ga0501047_0027251 3300049581 Bacteria 5503
1130 Ga0501047_0034801 3300049581 Bacteria 4863
1131 Ga0501047_0050179 3300049581 Bacteria 4029
1132 Ga0501047_0086480 3300049581 Bacteria 3012
1133 Ga0501047_0167353 3300049581 Bacteria 2068
1134 Ga0501047_0179758 3300049581 Bacteria 1982
1135 Ga0501047_0293528 3300049581 Bacteria 1469
1136 Ga0501047_0310650 3300049581 Bacteria 1417
1137 Ga0501047_0828569 3300049581 Bacteria 739
1138 Ga0501048_0004628 3300049582 Bacteria 10468
1139 Ga0501048_0007869 3300049582 Bacteria 8074
1140 Ga0501048_0820567 3300049582 Bacteria 668
1141 Ga0501067_0007035 3300049583 Bacteria 6248
1142 Ga0501067_0022035 3300049583 Bacteria 3525
1143 Ga0501067_0295047 3300049583 Bacteria 903
1144 Ga0501068_0007414 3300049584 Bacteria 6073
1145 Ga0501068_0122944 3300049584 Bacteria 1619
1146 Ga0501068_0124535 3300049584 Bacteria 1609
1147 Ga0501068_0393867 3300049584 Bacteria 893
1148 Ga0501069_0002221 3300049585 Bacteria 9786
1149 Ga0501069_0008771 3300049585 Bacteria 5324
1150 Ga0501069_0165680 3300049585 Bacteria 1274
1151 Ga0501069_0502313 3300049585 Bacteria 723
1152 Ga0501069_0658734 3300049585 Bacteria 630
1153 Ga0501070_0011443 3300049586 Bacteria 7496
1154 Ga0501070_0042918 3300049586 Bacteria 3765
1155 Ga0501070_0130455 3300049586 Bacteria 2076
1156 Ga0501070_0411665 3300049586 Bacteria 1092
1157 Ga0501070_0446783 3300049586 Bacteria 1043
1158 Ga0501070_0478065 3300049586 Bacteria 1002
1159 Ga0501070_0483560 3300049586 Bacteria 996
1160 Ga0501070_0582301 3300049586 Bacteria 893
1161 Ga0501070_0689014 3300049586 Bacteria 809
1162 Ga0501071_0006074 3300049587 Bacteria 7826
1163 Ga0501071_0046927 3300049587 Bacteria 3103
1164 Ga0501071_0261090 3300049587 Bacteria 1308
1165 Ga0501071_0647140 3300049587 Bacteria 813
1166 Ga0501072_0014303 3300049588 Bacteria 6082
1167 Ga0501072_0016491 3300049588 Bacteria 5674
1168 Ga0501072_0462003 3300049588 Bacteria 1005
1169 Ga0501072_0907192 3300049588 Bacteria 688
1170 Ga0501073_0010281 3300049589 Bacteria 6872
1171 Ga0501073_0020037 3300049589 Bacteria 4822
1172 Ga0501073_0021635 3300049589 Bacteria 4634
1173 Ga0501073_0055971 3300049589 Bacteria 2759
1174 Ga0501073_0102246 3300049589 Bacteria 1990
1175 Ga0501073_0133673 3300049589 Bacteria 1719
1176 Ga0501073_0310183 3300049589 Bacteria 1088
1177 Ga0501073_0370157 3300049589 Bacteria 990
1178 Ga0501074_0003207 3300049590 Bacteria 11539
1179 Ga0501074_0005681 3300049590 Bacteria 8985
1180 Ga0501074_0039482 3300049590 Bacteria 3419
1181 Ga0501074_0107240 3300049590 Bacteria 2000
1182 Ga0501074_0560219 3300049590 Bacteria 809
1183 Ga0501074_0905258 3300049590 Bacteria 621
1184 Ga0501075_0267240 3300049591 Bacteria 1303
1185 Ga0501075_0572403 3300049591 Unclassified 862
1186 Ga0501075_1212431 3300049591 Bacteria 572
1187 Ga0501076_0011677 3300049592 Bacteria 6557
1188 Ga0501076_0075768 3300049592 Bacteria 2697
1189 Ga0501076_0201296 3300049592 Bacteria 1626
1190 Ga0501076_0535222 3300049592 Bacteria 966
1191 Ga0501076_1030649 3300049592 Bacteria 678
1192 Ga0501077_0033010 3300049593 Bacteria 3296
1193 Ga0501077_0052284 3300049593 Bacteria 2595
1194 Ga0501077_0739472 3300049593 Bacteria 632
1195 Ga0501238_003625 3300049671 Bacteria 1904
1196 Ga0501079_0008417 3300049741 Bacteria 7819
1197 Ga0501079_0075720 3300049741 Bacteria 2603
1198 Ga0501079_0246941 3300049741 Bacteria 1395
1199 Ga0501079_0383435 3300049741 Bacteria 1102
1200 Ga0501079_0477963 3300049741 Bacteria 979
1201 Ga0501079_0902517 3300049741 Bacteria 696
1202 Ga0501079_1407031 3300049741 Bacteria 549
1203 Ga0501080_0006588 3300049742 Bacteria 10434
1204 Ga0501080_0020820 3300049742 Bacteria 6070
1205 Ga0501080_0020847 3300049742 Bacteria 6066
1206 Ga0501080_0033403 3300049742 Bacteria 4801
1207 Ga0501080_0047467 3300049742 Bacteria 3998
1208 Ga0501080_0143883 3300049742 Bacteria 2204
1209 Ga0501080_0270906 3300049742 Bacteria 1545
1210 Ga0501080_0349648 3300049742 Bacteria 1335
1211 Ga0501080_0410115 3300049742 Bacteria 1218
1212 Ga0501080_0440237 3300049742 Bacteria 1169
1213 Ga0501080_0663214 3300049742 Bacteria 922
1214 Ga0501080_1380145 3300049742 Bacteria 602
1215 Ga0501081_0127409 3300049743 Bacteria 1817
1216 Ga0501081_0236650 3300049743 Bacteria 1331
1217 Ga0501081_0299450 3300049743 Bacteria 1180
1218 Ga0501081_0452242 3300049743 Bacteria 954
1219 Ga0501083_0000008 3300049744 Bacteria 197749
1220 Ga0501083_0006112 3300049744 Bacteria 8534
1221 Ga0501083_0012059 3300049744 Bacteria 6052
1222 Ga0501083_0121548 3300049744 Bacteria 1713
1223 Ga0501083_0217461 3300049744 Bacteria 1245
1224 Ga0501083_0439733 3300049744 Bacteria 849
1225 Ga0501083_0512957 3300049744 Bacteria 780
1226 Ga0501035_0024262 3300049822 Bacteria 5562
1227 Ga0501035_0057865 3300049822 Bacteria 3455
1228 Ga0501035_0104463 3300049822 Bacteria 2484
1229 Ga0501035_0250444 3300049822 Bacteria 1504
1230 Ga0501035_0674847 3300049822 Bacteria 836
1231 Ga0501044_0000538 3300049823 Bacteria 45978
1232 Ga0501044_0011208 3300049823 Bacteria 9722
1233 Ga0501044_0012454 3300049823 Bacteria 9210
1234 Ga0501044_0020107 3300049823 Bacteria 7128
1235 Ga0501044_0027502 3300049823 Bacteria 6009
1236 Ga0501044_0038326 3300049823 Bacteria 5005
1237 Ga0501044_0044921 3300049823 Bacteria 4581
1238 Ga0501044_0059946 3300049823 Bacteria 3898
1239 Ga0501044_0065745 3300049823 Bacteria 3698
1240 Ga0501044_0103231 3300049823 Bacteria 2866
1241 Ga0501044_0175933 3300049823 Bacteria 2109
1242 Ga0501044_0305635 3300049823 Bacteria 1518
1243 Ga0501044_0409271 3300049823 Bacteria 1268
1244 Ga0501044_0824818 3300049823 Bacteria 805
1245 Ga0501045_0016996 3300049824 Bacteria 5167
1246 Ga0501045_0067713 3300049824 Bacteria 2623
1247 Ga0501045_0159487 3300049824 Bacteria 1679
1248 Ga0501045_0287193 3300049824 Bacteria 1224
1249 Ga0501045_0348242 3300049824 Bacteria 1103
1250 Ga0501045_0351384 3300049824 Bacteria 1097
1251 Ga0501045_1010056 3300049824 Bacteria 610
1252 nmdc:mga03683_44756_c1 3300050489 Bacteria 1830
1253 nmdc:mga03683_80152_c1 3300050489 Bacteria 1408
1254 nmdc:mga03683_98882_c2 3300050489 Bacteria 931
1255 nmdc:mga03n38_388604_c1 3300050490 Bacteria 766
1256 nmdc:mga03n38_632515_c1 3300050490 Bacteria 612
1257 nmdc:mga03n38_8487_c1 3300050490 Bacteria 3690
1258 nmdc:mga00v17_161904_c1 3300050491 Bacteria 1441
1259 nmdc:mga00v17_935549_c1 3300050491 Bacteria 548
1260 nmdc:mga0yw44_121327_c1 3300050492 Bacteria 1684
1261 nmdc:mga0yw44_271601_c1 3300050492 Bacteria 1132
1262 nmdc:mga0yw44_617697_c1 3300050492 Bacteria 737
1263 nmdc:mga0yw44_72587_c1 3300050492 Bacteria 2140
1264 nmdc:mga0k408_31208_c1 3300050493 Bacteria 3041
1265 nmdc:mga0k408_385063_c1 3300050493 Bacteria 835
1266 nmdc:mga0k408_917165_c1 3300050493 Bacteria 508
1267 nmdc:mga06z11_167513_c1 3300050494 Bacteria 1259
1268 nmdc:mga06z11_2801_c2 3300050494 Bacteria 5751
1269 nmdc:mga06z11_675493_c1 3300050494 Bacteria 629
1270 nmdc:mga04h51_149817_c1 3300050495 Bacteria 891
1271 nmdc:mga04h51_247393_c1 3300050495 Bacteria 714
1272 nmdc:mga04h51_26365_c1 3300050495 Bacteria 1796
1273 nmdc:mga07m45_126534_c2 3300050496 Bacteria 1134
1274 nmdc:mga07m45_23097_c1 3300050496 Bacteria 3398
1275 nmdc:mga07m45_317257_c1 3300050496 Bacteria 906
1276 nmdc:mga05p37_111_c2 3300050507 Bacteria 41438
1277 nmdc:mga05p37_3870_c1 3300050507 Bacteria 17511
1278 nmdc:mga05p37_82301_c2 3300050507 Bacteria 3100
1279 nmdc:mga09592_137_c1 3300050508 Bacteria 48140
1280 nmdc:mga09592_356382_c1 3300050508 Bacteria 1266
1281 nmdc:mga0qj67_1612_c1 3300050509 Bacteria 15868
1282 nmdc:mga06r32_269506_c1 3300050510 Bacteria 1690
1283 nmdc:mga06r32_526_c1 3300050510 Bacteria 33031
1284 nmdc:mga08y16_1030_c1 3300050511 Bacteria 27341
1285 nmdc:mga08y16_1147030_c1 3300050511 Unclassified 750
1286 nmdc:mga08y16_249015_c1 3300050511 Bacteria 1836
1287 nmdc:mga08y16_266044_c1 3300050511 Bacteria 1770
1288 nmdc:mga08y16_350528_c1 3300050511 Unclassified 1516
1289 nmdc:mga08y16_487843_c1 3300050511 Bacteria 1253
1290 nmdc:mga0n895_141436_c1 3300050512 Bacteria 2435
1291 nmdc:mga0n895_1544278_c1 3300050512 Bacteria 629
1292 nmdc:mga0n895_16023_c1 3300050512 Bacteria 6865
1293 nmdc:mga0n895_1753314_c1 3300050512 Bacteria 582
1294 nmdc:mga0n895_331_c1 3300050512 Bacteria 31576
1295 nmdc:mga0rr50_13728_c1 3300050513 Bacteria 5287
1296 nmdc:mga0rr50_549053_c1 3300050513 Bacteria 984
1297 nmdc:mga0rr50_66003_c1 3300050513 Bacteria 2743
1298 nmdc:mga0rr50_67884_c1 3300050513 Bacteria 2710
1299 nmdc:mga0rr50_97073_c1 3300050513 Bacteria 2307
1300 nmdc:mga08x19_18_c1 3300050514 Bacteria 321445
1301 nmdc:mga08x19_339581_c1 3300050514 Bacteria 1047
1302 nmdc:mga08x19_85478_c1 3300050514 Bacteria 2076
1303 nmdc:mga08x19_981834_c1 3300050514 Bacteria 600
1304 nmdc:mga0a205_50_c1 3300050515 Bacteria 64126
1305 nmdc:mga0sz30_88765_c1 3300050516 Bacteria 1343
1306 Ga0495601_0000021 3300053077 Bacteria 159355
1307 Ga0495601_0005197 3300053077 Bacteria 7566
1308 Ga0495601_0006555 3300053077 Bacteria 6810
1309 Ga0495601_0006972 3300053077 Bacteria 6617
1310 Ga0495601_0055523 3300053077 Bacteria 2508
1311 Ga0495601_0155556 3300053077 Bacteria 1493
1312 Ga0495612_0000018 3300053078 Bacteria 150870
1313 Ga0495612_0001061 3300053078 Bacteria 11253
1314 Ga0495612_0047688 3300053078 Bacteria 1755
1315 Ga0495655_0137637 3300053083 Bacteria 757
1316 Ga0495595_0000042 3300053084 Bacteria 67264
1317 Ga0495595_0004449 3300053084 Bacteria 5641
1318 Ga0495595_0011854 3300053084 Bacteria 3654
1319 Ga0495595_0017113 3300053084 Bacteria 3115
1320 Ga0495595_0299186 3300053084 Bacteria 809
1321 Ga0495619_0000006 3300053085 Bacteria 384835
1322 Ga0495619_0000206 3300053085 Bacteria 42730
1323 Ga0495619_0001055 3300053085 Bacteria 18077
1324 Ga0495619_0037097 3300053085 Bacteria 3175
1325 Ga0495619_0066605 3300053085 Bacteria 2403
1326 Ga0500578_0142787 3300053086 Bacteria 1496
1327 Ga0500646_0097108 3300053090 Bacteria 920
1328 Ga0500562_000052 3300053108 Bacteria 59070
1329 Ga0500562_118410 3300053108 Bacteria 722
1330 Ga0500592_051897 3300053116 Bacteria 667
1331 Ga0500642_0110015 3300053130 Bacteria 1286
1332 Ga0500652_000452 3300053131 Bacteria 14586
1333 Ga0500652_002435 3300053131 Bacteria 5603
1334 Ga0500616_0038141 3300053153 Bacteria 2597
1335 Ga0500616_0073666 3300053153 Bacteria 1733
1336 Ga0500634_0000032 3300053161 Bacteria 74391
1337 Ga0500634_0166399 3300053161 Bacteria 1011
1338 Ga0500552_079217 3300053733 Bacteria 601
1339 Ga0500601_008332 3300053737 Bacteria 1152
1340 Ga0501084_0020592 3300054114 Bacteria 5500
1341 Ga0501084_0025157 3300054114 Bacteria 4967
1342 Ga0501084_0226315 3300054114 Bacteria 1578
1343 Ga0501084_0297072 3300054114 Bacteria 1364
1344 Ga0501084_0324097 3300054114 Bacteria 1301
1345 Ga0501084_0564262 3300054114 Bacteria 962
1346 Ga0501084_0984193 3300054114 Bacteria 709
1347 Ga0501082_0000145 3300060353 Bacteria 58967
1348 Ga0501082_0009823 3300060353 Bacteria 8245
1349 Ga0501082_0052206 3300060353 Bacteria 3524
1350 Ga0501082_0059248 3300060353 Bacteria 3300
1351 Ga0501082_0158156 3300060353 Bacteria 1969
1352 Ga0501082_0346032 3300060353 Bacteria 1296
1353 Ga0501082_0360442 3300060353 Bacteria 1268
1354 Ga0501082_0573062 3300060353 Bacteria 988
1355 Ga0501082_0600496 3300060353 Bacteria 963
1356 Ga0501082_0673984 3300060353 Bacteria 905
1357 Ga0501082_1347216 3300060353 Bacteria 623
1358 Ga0530510_0007288 3300061734 Bacteria 7695
1359 Ga0530510_0059851 3300061734 Bacteria 2756
1360 Ga0530510_1386941 3300061734 Bacteria 539
1361 2511399406 2511231028 Bacteria 8046582
1362 2513623236 2513237092 Bacteria 8341956
1363 2513647728 2513237095 Bacteria 8976980
1364 2513699288 2513237102 Bacteria 7703324
1365 2513873676 2513237139 Bacteria 8737671
1366 2514012340 2513237161 Bacteria 8871253
1367 2517102120 2517093001 Bacteria 9002274
1368 2523468676 2523231067 Bacteria 5230452
1369 2528852480 2528768022 Bacteria 10457665
1370 2600376648 2600254933 Bacteria 4750527
1371 2617350964 2617270735 Bacteria 9163226
1372 2617373619 2617270741 Bacteria 8201522
1373 2739349828 2738543031 Bacteria 5769731
1374 2770198514 2767802442 Bacteria 5747986
1375 2774869622 2773857925 Bacteria 6472445
1376 2805915759 2802429603 Bacteria 8777136
1377 2818237517 2816332527 Bacteria 8933356
1378 2821445976 2821443989 Bacteria 7658172
1379 2824620673 2824617872 Bacteria 8814715
1380 2824629900 2824626560 Bacteria 8813858
1381 2824640556 2824635225 Bacteria 8785348
1382 2824647501 2824644064 Bacteria 8743947
1383 2824670646 2824661429 Bacteria 9877870
1384 2824683782 2824679649 Bacteria 8248951
1385 2824701020 2824696289 Bacteria 8335049
1386 2824731536 2824723954 Bacteria 8758240
1387 2824736192 2824732956 Bacteria 7810675
1388 2824751373 2824746037 Bacteria 7911610
1389 2824775658 2824773399 Bacteria 8360218
1390 2838124364 2838122688 Bacteria 8803140
1391 2841915143 2841911363 Bacteria 6173697
1392 2841922040 2841917233 Bacteria 6173500
1393 2841945057 2841941048 Bacteria 8688029
1394 2841951843 2841949485 Bacteria 8680857
1395 2841973781 2841966195 Bacteria 8673214
1396 2841980107 2841974524 Bacteria 8931498
1397 2841985290 2841983080 Bacteria 8395090
1398 2844534631 2844533157 Bacteria 7517899
1399 2847930941 2847930680 Bacteria 9342022
1400 2847941997 2847939898 Bacteria 8606328
1401 2874624652 2874620515 Bacteria 8290088
1402 2876765578 2876761206 Bacteria 10111113
1403 2879089803 2879083081 Bacteria 8587928
1404 2879108707 2879099564 Bacteria 10442239
1405 2881365812 2881364244 Bacteria 7710352
1406 2881665928 2881665667 Bacteria 8175609
1407 2882458395 2882456835 Bacteria 6863978
1408 2884301770 2884298095 Bacteria 3823049
1409 2885410531 2885409591 Bacteria 9235467
1410 2888379727 2888378607 Bacteria 9652610
1411 2888390810 2888388044 Bacteria 7304136
1412 2904670393 2904666416 Bacteria 8226587
1413 2906633424 2906626472 Bacteria 8826946
1414 2908776091 2908775508 Bacteria 8092255
1415 2922368795
1416 2922396298 2922393267 Bacteria 8285685
1417 2929618438 2929615660 Bacteria 9193770
1418 2929628877 2929624759 Bacteria 9339455
1419 2932786616 2932784394 Bacteria 9704911
1420 2932812324 2932809354 Bacteria 9135765
1421 2932823316 2932818245 Bacteria 9955613
1422 2932829844 2932828146 Bacteria 9745859
1423 2933580849 2933577622 Bacteria 9116884
1424 2935618362 2935616580 Bacteria 9032984
1425 2935641240 2935638405 Bacteria 10015038
1426 2935670156 2935665750 Bacteria 9571747
1427 2935680846 2935675223 Bacteria 9928132
1428 2935689863 2935684952 Bacteria 9590419
1429 2935698385 2935694250 Bacteria 9291695
1430 2935707528 2935703347 Bacteria 10242284
1431 2935717383 2935713505 Bacteria 9608509
1432 2935723948 2935722832 Bacteria 9608746
1433 2935740157 2935732158 Bacteria 9706831
1434 2935749420 2935741537 Bacteria 9707219
1435 2935757217 2935750917 Bacteria 9590372
1436 2935763694 2935760218 Bacteria 9817913
1437 2935804095 2935801545 Bacteria 9301974
1438 2935815179 2935810662 Bacteria 9401221
1439 2935830971 2935827899 Bacteria 10038562
1440 2935841582 2935837841 Bacteria 9454360
1441 2935862543 2935855204 Bacteria 9035059
1442 2935866529 2935864058 Bacteria 9784707
1443 2935874836 2935873716 Bacteria 9632195
1444 2935962505 2935959822 Bacteria 7869783
1445 2935994342 2935992306 Bacteria 9802711
1446 2936004680 2936002035 Bacteria 9362176
1447 2936043246 2936037263 Bacteria 9446081
1448 2937846245 2937843397 Bacteria 5256375
1449 2940563131 2940556831 Bacteria 9590747
1450 2941543048 2941538514 Bacteria 9402094
1451 3005509316 3005506211 Bacteria 6943378
1452 3005594044 3005587118 Bacteria 7794411
1453 8006930263 8006926726 Bacteria 6749210
1454 8017058306 8017057580 Bacteria 10023680
1455 8019577402 8019576017 Bacteria 10049540
1456 8019595490 8019586578 Bacteria 10212056
1457 8019606271 8019597564 Bacteria 10041141
1458 8019612260 8019608314 Bacteria 10042931
1459 8055742289 8055742211 Bacteria 9226248
1460 Ga0501079_0071434
1461 JGI24738J21930_10036415
1462 JGI25151J46595_10000672
1463 JGI25153J46596_10002958
1464 JGI25153J46596_10010245
1465 JGI25153J46596_10055504
1466 rootH1_10131172
1467 JGI25404J52841_10005557
1468 Ga0055526_1000242
1469 Ga0065707_10782720
1470 Ga0065707_10904611
1471 Ga0070658_10098641
1472 Ga0070658_10526772
1473 Ga0070683_100981220
1474 Ga0070690_100020110
1475 Ga0070690_100059637
1476 Ga0070670_100061445
1477 Ga0068869_100886695
1478 Ga0070666_10000427
1479 Ga0070666_10000567
1480 Ga0070666_10245988
1481 Ga0070666_10480075
1482 Ga0070680_100015618
1483 Ga0070680_100030550
1484 Ga0070680_100044994
1485 Ga0070680_100153996
1486 Ga0070680_100193888
1487 Ga0070680_100696725
1488 Ga0070682_100000566
1489 Ga0070682_100182236
1490 Ga0070682_100515762
1491 Ga0070682_101286701
1492 Ga0068868_100217133
1493 Ga0068868_100365685
1494 Ga0068868_101476849
1495 Ga0070660_100029124
1496 Ga0070660_100046559
1497 Ga0070660_100093976
1498 Ga0070660_100194309
1499 Ga0070660_101433024
1500 Ga0070689_100007812
1501 Ga0070689_100040488
1502 Ga0070689_100439576
1503 Ga0070691_10152839
1504 Ga0070687_100132948
1505 Ga0070687_100443475
1506 Ga0070687_101033922
1507 Ga0070661_100004323
1508 Ga0070661_100017626
1509 Ga0070661_100054574
1510 Ga0070661_100234568
1511 Ga0070661_100358170
1512 Ga0070661_101059665
1513 Ga0070668_100040477
1514 Ga0070668_100050793
1515 Ga0070668_100058223
1516 Ga0070668_100059275
1517 Ga0070669_101279258
1518 Ga0070675_100080365
1519 Ga0070675_100197144
1520 Ga0070675_100416774
1521 Ga0070671_100001825
1522 Ga0070671_100007171
1523 Ga0070671_100699533
1524 Ga0070674_100000514
1525 Ga0070674_100049648
1526 Ga0070673_100126656
1527 Ga0070688_100156993
1528 Ga0070659_100030507
1529 Ga0070659_100041927
1530 Ga0070659_100297498
1531 Ga0070659_100471298
1532 Ga0070659_101078646
1533 Ga0070667_100143072
1534 Ga0070667_101271617
1535 Ga0070703_10278016
1536 Ga0070709_10048529
1537 Ga0070709_10056754
1538 Ga0070709_10147938
1539 Ga0070714_100020675
1540 Ga0070714_100063509
1541 Ga0070714_100092690
1542 Ga0070714_100195101
1543 Ga0070714_100322508
1544 Ga0070714_100634996
1545 Ga0070713_100612680
1546 Ga0070713_100668837
1547 Ga0070713_100879509
1548 Ga0070713_101285827
1549 Ga0070710_10146699
1550 Ga0070710_10237772
1551 Ga0070710_10505562
1552 Ga0070710_10900511
1553 Ga0070711_100010787
1554 Ga0070711_100130906
1555 Ga0070711_100422608
1556 Ga0070711_100450785
1557 Ga0070711_100659423
1558 Ga0070711_100681415
1559 Ga0070711_101871128
1560 Ga0070705_100040425
1561 Ga0070705_100570284
1562 Ga0070694_100307162
1563 Ga0070694_100979855
1564 Ga0070708_100195621
1565 Ga0070663_100052113
1566 Ga0070663_100057957
1567 Ga0070663_100096836
1568 Ga0070663_101087590
1569 Ga0070678_100007656
1570 Ga0070678_100353111
1571 Ga0070662_100125116
1572 Ga0070662_100135141
1573 Ga0070662_100159207
1574 Ga0070662_100643089
1575 Ga0070662_100665282
1576 Ga0070662_100730396
1577 Ga0070681_10001010
1578 Ga0070681_10026663
1579 Ga0070681_10199077
1580 Ga0070681_10204214
1581 Ga0070681_10213879
1582 Ga0070681_10713904
1583 Ga0070681_10714249
1584 Ga0070681_11220321
1585 Ga0068867_100927980
1586 Ga0070685_10198636
1587 Ga0070685_10253702
1588 Ga0070706_100080593
1589 Ga0070707_100202890
1590 Ga0070707_100409651
1591 Ga0070698_100007707
1592 Ga0070698_101035554
1593 Ga0070699_100003726
1594 Ga0070699_100563500
1595 Ga0070679_100004669
1596 Ga0070679_100009814
1597 Ga0070679_100031168
1598 Ga0070679_100119253
1599 Ga0070679_100154394
1600 Ga0070679_100253863
1601 Ga0070679_100340918
1602 Ga0070679_100895030
1603 Ga0070684_100228615
1604 Ga0070697_100001362
1605 Ga0070697_100752344
1606 Ga0068853_100000543
1607 Ga0068853_100013377
1608 Ga0068853_100076877
1609 Ga0068853_100146617
1610 Ga0068853_100893927
1611 Ga0070672_100308279
1612 Ga0070672_100621512
1613 Ga0070686_100003363
1614 Ga0070686_101178486
1615 Ga0070695_100023948
1616 Ga0070695_100255834
1617 Ga0070696_100019455
1618 Ga0070696_100341772
1619 Ga0070696_100676865
1620 Ga0070693_100018605
1621 Ga0070693_100025551
1622 Ga0070693_100330805
1623 Ga0070693_100421577
1624 Ga0070693_100688445
1625 Ga0070665_100040141
1626 Ga0070665_100054503
1627 Ga0070665_100638343
1628 Ga0070665_100962053
1629 Ga0070704_100007544
1630 Ga0070704_100164635
1631 Ga0070704_101559596
1632 Ga0068855_100021259
1633 Ga0068855_100080314
1634 Ga0068855_100116359
1635 Ga0068855_100138421
1636 Ga0068855_100163742
1637 Ga0068855_100199467
1638 Ga0068855_100251629
1639 Ga0068855_100513304
1640 Ga0068855_100529368
1641 Ga0070664_100197992
1642 Ga0068857_100002988
1643 Ga0068857_100146925
1644 Ga0068857_100315094
1645 Ga0068857_100793236
1646 Ga0068854_100023530
1647 Ga0068854_100096434
1648 Ga0068856_100004408
1649 Ga0068856_100030605
1650 Ga0068856_100079823
1651 Ga0068856_100145504
1652 Ga0068856_100147233
1653 Ga0068856_100919459
1654 Ga0068856_101149126
1655 Ga0068856_101400174
1656 Ga0068852_100029027
1657 Ga0068852_100049845
1658 Ga0068852_100053455
1659 Ga0068852_100102394
1660 Ga0068852_100144959
1661 Ga0068852_100522725
1662 Ga0068852_100631091
1663 Ga0068859_100071633
1664 Ga0068859_100364638
1665 Ga0068859_100396387
1666 Ga0068859_100569320
1667 Ga0068859_100740472
1668 Ga0068859_100775941
1669 Ga0068866_10181410
1670 Ga0068866_10621773
1671 Ga0068861_100145993
1672 Ga0068861_100463220
1673 Ga0068861_100538940
1674 Ga0068851_10001949
1675 Ga0068851_10085393
1676 Ga0068870_10474519
1677 Ga0068863_100321222
1678 Ga0068858_100041503
1679 Ga0068858_100056156
1680 Ga0068858_100338486
1681 Ga0068858_101008921
1682 Ga0068860_100043881
1683 Ga0068860_100297942
1684 Ga0068860_100491272
1685 Ga0068860_100536397
1686 Ga0068860_101038605
1687 Ga0068862_101113548
1688 Ga0068862_101272267
1689 Ga0068862_101868830
1690 Ga0081455_10036141
1691 Ga0081455_10109224
1692 Ga0081455_10256396
1693 Ga0081455_10477406
1694 Ga0081538_10012021
1695 Ga0081540_1000038
1696 Ga0081540_1012758
1697 Ga0081540_1015430
1698 Ga0081540_1035483
1699 Ga0081540_1056340
1700 Ga0070717_10037644
1701 Ga0070717_10051046
1702 Ga0070717_10090531
1703 Ga0070717_10523349
1704 Ga0070717_10812500
1705 Ga0070717_11410383
1706 Ga0075365_10026857
1707 Ga0075365_10063627
1708 Ga0075365_10065825
1709 Ga0075365_10137355
1710 Ga0075368_10019526
1711 Ga0075368_10042005
1712 Ga0075368_10105341
1713 Ga0075432_10000166
1714 Ga0070715_10048556
1715 Ga0070716_100122565
1716 Ga0070716_100248980
1717 Ga0070716_100295883
1718 Ga0070716_101061176
1719 Ga0070712_100001297
1720 Ga0070712_100037305
1721 Ga0070712_100084520
1722 Ga0070712_100161490
1723 Ga0070712_100264142
1724 Ga0070712_100584919
1725 Ga0075362_10009261
1726 Ga0075362_10395832
1727 Ga0075367_10056691
1728 Ga0075367_10072065
1729 Ga0075367_10285315
1730 Ga0075369_10050225
1731 Ga0075369_10105788
1732 Ga0075369_10154980
1733 Ga0075369_10203664
1734 Ga0075427_10001991
1735 Ga0075366_10079338
1736 Ga0075366_10418832
1737 Ga0075366_10502546
1738 Ga0097621_100079011
1739 Ga0097621_100110848
1740 Ga0075370_10016199
1741 Ga0075370_10046241
1742 Ga0075428_100001888
1743 Ga0075428_100955280
1744 Ga0075428_101872298
1745 Ga0075430_100000129
1746 Ga0075430_100195286
1747 Ga0075431_100000948
1748 Ga0075431_100358764
1749 Ga0075433_10000100
1750 Ga0075434_100001229
1751 Ga0075434_100029045
1752 Ga0075434_100072578
1753 Ga0075434_100632412
1754 Ga0075429_100000278
1755 Ga0075429_100293227
1756 Ga0068865_100991629
1757 Ga0075436_100058342
1758 Ga0075436_100082766
1759 Ga0075436_100254919
1760 Ga0075436_100331970
1761 Ga0075436_100851347
1762 Ga0097620_100071633
1763 Ga0097620_100364630
1764 Ga0097620_100396360
1765 Ga0097620_100569356
1766 Ga0097620_100740473
1767 Ga0097620_100775966
1768 Ga0097620_101836044
1769 Ga0099824_1013934
1770 Ga0099822_1064350
1771 Ga0075435_100017187
1772 Ga0075435_100045435
1773 Ga0075435_100046079
1774 Ga0075435_100254917
1775 Ga0075435_100568898
1776 Ga0075435_101307811
1777 Ga0099794_10040343
1778 Ga0099795_10017377
1779 Ga0099795_10074430
1780 Ga0105240_10115106
1781 Ga0105240_10127337
1782 Ga0105240_10237186
1783 Ga0105240_10387976
1784 Ga0105240_10465532
1785 Ga0105240_10829261
1786 Ga0105240_11217584
1787 Ga0111539_10001748
1788 Ga0111539_10593087
1789 Ga0111539_11586565
1790 Ga0105245_10069786
1791 Ga0105245_10189071
1792 Ga0105245_10209074
1793 Ga0105245_10286819
1794 Ga0105245_10504493
1795 Ga0114129_10002143
1796 Ga0114129_10057915
1797 Ga0105243_10230495
1798 Ga0105243_10240816
1799 Ga0105243_10420513
1800 Ga0105243_10717939
1801 Ga0105243_12781599
1802 Ga0105241_10033096
1803 Ga0105241_10301517
1804 Ga0105241_10593000
1805 Ga0105241_10751379
1806 Ga0105241_10818770
1807 Ga0105242_10268820
1808 Ga0105248_10055367
1809 Ga0105248_10173605
1810 Ga0105248_10267301
1811 Ga0105237_10049382
1812 Ga0105237_10203047
1813 Ga0105237_10207610
1814 Ga0105237_10276860
1815 Ga0105237_10374239
1816 Ga0105237_10675639
1817 Ga0105238_10120341
1818 Ga0105238_10126420
1819 Ga0105238_10285802
1820 Ga0105238_10292085
1821 Ga0105238_10305449
1822 Ga0105249_10108769
1823 Ga0105249_10632159
1824 Ga0105033_105541
1825 Ga0099796_10046619
1826 Ga0099796_10103469
1827 Ga0105239_10029085
1828 Ga0105239_10033765
1829 Ga0105239_10161811
1830 Ga0105239_10655577
1831 Ga0105239_11655131
1832 Ga0105246_10146763
1833 Ga0105246_10381893
1834 Ga0157342_1061617
1835 Ga0157373_10064966
1836 Ga0157373_10769828
1837 Ga0157371_10111750
1838 Ga0157371_10338740
1839 Ga0157371_10354101
1840 Ga0157371_11086995
1841 Ga0157370_10076215
1842 Ga0157370_10165458
1843 Ga0157370_10185132
1844 Ga0157370_10651879
1845 Ga0157369_10073444
1846 Ga0157369_10314460
1847 Ga0157369_10580971
1848 Ga0157369_11214724
1849 Ga0157369_11228487
1850 Ga0157369_11663565
1851 Ga0157374_10136489
1852 Ga0157374_10577297
1853 Ga0157374_12376768
1854 Ga0157378_10404000
1855 Ga0163162_10070190
1856 Ga0163162_10310667
1857 Ga0157372_10017231
1858 Ga0157372_10442927
1859 Ga0157372_10996703
1860 Ga0157372_11017697
1861 Ga0157375_10081426
1862 Ga0157375_10867132
1863 Ga0163163_10056801
1864 Ga0163163_10162558
1865 Ga0163163_10584716
1866 Ga0163163_12142851
1867 Ga0157380_10157590
1868 Ga0157380_10188434
1869 Ga0157380_10215561
1870 Ga0157380_11512140
1871 Ga0157379_10101532
1872 Ga0157379_10190243
1873 Ga0157379_10743915
1874 Ga0157376_11089811
1875 Ga0163161_10321014
1876 Ga0206356_11838946
1877 Ga0206352_10997270
1878 Ga0206354_10085180
1879 Ga0206353_11856768
1880 Ga0206353_12068506
1881 Ga0214544_1000056
1882 Ga0214542_1000071
1883 Ga0214545_1000033
1884 Ga0214543_1000105
1885 Ga0213876_10000257
1886 Ga0213876_10013908
1887 Ga0213876_10033347
1888 Ga0209233_1038629
1889 Ga0209673_1017880
1890 Ga0209130_1001182
1891 Ga0209025_1000636
1892 Ga0209025_1118533
1893 Ga0209564_1000043
1894 Ga0209564_1009031
1895 Ga0209758_1000634
1896 Ga0209758_1003408
1897 Ga0209758_1048174
1898 Ga0207426_1000088
1899 Ga0209257_1014909
1900 Ga0207692_10078063
1901 Ga0207692_10237854
1902 Ga0207692_10287856
1903 Ga0207692_10293496
1904 Ga0207688_10097542
1905 Ga0207688_10149266
1906 Ga0207688_10345333
1907 Ga0207680_10057620
1908 Ga0207680_10306945
1909 Ga0207647_10055372
1910 Ga0207685_10025337
1911 Ga0207685_10268886
1912 Ga0207699_10020390
1913 Ga0207699_10125758
1914 Ga0207699_10327738
1915 Ga0207705_10345597
1916 Ga0207654_10016506
1917 Ga0207654_10121122
1918 Ga0207654_10260219
1919 Ga0207654_10573183
1920 Ga0207654_11016634
1921 Ga0207707_10002294
1922 Ga0207707_10065074
1923 Ga0207707_10094957
1924 Ga0207707_10109342
1925 Ga0207707_10290012
1926 Ga0207695_10095017
1927 Ga0207695_10654217
1928 Ga0207695_10689678
1929 Ga0207695_10807574
1930 Ga0207695_11075340
1931 Ga0207671_10049984
1932 Ga0207671_11116321
1933 Ga0207693_10003011
1934 Ga0207693_10004816
1935 Ga0207693_10018001
1936 Ga0207693_10051140
1937 Ga0207693_10069716
1938 Ga0207693_10125170
1939 Ga0207693_10452571
1940 Ga0207663_10050127
1941 Ga0207663_10073084
1942 Ga0207663_10119319
1943 Ga0207663_10159942
1944 Ga0207663_10209701
1945 Ga0207663_10706925
1946 Ga0207663_10737393
1947 Ga0207660_10035495
1948 Ga0207660_10041415
1949 Ga0207660_10156408
1950 Ga0207660_10280144
1951 Ga0207660_10691899
1952 Ga0207660_10978272
1953 Ga0207662_10080927
1954 Ga0207662_10239988
1955 Ga0207662_10521743
1956 Ga0207657_10011982
1957 Ga0207657_10013583
1958 Ga0207657_10050240
1959 Ga0207657_10075353
1960 Ga0207649_10000037
1961 Ga0207649_10130703
1962 Ga0207649_10144696
1963 Ga0207652_10005368
1964 Ga0207652_10049414
1965 Ga0207652_10133158
1966 Ga0207652_10137183
1967 Ga0207652_10248208
1968 Ga0207652_10285073
1969 Ga0207652_10585443
1970 Ga0207652_11042337
1971 Ga0207652_11102517
1972 Ga0207652_11207187
1973 Ga0207646_10213598
1974 Ga0207646_10573651
1975 Ga0207646_10660045
1976 Ga0207681_11383240
1977 Ga0207694_10053425
1978 Ga0207694_10153039
1979 Ga0207694_10187113
1980 Ga0207694_10224281
1981 Ga0207694_10703475
1982 Ga0207650_10057033
1983 Ga0207650_10098186
1984 Ga0207659_10366146
1985 Ga0207659_10418878
1986 Ga0207687_10008311
1987 Ga0207687_10198907
1988 Ga0207687_10510705
1989 Ga0207700_10138888
1990 Ga0207700_10141145
1991 Ga0207700_10256654
1992 Ga0207700_10453091
1993 Ga0207700_10609934
1994 Ga0207700_11266070
1995 Ga0207664_10034755
1996 Ga0207664_10075476
1997 Ga0207664_10118736
1998 Ga0207664_10325272
1999 Ga0207664_10380638
2000 Ga0207664_10873404
2001 Ga0207664_11648760
2002 Ga0207644_10027239
2003 Ga0207644_10075274
2004 Ga0207690_10011004
2005 Ga0207690_10120400
2006 Ga0207690_10314336
2007 Ga0207690_11224134
2008 Ga0207706_10142359
2009 Ga0207706_10375777
2010 Ga0207706_10684169
2011 Ga0207706_10822448
2012 Ga0207686_10406171
2013 Ga0207709_10690455
2014 Ga0207670_10003625
2015 Ga0207670_10184432
2016 Ga0207670_10546695
2017 Ga0207669_10006197
2018 Ga0207704_10850443
2019 Ga0207704_11046278
2020 Ga0207665_10174853
2021 Ga0207665_10177441
2022 Ga0207665_10325289
2023 Ga0207665_10510885
2024 Ga0207691_10303021
2025 Ga0207711_10094448
2026 Ga0207689_10688044
2027 Ga0207661_10093866
2028 Ga0207661_10555363
2029 Ga0207679_10356402
2030 Ga0207679_10804074
2031 Ga0207667_10004998
2032 Ga0207667_10008893
2033 Ga0207667_10018467
2034 Ga0207667_10027306
2035 Ga0207667_10028917
2036 Ga0207667_10066850
2037 Ga0207667_10289341
2038 Ga0207667_10327051
2039 Ga0207667_10712457
2040 Ga0207667_10860357
2041 Ga0207667_10996323
2042 Ga0207651_10669990
2043 Ga0207668_10018472
2044 Ga0207668_10583235
2045 Ga0207640_10063686
2046 Ga0207640_10076390
2047 Ga0207658_11154552
2048 Ga0207677_11610963
2049 Ga0207703_10056902
2050 Ga0207703_10129074
2051 Ga0207639_10009672
2052 Ga0207639_10197365
2053 Ga0207639_10341609
2054 Ga0207639_10846725
2055 Ga0207678_10028473
2056 Ga0207678_10042026
2057 Ga0207678_10068916
2058 Ga0207678_10179616
2059 Ga0207702_10042240
2060 Ga0207702_10049700
2061 Ga0207702_10179869
2062 Ga0207702_10704434
2063 Ga0207702_10758366
2064 Ga0207702_10793540
2065 Ga0207702_11180438
2066 Ga0207641_10199723
2067 Ga0207641_10604207
2068 Ga0207641_11063742
2069 Ga0207648_10183269
2070 Ga0207648_10419907
2071 Ga0207648_10785185
2072 Ga0207674_10140299
2073 Ga0207674_10225628
2074 Ga0207674_10424332
2075 Ga0207674_10553962
2076 Ga0207675_100542055
2077 Ga0207675_100880694
2078 Ga0207675_100923017
2079 Ga0207683_10027851
2080 Ga0207683_10037115
2081 Ga0207683_10514776
2082 Ga0207683_10851260
2083 Ga0207698_10019486
2084 Ga0207698_10057661
2085 Ga0207698_10084844
2086 Ga0207698_10139571
2087 Ga0207698_10144391
2088 Ga0207698_11007838
2089 Ga0207698_11107348
2090 Ga0209389_1000217
2091 Ga0209589_1000032
2092 Ga0209489_102214
2093 Ga0209179_1007976
2094 Ga0209179_1023360
2095 Ga0209588_1080308
2096 Ga0209971_1058728
2097 Ga0209998_10009517
2098 Ga0209813_10001838
2099 Ga0209813_10022222
2100 Ga0207428_10000146
2101 Ga0268266_10017005
2102 Ga0268266_10018110
2103 Ga0268266_10127264
2104 Ga0268266_10164509
2105 Ga0268265_10400768
2106 Ga0268265_10500705
2107 Ga0268264_10025170
2108 Ga0268264_10447615
2109 Ga0268264_12538064
2110 Ga0265334_10025268
2111 Ga0265318_10063383
2112 Ga0307515_10148541
2113 Ga0265338_10037092
2114 Ga0265328_10108204
2115 Ga0265325_10000095
2116 Ga0265325_10011620
2117 Ga0265325_10015223
2118 Ga0265325_10138590
2119 Ga0265329_10207818
2120 Ga0265340_10017915
2121 Ga0265340_10127836
2122 Ga0265340_10226730
2123 Ga0265339_10012948
2124 Ga0265339_10085809
2125 Ga0265339_10274870
2126 Ga0265331_10000129
2127 Ga0265331_10000770
2128 Ga0265331_10001366
2129 Ga0265331_10055392
2130 Ga0265331_10076964
2131 Ga0265327_10000615
2132 Ga0265327_10000909
2133 Ga0265316_10076030
2134 Ga0307513_10155129
2135 Ga0307408_100284605
2136 Ga0265313_10005313
2137 Ga0265313_10006252
2138 Ga0265313_10055934
2139 Ga0265313_10093507
2140 Ga0307508_10007133
2141 Ga0307508_10018417
2142 Ga0265314_10000391
2143 Ga0265314_10000899
2144 Ga0265314_10002393
2145 Ga0265314_10019998
2146 Ga0265314_10081965
2147 Ga0265314_10164037
2148 Ga0265314_10185019
2149 Ga0265314_10209199
2150 Ga0265314_10450328
2151 Ga0265314_10500638
2152 Ga0265342_10012530
2153 Ga0265342_10116522
2154 Ga0265342_10154865
2155 Ga0265342_10189352
2156 Ga0307406_10377808
2157 Ga0307412_11308684
2158 Ga0307416_100245455
2159 Ga0307416_101125583
2160 Ga0307510_10089726
2161 Ga0307510_10227823
2162 Ga0307510_10271724
2163 Ga0373959_0177621
2164 Ga0373926_0103450
2165 Ga0373928_0025591
2166 Ga0373934_0011211
2167 Ga0373944_0058463
2168 Ga0373952_0098256
2169 Ga0373923_0003905
2170 Ga0373923_0058105
2171 Ga0373923_0106329
2172 Ga0373936_0007803
2173 Ga0373936_0064295
2174 Ga0373936_0080752
2175 Ga0373939_0040977
2176 Ga0373939_0470980
2177 Ga0373941_0078068
2178 Ga0373945_0102059
2179 Ga0373945_0222853
2180 Ga0373953_0022123
2181 Ga0373953_0150440
2182 Ga0373954_0000942
2183 Ga0373954_0058794
2184 Ga0373954_0448345
2185 Ga0373956_0038256
2186 Ga0373956_0105347
2187 Ga0373956_0143651
2188 Ga0373956_0351046
2189 Ga0373957_0005484
2190 Ga0373957_0080442
2191 Ga0373957_0145965
2192 Ga0373957_0155400
2193 Ga0373943_0000251
2194 Ga0373943_0024783
2195 Ga0373943_0083785
2196 Ga0373946_0001454
2197 Ga0373946_0001560
2198 Ga0373946_0117312
2199 Ga0373946_0598721
2200 Ga0373955_0000243
2201 Ga0373955_0061464
2202 Ga0373955_0061807
2203 Ga0373955_0234140
2204 Ga0373955_0242863
2205 Ga0373955_0537411
2206 Ga0373942_0058271
2207 Ga0373961_0004259
2208 Ga0373962_0080260
2209 Ga0373924_0001309
2210 Ga0373924_0066470
2211 Ga0373931_0736273
2212 Ga0373935_0000143
2213 Ga0373935_0017600
2214 Ga0373935_0255029
2215 Ga0373935_0553990
2216 Ga0373935_1067187
2217 Ga0373927_0013285
2218 Ga0373927_0056156
2219 Ga0373933_0001562
2220 Ga0373933_0002062
2221 Ga0373933_0074778
2222 Ga0373933_0369860
2223 Ga0373933_1095965
2224 Ga0373947_0000626
2225 Ga0373947_0130262
2226 Ga0373947_0135519
2227 Ga0373947_0295966
2228 Ga0373947_0619699
2229 Ga0373937_0000081
2230 Ga0373937_0008826
2231 Ga0373937_0044736
2232 Ga0373937_0150438
2233 Ga0373937_0367139
2234 Ga0373937_0596487
2235 Ga0373925_0000285
2236 Ga0373925_0029488
2237 Ga0373925_0206208
2238 Ga0373925_0236977
2239 Ga0373925_0302031
2240 Ga0373925_1173245
2241 Ga0395899_0031737
2242 Ga0395900_0025602
2243 Ga0395898_0024245
2244 Ga0395905_0404457
2245 Ga0436364_0216902
2246 Ga0436364_0537761
2247 Ga0436364_0860419
2248 Ga0436364_1051300
2249 Ga0395901_0007803
2250 Ga0395901_0029774
2251 Ga0395901_0164337
2252 Ga0436365_0439594
2253 Ga0436365_1023570
2254 Ga0436365_1038179
2255 Ga0436365_1219382
2256 Ga0436365_1263318
2257 Ga0436360_1030632
2258 Ga0436360_1263396
2259 Ga0436363_1220864
2260 Ga0436363_1603453
2261 Ga0436362_0129899
2262 Ga0436362_1152292
2263 Ga0439438_071152
2264 Ga0439465_0261438
2265 Ga0439465_0267110
2266 Ga0451800_0192145
2267 Ga0451849_0065596
2268 Ga0450894_000932
2269 Ga0450894_022336
2270 Ga0450895_003928
2271 Ga0450896_003419
2272 Ga0450899_033975
2273 Ga0450908_023140
2274 Ga0450918_000788
2275 Ga0466966_0263758
2276 Ga0466966_0891849
2277 Ga0466963_0226279
2278 Ga0466963_0256732
2279 Ga0466963_0303217
2280 Ga0466963_0462849
2281 Ga0453684_0277944
2282 Ga0466957_0156359
2283 Ga0466959_0132621
2284 Ga0466967_0142813
2285 Ga0466967_1243417
2286 Ga0466967_1585878
2287 Ga0495592_0000107
2288 Ga0495603_0012117
2289 Ga0495603_0065557
2290 Ga0495629_0009664
2291 Ga0495629_0051907
2292 Ga0495629_0108411
2293 Ga0495629_0177528
2294 Ga0495651_0000331
2295 Ga0495651_0118928
2296 Ga0495651_0224153
2297 Ga0495651_0280476
2298 Ga0495653_0000054
2299 Ga0495653_0087729
2300 Ga0495653_0700445
2301 Ga0495580_0069682
2302 Ga0495580_0255181
2303 Ga0495580_1024059
2304 Ga0495582_0032869
2305 Ga0495582_0073171
2306 Ga0495582_0104623
2307 Ga0495582_0187134
2308 Ga0495582_0313061
2309 Ga0495582_0758342
2310 Ga0495605_0175691
2311 Ga0495605_0204991
2312 Ga0495639_0051621
2313 Ga0495639_0279396
2314 Ga0495662_0001433
2315 Ga0495662_0168524
2316 Ga0495662_0219360
2317 Ga0495664_0000020
2318 Ga0495664_0012358
2319 Ga0495664_0185946
2320 Ga0495664_0304617
2321 Ga0495664_0778116
2322 Ga0495584_0180161
2323 Ga0495584_0226186
2324 Ga0495584_0612516
2325 Ga0495594_0178295
2326 Ga0495606_0361997
2327 Ga0495608_0000024
2328 Ga0495608_0023056
2329 Ga0495610_0018235
2330 Ga0495610_0039434
2331 Ga0495616_0050929
2332 Ga0495618_0000020
2333 Ga0495618_0129968
2334 Ga0495618_0230688
2335 Ga0495618_0280178
2336 Ga0495620_0038859
2337 Ga0495628_0000015
2338 Ga0495628_0089853
2339 Ga0495630_0011812
2340 Ga0495630_0253097
2341 Ga0495630_0273173
2342 Ga0495632_0314865
2343 Ga0495643_0006363
2344 Ga0495648_0034896
2345 Ga0495666_0204366
2346 Ga0495642_0177132
2347 Ga0495652_0000006
2348 Ga0495652_0067731
2349 Ga0495652_0216457
2350 Ga0495652_0563479
2351 Ga0495640_0000002
2352 Ga0495640_0013118
2353 Ga0495640_0152815
2354 Ga0495586_0026231
2355 Ga0495586_0374985
2356 Ga0495587_0000001
2357 Ga0495587_0193020
2358 Ga0495587_0272974
2359 Ga0495645_0000013
2360 Ga0495645_0010183
2361 Ga0495645_0116921
2362 Ga0495645_0191498
2363 Ga0495645_0224994
2364 Ga0495667_0000030
2365 Ga0495667_0012257
2366 Ga0495667_0150764
2367 Ga0495668_0043116
2368 Ga0495634_0000264
2369 Ga0495634_0073894
2370 Ga0495625_0200297
2371 Ga0495635_0000001
2372 Ga0495635_0037699
2373 Ga0495635_0127476
2374 Ga0495635_0473870
2375 Ga0495588_0073678
2376 Ga0495657_0000028
2377 Ga0495657_0025226
2378 Ga0495599_0000056
2379 Ga0495599_0098063
2380 Ga0495599_0732596
2381 Ga0495623_0023321
2382 Ga0495623_0091908
2383 Ga0495646_0000003
2384 Ga0495646_0386544
2385 Ga0495647_0046028
2386 Ga0495647_0105542
2387 Ga0495658_0010673
2388 Ga0495658_0073111
2389 Ga0495658_0226541
2390 Ga0495669_0000007
2391 Ga0495669_0232900
2392 Ga0495613_0055103
2393 Ga0495613_0213007
2394 Ga0495613_0832531
2395 Ga0495624_0141206
2396 Ga0495624_0213039
2397 Ga0495624_0484268
2398 Ga0495670_0188068
2399 Ga0495671_0435133
2400 Ga0495649_0107431
2401 Ga0495649_0213025
2402 Ga0495649_0231722
2403 Ga0495600_0000002
2404 Ga0495600_0135825
2405 Ga0495600_0264381
2406 Ga0495600_0309178
2407 Ga0495600_0441210
2408 Ga0495581_0118644
2409 Ga0495604_0000001
2410 Ga0495604_0036462
2411 Ga0495674_0000018
2412 Ga0495674_0011191
2413 Ga0495674_0103957
2414 Ga0495674_0182711
2415 Ga0495672_0288509
2416 Ga0495676_0868794
2417 Ga0495680_0000628
2418 Ga0495680_0028341
2419 Ga0495680_0061929
2420 Ga0495683_0022855
2421 Ga0495687_004768
2422 Ga0495675_0000430
2423 Ga0495675_0043885
2424 Ga0495675_0087398
2425 Ga0495677_0083549
2426 Ga0495673_0062575
2427 Ga0495673_0240902
2428 Ga0495684_0000010
2429 Ga0495684_0157119
2430 Ga0495684_0297743
2431 Ga0495593_0000335
2432 Ga0495602_0000016
2433 Ga0495602_0110959
2434 Ga0495602_0217636
2435 Ga0495602_0523221
2436 Ga0495614_0054775
2437 Ga0495626_0135425
2438 Ga0496100_0034206
2439 Ga0496100_0134171
2440 Ga0496100_0208083
2441 Ga0496101_0093800
2442 Ga0496101_0108062
2443 Ga0496101_0181218
2444 Ga0496101_0269757
2445 Ga0496101_0299168
2446 Ga0496102_0188309
2447 Ga0496102_0315321
2448 Ga0496102_0328140
2449 Ga0496102_0846480
2450 Ga0496103_0007828
2451 Ga0496103_0020702
2452 Ga0496103_0168044
2453 Ga0496103_0198936
2454 Ga0496104_0001340
2455 Ga0496104_0022668
2456 Ga0496104_0048030
2457 Ga0496104_0082268
2458 Ga0496104_0375782
2459 Ga0496104_0541748
2460 Ga0496104_1554370
2461 Ga0496105_0012459
2462 Ga0496105_0016192
2463 Ga0496105_0581734
2464 Ga0496106_0154378
2465 Ga0496106_0169919
2466 Ga0496106_0179742
2467 Ga0496106_0371539
2468 Ga0496107_0050110
2469 Ga0496107_0051084
2470 Ga0496107_0101040
2471 Ga0496107_0126785
2472 Ga0496108_0002266
2473 Ga0496108_0140902
2474 Ga0496108_0148122
2475 Ga0496109_0022509
2476 Ga0496109_0061610
2477 Ga0496109_0082627
2478 Ga0496109_0108139
2479 Ga0496109_0355023
2480 Ga0496110_0061347
2481 Ga0496110_0078450
2482 Ga0496110_0202187
2483 Ga0496111_0026356
2484 Ga0496111_0218775
2485 Ga0496111_0357190
2486 Ga0496112_0004145
2487 Ga0496112_0033618
2488 Ga0496112_0114347
2489 Ga0496112_0216430
2490 Ga0496112_0248497
2491 Ga0496112_0456088
2492 Ga0496112_0611394
2493 Ga0496112_0764980
2494 Ga0496112_1325189
2495 Ga0496113_0010192
2496 Ga0496113_0629039
2497 Ga0496113_0647436
2498 Ga0496114_0004610
2499 Ga0496115_0262704
2500 Ga0496115_0320198
2501 Ga0496115_0563632
2502 Ga0496116_0228312
2503 Ga0496117_0098022
2504 Ga0496118_0314108
2505 Ga0496119_0028782
2506 Ga0496119_0145487
2507 Ga0496119_0272900
2508 Ga0496121_0007191
2509 Ga0496121_0032236
2510 Ga0496121_0508116
2511 Ga0496123_0233677
2512 Ga0496124_0379152
2513 Ga0496125_0019407
2514 Ga0496125_0071691
2515 Ga0496125_0144021
2516 Ga0496126_0044110
2517 Ga0496126_0543178
2518 Ga0496126_0553678
2519 Ga0495682_0113806
2520 Ga0501031_0008636
2521 Ga0501031_0068564
2522 Ga0501032_0008005
2523 Ga0501032_0122581
2524 Ga0501032_0182018
2525 Ga0501032_0242750
2526 Ga0501032_0537287
2527 Ga0501033_0007648
2528 Ga0501033_0034014
2529 Ga0501033_0138683
2530 Ga0501033_0492164
2531 Ga0501033_0518555
2532 Ga0501034_0000565
2533 Ga0501034_0009306
2534 Ga0501034_0018134
2535 Ga0501034_0028815
2536 Ga0501034_0028996
2537 Ga0501034_0042650
2538 Ga0501034_0135248
2539 Ga0501034_0533291
2540 Ga0501034_0553798
2541 Ga0501036_0023279
2542 Ga0501036_0094094
2543 Ga0501036_0161181
2544 Ga0501036_0191639
2545 Ga0501036_0340933
2546 Ga0501036_0455796
2547 Ga0501036_0573790
2548 Ga0501036_0973226
2549 Ga0501037_0002282
2550 Ga0501037_0002770
2551 Ga0501037_0063419
2552 Ga0501037_0111051
2553 Ga0501037_0202345
2554 Ga0501037_0925111
2555 Ga0501038_0000096
2556 Ga0501038_0008207
2557 Ga0501038_0009120
2558 Ga0501038_0040756
2559 Ga0501038_0089589
2560 Ga0501038_0293587
2561 Ga0501038_0444646
2562 Ga0501038_0704879
2563 Ga0501039_0007355
2564 Ga0501039_0009126
2565 Ga0501039_0363677
2566 Ga0501039_0446412
2567 Ga0501039_1214715
2568 Ga0501040_0243673
2569 Ga0501040_0618480
2570 Ga0501041_0398103
2571 Ga0501041_0398310
2572 Ga0501042_0012513
2573 Ga0501042_0953267
2574 Ga0501043_0008319
2575 Ga0501043_0010070
2576 Ga0501043_0016283
2577 Ga0501043_0024321
2578 Ga0501043_0028999
2579 Ga0501043_0070366
2580 Ga0501043_0584926
2581 Ga0501046_0000346
2582 Ga0501046_0008546
2583 Ga0501046_0118436
2584 Ga0501046_0315325
2585 Ga0501046_0404094
2586 Ga0501046_0543378
2587 Ga0501047_0011691
2588 Ga0501047_0027251
2589 Ga0501047_0034801
2590 Ga0501047_0050179
2591 Ga0501047_0086480
2592 Ga0501047_0167353
2593 Ga0501047_0179758
2594 Ga0501047_0293528
2595 Ga0501047_0310650
2596 Ga0501047_0828569
2597 Ga0501048_0004628
2598 Ga0501048_0007869
2599 Ga0501048_0820567
2600 Ga0501067_0007035
2601 Ga0501067_0022035
2602 Ga0501067_0295047
2603 Ga0501068_0007414
2604 Ga0501068_0122944
2605 Ga0501068_0124535
2606 Ga0501068_0393867
2607 Ga0501069_0002221
2608 Ga0501069_0008771
2609 Ga0501069_0165680
2610 Ga0501069_0502313
2611 Ga0501069_0658734
2612 Ga0501070_0011443
2613 Ga0501070_0042918
2614 Ga0501070_0130455
2615 Ga0501070_0411665
2616 Ga0501070_0446783
2617 Ga0501070_0478065
2618 Ga0501070_0483560
2619 Ga0501070_0582301
2620 Ga0501070_0689014
2621 Ga0501071_0006074
2622 Ga0501071_0046927
2623 Ga0501071_0261090
2624 Ga0501071_0647140
2625 Ga0501072_0014303
2626 Ga0501072_0016491
2627 Ga0501072_0462003
2628 Ga0501072_0907192
2629 Ga0501073_0010281
2630 Ga0501073_0020037
2631 Ga0501073_0021635
2632 Ga0501073_0055971
2633 Ga0501073_0102246
2634 Ga0501073_0133673
2635 Ga0501073_0310183
2636 Ga0501073_0370157
2637 Ga0501074_0003207
2638 Ga0501074_0005681
2639 Ga0501074_0039482
2640 Ga0501074_0107240
2641 Ga0501074_0560219
2642 Ga0501074_0905258
2643 Ga0501075_0267240
2644 Ga0501075_0572403
2645 Ga0501075_1212431
2646 Ga0501076_0011677
2647 Ga0501076_0075768
2648 Ga0501076_0201296
2649 Ga0501076_0535222
2650 Ga0501076_1030649
2651 Ga0501077_0033010
2652 Ga0501077_0052284
2653 Ga0501077_0739472
2654 Ga0501238_003625
2655 Ga0501079_0008417
2656 Ga0501079_0075720
2657 Ga0501079_0246941
2658 Ga0501079_0383435
2659 Ga0501079_0477963
2660 Ga0501079_0902517
2661 Ga0501079_1407031
2662 Ga0501080_0006588
2663 Ga0501080_0020820
2664 Ga0501080_0020847
2665 Ga0501080_0033403
2666 Ga0501080_0047467
2667 Ga0501080_0143883
2668 Ga0501080_0270906
2669 Ga0501080_0349648
2670 Ga0501080_0410115
2671 Ga0501080_0440237
2672 Ga0501080_0663214
2673 Ga0501080_1380145
2674 Ga0501081_0127409
2675 Ga0501081_0236650
2676 Ga0501081_0299450
2677 Ga0501081_0452242
2678 Ga0501083_0000008
2679 Ga0501083_0006112
2680 Ga0501083_0012059
2681 Ga0501083_0121548
2682 Ga0501083_0217461
2683 Ga0501083_0439733
2684 Ga0501083_0512957
2685 Ga0501035_0024262
2686 Ga0501035_0057865
2687 Ga0501035_0104463
2688 Ga0501035_0250444
2689 Ga0501035_0674847
2690 Ga0501044_0000538
2691 Ga0501044_0011208
2692 Ga0501044_0012454
2693 Ga0501044_0020107
2694 Ga0501044_0027502
2695 Ga0501044_0038326
2696 Ga0501044_0044921
2697 Ga0501044_0059946
2698 Ga0501044_0065745
2699 Ga0501044_0103231
2700 Ga0501044_0175933
2701 Ga0501044_0305635
2702 Ga0501044_0409271
2703 Ga0501044_0824818
2704 Ga0501045_0016996
2705 Ga0501045_0067713
2706 Ga0501045_0159487
2707 Ga0501045_0287193
2708 Ga0501045_0348242
2709 Ga0501045_0351384
2710 Ga0501045_1010056
2711 nmdc:mga03683_44756_c1
2712 nmdc:mga03683_80152_c1
2713 nmdc:mga03683_98882_c2
2714 nmdc:mga03n38_388604_c1
2715 nmdc:mga03n38_632515_c1
2716 nmdc:mga03n38_8487_c1
2717 nmdc:mga00v17_161904_c1
2718 nmdc:mga00v17_935549_c1
2719 nmdc:mga0yw44_121327_c1
2720 nmdc:mga0yw44_271601_c1
2721 nmdc:mga0yw44_617697_c1
2722 nmdc:mga0yw44_72587_c1
2723 nmdc:mga0k408_31208_c1
2724 nmdc:mga0k408_385063_c1
2725 nmdc:mga0k408_917165_c1
2726 nmdc:mga06z11_167513_c1
2727 nmdc:mga06z11_2801_c2
2728 nmdc:mga06z11_675493_c1
2729 nmdc:mga04h51_149817_c1
2730 nmdc:mga04h51_247393_c1
2731 nmdc:mga04h51_26365_c1
2732 nmdc:mga07m45_126534_c2
2733 nmdc:mga07m45_23097_c1
2734 nmdc:mga07m45_317257_c1
2735 nmdc:mga05p37_111_c2
2736 nmdc:mga05p37_3870_c1
2737 nmdc:mga05p37_82301_c2
2738 nmdc:mga09592_137_c1
2739 nmdc:mga09592_356382_c1
2740 nmdc:mga0qj67_1612_c1
2741 nmdc:mga06r32_269506_c1
2742 nmdc:mga06r32_526_c1
2743 nmdc:mga08y16_1030_c1
2744 nmdc:mga08y16_1147030_c1
2745 nmdc:mga08y16_249015_c1
2746 nmdc:mga08y16_266044_c1
2747 nmdc:mga08y16_350528_c1
2748 nmdc:mga08y16_487843_c1
2749 nmdc:mga0n895_141436_c1
2750 nmdc:mga0n895_1544278_c1
2751 nmdc:mga0n895_16023_c1
2752 nmdc:mga0n895_1753314_c1
2753 nmdc:mga0n895_331_c1
2754 nmdc:mga0rr50_13728_c1
2755 nmdc:mga0rr50_549053_c1
2756 nmdc:mga0rr50_66003_c1
2757 nmdc:mga0rr50_67884_c1
2758 nmdc:mga0rr50_97073_c1
2759 nmdc:mga08x19_18_c1
2760 nmdc:mga08x19_339581_c1
2761 nmdc:mga08x19_85478_c1
2762 nmdc:mga08x19_981834_c1
2763 nmdc:mga0a205_50_c1
2764 nmdc:mga0sz30_88765_c1
2765 Ga0495601_0000021
2766 Ga0495601_0005197
2767 Ga0495601_0006555
2768 Ga0495601_0006972
2769 Ga0495601_0055523
2770 Ga0495601_0155556
2771 Ga0495612_0000018
2772 Ga0495612_0001061
2773 Ga0495612_0047688
2774 Ga0495655_0137637
2775 Ga0495595_0000042
2776 Ga0495595_0004449
2777 Ga0495595_0011854
2778 Ga0495595_0017113
2779 Ga0495595_0299186
2780 Ga0495619_0000006
2781 Ga0495619_0000206
2782 Ga0495619_0001055
2783 Ga0495619_0037097
2784 Ga0495619_0066605
2785 Ga0500578_0142787
2786 Ga0500646_0097108
2787 Ga0500562_000052
2788 Ga0500562_118410
2789 Ga0500592_051897
2790 Ga0500642_0110015
2791 Ga0500652_000452
2792 Ga0500652_002435
2793 Ga0500616_0038141
2794 Ga0500616_0073666
2795 Ga0500634_0000032
2796 Ga0500634_0166399
2797 Ga0500552_079217
2798 Ga0500601_008332
2799 Ga0501084_0020592
2800 Ga0501084_0025157
2801 Ga0501084_0226315
2802 Ga0501084_0297072
2803 Ga0501084_0324097
2804 Ga0501084_0564262
2805 Ga0501084_0984193
2806 Ga0501082_0000145
2807 Ga0501082_0009823
2808 Ga0501082_0052206
2809 Ga0501082_0059248
2810 Ga0501082_0158156
2811 Ga0501082_0346032
2812 Ga0501082_0360442
2813 Ga0501082_0573062
2814 Ga0501082_0600496
2815 Ga0501082_0673984
2816 Ga0501082_1347216
2817 Ga0530510_0007288
2818 Ga0530510_0059851
2819 Ga0530510_1386941
2820 2511399406
2821 2513623236
2822 2513647728
2823 2513699288
2824 2513873676
2825 2514012340
2826 2517102120
2827 2523468676
2828 2528852480
2829 2600376648
2830 2617350964
2831 2617373619
2832 2739349828
2833 2770198514
2834 2774869622
2835 2805915759
2836 2818237517
2837 2821445976
2838 2824620673
2839 2824629900
2840 2824640556
2841 2824647501
2842 2824670646
2843 2824683782
2844 2824701020
2845 2824731536
2846 2824736192
2847 2824751373
2848 2824775658
2849 2838124364
2850 2841915143
2851 2841922040
2852 2841945057
2853 2841951843
2854 2841973781
2855 2841980107
2856 2841985290
2857 2844534631
2858 2847930941
2859 2847941997
2860 2874624652
2861 2876765578
2862 2879089803
2863 2879108707
2864 2881365812
2865 2881665928
2866 2882458395
2867 2884301770
2868 2885410531
2869 2888379727
2870 2888390810
2871 2904670393
2872 2906633424
2873 2908776091
2874 2922368795
2875 2922396298
2876 2929618438
2877 2929628877
2878 2932786616
2879 2932812324
2880 2932823316
2881 2932829844
2882 2933580849
2883 2935618362
2884 2935641240
2885 2935670156
2886 2935680846
2887 2935689863
2888 2935698385
2889 2935707528
2890 2935717383
2891 2935723948
2892 2935740157
2893 2935749420
2894 2935757217
2895 2935763694
2896 2935804095
2897 2935815179
2898 2935830971
2899 2935841582
2900 2935862543
2901 2935866529
2902 2935874836
2903 2935962505
2904 2935994342
2905 2936004680
2906 2936043246
2907 2937846245
2908 2940563131
2909 2941543048
2910 3005509316
2911 3005594044
2912 8006930263
2913 8017058306
2914 8019577402
2915 8019595490
2916 8019606271
2917 8019612260
2918 8055742289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22769

DCD

dCTP deaminase-like

47

147

0.94

PF00692

dUTPase

dUTPase

38

172

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mbq-assembly1.cif.gz_B crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9927 5 133
7n56-assembly3.cif.gz_K crystal structure of deoxyuridine 5'-triphosphate nucleotidohydrolase from rickettsia prowazekii str. madrid e 0.9775 1 136
3mbq-assembly1.cif.gz_C crystal structure of deoxyuridine 5-triphosphate nucleotidohydrolase from brucella melitensis, orthorhombic crystal form 0.9682 3 146
3h6d-assembly1.cif.gz_A structure of the mycobacterium tuberculosis dutpase d28n mutant 0.9664 4 135
5edd-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis dutpase r140k, h145w mutant 0.9661 4 135
ID Description Score Start End Superfamily
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9781 5 136 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9616 3 136 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9544 3 136 2.70.40.10
3mbqA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9498 5 136 2.70.40.10
2p9oA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9404 5 138 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A656KD48-F1-model_v4 deleted 0.9993 31 125
AF-A0A1Q3IXS7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9937 4 136 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A357CEZ8-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9918 2 136 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A1F9ZMA5-F1-model_v4 deleted 0.9918 3 128
AF-A0A2S6THV7-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9912 3 134 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Map