F494136
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1462 | 669 | 2924 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0039383|Ga0373925_0039383_2444_3118 |
| Length | 224 |
| Sequence | MRPGRTFGTSTKTVNTENDNVTKRAESKYKIDRRLQVNLWGRPKSPYNDREYGPGQHGQRRRKPTEYGTQLMAKQRLKGYYGNIGERQFRKIYEEAARRRGDTGENLVGLLERRLDTVVYRAKFVSTVFAARQFVNHGHIRVNGKRVNVSSYQLKDNDVVELREKSRELAVVLEAVGSGERDVPGYIDADHKKMRAVFLRAPALSDVPYPVQMNPSMVVEFYSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 227 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 236 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 240 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 241 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 242 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 243 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 244 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 245 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 259 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 276 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 282 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 283 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 284 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 288 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 289 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 290 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 291 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 292 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 293 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 294 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 295 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 296 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 297 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 298 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 299 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 300 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 301 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 302 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 303 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 304 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 305 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 306 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 307 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 308 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 309 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 310 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 409 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 410 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 411 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 412 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 413 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 414 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 415 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 416 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 417 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 418 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 451 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 452 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 456 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 460 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 461 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 463 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 473 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 476 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 479 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 480 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 481 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 482 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 483 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 484 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 486 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 487 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 488 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 489 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 491 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 492 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 493 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 494 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 496 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 497 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 498 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 499 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 501 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 502 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 504 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 505 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 507 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 508 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 509 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 512 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 513 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 515 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 516 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 517 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 518 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 519 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 520 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 521 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 522 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 523 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 524 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 525 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 526 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 528 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 529 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 541 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 542 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 543 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 544 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 545 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 546 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 547 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 548 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 549 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 550 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 551 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 552 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 553 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 554 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 555 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 556 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 557 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 558 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 559 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 560 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 561 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 562 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 563 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 564 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 565 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 566 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 567 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 568 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 569 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 570 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 571 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 572 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 573 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 574 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 575 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 576 | 2791355199 | |||
| 577 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 578 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 579 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 580 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 581 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 582 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 583 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 584 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 585 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 586 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 587 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 588 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 589 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 590 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 591 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 592 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 593 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 594 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 595 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 596 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 597 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 598 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 599 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 600 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 601 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 602 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 603 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 604 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 605 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 606 | 2904699407 | |||
| 607 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 608 | 2906610324 | |||
| 609 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 610 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 611 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 612 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 613 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 614 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 615 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 616 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 617 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 618 | 2922425934 | |||
| 619 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 620 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 621 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 622 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 623 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 624 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 625 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 626 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 627 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 628 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 629 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 630 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 631 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 632 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 633 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 634 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 635 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 636 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 637 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 638 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 639 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 640 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 641 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 642 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 643 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 644 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 645 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 646 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 647 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 648 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 649 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 650 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 651 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 652 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 653 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 654 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 655 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 656 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 657 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 658 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 659 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 660 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 661 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 662 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 663 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 664 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 665 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 666 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 667 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 668 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 669 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.57 |
| Metatranscriptomes | 1.85 |
| Isolates | 8.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.15 |
| Nodule | 4.65 |
| Rhizoplane | 4.04 |
| Rhizosphere | 69.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373925_0039383 | 3300037068 | Bacteria | 3497 |
| 2 | CNBas_1004380 | 3300000531 | Bacteria | 798 |
| 3 | JGI24739J22299_10120830 | 3300001989 | Bacteria | 782 |
| 4 | JGI24735J21928_10014695 | 3300002067 | Bacteria | 2451 |
| 5 | JGI24738J21930_10071137 | 3300002075 | Bacteria | 721 |
| 6 | JGI25406J46586_10000101 | 3300003203 | Bacteria | 38086 |
| 7 | Ga0055526_1028152 | 3300003771 | Bacteria | 1709 |
| 8 | Ga0055537_1001423 | 3300003773 | Bacteria | 9378 |
| 9 | Ga0055524_1005289 | 3300003775 | Bacteria | 5795 |
| 10 | Ga0055524_1033973 | 3300003775 | Bacteria | 1418 |
| 11 | Ga0055536_1011111 | 3300003781 | Bacteria | 3496 |
| 12 | Ga0055528_1004840 | 3300003790 | Bacteria | 6399 |
| 13 | Ga0055530_10002837 | 3300003791 | Bacteria | 10598 |
| 14 | Ga0055530_10023172 | 3300003791 | Bacteria | 1790 |
| 15 | Ga0055531_10001240 | 3300003794 | Bacteria | 19383 |
| 16 | Ga0055531_10002429 | 3300003794 | Bacteria | 12473 |
| 17 | Ga0055531_10004719 | 3300003794 | Bacteria | 8152 |
| 18 | Ga0055531_10024439 | 3300003794 | Bacteria | 2229 |
| 19 | Ga0055543_1018162 | 3300004625 | Bacteria | 1315 |
| 20 | Ga0058862_12854699 | 3300004803 | Bacteria | 748 |
| 21 | Ga0065165_1000041 | 3300005262 | Bacteria | 203876 |
| 22 | Ga0065165_1000633 | 3300005262 | Bacteria | 50986 |
| 23 | Ga0065712_10253498 | 3300005290 | Bacteria | 938 |
| 24 | Ga0070658_10106345 | 3300005327 | Bacteria | 2321 |
| 25 | Ga0070658_10144361 | 3300005327 | Bacteria | 1989 |
| 26 | Ga0070658_10561700 | 3300005327 | Bacteria | 988 |
| 27 | Ga0070683_100072208 | 3300005329 | Bacteria | 3221 |
| 28 | Ga0070683_100499675 | 3300005329 | Bacteria | 1162 |
| 29 | Ga0070670_100000101 | 3300005331 | Bacteria | 79628 |
| 30 | Ga0070670_100587604 | 3300005331 | Bacteria | 996 |
| 31 | Ga0070666_10067482 | 3300005335 | Bacteria | 2429 |
| 32 | Ga0070666_10091155 | 3300005335 | Bacteria | 2094 |
| 33 | Ga0070680_100009670 | 3300005336 | Bacteria | 7417 |
| 34 | Ga0070680_100010206 | 3300005336 | Bacteria | 7240 |
| 35 | Ga0070680_100116799 | 3300005336 | Bacteria | 2224 |
| 36 | Ga0068868_100069182 | 3300005338 | Bacteria | 2813 |
| 37 | Ga0070660_100010739 | 3300005339 | Bacteria | 6482 |
| 38 | Ga0070660_100015321 | 3300005339 | Bacteria | 5533 |
| 39 | Ga0070660_100069935 | 3300005339 | Bacteria | 2738 |
| 40 | Ga0070660_100088007 | 3300005339 | Bacteria | 2445 |
| 41 | Ga0070689_100370609 | 3300005340 | Bacteria | 1205 |
| 42 | Ga0070691_10010631 | 3300005341 | Bacteria | 4202 |
| 43 | Ga0070691_10044810 | 3300005341 | Bacteria | 2098 |
| 44 | Ga0070661_100205100 | 3300005344 | Bacteria | 1508 |
| 45 | Ga0070668_100002639 | 3300005347 | Bacteria | 13171 |
| 46 | Ga0070668_100002804 | 3300005347 | Bacteria | 12824 |
| 47 | Ga0070668_100006876 | 3300005347 | Bacteria | 8431 |
| 48 | Ga0070668_100010442 | 3300005347 | Bacteria | 6900 |
| 49 | Ga0070668_100024530 | 3300005347 | Bacteria | 4570 |
| 50 | Ga0070668_100031453 | 3300005347 | Bacteria | 4038 |
| 51 | Ga0070669_100299233 | 3300005353 | Bacteria | 1293 |
| 52 | Ga0070669_100945213 | 3300005353 | Bacteria | 738 |
| 53 | Ga0070671_100010347 | 3300005355 | Bacteria | 7483 |
| 54 | Ga0070674_100082069 | 3300005356 | Bacteria | 2305 |
| 55 | Ga0070673_100294288 | 3300005364 | Bacteria | 1427 |
| 56 | Ga0070659_100007601 | 3300005366 | Bacteria | 7878 |
| 57 | Ga0070659_100105258 | 3300005366 | Bacteria | 2273 |
| 58 | Ga0070659_100118253 | 3300005366 | Bacteria | 2144 |
| 59 | Ga0070667_100000260 | 3300005367 | Bacteria | 60154 |
| 60 | Ga0070667_100061934 | 3300005367 | Bacteria | 3169 |
| 61 | Ga0070667_100415627 | 3300005367 | Bacteria | 1226 |
| 62 | Ga0070714_100010680 | 3300005435 | Bacteria | 7266 |
| 63 | Ga0070714_100027346 | 3300005435 | Bacteria | 4722 |
| 64 | Ga0070713_100014590 | 3300005436 | Bacteria | 5843 |
| 65 | Ga0070713_100183121 | 3300005436 | Bacteria | 1883 |
| 66 | Ga0070710_10008646 | 3300005437 | Bacteria | 4960 |
| 67 | Ga0070711_100022451 | 3300005439 | Bacteria | 4091 |
| 68 | Ga0070711_100072618 | 3300005439 | Bacteria | 2428 |
| 69 | Ga0070711_100342020 | 3300005439 | Bacteria | 1201 |
| 70 | Ga0070663_100033825 | 3300005455 | Bacteria | 3534 |
| 71 | Ga0070663_100702779 | 3300005455 | Bacteria | 859 |
| 72 | Ga0070678_100218620 | 3300005456 | Bacteria | 1583 |
| 73 | Ga0070662_100343500 | 3300005457 | Bacteria | 1222 |
| 74 | Ga0070681_10009749 | 3300005458 | Bacteria | 9452 |
| 75 | Ga0070681_10020222 | 3300005458 | Bacteria | 6673 |
| 76 | Ga0070681_10041919 | 3300005458 | Bacteria | 4588 |
| 77 | Ga0070681_10089343 | 3300005458 | Bacteria | 3032 |
| 78 | Ga0070681_10099566 | 3300005458 | Bacteria | 2852 |
| 79 | Ga0070681_10441312 | 3300005458 | Bacteria | 1214 |
| 80 | Ga0070681_11059156 | 3300005458 | Bacteria | 731 |
| 81 | Ga0070685_10313071 | 3300005466 | Bacteria | 1061 |
| 82 | Ga0070706_100282188 | 3300005467 | Bacteria | 1550 |
| 83 | Ga0070706_100320492 | 3300005467 | Bacteria | 1445 |
| 84 | Ga0070706_100557247 | 3300005467 | Bacteria | 1066 |
| 85 | Ga0070707_100926281 | 3300005468 | Bacteria | 836 |
| 86 | Ga0070698_100117512 | 3300005471 | Bacteria | 2621 |
| 87 | Ga0070699_100130782 | 3300005518 | Bacteria | 2212 |
| 88 | Ga0070679_100042441 | 3300005530 | Bacteria | 4529 |
| 89 | Ga0070679_100046034 | 3300005530 | Bacteria | 4347 |
| 90 | Ga0070679_100215694 | 3300005530 | Bacteria | 1881 |
| 91 | Ga0070679_100267662 | 3300005530 | Bacteria | 1664 |
| 92 | Ga0070684_100067429 | 3300005535 | Bacteria | 3143 |
| 93 | Ga0070684_100806656 | 3300005535 | Bacteria | 878 |
| 94 | Ga0070697_100013902 | 3300005536 | Bacteria | 6318 |
| 95 | Ga0070697_100231132 | 3300005536 | Bacteria | 1578 |
| 96 | Ga0068853_100057282 | 3300005539 | Bacteria | 3363 |
| 97 | Ga0068853_100310092 | 3300005539 | Bacteria | 1460 |
| 98 | Ga0068853_100481855 | 3300005539 | Bacteria | 1169 |
| 99 | Ga0068853_101570104 | 3300005539 | Bacteria | 637 |
| 100 | Ga0070672_100205918 | 3300005543 | Bacteria | 1646 |
| 101 | Ga0070686_100245897 | 3300005544 | Bacteria | 1304 |
| 102 | Ga0070695_100364240 | 3300005545 | Bacteria | 1086 |
| 103 | Ga0070696_100169497 | 3300005546 | Bacteria | 1613 |
| 104 | Ga0070696_100171209 | 3300005546 | Bacteria | 1605 |
| 105 | Ga0070696_100490905 | 3300005546 | Bacteria | 975 |
| 106 | Ga0070696_100499431 | 3300005546 | Bacteria | 967 |
| 107 | Ga0070665_100000397 | 3300005548 | Bacteria | 64128 |
| 108 | Ga0070665_100000880 | 3300005548 | Bacteria | 38536 |
| 109 | Ga0070665_100002230 | 3300005548 | Bacteria | 21591 |
| 110 | Ga0070665_100069160 | 3300005548 | Bacteria | 3539 |
| 111 | Ga0070665_100502518 | 3300005548 | Bacteria | 1224 |
| 112 | Ga0068855_100015616 | 3300005563 | Bacteria | 9137 |
| 113 | Ga0068855_100018740 | 3300005563 | Bacteria | 8322 |
| 114 | Ga0068855_100039947 | 3300005563 | Bacteria | 5569 |
| 115 | Ga0068855_100123883 | 3300005563 | Bacteria | 2956 |
| 116 | Ga0068855_100167450 | 3300005563 | Bacteria | 2490 |
| 117 | Ga0068855_100271020 | 3300005563 | Bacteria | 1887 |
| 118 | Ga0068855_100442475 | 3300005563 | Bacteria | 1419 |
| 119 | Ga0070664_100033202 | 3300005564 | Bacteria | 4320 |
| 120 | Ga0070664_100084582 | 3300005564 | Bacteria | 2739 |
| 121 | Ga0068857_100026104 | 3300005577 | Bacteria | 5146 |
| 122 | Ga0068857_100116325 | 3300005577 | Bacteria | 2405 |
| 123 | Ga0068856_100134140 | 3300005614 | Bacteria | 2481 |
| 124 | Ga0068856_100372226 | 3300005614 | Bacteria | 1447 |
| 125 | Ga0070702_100267382 | 3300005615 | Bacteria | 1167 |
| 126 | Ga0068852_100130708 | 3300005616 | Bacteria | 2312 |
| 127 | Ga0068852_100135812 | 3300005616 | Bacteria | 2271 |
| 128 | Ga0068852_100215372 | 3300005616 | Bacteria | 1824 |
| 129 | Ga0068852_100559513 | 3300005616 | Bacteria | 1145 |
| 130 | Ga0068852_100682386 | 3300005616 | Bacteria | 1036 |
| 131 | Ga0068859_100000437 | 3300005617 | Bacteria | 41851 |
| 132 | Ga0068859_100016312 | 3300005617 | Bacteria | 7462 |
| 133 | Ga0068859_100304730 | 3300005617 | Bacteria | 1686 |
| 134 | Ga0068864_100000496 | 3300005618 | Bacteria | 33880 |
| 135 | Ga0068864_100000701 | 3300005618 | Bacteria | 28115 |
| 136 | Ga0068864_100098794 | 3300005618 | Bacteria | 2586 |
| 137 | Ga0068864_100107862 | 3300005618 | Bacteria | 2477 |
| 138 | Ga0068861_100124429 | 3300005719 | Bacteria | 2084 |
| 139 | Ga0068851_10207230 | 3300005834 | Bacteria | 1097 |
| 140 | Ga0068863_100000864 | 3300005841 | Bacteria | 30310 |
| 141 | Ga0068863_100001649 | 3300005841 | Bacteria | 22078 |
| 142 | Ga0068863_100006085 | 3300005841 | Bacteria | 11837 |
| 143 | Ga0068863_100009904 | 3300005841 | Bacteria | 9281 |
| 144 | Ga0068863_100060517 | 3300005841 | Bacteria | 3581 |
| 145 | Ga0068863_100113685 | 3300005841 | Bacteria | 2579 |
| 146 | Ga0068863_100465067 | 3300005841 | Bacteria | 1242 |
| 147 | Ga0068863_100482290 | 3300005841 | Bacteria | 1219 |
| 148 | Ga0068863_100935709 | 3300005841 | Bacteria | 868 |
| 149 | Ga0068858_100000557 | 3300005842 | Bacteria | 38867 |
| 150 | Ga0068860_100000070 | 3300005843 | Bacteria | 178676 |
| 151 | Ga0068860_100000309 | 3300005843 | Bacteria | 67252 |
| 152 | Ga0068862_100001520 | 3300005844 | Bacteria | 21267 |
| 153 | Ga0068862_100056514 | 3300005844 | Bacteria | 3362 |
| 154 | Ga0068862_100205590 | 3300005844 | Bacteria | 1777 |
| 155 | Ga0068862_100345741 | 3300005844 | Bacteria | 1379 |
| 156 | Ga0081455_10002423 | 3300005937 | Bacteria | 22248 |
| 157 | Ga0081455_10010819 | 3300005937 | Bacteria | 9218 |
| 158 | Ga0081538_10003068 | 3300005981 | Bacteria | 15895 |
| 159 | Ga0081538_10022376 | 3300005981 | Bacteria | 4580 |
| 160 | Ga0081538_10043188 | 3300005981 | Bacteria | 2834 |
| 161 | Ga0081540_1019810 | 3300005983 | Bacteria | 4072 |
| 162 | Ga0081540_1035967 | 3300005983 | Bacteria | 2648 |
| 163 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 164 | Ga0081539_10014085 | 3300005985 | Bacteria | 5950 |
| 165 | Ga0070717_10016637 | 3300006028 | Bacteria | 5707 |
| 166 | Ga0070717_10070743 | 3300006028 | Bacteria | 2908 |
| 167 | Ga0075365_10093296 | 3300006038 | Bacteria | 2053 |
| 168 | Ga0075368_10176869 | 3300006042 | Bacteria | 898 |
| 169 | Ga0075363_100124774 | 3300006048 | Bacteria | 1440 |
| 170 | Ga0075364_10046198 | 3300006051 | Bacteria | 2835 |
| 171 | Ga0075364_10370723 | 3300006051 | Bacteria | 976 |
| 172 | Ga0070715_10000358 | 3300006163 | Bacteria | 11380 |
| 173 | Ga0070715_10210497 | 3300006163 | Bacteria | 993 |
| 174 | Ga0070716_100006533 | 3300006173 | Bacteria | 5699 |
| 175 | Ga0070716_100242252 | 3300006173 | Bacteria | 1223 |
| 176 | Ga0070712_100208013 | 3300006175 | Bacteria | 1541 |
| 177 | Ga0075362_10037486 | 3300006177 | Bacteria | 2125 |
| 178 | Ga0075367_10057233 | 3300006178 | Bacteria | 2318 |
| 179 | Ga0075369_10076845 | 3300006186 | Bacteria | 1476 |
| 180 | Ga0075369_10081048 | 3300006186 | Bacteria | 1439 |
| 181 | Ga0075369_10163808 | 3300006186 | Bacteria | 1019 |
| 182 | Ga0075366_10013172 | 3300006195 | Bacteria | 4702 |
| 183 | Ga0075370_10069769 | 3300006353 | Bacteria | 2009 |
| 184 | Ga0068871_100358309 | 3300006358 | Bacteria | 1291 |
| 185 | Ga0068871_100804409 | 3300006358 | Bacteria | 867 |
| 186 | Ga0075428_100000612 | 3300006844 | Bacteria | 36453 |
| 187 | Ga0075428_100006199 | 3300006844 | Bacteria | 13302 |
| 188 | Ga0075428_100074390 | 3300006844 | Bacteria | 3711 |
| 189 | Ga0075428_100217357 | 3300006844 | Bacteria | 2064 |
| 190 | Ga0075430_100000371 | 3300006846 | Bacteria | 32893 |
| 191 | Ga0075430_100007366 | 3300006846 | Bacteria | 9295 |
| 192 | Ga0075430_100636539 | 3300006846 | Bacteria | 880 |
| 193 | Ga0075431_100000784 | 3300006847 | Bacteria | 27686 |
| 194 | Ga0075431_100044588 | 3300006847 | Bacteria | 4574 |
| 195 | Ga0075431_100120241 | 3300006847 | Bacteria | 2710 |
| 196 | Ga0075431_100456694 | 3300006847 | Bacteria | 1272 |
| 197 | Ga0075429_100001166 | 3300006880 | Bacteria | 21212 |
| 198 | Ga0075429_100003441 | 3300006880 | Bacteria | 13509 |
| 199 | Ga0075429_100115656 | 3300006880 | Bacteria | 2345 |
| 200 | Ga0075429_100675920 | 3300006880 | Bacteria | 905 |
| 201 | Ga0068865_100004894 | 3300006881 | Bacteria | 8094 |
| 202 | Ga0097620_100000437 | 3300006931 | Bacteria | 41851 |
| 203 | Ga0097620_100016312 | 3300006931 | Bacteria | 7462 |
| 204 | Ga0097620_100304730 | 3300006931 | Bacteria | 1686 |
| 205 | Ga0075435_100248266 | 3300007076 | Bacteria | 1515 |
| 206 | Ga0099794_10226604 | 3300007265 | Bacteria | 961 |
| 207 | Ga0099795_10014016 | 3300007788 | Bacteria | 2475 |
| 208 | Ga0105244_10097418 | 3300009036 | Bacteria | 1441 |
| 209 | Ga0105250_10057097 | 3300009092 | Bacteria | 1566 |
| 210 | Ga0105240_10000870 | 3300009093 | Bacteria | 54448 |
| 211 | Ga0105240_10027333 | 3300009093 | Bacteria | 7470 |
| 212 | Ga0105240_10040364 | 3300009093 | Bacteria | 5970 |
| 213 | Ga0105240_10041156 | 3300009093 | Bacteria | 5901 |
| 214 | Ga0105240_10049045 | 3300009093 | Bacteria | 5333 |
| 215 | Ga0105240_10123179 | 3300009093 | Bacteria | 3120 |
| 216 | Ga0105240_10150129 | 3300009093 | Bacteria | 2776 |
| 217 | Ga0111539_10354154 | 3300009094 | Bacteria | 1708 |
| 218 | Ga0105247_10185132 | 3300009101 | Bacteria | 1392 |
| 219 | Ga0114129_10033846 | 3300009147 | Bacteria | 7218 |
| 220 | Ga0114129_10281198 | 3300009147 | Bacteria | 2223 |
| 221 | Ga0114129_10285719 | 3300009147 | Bacteria | 2203 |
| 222 | Ga0105243_10187333 | 3300009148 | Bacteria | 1804 |
| 223 | Ga0105241_10473774 | 3300009174 | Bacteria | 1112 |
| 224 | Ga0105242_10036107 | 3300009176 | Bacteria | 3964 |
| 225 | Ga0105242_10831876 | 3300009176 | Bacteria | 917 |
| 226 | Ga0105242_10967200 | 3300009176 | Bacteria | 857 |
| 227 | Ga0105248_10002557 | 3300009177 | Bacteria | 20245 |
| 228 | Ga0105248_10007729 | 3300009177 | Bacteria | 11806 |
| 229 | Ga0105248_10008553 | 3300009177 | Bacteria | 11237 |
| 230 | Ga0105248_10791780 | 3300009177 | Bacteria | 1070 |
| 231 | Ga0105248_11792607 | 3300009177 | Bacteria | 696 |
| 232 | Ga0105237_10033614 | 3300009545 | Bacteria | 5196 |
| 233 | Ga0105237_10059315 | 3300009545 | Bacteria | 3829 |
| 234 | Ga0105238_10003129 | 3300009551 | Bacteria | 16514 |
| 235 | Ga0105238_10006387 | 3300009551 | Bacteria | 11728 |
| 236 | Ga0105238_10050733 | 3300009551 | Bacteria | 4176 |
| 237 | Ga0105238_10168139 | 3300009551 | Bacteria | 2169 |
| 238 | Ga0105249_10005538 | 3300009553 | Bacteria | 10915 |
| 239 | Ga0105249_10423524 | 3300009553 | Bacteria | 1365 |
| 240 | Ga0105249_10486055 | 3300009553 | Bacteria | 1278 |
| 241 | Ga0105249_10512142 | 3300009553 | Bacteria | 1246 |
| 242 | Ga0105249_10538176 | 3300009553 | Bacteria | 1217 |
| 243 | Ga0099796_10005800 | 3300010159 | Bacteria | 3110 |
| 244 | Ga0105239_10032269 | 3300010375 | Bacteria | 5756 |
| 245 | Ga0105239_10270021 | 3300010375 | Bacteria | 1913 |
| 246 | Ga0105239_10417378 | 3300010375 | Bacteria | 1520 |
| 247 | Ga0157370_10050985 | 3300013104 | Bacteria | 3954 |
| 248 | Ga0157370_10193638 | 3300013104 | Bacteria | 1887 |
| 249 | Ga0157370_10515923 | 3300013104 | Bacteria | 1097 |
| 250 | Ga0157369_10011431 | 3300013105 | Bacteria | 10082 |
| 251 | Ga0157369_10020578 | 3300013105 | Bacteria | 7376 |
| 252 | Ga0157369_10817895 | 3300013105 | Bacteria | 957 |
| 253 | Ga0157378_10720057 | 3300013297 | Bacteria | 1019 |
| 254 | Ga0163162_11116593 | 3300013306 | Bacteria | 893 |
| 255 | Ga0157372_11417165 | 3300013307 | Bacteria | 801 |
| 256 | Ga0157375_10084432 | 3300013308 | Bacteria | 3224 |
| 257 | Ga0163163_10045294 | 3300014325 | Bacteria | 4317 |
| 258 | Ga0163163_10108001 | 3300014325 | Bacteria | 2809 |
| 259 | Ga0163163_10180728 | 3300014325 | Bacteria | 2157 |
| 260 | Ga0163163_10242858 | 3300014325 | Bacteria | 1851 |
| 261 | Ga0163163_10275653 | 3300014325 | Bacteria | 1733 |
| 262 | Ga0182008_10290951 | 3300014497 | Bacteria | 852 |
| 263 | Ga0157379_10000373 | 3300014968 | Bacteria | 36116 |
| 264 | Ga0157379_10030580 | 3300014968 | Bacteria | 4794 |
| 265 | Ga0157379_10216894 | 3300014968 | Bacteria | 1733 |
| 266 | Ga0163161_10071187 | 3300017792 | Bacteria | 2544 |
| 267 | Ga0163161_10401502 | 3300017792 | Bacteria | 1099 |
| 268 | Ga0206356_11457785 | 3300020070 | Bacteria | 1176 |
| 269 | Ga0206353_10655117 | 3300020082 | Bacteria | 1136 |
| 270 | Ga0213874_10046890 | 3300021377 | Bacteria | 1313 |
| 271 | Ga0213876_10000218 | 3300021384 | Bacteria | 57753 |
| 272 | Ga0213875_10080495 | 3300021388 | Bacteria | 1520 |
| 273 | Ga0224712_10185394 | 3300022467 | Bacteria | 940 |
| 274 | Ga0209026_1001465 | 3300025250 | Bacteria | 10416 |
| 275 | Ga0209026_1012573 | 3300025250 | Bacteria | 1469 |
| 276 | Ga0209148_1000344 | 3300025254 | Bacteria | 61011 |
| 277 | Ga0209148_1005887 | 3300025254 | Bacteria | 2731 |
| 278 | Ga0209233_1021012 | 3300025261 | Bacteria | 1700 |
| 279 | Ga0209565_1000661 | 3300025263 | Bacteria | 22013 |
| 280 | Ga0209455_1001281 | 3300025272 | Bacteria | 11747 |
| 281 | Ga0209455_1009146 | 3300025272 | Bacteria | 2625 |
| 282 | Ga0209673_1001807 | 3300025273 | Bacteria | 17607 |
| 283 | Ga0209130_1042331 | 3300025284 | Bacteria | 872 |
| 284 | Ga0209675_1051408 | 3300025291 | Bacteria | 849 |
| 285 | Ga0209676_1000026 | 3300025292 | Bacteria | 574599 |
| 286 | Ga0209676_1000067 | 3300025292 | Bacteria | 315576 |
| 287 | Ga0209676_1000134 | 3300025292 | Bacteria | 183222 |
| 288 | Ga0209564_1000164 | 3300025295 | Bacteria | 160675 |
| 289 | Ga0209564_1010778 | 3300025295 | Bacteria | 4168 |
| 290 | Ga0209758_1000555 | 3300025297 | Bacteria | 59166 |
| 291 | Ga0209758_1000649 | 3300025297 | Bacteria | 52785 |
| 292 | Ga0209758_1001988 | 3300025297 | Bacteria | 22050 |
| 293 | Ga0209758_1002062 | 3300025297 | Bacteria | 21474 |
| 294 | Ga0209758_1011655 | 3300025297 | Bacteria | 5055 |
| 295 | Ga0209050_1000034 | 3300025298 | Bacteria | 433906 |
| 296 | Ga0209050_1000348 | 3300025298 | Bacteria | 90399 |
| 297 | Ga0209050_1001208 | 3300025298 | Bacteria | 30295 |
| 298 | Ga0209050_1004246 | 3300025298 | Bacteria | 9845 |
| 299 | Ga0209050_1035716 | 3300025298 | Bacteria | 1465 |
| 300 | Ga0209050_1046109 | 3300025298 | Bacteria | 1148 |
| 301 | Ga0209256_1010886 | 3300025299 | Bacteria | 3733 |
| 302 | Ga0209256_1084284 | 3300025299 | Bacteria | 688 |
| 303 | Ga0209257_1000052 | 3300025304 | Bacteria | 430947 |
| 304 | Ga0209257_1000066 | 3300025304 | Bacteria | 344166 |
| 305 | Ga0209257_1000100 | 3300025304 | Bacteria | 253399 |
| 306 | Ga0209257_1000424 | 3300025304 | Bacteria | 81333 |
| 307 | Ga0209257_1000618 | 3300025304 | Bacteria | 57657 |
| 308 | Ga0207697_10053351 | 3300025315 | Bacteria | 1674 |
| 309 | Ga0207696_1078880 | 3300025711 | Bacteria | 910 |
| 310 | Ga0207682_10050958 | 3300025893 | Bacteria | 1713 |
| 311 | Ga0207692_10147659 | 3300025898 | Bacteria | 1343 |
| 312 | Ga0207710_10037028 | 3300025900 | Bacteria | 2153 |
| 313 | Ga0207710_10038762 | 3300025900 | Bacteria | 2108 |
| 314 | Ga0207710_10275677 | 3300025900 | Bacteria | 845 |
| 315 | Ga0207688_10041574 | 3300025901 | Bacteria | 2558 |
| 316 | Ga0207688_10047746 | 3300025901 | Bacteria | 2391 |
| 317 | Ga0207680_10029163 | 3300025903 | Bacteria | 3097 |
| 318 | Ga0207680_10050436 | 3300025903 | Bacteria | 2483 |
| 319 | Ga0207647_10003636 | 3300025904 | Bacteria | 11537 |
| 320 | Ga0207685_10022739 | 3300025905 | Bacteria | 2124 |
| 321 | Ga0207699_10002386 | 3300025906 | Bacteria | 8866 |
| 322 | Ga0207699_10125930 | 3300025906 | Bacteria | 1663 |
| 323 | Ga0207645_10181878 | 3300025907 | Bacteria | 1379 |
| 324 | Ga0207643_10138117 | 3300025908 | Bacteria | 1454 |
| 325 | Ga0207643_10285400 | 3300025908 | Bacteria | 1024 |
| 326 | Ga0207705_10002082 | 3300025909 | Bacteria | 15557 |
| 327 | Ga0207705_10088789 | 3300025909 | Bacteria | 2261 |
| 328 | Ga0207705_10174852 | 3300025909 | Bacteria | 1618 |
| 329 | Ga0207705_10319137 | 3300025909 | Bacteria | 1194 |
| 330 | Ga0207684_10284644 | 3300025910 | Bacteria | 1425 |
| 331 | Ga0207654_10027785 | 3300025911 | Bacteria | 3079 |
| 332 | Ga0207654_10247229 | 3300025911 | Bacteria | 1194 |
| 333 | Ga0207707_10000466 | 3300025912 | Bacteria | 41992 |
| 334 | Ga0207707_10008012 | 3300025912 | Bacteria | 9177 |
| 335 | Ga0207707_10035840 | 3300025912 | Bacteria | 4338 |
| 336 | Ga0207707_10037513 | 3300025912 | Bacteria | 4235 |
| 337 | Ga0207707_10230934 | 3300025912 | Bacteria | 1610 |
| 338 | Ga0207707_10235479 | 3300025912 | Bacteria | 1593 |
| 339 | Ga0207707_10293286 | 3300025912 | Bacteria | 1407 |
| 340 | Ga0207707_10442252 | 3300025912 | Bacteria | 1113 |
| 341 | Ga0207707_10506403 | 3300025912 | Bacteria | 1029 |
| 342 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 343 | Ga0207695_10001430 | 3300025913 | Bacteria | 40141 |
| 344 | Ga0207695_10001687 | 3300025913 | Bacteria | 35481 |
| 345 | Ga0207695_10006230 | 3300025913 | Bacteria | 15536 |
| 346 | Ga0207695_10043806 | 3300025913 | Bacteria | 4764 |
| 347 | Ga0207695_10057285 | 3300025913 | Bacteria | 4049 |
| 348 | Ga0207695_10063634 | 3300025913 | Bacteria | 3802 |
| 349 | Ga0207695_10134339 | 3300025913 | Bacteria | 2429 |
| 350 | Ga0207695_10183143 | 3300025913 | Bacteria | 2015 |
| 351 | Ga0207695_10446384 | 3300025913 | Bacteria | 1177 |
| 352 | Ga0207671_10013462 | 3300025914 | Bacteria | 6512 |
| 353 | Ga0207671_10057564 | 3300025914 | Bacteria | 2881 |
| 354 | Ga0207671_10121542 | 3300025914 | Bacteria | 1996 |
| 355 | Ga0207671_10175859 | 3300025914 | Bacteria | 1664 |
| 356 | Ga0207671_10256670 | 3300025914 | Bacteria | 1375 |
| 357 | Ga0207671_10770548 | 3300025914 | Bacteria | 764 |
| 358 | Ga0207693_10018646 | 3300025915 | Bacteria | 5524 |
| 359 | Ga0207693_10215389 | 3300025915 | Bacteria | 1509 |
| 360 | Ga0207663_10028365 | 3300025916 | Bacteria | 3276 |
| 361 | Ga0207663_10028656 | 3300025916 | Bacteria | 3262 |
| 362 | Ga0207663_10460513 | 3300025916 | Bacteria | 982 |
| 363 | Ga0207663_10815521 | 3300025916 | Bacteria | 744 |
| 364 | Ga0207660_10002013 | 3300025917 | Bacteria | 13517 |
| 365 | Ga0207660_10004908 | 3300025917 | Bacteria | 8710 |
| 366 | Ga0207660_10048121 | 3300025917 | Bacteria | 3017 |
| 367 | Ga0207660_10049198 | 3300025917 | Bacteria | 2986 |
| 368 | Ga0207660_10448611 | 3300025917 | Bacteria | 1043 |
| 369 | Ga0207660_10476264 | 3300025917 | Bacteria | 1011 |
| 370 | Ga0207662_10135662 | 3300025918 | Bacteria | 1555 |
| 371 | Ga0207662_10403451 | 3300025918 | Bacteria | 927 |
| 372 | Ga0207657_10004634 | 3300025919 | Bacteria | 14526 |
| 373 | Ga0207649_10103135 | 3300025920 | Bacteria | 1892 |
| 374 | Ga0207649_10523330 | 3300025920 | Bacteria | 904 |
| 375 | Ga0207652_10002138 | 3300025921 | Bacteria | 16939 |
| 376 | Ga0207652_10011255 | 3300025921 | Bacteria | 7208 |
| 377 | Ga0207652_10015469 | 3300025921 | Bacteria | 6202 |
| 378 | Ga0207652_10024322 | 3300025921 | Bacteria | 5024 |
| 379 | Ga0207652_10150415 | 3300025921 | Bacteria | 2084 |
| 380 | Ga0207652_10537001 | 3300025921 | Bacteria | 1052 |
| 381 | Ga0207652_10889039 | 3300025921 | Bacteria | 787 |
| 382 | Ga0207646_10121935 | 3300025922 | Bacteria | 2342 |
| 383 | Ga0207646_10765904 | 3300025922 | Bacteria | 861 |
| 384 | Ga0207681_10002433 | 3300025923 | Bacteria | 11804 |
| 385 | Ga0207681_10415939 | 3300025923 | Bacteria | 1088 |
| 386 | Ga0207694_10000131 | 3300025924 | Bacteria | 76343 |
| 387 | Ga0207694_10014107 | 3300025924 | Bacteria | 6024 |
| 388 | Ga0207694_10025852 | 3300025924 | Bacteria | 4464 |
| 389 | Ga0207694_10105194 | 3300025924 | Bacteria | 2240 |
| 390 | Ga0207694_10125480 | 3300025924 | Bacteria | 2053 |
| 391 | Ga0207694_10160307 | 3300025924 | Bacteria | 1817 |
| 392 | Ga0207694_10245872 | 3300025924 | Bacteria | 1463 |
| 393 | Ga0207650_10000064 | 3300025925 | Bacteria | 142969 |
| 394 | Ga0207650_10025375 | 3300025925 | Bacteria | 4222 |
| 395 | Ga0207650_10098260 | 3300025925 | Bacteria | 2249 |
| 396 | Ga0207650_10693003 | 3300025925 | Bacteria | 860 |
| 397 | Ga0207687_10017929 | 3300025927 | Bacteria | 4671 |
| 398 | Ga0207687_10387715 | 3300025927 | Bacteria | 1146 |
| 399 | Ga0207687_10964580 | 3300025927 | Bacteria | 731 |
| 400 | Ga0207700_10013938 | 3300025928 | Bacteria | 5252 |
| 401 | Ga0207700_10056499 | 3300025928 | Bacteria | 2955 |
| 402 | Ga0207664_10249595 | 3300025929 | Bacteria | 1548 |
| 403 | Ga0207664_10524963 | 3300025929 | Bacteria | 1061 |
| 404 | Ga0207690_10000170 | 3300025932 | Bacteria | 50577 |
| 405 | Ga0207690_10006537 | 3300025932 | Bacteria | 6913 |
| 406 | Ga0207690_10079124 | 3300025932 | Bacteria | 2290 |
| 407 | Ga0207690_10359302 | 3300025932 | Bacteria | 1153 |
| 408 | Ga0207706_10279629 | 3300025933 | Bacteria | 1456 |
| 409 | Ga0207686_10017727 | 3300025934 | Bacteria | 4017 |
| 410 | Ga0207670_10671700 | 3300025936 | Bacteria | 856 |
| 411 | Ga0207669_10325250 | 3300025937 | Bacteria | 1178 |
| 412 | Ga0207704_10012197 | 3300025938 | Bacteria | 4259 |
| 413 | Ga0207665_10000064 | 3300025939 | Bacteria | 68931 |
| 414 | Ga0207665_10399042 | 3300025939 | Bacteria | 1047 |
| 415 | Ga0207711_10001318 | 3300025941 | Bacteria | 23485 |
| 416 | Ga0207711_10002832 | 3300025941 | Bacteria | 15237 |
| 417 | Ga0207711_10009573 | 3300025941 | Bacteria | 8076 |
| 418 | Ga0207711_10021129 | 3300025941 | Bacteria | 5437 |
| 419 | Ga0207711_10995048 | 3300025941 | Bacteria | 778 |
| 420 | Ga0207689_10128904 | 3300025942 | Bacteria | 2081 |
| 421 | Ga0207689_10643491 | 3300025942 | Bacteria | 893 |
| 422 | Ga0207689_10753412 | 3300025942 | Bacteria | 822 |
| 423 | Ga0207661_10043844 | 3300025944 | Bacteria | 3531 |
| 424 | Ga0207661_10283335 | 3300025944 | Bacteria | 1482 |
| 425 | Ga0207679_10067373 | 3300025945 | Bacteria | 2686 |
| 426 | Ga0207679_10454341 | 3300025945 | Bacteria | 1137 |
| 427 | Ga0207679_10566261 | 3300025945 | Bacteria | 1021 |
| 428 | Ga0207667_10012774 | 3300025949 | Bacteria | 9646 |
| 429 | Ga0207667_10042898 | 3300025949 | Bacteria | 4804 |
| 430 | Ga0207667_10180188 | 3300025949 | Bacteria | 2170 |
| 431 | Ga0207667_10200996 | 3300025949 | Bacteria | 2044 |
| 432 | Ga0207667_10217326 | 3300025949 | Bacteria | 1958 |
| 433 | Ga0207651_10160210 | 3300025960 | Bacteria | 1763 |
| 434 | Ga0207651_10310825 | 3300025960 | Bacteria | 1314 |
| 435 | Ga0207712_10000569 | 3300025961 | Bacteria | 29784 |
| 436 | Ga0207712_10168262 | 3300025961 | Bacteria | 1711 |
| 437 | Ga0207712_10311459 | 3300025961 | Bacteria | 1295 |
| 438 | Ga0207712_10567989 | 3300025961 | Bacteria | 977 |
| 439 | Ga0207668_10000003 | 3300025972 | Bacteria | 206959 |
| 440 | Ga0207668_10000678 | 3300025972 | Bacteria | 20916 |
| 441 | Ga0207668_10016025 | 3300025972 | Bacteria | 4669 |
| 442 | Ga0207668_10068169 | 3300025972 | Bacteria | 2528 |
| 443 | Ga0207668_10092129 | 3300025972 | Bacteria | 2229 |
| 444 | Ga0207658_10000470 | 3300025986 | Bacteria | 37577 |
| 445 | Ga0207658_10075281 | 3300025986 | Bacteria | 2568 |
| 446 | Ga0207658_10148121 | 3300025986 | Bacteria | 1909 |
| 447 | Ga0207677_10061549 | 3300026023 | Bacteria | 2600 |
| 448 | Ga0207703_10001508 | 3300026035 | Bacteria | 21233 |
| 449 | Ga0207703_10009963 | 3300026035 | Bacteria | 7455 |
| 450 | Ga0207703_10452893 | 3300026035 | Bacteria | 1199 |
| 451 | Ga0207639_10005534 | 3300026041 | Bacteria | 8539 |
| 452 | Ga0207639_10010391 | 3300026041 | Bacteria | 6446 |
| 453 | Ga0207639_10056544 | 3300026041 | Bacteria | 3008 |
| 454 | Ga0207639_10488418 | 3300026041 | Bacteria | 1123 |
| 455 | Ga0207678_10637942 | 3300026067 | Bacteria | 935 |
| 456 | Ga0207702_10065320 | 3300026078 | Bacteria | 3116 |
| 457 | Ga0207641_10000067 | 3300026088 | Bacteria | 155379 |
| 458 | Ga0207641_10002338 | 3300026088 | Bacteria | 17553 |
| 459 | Ga0207641_10002399 | 3300026088 | Bacteria | 17295 |
| 460 | Ga0207641_10627466 | 3300026088 | Bacteria | 1054 |
| 461 | Ga0207641_10885041 | 3300026088 | Bacteria | 886 |
| 462 | Ga0207676_10000285 | 3300026095 | Bacteria | 43703 |
| 463 | Ga0207676_10001669 | 3300026095 | Bacteria | 16357 |
| 464 | Ga0207676_10017334 | 3300026095 | Bacteria | 5220 |
| 465 | Ga0207674_10003851 | 3300026116 | Bacteria | 18291 |
| 466 | Ga0207674_10023460 | 3300026116 | Bacteria | 6608 |
| 467 | Ga0207674_10064139 | 3300026116 | Bacteria | 3706 |
| 468 | Ga0207674_11325862 | 3300026116 | Bacteria | 689 |
| 469 | Ga0207675_100031120 | 3300026118 | Bacteria | 4969 |
| 470 | Ga0207675_100058131 | 3300026118 | Bacteria | 3609 |
| 471 | Ga0207683_10091755 | 3300026121 | Bacteria | 2706 |
| 472 | Ga0207683_10560164 | 3300026121 | Bacteria | 1057 |
| 473 | Ga0207698_10033186 | 3300026142 | Bacteria | 3748 |
| 474 | Ga0207698_10042590 | 3300026142 | Bacteria | 3394 |
| 475 | Ga0207698_10139974 | 3300026142 | Bacteria | 2083 |
| 476 | Ga0207698_10475900 | 3300026142 | Bacteria | 1211 |
| 477 | Ga0209969_1024606 | 3300027360 | Bacteria | 905 |
| 478 | Ga0209981_1000340 | 3300027378 | Bacteria | 6003 |
| 479 | Ga0209179_1031830 | 3300027512 | Bacteria | 1084 |
| 480 | Ga0209999_1001296 | 3300027543 | Bacteria | 4289 |
| 481 | Ga0209813_10002235 | 3300027866 | Bacteria | 4418 |
| 482 | Ga0209813_10125183 | 3300027866 | Bacteria | 898 |
| 483 | Ga0268266_10000062 | 3300028379 | Bacteria | 253490 |
| 484 | Ga0268266_10001802 | 3300028379 | Bacteria | 24277 |
| 485 | Ga0268266_10003531 | 3300028379 | Bacteria | 15523 |
| 486 | Ga0268266_10016020 | 3300028379 | Bacteria | 6410 |
| 487 | Ga0268266_10016270 | 3300028379 | Bacteria | 6357 |
| 488 | Ga0268266_10556631 | 3300028379 | Bacteria | 1099 |
| 489 | Ga0268265_10001343 | 3300028380 | Bacteria | 20961 |
| 490 | Ga0268265_10002488 | 3300028380 | Bacteria | 13836 |
| 491 | Ga0268265_10016485 | 3300028380 | Bacteria | 5077 |
| 492 | Ga0268265_10069519 | 3300028380 | Bacteria | 2734 |
| 493 | Ga0268265_10081510 | 3300028380 | Bacteria | 2555 |
| 494 | Ga0268265_10120918 | 3300028380 | Bacteria | 2157 |
| 495 | Ga0268264_10000029 | 3300028381 | Bacteria | 419246 |
| 496 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 497 | Ga0268264_10000118 | 3300028381 | Bacteria | 193487 |
| 498 | Ga0268264_10024356 | 3300028381 | Bacteria | 4942 |
| 499 | Ga0268264_10053855 | 3300028381 | Bacteria | 3358 |
| 500 | Ga0265326_10093849 | 3300028558 | Bacteria | 850 |
| 501 | Ga0265334_10002345 | 3300028573 | Bacteria | 8909 |
| 502 | Ga0265334_10006982 | 3300028573 | Bacteria | 4848 |
| 503 | Ga0265334_10134070 | 3300028573 | Bacteria | 880 |
| 504 | Ga0265323_10084554 | 3300028653 | Bacteria | 1068 |
| 505 | Ga0265336_10002849 | 3300028666 | Bacteria | 6968 |
| 506 | Ga0307517_10000049 | 3300028786 | Bacteria | 160368 |
| 507 | Ga0307517_10004318 | 3300028786 | Bacteria | 21895 |
| 508 | Ga0307517_10126022 | 3300028786 | Bacteria | 1868 |
| 509 | Ga0307517_10290175 | 3300028786 | Bacteria | 925 |
| 510 | Ga0265338_10000065 | 3300028800 | Bacteria | 188966 |
| 511 | Ga0265338_10011636 | 3300028800 | Bacteria | 10140 |
| 512 | Ga0265338_10023104 | 3300028800 | Bacteria | 6404 |
| 513 | Ga0265338_10023917 | 3300028800 | Bacteria | 6261 |
| 514 | Ga0265338_10220362 | 3300028800 | Bacteria | 1418 |
| 515 | Ga0265338_10396690 | 3300028800 | Bacteria | 984 |
| 516 | Ga0265324_10014325 | 3300029957 | Bacteria | 2937 |
| 517 | Ga0307511_10002913 | 3300030521 | Bacteria | 17719 |
| 518 | Ga0307511_10065390 | 3300030521 | Bacteria | 2722 |
| 519 | Ga0265760_10018921 | 3300031090 | Bacteria | 1984 |
| 520 | Ga0265330_10120172 | 3300031235 | Bacteria | 1120 |
| 521 | Ga0265320_10120452 | 3300031240 | Bacteria | 1197 |
| 522 | Ga0265325_10005453 | 3300031241 | Bacteria | 7850 |
| 523 | Ga0265339_10001461 | 3300031249 | Bacteria | 17491 |
| 524 | Ga0265339_10005966 | 3300031249 | Bacteria | 8054 |
| 525 | Ga0265331_10001629 | 3300031250 | Bacteria | 16372 |
| 526 | Ga0265331_10039828 | 3300031250 | Bacteria | 2289 |
| 527 | Ga0265331_10112694 | 3300031250 | Bacteria | 1247 |
| 528 | Ga0265327_10000334 | 3300031251 | Bacteria | 89444 |
| 529 | Ga0265327_10002518 | 3300031251 | Bacteria | 19130 |
| 530 | Ga0265327_10005115 | 3300031251 | Bacteria | 11138 |
| 531 | Ga0265316_10090273 | 3300031344 | Bacteria | 2338 |
| 532 | Ga0265316_10091351 | 3300031344 | Bacteria | 2322 |
| 533 | Ga0307513_10000414 | 3300031456 | Bacteria | 61908 |
| 534 | Ga0307513_10000431 | 3300031456 | Bacteria | 60478 |
| 535 | Ga0307513_10019412 | 3300031456 | Bacteria | 8093 |
| 536 | Ga0307513_10106608 | 3300031456 | Bacteria | 2808 |
| 537 | Ga0307509_10176861 | 3300031507 | Bacteria | 2005 |
| 538 | Ga0265313_10000270 | 3300031595 | Bacteria | 56761 |
| 539 | Ga0265313_10000290 | 3300031595 | Bacteria | 54838 |
| 540 | Ga0307508_10000090 | 3300031616 | Bacteria | 106893 |
| 541 | Ga0307508_10448280 | 3300031616 | Bacteria | 883 |
| 542 | Ga0307514_10319746 | 3300031649 | Bacteria | 853 |
| 543 | Ga0265314_10035278 | 3300031711 | Bacteria | 3647 |
| 544 | Ga0265314_10054614 | 3300031711 | Bacteria | 2764 |
| 545 | Ga0265314_10057598 | 3300031711 | Bacteria | 2667 |
| 546 | Ga0265314_10151527 | 3300031711 | Bacteria | 1421 |
| 547 | Ga0265314_10245940 | 3300031711 | Bacteria | 1029 |
| 548 | Ga0265342_10005498 | 3300031712 | Bacteria | 9637 |
| 549 | Ga0265342_10015375 | 3300031712 | Bacteria | 5036 |
| 550 | Ga0265342_10028716 | 3300031712 | Bacteria | 3461 |
| 551 | Ga0307516_10000084 | 3300031730 | Bacteria | 104156 |
| 552 | Ga0307405_10843136 | 3300031731 | Bacteria | 771 |
| 553 | Ga0307518_10350958 | 3300031838 | Bacteria | 859 |
| 554 | Ga0307407_10073331 | 3300031903 | Bacteria | 2045 |
| 555 | Ga0307407_10074665 | 3300031903 | Bacteria | 2030 |
| 556 | Ga0307412_10240913 | 3300031911 | Bacteria | 1399 |
| 557 | Ga0307412_10440069 | 3300031911 | Bacteria | 1071 |
| 558 | Ga0307409_100100735 | 3300031995 | Bacteria | 2395 |
| 559 | Ga0307409_100318933 | 3300031995 | Bacteria | 1453 |
| 560 | Ga0307409_100401457 | 3300031995 | Bacteria | 1309 |
| 561 | Ga0307416_101189046 | 3300032002 | Bacteria | 868 |
| 562 | Ga0307414_10861920 | 3300032004 | Bacteria | 829 |
| 563 | Ga0307507_10167482 | 3300033179 | Bacteria | 1606 |
| 564 | Ga0307510_10004617 | 3300033180 | Bacteria | 16241 |
| 565 | Ga0307510_10005455 | 3300033180 | Bacteria | 15151 |
| 566 | Ga0307510_10049660 | 3300033180 | Bacteria | 4459 |
| 567 | Ga0307510_10180789 | 3300033180 | Bacteria | 1672 |
| 568 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 569 | Ga0316212_1030239 | 3300033547 | Bacteria | 761 |
| 570 | Ga0373948_0047216 | 3300034817 | Bacteria | 917 |
| 571 | Ga0373926_0078469 | 3300035083 | Bacteria | 1218 |
| 572 | Ga0373926_0107294 | 3300035083 | Bacteria | 1047 |
| 573 | Ga0373934_0015323 | 3300035086 | Bacteria | 2908 |
| 574 | Ga0373934_0166516 | 3300035086 | Bacteria | 904 |
| 575 | Ga0373944_0002107 | 3300035089 | Bacteria | 5055 |
| 576 | Ga0373952_0051144 | 3300035092 | Bacteria | 986 |
| 577 | Ga0373923_0008238 | 3300035111 | Bacteria | 3707 |
| 578 | Ga0373923_0044399 | 3300035111 | Bacteria | 1842 |
| 579 | Ga0373923_0346578 | 3300035111 | Bacteria | 709 |
| 580 | Ga0373932_0027180 | 3300035112 | Bacteria | 1563 |
| 581 | Ga0373936_0006507 | 3300035113 | Bacteria | 4403 |
| 582 | Ga0373936_0016751 | 3300035113 | Bacteria | 2820 |
| 583 | Ga0373936_0034573 | 3300035113 | Bacteria | 2009 |
| 584 | Ga0373945_0014375 | 3300035116 | Bacteria | 2651 |
| 585 | Ga0373945_0325100 | 3300035116 | Bacteria | 663 |
| 586 | Ga0373953_0044097 | 3300035117 | Bacteria | 1782 |
| 587 | Ga0373953_0058182 | 3300035117 | Bacteria | 1575 |
| 588 | Ga0373954_0001303 | 3300035118 | Bacteria | 10039 |
| 589 | Ga0373954_0113370 | 3300035118 | Bacteria | 1312 |
| 590 | Ga0373956_0000726 | 3300035119 | Bacteria | 13568 |
| 591 | Ga0373956_0044953 | 3300035119 | Bacteria | 1969 |
| 592 | Ga0373960_0102667 | 3300035121 | Bacteria | 929 |
| 593 | Ga0373943_0004812 | 3300035170 | Bacteria | 6099 |
| 594 | Ga0373943_0168271 | 3300035170 | Bacteria | 1198 |
| 595 | Ga0373946_0008147 | 3300035171 | Bacteria | 3846 |
| 596 | Ga0373946_0330958 | 3300035171 | Bacteria | 758 |
| 597 | Ga0373955_0003241 | 3300035172 | Bacteria | 7127 |
| 598 | Ga0373955_0337575 | 3300035172 | Bacteria | 911 |
| 599 | Ga0373924_0069637 | 3300035410 | Bacteria | 1482 |
| 600 | Ga0373931_0001506 | 3300035691 | Bacteria | 10029 |
| 601 | Ga0373931_0192097 | 3300035691 | Bacteria | 1215 |
| 602 | Ga0373935_0000746 | 3300035692 | Bacteria | 17275 |
| 603 | Ga0373935_0142286 | 3300035692 | Bacteria | 1621 |
| 604 | Ga0373935_0148398 | 3300035692 | Bacteria | 1589 |
| 605 | Ga0373935_0267523 | 3300035692 | Bacteria | 1200 |
| 606 | Ga0373927_0001005 | 3300035695 | Bacteria | 21497 |
| 607 | Ga0373927_0005832 | 3300035695 | Bacteria | 8449 |
| 608 | Ga0373927_0007328 | 3300035695 | Bacteria | 7471 |
| 609 | Ga0373927_0046813 | 3300035695 | Bacteria | 2797 |
| 610 | Ga0373927_0072459 | 3300035695 | Bacteria | 2229 |
| 611 | Ga0373927_0140972 | 3300035695 | Bacteria | 1577 |
| 612 | Ga0373933_0002183 | 3300035724 | Bacteria | 11198 |
| 613 | Ga0373933_0017857 | 3300035724 | Bacteria | 3984 |
| 614 | Ga0373933_0033690 | 3300035724 | Bacteria | 2981 |
| 615 | Ga0373947_0005667 | 3300035725 | Bacteria | 7285 |
| 616 | Ga0373947_0087448 | 3300035725 | Bacteria | 1938 |
| 617 | Ga0373947_0225329 | 3300035725 | Bacteria | 1233 |
| 618 | Ga0373947_0256246 | 3300035725 | Bacteria | 1158 |
| 619 | Ga0373947_0297724 | 3300035725 | Bacteria | 1075 |
| 620 | Ga0373947_0313140 | 3300035725 | Bacteria | 1048 |
| 621 | Ga0373937_0002920 | 3300036401 | Bacteria | 14286 |
| 622 | Ga0373937_0061629 | 3300036401 | Bacteria | 3448 |
| 623 | Ga0373937_0101399 | 3300036401 | Bacteria | 2671 |
| 624 | Ga0373937_0144521 | 3300036401 | Bacteria | 2226 |
| 625 | Ga0373937_0189840 | 3300036401 | Bacteria | 1930 |
| 626 | Ga0373937_0583978 | 3300036401 | Bacteria | 1061 |
| 627 | Ga0310109_024461 | 3300036534 | Bacteria | 811 |
| 628 | Ga0373925_0000335 | 3300037068 | Bacteria | 48779 |
| 629 | Ga0373925_0006131 | 3300037068 | Bacteria | 8880 |
| 630 | Ga0373925_0024191 | 3300037068 | Bacteria | 4433 |
| 631 | Ga0373925_0051552 | 3300037068 | Bacteria | 3072 |
| 632 | Ga0373925_0058505 | 3300037068 | Bacteria | 2890 |
| 633 | Ga0395899_0000004 | 3300037312 | Bacteria | 874267 |
| 634 | Ga0395899_0000392 | 3300037312 | Bacteria | 52225 |
| 635 | Ga0395899_0037553 | 3300037312 | Bacteria | 3631 |
| 636 | Ga0395899_0149214 | 3300037312 | Bacteria | 1658 |
| 637 | Ga0395900_0000004 | 3300037418 | Bacteria | 564908 |
| 638 | Ga0395900_0039173 | 3300037418 | Bacteria | 4884 |
| 639 | Ga0395900_0046235 | 3300037418 | Bacteria | 4482 |
| 640 | Ga0395900_0063108 | 3300037418 | Bacteria | 3809 |
| 641 | Ga0395900_0081560 | 3300037418 | Bacteria | 3323 |
| 642 | Ga0395900_0139812 | 3300037418 | Bacteria | 2480 |
| 643 | Ga0395900_0319424 | 3300037418 | Bacteria | 1533 |
| 644 | Ga0395900_0511166 | 3300037418 | Bacteria | 1150 |
| 645 | Ga0395898_0015313 | 3300037466 | Bacteria | 7867 |
| 646 | Ga0395898_0133953 | 3300037466 | Bacteria | 2372 |
| 647 | Ga0395898_0264804 | 3300037466 | Bacteria | 1639 |
| 648 | Ga0395898_0273995 | 3300037466 | Bacteria | 1609 |
| 649 | Ga0395898_0409631 | 3300037466 | Bacteria | 1292 |
| 650 | Ga0395905_0012043 | 3300037471 | Bacteria | 8337 |
| 651 | Ga0395905_0014075 | 3300037471 | Bacteria | 7647 |
| 652 | Ga0395905_0329054 | 3300037471 | Bacteria | 1418 |
| 653 | Ga0395905_0419442 | 3300037471 | Bacteria | 1234 |
| 654 | Ga0395905_0782467 | 3300037471 | Bacteria | 857 |
| 655 | Ga0436364_0294495 | 3300037853 | Bacteria | 996 |
| 656 | Ga0436364_0765763 | 3300037853 | Bacteria | 2884 |
| 657 | Ga0436364_0967922 | 3300037853 | Bacteria | 1775 |
| 658 | Ga0436364_1145508 | 3300037853 | Bacteria | 5108 |
| 659 | Ga0436364_1328893 | 3300037853 | Bacteria | 936 |
| 660 | Ga0436364_1523679 | 3300037853 | Bacteria | 845 |
| 661 | Ga0436364_1525373 | 3300037853 | Bacteria | 968 |
| 662 | Ga0395901_0000005 | 3300038443 | Bacteria | 544998 |
| 663 | Ga0395901_0002466 | 3300038443 | Bacteria | 18767 |
| 664 | Ga0395901_0039843 | 3300038443 | Bacteria | 4863 |
| 665 | Ga0395901_0306632 | 3300038443 | Bacteria | 1645 |
| 666 | Ga0395901_0371755 | 3300038443 | Bacteria | 1472 |
| 667 | Ga0395901_0834628 | 3300038443 | Bacteria | 908 |
| 668 | Ga0400485_03320 | 3300038735 | Bacteria | 10604 |
| 669 | Ga0400483_023760 | 3300039062 | Bacteria | 7131 |
| 670 | Ga0400483_040634 | 3300039062 | Bacteria | 6524 |
| 671 | Ga0400483_052412 | 3300039062 | Bacteria | 5315 |
| 672 | Ga0400483_092856 | 3300039062 | Bacteria | 1926 |
| 673 | Ga0400483_183320 | 3300039062 | Bacteria | 6606 |
| 674 | Ga0400483_193625 | 3300039062 | Bacteria | 8230 |
| 675 | Ga0400483_217638 | 3300039062 | Bacteria | 24445 |
| 676 | Ga0400483_218418 | 3300039062 | Bacteria | 42144 |
| 677 | Ga0400483_257882 | 3300039062 | Bacteria | 2972 |
| 678 | Ga0400483_272292 | 3300039062 | Bacteria | 4518 |
| 679 | Ga0400483_275881 | 3300039062 | Bacteria | 1023 |
| 680 | Ga0436365_0442593 | 3300039437 | Bacteria | 1541 |
| 681 | Ga0436365_0577642 | 3300039437 | Bacteria | 77516 |
| 682 | Ga0436365_0603212 | 3300039437 | Bacteria | 6165 |
| 683 | Ga0436365_0649797 | 3300039437 | Bacteria | 875 |
| 684 | Ga0436365_0751394 | 3300039437 | Bacteria | 2322 |
| 685 | Ga0436365_0891213 | 3300039437 | Bacteria | 807 |
| 686 | Ga0436365_1118553 | 3300039437 | Bacteria | 2521 |
| 687 | Ga0436365_1300363 | 3300039437 | Bacteria | 1869 |
| 688 | Ga0436360_0164010 | 3300039438 | Bacteria | 1373 |
| 689 | Ga0436360_0272555 | 3300039438 | Bacteria | 749 |
| 690 | Ga0436360_0339257 | 3300039438 | Bacteria | 3187 |
| 691 | Ga0436360_0355615 | 3300039438 | Bacteria | 634 |
| 692 | Ga0436360_0412786 | 3300039438 | Bacteria | 1453 |
| 693 | Ga0436360_0640524 | 3300039438 | Bacteria | 739 |
| 694 | Ga0436360_1305805 | 3300039438 | Bacteria | 1129 |
| 695 | Ga0436360_1306958 | 3300039438 | Bacteria | 1836 |
| 696 | Ga0436361_0223293 | 3300039447 | Bacteria | 1684 |
| 697 | Ga0436361_0569699 | 3300039447 | Bacteria | 18031 |
| 698 | Ga0436361_0783402 | 3300039447 | Bacteria | 2796 |
| 699 | Ga0436361_1136221 | 3300039447 | Bacteria | 1043 |
| 700 | Ga0436363_0225819 | 3300039450 | Bacteria | 706 |
| 701 | Ga0436363_0740142 | 3300039450 | Bacteria | 901 |
| 702 | Ga0436363_1100534 | 3300039450 | Bacteria | 696 |
| 703 | Ga0436363_1533112 | 3300039450 | Bacteria | 879 |
| 704 | Ga0436362_1014140 | 3300039453 | Bacteria | 797 |
| 705 | Ga0439465_0034528 | 3300041413 | Bacteria | 1619 |
| 706 | Ga0451790_33576 | 3300041444 | Bacteria | 777 |
| 707 | Ga0451793_1221768 | 3300041452 | Bacteria | 615 |
| 708 | Ga0451793_1584844 | 3300041452 | Bacteria | 926 |
| 709 | Ga0451800_0349978 | 3300041459 | Bacteria | 758 |
| 710 | Ga0451807_1028089 | 3300041486 | Bacteria | 705 |
| 711 | Ga0451839_0013675 | 3300041496 | Bacteria | 781 |
| 712 | Ga0451851_0179760 | 3300041507 | Bacteria | 859 |
| 713 | Ga0439431_0053914 | 3300041997 | Bacteria | 1048 |
| 714 | Ga0439431_0122671 | 3300041997 | Bacteria | 725 |
| 715 | Ga0439448_0020795 | 3300042005 | Bacteria | 2034 |
| 716 | Ga0439448_0112534 | 3300042005 | Bacteria | 931 |
| 717 | Ga0439432_034533 | 3300042006 | Bacteria | 1623 |
| 718 | Ga0439432_077648 | 3300042006 | Bacteria | 1008 |
| 719 | Ga0439450_015569 | 3300042008 | Bacteria | 1559 |
| 720 | Ga0439454_000646 | 3300042011 | Bacteria | 2921 |
| 721 | Ga0439455_0004924 | 3300042012 | Bacteria | 2680 |
| 722 | Ga0439456_083156 | 3300042013 | Bacteria | 716 |
| 723 | Ga0439463_001082 | 3300042016 | Bacteria | 7352 |
| 724 | Ga0439446_0012923 | 3300042156 | Bacteria | 2285 |
| 725 | Ga0439434_0102851 | 3300042435 | Bacteria | 921 |
| 726 | Ga0439434_0160628 | 3300042435 | Bacteria | 746 |
| 727 | Ga0439459_0009822 | 3300042438 | Bacteria | 1658 |
| 728 | Ga0439464_0007526 | 3300042439 | Bacteria | 2848 |
| 729 | Ga0439460_0007151 | 3300042461 | Bacteria | 2785 |
| 730 | Ga0439440_0012915 | 3300042993 | Bacteria | 1783 |
| 731 | Ga0466966_0001611 | 3300044684 | Bacteria | 14530 |
| 732 | Ga0466966_0211388 | 3300044684 | Bacteria | 1172 |
| 733 | Ga0466966_0290872 | 3300044684 | Bacteria | 982 |
| 734 | Ga0466961_0000729 | 3300044693 | Bacteria | 20668 |
| 735 | Ga0466961_0176993 | 3300044693 | Bacteria | 1325 |
| 736 | Ga0466963_0092275 | 3300044694 | Bacteria | 2063 |
| 737 | Ga0466963_0381938 | 3300044694 | Bacteria | 993 |
| 738 | Ga0466968_0036681 | 3300044735 | Bacteria | 2055 |
| 739 | Ga0466957_0288464 | 3300044842 | Bacteria | 1100 |
| 740 | Ga0466959_0016762 | 3300045049 | Bacteria | 5361 |
| 741 | Ga0466959_0284459 | 3300045049 | Bacteria | 1134 |
| 742 | Ga0466967_0064758 | 3300045976 | Bacteria | 3251 |
| 743 | Ga0466967_0140691 | 3300045976 | Bacteria | 2248 |
| 744 | Ga0466967_0356150 | 3300045976 | Bacteria | 1417 |
| 745 | Ga0466967_0508770 | 3300045976 | Bacteria | 1182 |
| 746 | Ga0495617_082408 | 3300046452 | Bacteria | 1053 |
| 747 | Ga0495592_0001015 | 3300046454 | Bacteria | 19460 |
| 748 | Ga0495592_0160953 | 3300046454 | Bacteria | 1544 |
| 749 | Ga0495592_0292078 | 3300046454 | Bacteria | 1062 |
| 750 | Ga0495592_0386922 | 3300046454 | Bacteria | 889 |
| 751 | Ga0495603_0014076 | 3300046455 | Bacteria | 4838 |
| 752 | Ga0495603_0096327 | 3300046455 | Bacteria | 1729 |
| 753 | Ga0495603_0286794 | 3300046455 | Bacteria | 946 |
| 754 | Ga0495590_0001375 | 3300046457 | Bacteria | 10563 |
| 755 | Ga0495629_0011592 | 3300046459 | Bacteria | 6400 |
| 756 | Ga0495629_0054448 | 3300046459 | Bacteria | 2798 |
| 757 | Ga0495629_0224185 | 3300046459 | Bacteria | 1296 |
| 758 | Ga0495629_0307888 | 3300046459 | Bacteria | 1084 |
| 759 | Ga0495638_0006134 | 3300046460 | Bacteria | 8794 |
| 760 | Ga0495638_0054700 | 3300046460 | Bacteria | 2480 |
| 761 | Ga0495638_0061356 | 3300046460 | Bacteria | 2323 |
| 762 | Ga0495641_0009631 | 3300046461 | Bacteria | 5717 |
| 763 | Ga0495651_0363585 | 3300046462 | Bacteria | 953 |
| 764 | Ga0495651_0526357 | 3300046462 | Bacteria | 754 |
| 765 | Ga0495653_0000934 | 3300046463 | Bacteria | 22498 |
| 766 | Ga0495653_0079298 | 3300046463 | Bacteria | 2432 |
| 767 | Ga0495653_0142684 | 3300046463 | Bacteria | 1682 |
| 768 | Ga0495653_0335730 | 3300046463 | Bacteria | 976 |
| 769 | Ga0495650_0000244 | 3300046471 | Bacteria | 107511 |
| 770 | Ga0495580_0000612 | 3300046472 | Bacteria | 30191 |
| 771 | Ga0495580_0010282 | 3300046472 | Bacteria | 7298 |
| 772 | Ga0495582_0019067 | 3300046473 | Bacteria | 3754 |
| 773 | Ga0495582_0068295 | 3300046473 | Bacteria | 1964 |
| 774 | Ga0495582_0089154 | 3300046473 | Bacteria | 1719 |
| 775 | Ga0495639_0001536 | 3300046475 | Bacteria | 10297 |
| 776 | Ga0495639_0038030 | 3300046475 | Bacteria | 2160 |
| 777 | Ga0495639_0238859 | 3300046475 | Bacteria | 896 |
| 778 | Ga0495664_0013114 | 3300046477 | Bacteria | 4701 |
| 779 | Ga0495664_0322198 | 3300046477 | Bacteria | 932 |
| 780 | Ga0495664_0330181 | 3300046477 | Bacteria | 919 |
| 781 | Ga0495585_0039584 | 3300046492 | Bacteria | 2649 |
| 782 | Ga0495585_0226696 | 3300046492 | Bacteria | 941 |
| 783 | Ga0495594_0098647 | 3300046499 | Bacteria | 1642 |
| 784 | Ga0495594_0209109 | 3300046499 | Bacteria | 1112 |
| 785 | Ga0495596_0167271 | 3300046500 | Bacteria | 855 |
| 786 | Ga0495607_0307923 | 3300046501 | Bacteria | 743 |
| 787 | Ga0495583_0097502 | 3300046506 | Bacteria | 1258 |
| 788 | Ga0495606_0005813 | 3300046507 | Bacteria | 11637 |
| 789 | Ga0495606_0059666 | 3300046507 | Bacteria | 2446 |
| 790 | Ga0495608_0002093 | 3300046511 | Bacteria | 14381 |
| 791 | Ga0495608_0013352 | 3300046511 | Bacteria | 5698 |
| 792 | Ga0495608_0393237 | 3300046511 | Bacteria | 849 |
| 793 | Ga0495610_0002447 | 3300046512 | Bacteria | 15615 |
| 794 | Ga0495616_0000561 | 3300046513 | Bacteria | 28171 |
| 795 | Ga0495618_0317127 | 3300046514 | Bacteria | 966 |
| 796 | Ga0495628_0020462 | 3300046516 | Bacteria | 5456 |
| 797 | Ga0495628_0091030 | 3300046516 | Bacteria | 2361 |
| 798 | Ga0495628_0123443 | 3300046516 | Bacteria | 1985 |
| 799 | Ga0495628_0203866 | 3300046516 | Bacteria | 1489 |
| 800 | Ga0495630_0035589 | 3300046517 | Bacteria | 3720 |
| 801 | Ga0495630_0050507 | 3300046517 | Bacteria | 3113 |
| 802 | Ga0495630_0127018 | 3300046517 | Bacteria | 1936 |
| 803 | Ga0495631_0118568 | 3300046518 | Bacteria | 1138 |
| 804 | Ga0495637_0023333 | 3300046520 | Bacteria | 2814 |
| 805 | Ga0495643_0041517 | 3300046522 | Bacteria | 2507 |
| 806 | Ga0495643_0134258 | 3300046522 | Bacteria | 1240 |
| 807 | Ga0495644_0215384 | 3300046523 | Bacteria | 742 |
| 808 | Ga0495648_0000165 | 3300046524 | Bacteria | 78462 |
| 809 | Ga0495648_0030929 | 3300046524 | Bacteria | 3533 |
| 810 | Ga0495666_0026921 | 3300046526 | Bacteria | 2831 |
| 811 | Ga0495642_0018614 | 3300046528 | Bacteria | 2719 |
| 812 | Ga0495642_0036369 | 3300046528 | Bacteria | 1990 |
| 813 | Ga0495642_0181321 | 3300046528 | Bacteria | 916 |
| 814 | Ga0495652_0002209 | 3300046529 | Bacteria | 20424 |
| 815 | Ga0495652_0036404 | 3300046529 | Bacteria | 4280 |
| 816 | Ga0495652_0049140 | 3300046529 | Bacteria | 3612 |
| 817 | Ga0495652_0112630 | 3300046529 | Bacteria | 2185 |
| 818 | Ga0495652_0160604 | 3300046529 | Bacteria | 1745 |
| 819 | Ga0495652_0230424 | 3300046529 | Bacteria | 1386 |
| 820 | Ga0495652_0401043 | 3300046529 | Bacteria | 971 |
| 821 | Ga0495654_0000024 | 3300046530 | Bacteria | 238195 |
| 822 | Ga0495654_0041892 | 3300046530 | Bacteria | 2276 |
| 823 | Ga0495665_0000866 | 3300046531 | Bacteria | 15828 |
| 824 | Ga0495665_0243738 | 3300046531 | Bacteria | 926 |
| 825 | Ga0495640_0003099 | 3300046533 | Bacteria | 13412 |
| 826 | Ga0495640_0060112 | 3300046533 | Bacteria | 2585 |
| 827 | Ga0495640_0247644 | 3300046533 | Bacteria | 1117 |
| 828 | Ga0495640_0353867 | 3300046533 | Bacteria | 906 |
| 829 | Ga0495587_0015200 | 3300046536 | Bacteria | 4810 |
| 830 | Ga0495587_0029924 | 3300046536 | Bacteria | 3304 |
| 831 | Ga0495587_0133003 | 3300046536 | Bacteria | 1421 |
| 832 | Ga0495609_0023541 | 3300046538 | Bacteria | 2830 |
| 833 | Ga0495621_0076579 | 3300046539 | Bacteria | 1241 |
| 834 | Ga0495597_0003599 | 3300046542 | Bacteria | 8921 |
| 835 | Ga0495597_0043380 | 3300046542 | Bacteria | 2003 |
| 836 | Ga0495645_0012499 | 3300046543 | Bacteria | 5983 |
| 837 | Ga0495645_0013311 | 3300046543 | Bacteria | 5815 |
| 838 | Ga0495645_0040862 | 3300046543 | Bacteria | 3382 |
| 839 | Ga0495645_0338967 | 3300046543 | Bacteria | 971 |
| 840 | Ga0495645_0358784 | 3300046543 | Bacteria | 937 |
| 841 | Ga0495645_0425059 | 3300046543 | Bacteria | 842 |
| 842 | Ga0495622_0010588 | 3300046557 | Bacteria | 4255 |
| 843 | Ga0495622_0033434 | 3300046557 | Bacteria | 2400 |
| 844 | Ga0495622_0054153 | 3300046557 | Bacteria | 1861 |
| 845 | Ga0495633_0024018 | 3300046558 | Bacteria | 3016 |
| 846 | Ga0495633_0139294 | 3300046558 | Bacteria | 1122 |
| 847 | Ga0495667_0009515 | 3300046559 | Bacteria | 6585 |
| 848 | Ga0495667_0023947 | 3300046559 | Bacteria | 4112 |
| 849 | Ga0495667_0156529 | 3300046559 | Bacteria | 1466 |
| 850 | Ga0495656_0015319 | 3300046615 | Bacteria | 2892 |
| 851 | Ga0495656_0445946 | 3300046615 | Bacteria | 681 |
| 852 | Ga0495668_0000042 | 3300046616 | Bacteria | 229361 |
| 853 | Ga0495668_0006417 | 3300046616 | Bacteria | 7704 |
| 854 | Ga0495668_0006930 | 3300046616 | Bacteria | 7335 |
| 855 | Ga0495668_0070100 | 3300046616 | Bacteria | 1927 |
| 856 | Ga0495668_0135365 | 3300046616 | Bacteria | 1348 |
| 857 | Ga0495668_0165455 | 3300046616 | Bacteria | 1211 |
| 858 | Ga0495668_0173531 | 3300046616 | Bacteria | 1181 |
| 859 | Ga0495634_0003047 | 3300046642 | Bacteria | 13635 |
| 860 | Ga0495634_0045191 | 3300046642 | Bacteria | 2978 |
| 861 | Ga0495634_0068412 | 3300046642 | Bacteria | 2346 |
| 862 | Ga0495634_0078105 | 3300046642 | Bacteria | 2169 |
| 863 | Ga0495611_0316360 | 3300046648 | Bacteria | 718 |
| 864 | Ga0495625_0029821 | 3300046660 | Bacteria | 4075 |
| 865 | Ga0495625_0065494 | 3300046660 | Bacteria | 2561 |
| 866 | Ga0495625_0121557 | 3300046660 | Bacteria | 1776 |
| 867 | Ga0495625_0203516 | 3300046660 | Bacteria | 1305 |
| 868 | Ga0495625_0289169 | 3300046660 | Bacteria | 1052 |
| 869 | Ga0495635_0000540 | 3300046663 | Bacteria | 24055 |
| 870 | Ga0495635_0007303 | 3300046663 | Bacteria | 7716 |
| 871 | Ga0495635_0062629 | 3300046663 | Bacteria | 2554 |
| 872 | Ga0495635_0065285 | 3300046663 | Bacteria | 2497 |
| 873 | Ga0495659_0080223 | 3300046664 | Bacteria | 1237 |
| 874 | Ga0495588_0026578 | 3300046674 | Bacteria | 2891 |
| 875 | Ga0495588_0057027 | 3300046674 | Bacteria | 2017 |
| 876 | Ga0495657_0001615 | 3300046675 | Bacteria | 19351 |
| 877 | Ga0495657_0003319 | 3300046675 | Bacteria | 13189 |
| 878 | Ga0495657_0023689 | 3300046675 | Bacteria | 4384 |
| 879 | Ga0495599_0007666 | 3300046678 | Bacteria | 6555 |
| 880 | Ga0495599_0071308 | 3300046678 | Bacteria | 2169 |
| 881 | Ga0495599_0169737 | 3300046678 | Bacteria | 1346 |
| 882 | Ga0495623_0051844 | 3300046679 | Bacteria | 2594 |
| 883 | Ga0495623_0168305 | 3300046679 | Bacteria | 1282 |
| 884 | Ga0495646_0010030 | 3300046680 | Bacteria | 6021 |
| 885 | Ga0495646_0096661 | 3300046680 | Bacteria | 1698 |
| 886 | Ga0495647_0021408 | 3300046681 | Bacteria | 2328 |
| 887 | Ga0495658_0005259 | 3300046683 | Bacteria | 6372 |
| 888 | Ga0495658_0215711 | 3300046683 | Bacteria | 1200 |
| 889 | Ga0495658_0257007 | 3300046683 | Bacteria | 1099 |
| 890 | Ga0495669_0000078 | 3300046684 | Bacteria | 64436 |
| 891 | Ga0495669_0009879 | 3300046684 | Bacteria | 4032 |
| 892 | Ga0495669_0045945 | 3300046684 | Bacteria | 1948 |
| 893 | Ga0495613_0004342 | 3300046689 | Bacteria | 10610 |
| 894 | Ga0495613_0148598 | 3300046689 | Bacteria | 1672 |
| 895 | Ga0495613_0584005 | 3300046689 | Bacteria | 745 |
| 896 | Ga0495624_0000079 | 3300046690 | Bacteria | 63196 |
| 897 | Ga0495670_0106363 | 3300046691 | Bacteria | 1449 |
| 898 | Ga0495600_0007254 | 3300046809 | Bacteria | 6770 |
| 899 | Ga0495600_0065595 | 3300046809 | Bacteria | 2374 |
| 900 | Ga0495600_0085449 | 3300046809 | Bacteria | 2058 |
| 901 | Ga0495660_0029161 | 3300046810 | Bacteria | 3115 |
| 902 | Ga0495660_0065495 | 3300046810 | Bacteria | 1939 |
| 903 | Ga0495581_0000260 | 3300047315 | Bacteria | 25339 |
| 904 | Ga0495581_0108817 | 3300047315 | Bacteria | 1611 |
| 905 | Ga0495581_0244006 | 3300047315 | Bacteria | 1050 |
| 906 | Ga0495581_0361447 | 3300047315 | Bacteria | 847 |
| 907 | Ga0495604_0006608 | 3300047317 | Bacteria | 9190 |
| 908 | Ga0495604_0021019 | 3300047317 | Bacteria | 5207 |
| 909 | Ga0495604_0093261 | 3300047317 | Bacteria | 2228 |
| 910 | Ga0495604_0124469 | 3300047317 | Bacteria | 1861 |
| 911 | Ga0495636_0082612 | 3300047318 | Bacteria | 1385 |
| 912 | Ga0495674_0039127 | 3300047319 | Bacteria | 4252 |
| 913 | Ga0495674_0060084 | 3300047319 | Bacteria | 3317 |
| 914 | Ga0495674_0062608 | 3300047319 | Bacteria | 3238 |
| 915 | Ga0495672_0065581 | 3300047320 | Bacteria | 2075 |
| 916 | Ga0495672_0103686 | 3300047320 | Bacteria | 1538 |
| 917 | Ga0495672_0229000 | 3300047320 | Bacteria | 913 |
| 918 | Ga0495676_0070484 | 3300047321 | Bacteria | 2692 |
| 919 | Ga0495680_0012504 | 3300047322 | Bacteria | 7465 |
| 920 | Ga0495680_0032774 | 3300047322 | Bacteria | 4213 |
| 921 | Ga0495680_0118005 | 3300047322 | Bacteria | 1961 |
| 922 | Ga0495687_080764 | 3300047443 | Bacteria | 1274 |
| 923 | Ga0495675_0001958 | 3300047444 | Bacteria | 12284 |
| 924 | Ga0495675_0048595 | 3300047444 | Bacteria | 2698 |
| 925 | Ga0495675_0086146 | 3300047444 | Bacteria | 1975 |
| 926 | Ga0495677_0046949 | 3300047445 | Bacteria | 1585 |
| 927 | Ga0495677_0152752 | 3300047445 | Bacteria | 889 |
| 928 | Ga0495673_0015936 | 3300047469 | Bacteria | 3857 |
| 929 | Ga0495673_0028515 | 3300047469 | Bacteria | 2643 |
| 930 | Ga0495681_0124308 | 3300047470 | Bacteria | 1104 |
| 931 | Ga0495681_0185514 | 3300047470 | Bacteria | 852 |
| 932 | Ga0495684_0001865 | 3300047471 | Bacteria | 16864 |
| 933 | Ga0495684_0007297 | 3300047471 | Bacteria | 8566 |
| 934 | Ga0495684_0010601 | 3300047471 | Bacteria | 7124 |
| 935 | Ga0495684_0048320 | 3300047471 | Bacteria | 3254 |
| 936 | Ga0495686_0001646 | 3300047472 | Bacteria | 23306 |
| 937 | Ga0495686_0003347 | 3300047472 | Bacteria | 13988 |
| 938 | Ga0495686_0027519 | 3300047472 | Bacteria | 3710 |
| 939 | Ga0495686_0193227 | 3300047472 | Bacteria | 1172 |
| 940 | Ga0495686_0249230 | 3300047472 | Bacteria | 998 |
| 941 | Ga0495593_0002394 | 3300047673 | Bacteria | 11278 |
| 942 | Ga0495593_0027612 | 3300047673 | Bacteria | 3123 |
| 943 | Ga0495593_0040729 | 3300047673 | Bacteria | 2500 |
| 944 | Ga0495602_0009374 | 3300048088 | Bacteria | 10184 |
| 945 | Ga0495602_0040611 | 3300048088 | Bacteria | 4262 |
| 946 | Ga0495602_0142472 | 3300048088 | Bacteria | 1896 |
| 947 | Ga0495626_0059314 | 3300048091 | Bacteria | 1746 |
| 948 | Ga0496100_0059701 | 3300048903 | Bacteria | 2507 |
| 949 | Ga0496100_0232261 | 3300048903 | Bacteria | 1358 |
| 950 | Ga0496100_0367005 | 3300048903 | Bacteria | 1091 |
| 951 | Ga0496100_0848994 | 3300048903 | Bacteria | 716 |
| 952 | Ga0496101_0015844 | 3300048904 | Bacteria | 5088 |
| 953 | Ga0496102_0000518 | 3300048905 | Bacteria | 42014 |
| 954 | Ga0496102_0018170 | 3300048905 | Bacteria | 6171 |
| 955 | Ga0496102_0018766 | 3300048905 | Bacteria | 6083 |
| 956 | Ga0496102_0052840 | 3300048905 | Bacteria | 3703 |
| 957 | Ga0496102_0739641 | 3300048905 | Bacteria | 906 |
| 958 | Ga0496103_0077711 | 3300048906 | Bacteria | 2084 |
| 959 | Ga0496104_0137241 | 3300048907 | Bacteria | 2349 |
| 960 | Ga0496105_0004162 | 3300048908 | Bacteria | 10857 |
| 961 | Ga0496105_0004256 | 3300048908 | Bacteria | 10766 |
| 962 | Ga0496105_0112402 | 3300048908 | Bacteria | 2248 |
| 963 | Ga0496105_0679311 | 3300048908 | Bacteria | 792 |
| 964 | Ga0496106_0000116 | 3300048909 | Bacteria | 61237 |
| 965 | Ga0496106_0013096 | 3300048909 | Bacteria | 6120 |
| 966 | Ga0496106_0078196 | 3300048909 | Bacteria | 2538 |
| 967 | Ga0496106_0094820 | 3300048909 | Bacteria | 2308 |
| 968 | Ga0496106_0363639 | 3300048909 | Bacteria | 1162 |
| 969 | Ga0496107_0001003 | 3300048910 | Bacteria | 16852 |
| 970 | Ga0496107_0554203 | 3300048910 | Bacteria | 851 |
| 971 | Ga0496108_0000523 | 3300048911 | Bacteria | 30064 |
| 972 | Ga0496108_0005230 | 3300048911 | Bacteria | 10477 |
| 973 | Ga0496108_0034870 | 3300048911 | Bacteria | 4181 |
| 974 | Ga0496109_0001407 | 3300048912 | Bacteria | 19953 |
| 975 | Ga0496109_0005646 | 3300048912 | Bacteria | 10464 |
| 976 | Ga0496109_0285204 | 3300048912 | Bacteria | 1556 |
| 977 | Ga0496110_0018684 | 3300048913 | Bacteria | 5815 |
| 978 | Ga0496110_0065369 | 3300048913 | Bacteria | 3215 |
| 979 | Ga0496110_0444838 | 3300048913 | Bacteria | 1181 |
| 980 | Ga0496110_1073373 | 3300048913 | Bacteria | 713 |
| 981 | Ga0496111_0078263 | 3300048914 | Bacteria | 2411 |
| 982 | Ga0496111_0333052 | 3300048914 | Bacteria | 1124 |
| 983 | Ga0496112_0005822 | 3300048915 | Bacteria | 10731 |
| 984 | Ga0496112_0030428 | 3300048915 | Bacteria | 5224 |
| 985 | Ga0496112_0069799 | 3300048915 | Bacteria | 3470 |
| 986 | Ga0496112_0089521 | 3300048915 | Bacteria | 3046 |
| 987 | Ga0496112_0097854 | 3300048915 | Bacteria | 2904 |
| 988 | Ga0496112_0164043 | 3300048915 | Bacteria | 2188 |
| 989 | Ga0496112_0220787 | 3300048915 | Bacteria | 1851 |
| 990 | Ga0496112_0358193 | 3300048915 | Bacteria | 1401 |
| 991 | Ga0496113_0073598 | 3300048916 | Bacteria | 2603 |
| 992 | Ga0496113_0468122 | 3300048916 | Bacteria | 1013 |
| 993 | Ga0496114_0023481 | 3300048917 | Bacteria | 5033 |
| 994 | Ga0496114_0166178 | 3300048917 | Bacteria | 1921 |
| 995 | Ga0496115_0001962 | 3300048918 | Bacteria | 14682 |
| 996 | Ga0496115_0002796 | 3300048918 | Bacteria | 12540 |
| 997 | Ga0496115_0010930 | 3300048918 | Bacteria | 6796 |
| 998 | Ga0496115_0012733 | 3300048918 | Bacteria | 6339 |
| 999 | Ga0496115_0279760 | 3300048918 | Bacteria | 1370 |
| 1000 | Ga0496115_0652816 | 3300048918 | Bacteria | 831 |
| 1001 | Ga0496117_0039261 | 3300048920 | Bacteria | 3496 |
| 1002 | Ga0496117_0056067 | 3300048920 | Bacteria | 2748 |
| 1003 | Ga0496117_0090740 | 3300048920 | Bacteria | 1968 |
| 1004 | Ga0496118_0006091 | 3300048921 | Bacteria | 13407 |
| 1005 | Ga0496118_0010206 | 3300048921 | Bacteria | 9325 |
| 1006 | Ga0496118_0057706 | 3300048921 | Bacteria | 2907 |
| 1007 | Ga0496118_0183459 | 3300048921 | Bacteria | 1261 |
| 1008 | Ga0496119_0023537 | 3300048922 | Bacteria | 4363 |
| 1009 | Ga0496120_0291662 | 3300048923 | Bacteria | 750 |
| 1010 | Ga0496121_0000053 | 3300048924 | Bacteria | 312611 |
| 1011 | Ga0496121_0001006 | 3300048924 | Bacteria | 50348 |
| 1012 | Ga0496121_0007140 | 3300048924 | Bacteria | 13552 |
| 1013 | Ga0496121_0012978 | 3300048924 | Bacteria | 9004 |
| 1014 | Ga0496121_0036555 | 3300048924 | Bacteria | 4375 |
| 1015 | Ga0496121_0037388 | 3300048924 | Bacteria | 4312 |
| 1016 | Ga0496121_0095890 | 3300048924 | Bacteria | 2304 |
| 1017 | Ga0496122_0028275 | 3300048925 | Bacteria | 4764 |
| 1018 | Ga0496122_0175784 | 3300048925 | Bacteria | 1283 |
| 1019 | Ga0496123_0034089 | 3300048926 | Bacteria | 3652 |
| 1020 | Ga0496123_0181302 | 3300048926 | Bacteria | 1099 |
| 1021 | Ga0496124_0027923 | 3300048927 | Bacteria | 5054 |
| 1022 | Ga0496124_0134902 | 3300048927 | Bacteria | 1955 |
| 1023 | Ga0496124_0163386 | 3300048927 | Bacteria | 1733 |
| 1024 | Ga0496124_0273170 | 3300048927 | Bacteria | 1236 |
| 1025 | Ga0496124_0490044 | 3300048927 | Bacteria | 827 |
| 1026 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 1027 | Ga0496125_0000692 | 3300048928 | Bacteria | 55634 |
| 1028 | Ga0496125_0004834 | 3300048928 | Bacteria | 15300 |
| 1029 | Ga0496125_0206556 | 3300048928 | Bacteria | 1280 |
| 1030 | Ga0496125_0207858 | 3300048928 | Bacteria | 1274 |
| 1031 | Ga0496125_0308976 | 3300048928 | Bacteria | 964 |
| 1032 | Ga0496126_0005437 | 3300048929 | Bacteria | 14524 |
| 1033 | Ga0496126_0005856 | 3300048929 | Bacteria | 13876 |
| 1034 | Ga0496126_0010695 | 3300048929 | Bacteria | 9587 |
| 1035 | Ga0496126_0024996 | 3300048929 | Bacteria | 5757 |
| 1036 | Ga0496126_0061522 | 3300048929 | Bacteria | 3372 |
| 1037 | Ga0496126_0084558 | 3300048929 | Bacteria | 2798 |
| 1038 | Ga0496126_0088140 | 3300048929 | Bacteria | 2734 |
| 1039 | Ga0496126_0105848 | 3300048929 | Bacteria | 2455 |
| 1040 | Ga0496126_0194926 | 3300048929 | Bacteria | 1714 |
| 1041 | Ga0496126_0221731 | 3300048929 | Bacteria | 1588 |
| 1042 | Ga0496126_0776235 | 3300048929 | Bacteria | 737 |
| 1043 | Ga0495682_0062222 | 3300049460 | Bacteria | 1347 |
| 1044 | Ga0501314_019671 | 3300049530 | Bacteria | 694 |
| 1045 | Ga0501317_046203 | 3300049533 | Bacteria | 679 |
| 1046 | Ga0501323_035212 | 3300049539 | Bacteria | 717 |
| 1047 | Ga0501329_02705 | 3300049545 | Bacteria | 865 |
| 1048 | Ga0501335_017530 | 3300049551 | Bacteria | 744 |
| 1049 | Ga0501336_018612 | 3300049552 | Bacteria | 617 |
| 1050 | Ga0501031_0018753 | 3300049568 | Bacteria | 4504 |
| 1051 | Ga0501031_0040667 | 3300049568 | Bacteria | 3036 |
| 1052 | Ga0501031_0131864 | 3300049568 | Bacteria | 1632 |
| 1053 | Ga0501032_0036721 | 3300049569 | Bacteria | 3344 |
| 1054 | Ga0501032_0408136 | 3300049569 | Bacteria | 872 |
| 1055 | Ga0501033_0010145 | 3300049570 | Bacteria | 7230 |
| 1056 | Ga0501033_0039811 | 3300049570 | Bacteria | 3510 |
| 1057 | Ga0501033_0057649 | 3300049570 | Bacteria | 2870 |
| 1058 | Ga0501033_0061003 | 3300049570 | Bacteria | 2780 |
| 1059 | Ga0501033_0062673 | 3300049570 | Bacteria | 2738 |
| 1060 | Ga0501033_0666746 | 3300049570 | Bacteria | 710 |
| 1061 | Ga0501034_0002925 | 3300049571 | Bacteria | 19803 |
| 1062 | Ga0501034_0052520 | 3300049571 | Bacteria | 4105 |
| 1063 | Ga0501034_0891302 | 3300049571 | Bacteria | 778 |
| 1064 | Ga0501036_0017092 | 3300049572 | Bacteria | 6064 |
| 1065 | Ga0501036_0019870 | 3300049572 | Bacteria | 5640 |
| 1066 | Ga0501036_0045518 | 3300049572 | Bacteria | 3717 |
| 1067 | Ga0501037_0018936 | 3300049573 | Bacteria | 5075 |
| 1068 | Ga0501037_0132577 | 3300049573 | Bacteria | 1786 |
| 1069 | Ga0501037_0140022 | 3300049573 | Bacteria | 1732 |
| 1070 | Ga0501037_0143231 | 3300049573 | Bacteria | 1710 |
| 1071 | Ga0501037_0194571 | 3300049573 | Bacteria | 1435 |
| 1072 | Ga0501038_0061441 | 3300049574 | Bacteria | 3213 |
| 1073 | Ga0501038_0140642 | 3300049574 | Bacteria | 1975 |
| 1074 | Ga0501038_0203618 | 3300049574 | Bacteria | 1587 |
| 1075 | Ga0501038_0210776 | 3300049574 | Bacteria | 1554 |
| 1076 | Ga0501038_0741293 | 3300049574 | Bacteria | 733 |
| 1077 | Ga0501039_0001765 | 3300049575 | Bacteria | 15962 |
| 1078 | Ga0501039_0082192 | 3300049575 | Bacteria | 2508 |
| 1079 | Ga0501039_0099838 | 3300049575 | Bacteria | 2265 |
| 1080 | Ga0501040_0002053 | 3300049576 | Bacteria | 12978 |
| 1081 | Ga0501040_0006026 | 3300049576 | Bacteria | 7847 |
| 1082 | Ga0501040_0041569 | 3300049576 | Bacteria | 3131 |
| 1083 | Ga0501041_0031708 | 3300049577 | Bacteria | 3194 |
| 1084 | Ga0501041_0032148 | 3300049577 | Bacteria | 3171 |
| 1085 | Ga0501041_0107255 | 3300049577 | Bacteria | 1731 |
| 1086 | Ga0501041_0222424 | 3300049577 | Bacteria | 1185 |
| 1087 | Ga0501042_0006496 | 3300049578 | Bacteria | 7592 |
| 1088 | Ga0501042_0007090 | 3300049578 | Bacteria | 7324 |
| 1089 | Ga0501042_0101129 | 3300049578 | Bacteria | 2073 |
| 1090 | Ga0501042_0210836 | 3300049578 | Bacteria | 1401 |
| 1091 | Ga0501042_0856644 | 3300049578 | Bacteria | 662 |
| 1092 | Ga0501043_0020010 | 3300049579 | Bacteria | 5253 |
| 1093 | Ga0501043_0083945 | 3300049579 | Bacteria | 2504 |
| 1094 | Ga0501043_0382572 | 3300049579 | Bacteria | 1065 |
| 1095 | Ga0501043_0462899 | 3300049579 | Bacteria | 951 |
| 1096 | Ga0501046_0013607 | 3300049580 | Bacteria | 6882 |
| 1097 | Ga0501046_0033739 | 3300049580 | Bacteria | 4133 |
| 1098 | Ga0501046_0052251 | 3300049580 | Bacteria | 3221 |
| 1099 | Ga0501046_0104794 | 3300049580 | Bacteria | 2167 |
| 1100 | Ga0501047_0024481 | 3300049581 | Bacteria | 5793 |
| 1101 | Ga0501047_0035413 | 3300049581 | Bacteria | 4823 |
| 1102 | Ga0501047_0060948 | 3300049581 | Bacteria | 3640 |
| 1103 | Ga0501047_0394826 | 3300049581 | Bacteria | 1217 |
| 1104 | Ga0501047_0704524 | 3300049581 | Bacteria | 827 |
| 1105 | Ga0501048_0050138 | 3300049582 | Bacteria | 2973 |
| 1106 | Ga0501048_0063127 | 3300049582 | Bacteria | 2621 |
| 1107 | Ga0501048_0071077 | 3300049582 | Bacteria | 2457 |
| 1108 | Ga0501048_0547898 | 3300049582 | Bacteria | 830 |
| 1109 | Ga0501067_0083497 | 3300049583 | Bacteria | 1772 |
| 1110 | Ga0501068_0046288 | 3300049584 | Bacteria | 2623 |
| 1111 | Ga0501068_0166528 | 3300049584 | Bacteria | 1390 |
| 1112 | Ga0501068_0205588 | 3300049584 | Bacteria | 1249 |
| 1113 | Ga0501070_0000329 | 3300049586 | Bacteria | 43062 |
| 1114 | Ga0501071_0002499 | 3300049587 | Bacteria | 11181 |
| 1115 | Ga0501071_0043672 | 3300049587 | Bacteria | 3215 |
| 1116 | Ga0501071_0083826 | 3300049587 | Bacteria | 2335 |
| 1117 | Ga0501071_0205774 | 3300049587 | Bacteria | 1479 |
| 1118 | Ga0501072_0000404 | 3300049588 | Bacteria | 30870 |
| 1119 | Ga0501072_0005957 | 3300049588 | Bacteria | 9289 |
| 1120 | Ga0501072_0284636 | 3300049588 | Bacteria | 1315 |
| 1121 | Ga0501073_0094101 | 3300049589 | Bacteria | 2081 |
| 1122 | Ga0501073_0341263 | 3300049589 | Bacteria | 1034 |
| 1123 | Ga0501074_0020761 | 3300049590 | Bacteria | 4772 |
| 1124 | Ga0501074_0068008 | 3300049590 | Bacteria | 2561 |
| 1125 | Ga0501074_0174655 | 3300049590 | Bacteria | 1533 |
| 1126 | Ga0501074_0514973 | 3300049590 | Bacteria | 848 |
| 1127 | Ga0501075_0003123 | 3300049591 | Bacteria | 11073 |
| 1128 | Ga0501075_0056549 | 3300049591 | Bacteria | 2953 |
| 1129 | Ga0501075_0081749 | 3300049591 | Bacteria | 2446 |
| 1130 | Ga0501075_0134392 | 3300049591 | Bacteria | 1884 |
| 1131 | Ga0501075_0143716 | 3300049591 | Bacteria | 1818 |
| 1132 | Ga0501075_0278874 | 3300049591 | Bacteria | 1274 |
| 1133 | Ga0501076_0008200 | 3300049592 | Bacteria | 7652 |
| 1134 | Ga0501076_0014532 | 3300049592 | Bacteria | 5932 |
| 1135 | Ga0501076_0051590 | 3300049592 | Bacteria | 3256 |
| 1136 | Ga0501076_0273486 | 3300049592 | Bacteria | 1383 |
| 1137 | Ga0501077_0002661 | 3300049593 | Bacteria | 10707 |
| 1138 | Ga0501077_0007349 | 3300049593 | Bacteria | 6792 |
| 1139 | Ga0501077_0014674 | 3300049593 | Bacteria | 4924 |
| 1140 | Ga0501077_0066656 | 3300049593 | Bacteria | 2284 |
| 1141 | Ga0501077_0189801 | 3300049593 | Bacteria | 1305 |
| 1142 | Ga0501077_0543500 | 3300049593 | Bacteria | 745 |
| 1143 | Ga0501238_002774 | 3300049671 | Bacteria | 2119 |
| 1144 | Ga0501257_003510 | 3300049686 | Bacteria | 3369 |
| 1145 | Ga0501079_0017122 | 3300049741 | Bacteria | 5534 |
| 1146 | Ga0501079_0028862 | 3300049741 | Bacteria | 4258 |
| 1147 | Ga0501079_0078560 | 3300049741 | Bacteria | 2552 |
| 1148 | Ga0501080_0160907 | 3300049742 | Bacteria | 2073 |
| 1149 | Ga0501080_0230862 | 3300049742 | Bacteria | 1691 |
| 1150 | Ga0501081_0005768 | 3300049743 | Bacteria | 8018 |
| 1151 | Ga0501081_0048682 | 3300049743 | Bacteria | 2917 |
| 1152 | Ga0501081_0090285 | 3300049743 | Bacteria | 2153 |
| 1153 | Ga0501273_027996 | 3300049770 | Bacteria | 792 |
| 1154 | Ga0501035_0001146 | 3300049822 | Bacteria | 27712 |
| 1155 | Ga0501035_0057192 | 3300049822 | Bacteria | 3478 |
| 1156 | Ga0501035_0216337 | 3300049822 | Bacteria | 1638 |
| 1157 | Ga0501035_0317235 | 3300049822 | Bacteria | 1310 |
| 1158 | Ga0501044_0014747 | 3300049823 | Bacteria | 8425 |
| 1159 | Ga0501044_0018956 | 3300049823 | Bacteria | 7368 |
| 1160 | Ga0501044_0110240 | 3300049823 | Bacteria | 2761 |
| 1161 | Ga0501044_0138142 | 3300049823 | Bacteria | 2427 |
| 1162 | Ga0501044_1029363 | 3300049823 | Bacteria | 694 |
| 1163 | Ga0501045_0000769 | 3300049824 | Bacteria | 20594 |
| 1164 | Ga0501045_0012830 | 3300049824 | Bacteria | 5906 |
| 1165 | Ga0501045_0033121 | 3300049824 | Bacteria | 3747 |
| 1166 | Ga0501045_0064576 | 3300049824 | Bacteria | 2687 |
| 1167 | nmdc:mga03683_102815_c1 | 3300050489 | Bacteria | 1257 |
| 1168 | nmdc:mga00v17_76660_c1 | 3300050491 | Bacteria | 2080 |
| 1169 | nmdc:mga0yw44_283950_c1 | 3300050492 | Bacteria | 1107 |
| 1170 | nmdc:mga0yw44_40419_c1 | 3300050492 | Bacteria | 2771 |
| 1171 | nmdc:mga0yw44_578169_c1 | 3300050492 | Bacteria | 763 |
| 1172 | nmdc:mga0k408_99988_c1 | 3300050493 | Bacteria | 1710 |
| 1173 | nmdc:mga06z11_2536_c1 | 3300050494 | Bacteria | 6982 |
| 1174 | nmdc:mga06z11_398842_c1 | 3300050494 | Bacteria | 828 |
| 1175 | nmdc:mga04h51_3728_c1 | 3300050495 | Bacteria | 3731 |
| 1176 | nmdc:mga07m45_132961_c1 | 3300050496 | Bacteria | 1440 |
| 1177 | nmdc:mga07m45_154896_c1 | 3300050496 | Bacteria | 1329 |
| 1178 | nmdc:mga05p37_112203_c1 | 3300050507 | Bacteria | 3353 |
| 1179 | nmdc:mga05p37_154934_c1 | 3300050507 | Bacteria | 2801 |
| 1180 | nmdc:mga05p37_171_c1 | 3300050507 | Bacteria | 63303 |
| 1181 | nmdc:mga05p37_185239_c1 | 3300050507 | Bacteria | 2531 |
| 1182 | nmdc:mga05p37_478512_c1 | 3300050507 | Bacteria | 1435 |
| 1183 | nmdc:mga05p37_634367_c1 | 3300050507 | Bacteria | 1200 |
| 1184 | nmdc:mga05p37_94514_c1 | 3300050507 | Bacteria | 3683 |
| 1185 | nmdc:mga09592_183_c1 | 3300050508 | Bacteria | 44709 |
| 1186 | nmdc:mga09592_192657_c1 | 3300050508 | Bacteria | 1765 |
| 1187 | nmdc:mga09592_565_c1 | 3300050508 | Bacteria | 28059 |
| 1188 | nmdc:mga09592_617536_c1 | 3300050508 | Bacteria | 928 |
| 1189 | nmdc:mga0qj67_14906_c1 | 3300050509 | Bacteria | 5879 |
| 1190 | nmdc:mga0qj67_300347_c1 | 3300050509 | Bacteria | 1301 |
| 1191 | nmdc:mga0qj67_306246_c1 | 3300050509 | Bacteria | 1287 |
| 1192 | nmdc:mga0qj67_337702_c1 | 3300050509 | Bacteria | 1219 |
| 1193 | nmdc:mga0qj67_538_c1 | 3300050509 | Bacteria | 25772 |
| 1194 | nmdc:mga06r32_102130_c1 | 3300050510 | Bacteria | 2815 |
| 1195 | nmdc:mga06r32_10511_c1 | 3300050510 | Bacteria | 8348 |
| 1196 | nmdc:mga06r32_156443_c1 | 3300050510 | Bacteria | 2261 |
| 1197 | nmdc:mga06r32_342_c1 | 3300050510 | Bacteria | 38838 |
| 1198 | nmdc:mga06r32_54803_c1 | 3300050510 | Bacteria | 3824 |
| 1199 | nmdc:mga0n895_150649_c1 | 3300050512 | Bacteria | 2356 |
| 1200 | nmdc:mga0n895_68361_c1 | 3300050512 | Bacteria | 3519 |
| 1201 | nmdc:mga0rr50_351456_c1 | 3300050513 | Bacteria | 1240 |
| 1202 | nmdc:mga0sz30_190741_c1 | 3300050516 | Bacteria | 910 |
| 1203 | nmdc:mga0sz30_94027_c2 | 3300050516 | Bacteria | 881 |
| 1204 | Ga0495601_0102887 | 3300053077 | Bacteria | 1846 |
| 1205 | Ga0495601_0112525 | 3300053077 | Bacteria | 1763 |
| 1206 | Ga0495601_0215294 | 3300053077 | Bacteria | 1255 |
| 1207 | Ga0495612_0007827 | 3300053078 | Bacteria | 4359 |
| 1208 | Ga0495612_0027321 | 3300053078 | Bacteria | 2294 |
| 1209 | Ga0495612_0087489 | 3300053078 | Bacteria | 1315 |
| 1210 | Ga0495612_0143475 | 3300053078 | Bacteria | 1037 |
| 1211 | Ga0500635_0000253 | 3300053080 | Bacteria | 22197 |
| 1212 | Ga0500635_0021631 | 3300053080 | Bacteria | 1984 |
| 1213 | Ga0500635_0059095 | 3300053080 | Bacteria | 1333 |
| 1214 | Ga0495595_0120370 | 3300053084 | Bacteria | 1278 |
| 1215 | Ga0495595_0231231 | 3300053084 | Bacteria | 924 |
| 1216 | Ga0495619_0030125 | 3300053085 | Bacteria | 3511 |
| 1217 | Ga0495619_0034980 | 3300053085 | Bacteria | 3267 |
| 1218 | Ga0495619_0223782 | 3300053085 | Bacteria | 1303 |
| 1219 | Ga0495619_0232128 | 3300053085 | Bacteria | 1278 |
| 1220 | Ga0500578_0000004 | 3300053086 | Bacteria | 260037 |
| 1221 | Ga0500578_0143138 | 3300053086 | Bacteria | 1494 |
| 1222 | Ga0500643_010462 | 3300053087 | Bacteria | 3450 |
| 1223 | Ga0500643_051721 | 3300053087 | Bacteria | 1172 |
| 1224 | Ga0500644_0015838 | 3300053088 | Bacteria | 2159 |
| 1225 | Ga0500651_0290965 | 3300053093 | Bacteria | 939 |
| 1226 | Ga0500566_0000064 | 3300053094 | Bacteria | 50908 |
| 1227 | Ga0500641_0000579 | 3300053096 | Bacteria | 13194 |
| 1228 | Ga0500641_0005464 | 3300053096 | Bacteria | 4503 |
| 1229 | Ga0500654_097567 | 3300053099 | Bacteria | 1272 |
| 1230 | Ga0500555_001693 | 3300053103 | Bacteria | 6635 |
| 1231 | Ga0500555_031479 | 3300053103 | Bacteria | 1503 |
| 1232 | Ga0500556_0032494 | 3300053104 | Bacteria | 1783 |
| 1233 | Ga0500556_0106605 | 3300053104 | Bacteria | 1084 |
| 1234 | Ga0500557_000039 | 3300053105 | Bacteria | 66862 |
| 1235 | Ga0500562_000608 | 3300053108 | Bacteria | 8644 |
| 1236 | Ga0500562_001033 | 3300053108 | Bacteria | 6815 |
| 1237 | Ga0500572_000026 | 3300053111 | Bacteria | 45518 |
| 1238 | Ga0500572_000344 | 3300053111 | Bacteria | 16637 |
| 1239 | Ga0500572_001098 | 3300053111 | Bacteria | 7936 |
| 1240 | Ga0500591_132517 | 3300053115 | Bacteria | 1002 |
| 1241 | Ga0500592_037410 | 3300053116 | Bacteria | 784 |
| 1242 | Ga0500592_043485 | 3300053116 | Bacteria | 728 |
| 1243 | Ga0500594_0000138 | 3300053118 | Bacteria | 20114 |
| 1244 | Ga0500595_001915 | 3300053119 | Bacteria | 10728 |
| 1245 | Ga0500595_002372 | 3300053119 | Bacteria | 9413 |
| 1246 | Ga0500595_003808 | 3300053119 | Bacteria | 6935 |
| 1247 | Ga0500595_004822 | 3300053119 | Bacteria | 5969 |
| 1248 | Ga0500595_005581 | 3300053119 | Bacteria | 5476 |
| 1249 | Ga0500595_009864 | 3300053119 | Bacteria | 3831 |
| 1250 | Ga0500595_016291 | 3300053119 | Bacteria | 2772 |
| 1251 | Ga0500597_129962 | 3300053120 | Bacteria | 1089 |
| 1252 | Ga0500607_025494 | 3300053121 | Bacteria | 3290 |
| 1253 | Ga0500608_000023 | 3300053122 | Bacteria | 72341 |
| 1254 | Ga0500608_019488 | 3300053122 | Bacteria | 3112 |
| 1255 | Ga0500608_141741 | 3300053122 | Bacteria | 1064 |
| 1256 | Ga0500614_008827 | 3300053123 | Bacteria | 2142 |
| 1257 | Ga0500614_010766 | 3300053123 | Bacteria | 1968 |
| 1258 | Ga0500621_016170 | 3300053126 | Bacteria | 2759 |
| 1259 | Ga0500642_0000063 | 3300053130 | Bacteria | 58680 |
| 1260 | Ga0500642_0019596 | 3300053130 | Bacteria | 2642 |
| 1261 | Ga0500652_079500 | 3300053131 | Bacteria | 1365 |
| 1262 | Ga0500655_034645 | 3300053133 | Bacteria | 980 |
| 1263 | Ga0500658_0049187 | 3300053134 | Bacteria | 1717 |
| 1264 | Ga0500658_0146711 | 3300053134 | Bacteria | 1061 |
| 1265 | Ga0500559_0000002 | 3300053136 | Bacteria | 262002 |
| 1266 | Ga0500559_0001395 | 3300053136 | Bacteria | 13743 |
| 1267 | Ga0500559_0003076 | 3300053136 | Bacteria | 8326 |
| 1268 | Ga0500559_0007457 | 3300053136 | Bacteria | 4847 |
| 1269 | Ga0500559_0146195 | 3300053136 | Bacteria | 1108 |
| 1270 | Ga0500559_0180086 | 3300053136 | Bacteria | 995 |
| 1271 | Ga0500561_0046394 | 3300053137 | Bacteria | 1169 |
| 1272 | Ga0500564_000305 | 3300053138 | Bacteria | 13757 |
| 1273 | Ga0500568_0141317 | 3300053139 | Bacteria | 892 |
| 1274 | Ga0500577_0000092 | 3300053142 | Bacteria | 21385 |
| 1275 | Ga0500577_0223170 | 3300053142 | Bacteria | 816 |
| 1276 | Ga0500585_141361 | 3300053144 | Bacteria | 847 |
| 1277 | Ga0500603_025338 | 3300053150 | Bacteria | 1491 |
| 1278 | Ga0500616_0023510 | 3300053153 | Bacteria | 3432 |
| 1279 | Ga0500619_003604 | 3300053154 | Bacteria | 3200 |
| 1280 | Ga0500622_0000284 | 3300053156 | Bacteria | 51631 |
| 1281 | Ga0500622_0003739 | 3300053156 | Bacteria | 9948 |
| 1282 | Ga0500622_0017705 | 3300053156 | Bacteria | 3791 |
| 1283 | Ga0500622_0038142 | 3300053156 | Bacteria | 2507 |
| 1284 | Ga0500627_0003805 | 3300053158 | Bacteria | 4740 |
| 1285 | Ga0500627_0055665 | 3300053158 | Bacteria | 1732 |
| 1286 | Ga0500630_000572 | 3300053159 | Bacteria | 16714 |
| 1287 | Ga0500633_0120469 | 3300053160 | Bacteria | 976 |
| 1288 | Ga0500634_0041129 | 3300053161 | Bacteria | 2510 |
| 1289 | Ga0500638_000124 | 3300053162 | Bacteria | 14946 |
| 1290 | Ga0500638_073702 | 3300053162 | Bacteria | 1629 |
| 1291 | Ga0500638_192661 | 3300053162 | Bacteria | 869 |
| 1292 | Ga0500639_000353 | 3300053163 | Bacteria | 22721 |
| 1293 | Ga0500639_104745 | 3300053163 | Bacteria | 1386 |
| 1294 | Ga0500639_158560 | 3300053163 | Bacteria | 1033 |
| 1295 | Ga0500636_0027446 | 3300053177 | Bacteria | 3364 |
| 1296 | Ga0500636_0207102 | 3300053177 | Bacteria | 1032 |
| 1297 | Ga0500637_0000356 | 3300053178 | Bacteria | 17344 |
| 1298 | Ga0500637_0053738 | 3300053178 | Bacteria | 2299 |
| 1299 | Ga0500576_040143 | 3300053725 | Bacteria | 2109 |
| 1300 | Ga0500625_080811 | 3300053729 | Bacteria | 1419 |
| 1301 | Ga0500645_014088 | 3300053730 | Bacteria | 2554 |
| 1302 | Ga0500596_004103 | 3300053735 | Bacteria | 2699 |
| 1303 | Ga0500596_006575 | 3300053735 | Bacteria | 1956 |
| 1304 | Ga0500599_001756 | 3300053736 | Bacteria | 2537 |
| 1305 | Ga0501084_0001541 | 3300054114 | Bacteria | 18335 |
| 1306 | Ga0501084_0007455 | 3300054114 | Bacteria | 9018 |
| 1307 | Ga0501084_0045054 | 3300054114 | Bacteria | 3694 |
| 1308 | Ga0500661_000328 | 3300055283 | Bacteria | 8643 |
| 1309 | Ga0590074_010167 | 3300059423 | Bacteria | 1573 |
| 1310 | Ga0587084_036967 | 3300059477 | Bacteria | 813 |
| 1311 | Ga0587084_048941 | 3300059477 | Bacteria | 743 |
| 1312 | Ga0587084_051779 | 3300059477 | Bacteria | 729 |
| 1313 | Ga0587084_072327 | 3300059477 | Bacteria | 653 |
| 1314 | Ga0587077_083954 | 3300059493 | Bacteria | 736 |
| 1315 | Ga0587085_051521 | 3300059506 | Bacteria | 751 |
| 1316 | Ga0587086_030546 | 3300059507 | Bacteria | 790 |
| 1317 | Ga0587101_051517 | 3300059623 | Bacteria | 710 |
| 1318 | Ga0587115_040151 | 3300059626 | Bacteria | 728 |
| 1319 | Ga0587062_041186 | 3300059639 | Bacteria | 750 |
| 1320 | Ga0587068_031220 | 3300059641 | Bacteria | 925 |
| 1321 | Ga0587068_054066 | 3300059641 | Bacteria | 758 |
| 1322 | Ga0587072_070570 | 3300059643 | Bacteria | 737 |
| 1323 | Ga0587079_080167 | 3300059647 | Bacteria | 745 |
| 1324 | Ga0501082_0003607 | 3300060353 | Bacteria | 13517 |
| 1325 | Ga0501082_0005568 | 3300060353 | Bacteria | 10936 |
| 1326 | Ga0501082_0117648 | 3300060353 | Bacteria | 2302 |
| 1327 | Ga0501082_0273588 | 3300060353 | Bacteria | 1470 |
| 1328 | Ga0501082_0643757 | 3300060353 | Bacteria | 928 |
| 1329 | Ga0501082_0746699 | 3300060353 | Bacteria | 856 |
| 1330 | Ga0530510_0000429 | 3300061734 | Bacteria | 27096 |
| 1331 | Ga0530510_0005706 | 3300061734 | Bacteria | 8623 |
| 1332 | Ga0530510_0007861 | 3300061734 | Bacteria | 7438 |
| 1333 | Ga0530510_0033114 | 3300061734 | Bacteria | 3720 |
| 1334 | 2508544080 | 2508501009 | Bacteria | 7784016 |
| 1335 | 2509153763 | 2508501128 | Bacteria | 8613869 |
| 1336 | 2513660051 | 2513237096 | Bacteria | 8722461 |
| 1337 | 2513676488 | 2513237098 | Bacteria | 9902361 |
| 1338 | 2513696983 | 2513237101 | Bacteria | 7952346 |
| 1339 | 2513858229 | 2513237137 | Bacteria | 9558895 |
| 1340 | 2513922139 | 2513237145 | Bacteria | 8979722 |
| 1341 | 2517893882 | 2517572143 | Bacteria | 9484767 |
| 1342 | 2524537849 | 2524023228 | Bacteria | 10118060 |
| 1343 | 2535484567 | 2534681786 | Bacteria | 3308809 |
| 1344 | 2545678007 | 2545555834 | Bacteria | 8130841 |
| 1345 | 2585147323 | 2582581279 | Bacteria | 4980720 |
| 1346 | 2585150763 | 2582581280 | Bacteria | 5994497 |
| 1347 | 2585195735 | 2582581293 | Bacteria | 5907401 |
| 1348 | 2587916167 | 2585428106 | Bacteria | 5179711 |
| 1349 | 2596371274 | 2595698237 | Bacteria | 6712432 |
| 1350 | 2643751184 | 2643221545 | Bacteria | 5083237 |
| 1351 | 2643780554 | 2643221552 | Bacteria | 5708754 |
| 1352 | 2643929197 | 2643221584 | Bacteria | 5511711 |
| 1353 | 2644227337 | 2643221640 | Bacteria | 5258820 |
| 1354 | 2644233195 | 2643221642 | Bacteria | 5357871 |
| 1355 | 2644287793 | 2643221651 | Bacteria | 4798932 |
| 1356 | 2644511150 | 2643221691 | Bacteria | 5093099 |
| 1357 | 2671122875 | 2667528175 | Bacteria | 7532676 |
| 1358 | 2671692796 | 2671180139 | Bacteria | 4196045 |
| 1359 | 2723846426 | 2721755755 | Bacteria | 8322773 |
| 1360 | 2728748009 | 2728368998 | Bacteria | 8720350 |
| 1361 | 2738743370 | 2738541281 | Bacteria | 5112672 |
| 1362 | 2739352987 | 2738543032 | Bacteria | 5115625 |
| 1363 | 2739793299 | 2739367756 | Bacteria | 4553612 |
| 1364 | 2753359147 | 2751185800 | Bacteria | 5467370 |
| 1365 | 2757570020 | 2757320392 | Bacteria | 3737298 |
| 1366 | 2758641391 | 2758568016 | Bacteria | 5645291 |
| 1367 | 2792460098 | 2791355048 | Bacteria | 5832535 |
| 1368 | 2793072479 | 2791355197 | Bacteria | 8420563 |
| 1369 | 2793076915 | |||
| 1370 | 2819538689 | 2818991435 | Bacteria | 5433759 |
| 1371 | 2819646777 | 2818991454 | Bacteria | 5563326 |
| 1372 | 2843746665 | 2843744320 | Bacteria | 5659202 |
| 1373 | 2844317684 | 2844315083 | Bacteria | 8138177 |
| 1374 | 2849563781 | 2849560528 | Bacteria | 5393480 |
| 1375 | 2849576102 | 2849573788 | Bacteria | 5421256 |
| 1376 | 2851154917 | 2851153111 | Bacteria | 5542585 |
| 1377 | 2854915170 | 2854911287 | Bacteria | 5582813 |
| 1378 | 2857507458 | 2857504554 | Bacteria | 5369913 |
| 1379 | 2874610606 | 2874604998 | Bacteria | 7834745 |
| 1380 | 2874623165 | 2874620515 | Bacteria | 8290088 |
| 1381 | 2876816247 | 2876808645 | Bacteria | 8824342 |
| 1382 | 2879118668 | 2879110137 | Bacteria | 8907982 |
| 1383 | 2883295631 | 2883291878 | Bacteria | 5894118 |
| 1384 | 2884962731 | 2884960567 | Bacteria | 5437054 |
| 1385 | 2885368887 | 2885366525 | Bacteria | 8326213 |
| 1386 | 2885382470 | 2885374607 | Bacteria | 8927485 |
| 1387 | 2885387390 | 2885383462 | Bacteria | 9473874 |
| 1388 | 2889039060 | 2889033259 | Bacteria | 9099371 |
| 1389 | 2889306345 | 2889306138 | Bacteria | 6358934 |
| 1390 | 2894818995 | 2894817345 | Bacteria | 4892941 |
| 1391 | 2898331456 | 2898329390 | Bacteria | 5168154 |
| 1392 | 2902334960 | 2902330777 | Bacteria | 6395352 |
| 1393 | 2902408077 | 2902405164 | Bacteria | 6784948 |
| 1394 | 2903735364 | 2903727486 | Bacteria | 8281579 |
| 1395 | 2903750453 | 2903748898 | Bacteria | 9972761 |
| 1396 | 2903771736 | 2903768456 | Bacteria | 9749579 |
| 1397 | 2904669985 | 2904666416 | Bacteria | 8226587 |
| 1398 | 2904693470 | 2904690495 | Bacteria | 9412302 |
| 1399 | 2904700698 | |||
| 1400 | 2906608717 | 2906602504 | Bacteria | 8295279 |
| 1401 | 2906610772 | |||
| 1402 | 2906630150 | 2906626472 | Bacteria | 8826946 |
| 1403 | 2906635928 | 2906635258 | Bacteria | 8601019 |
| 1404 | 2906663975 | 2906660503 | Bacteria | 8595048 |
| 1405 | 2908744282 | 2908739725 | Bacteria | 8628932 |
| 1406 | 2908761795 | 2908756301 | Bacteria | 8864324 |
| 1407 | 2915651658 | 2915650412 | Bacteria | 4288180 |
| 1408 | 2917557478 | 2917554339 | Bacteria | 4987857 |
| 1409 | 2922362237 | 2922361189 | Bacteria | 7436256 |
| 1410 | 2922388008 | 2922386360 | Bacteria | 7017218 |
| 1411 | 2922428553 | |||
| 1412 | 2928126203 | 2928125067 | Bacteria | 5937560 |
| 1413 | 2928534269 | 2928531327 | Bacteria | 5101314 |
| 1414 | 2932402893 | 2932401849 | Bacteria | 4262978 |
| 1415 | 2935634533 | 2935630451 | Bacteria | 8169952 |
| 1416 | 2935771432 | 2935769743 | Bacteria | 7878163 |
| 1417 | 2935779121 | 2935777560 | Bacteria | 8077691 |
| 1418 | 2935788325 | 2935785616 | Bacteria | 7962367 |
| 1419 | 2935800862 | 2935793552 | Bacteria | 8012592 |
| 1420 | 2935911737 | 2935908558 | Bacteria | 8568796 |
| 1421 | 2935919392 | 2935916978 | Bacteria | 9113783 |
| 1422 | 2935928766 | 2935926038 | Bacteria | 8601059 |
| 1423 | 2935938411 | 2935934488 | Bacteria | 8602579 |
| 1424 | 2935945697 | 2935942939 | Bacteria | 8599779 |
| 1425 | 2935954696 | 2935951376 | Bacteria | 8602333 |
| 1426 | 2935970583 | 2935967501 | Bacteria | 8603075 |
| 1427 | 2941509019 | 2941507105 | Bacteria | 8166816 |
| 1428 | 2941516848 | 2941515067 | Bacteria | 8166720 |
| 1429 | 2941525057 | 2941523033 | Bacteria | 8169134 |
| 1430 | 2941536324 | 2941531003 | Bacteria | 7653939 |
| 1431 | 3005478684 | 3005474847 | Bacteria | 9259049 |
| 1432 | 3005597420 | 3005594810 | Bacteria | 8716512 |
| 1433 | 3005720862 | 3005718088 | Bacteria | 8283608 |
| 1434 | 641642475 | 641522639 | Bacteria | 7737025 |
| 1435 | 643598139 | 643348564 | Bacteria | 8839022 |
| 1436 | 8006942675 | 8006933436 | Bacteria | 10410654 |
| 1437 | 8006964812 | 8006964411 | Bacteria | 8966052 |
| 1438 | 8006982402 | 8006973647 | Bacteria | 10679141 |
| 1439 | 8006991791 | 8006984368 | Bacteria | 9651211 |
| 1440 | 8006995548 | 8006994254 | Bacteria | 8309700 |
| 1441 | 8016522953 | 8016522445 | Bacteria | 8156687 |
| 1442 | 8016536414 | 8016530956 | Bacteria | 8155261 |
| 1443 | 8016540695 | 8016539877 | Bacteria | 8155419 |
| 1444 | 8016560929 | 8016557553 | Bacteria | 8154380 |
| 1445 | 8016574777 | 8016566248 | Bacteria | 8158151 |
| 1446 | 8016578852 | 8016575299 | Bacteria | 8154085 |
| 1447 | 8016590787 | 8016583857 | Bacteria | 10421953 |
| 1448 | 8016598797 | 8016595262 | Bacteria | 8149947 |
| 1449 | 8016612284 | 8016603502 | Bacteria | 8731218 |
| 1450 | 8016628437 | 8016622563 | Bacteria | 7999408 |
| 1451 | 8019536135 | 8019530166 | Bacteria | 8155624 |
| 1452 | 8019543336 | 8019538911 | Bacteria | 7872763 |
| 1453 | 8019555521 | 8019547302 | Bacteria | 7996444 |
| 1454 | 8019558442 | 8019555841 | Bacteria | 9642137 |
| 1455 | 8019566856 | 8019565922 | Bacteria | 9639779 |
| 1456 | 8019656421 | 8019648815 | Bacteria | 10014479 |
| 1457 | 8019688383 | 8019687851 | Bacteria | 8712826 |
| 1458 | 8045865095 | 8045864390 | Bacteria | 5043873 |
| 1459 | 8056676406 | 8056673599 | Bacteria | 7871253 |
| 1460 | 8056691867 | 8056689827 | Bacteria | 6712655 |
| 1461 | 8056969488 | 8056967851 | Bacteria | 9038162 |
| 1462 | 8057530600 | 8057529695 | Bacteria | 6306553 |
| 1463 | Ga0373925_0039383 | |||
| 1464 | CNBas_1004380 | |||
| 1465 | JGI24739J22299_10120830 | |||
| 1466 | JGI24735J21928_10014695 | |||
| 1467 | JGI24738J21930_10071137 | |||
| 1468 | JGI25406J46586_10000101 | |||
| 1469 | Ga0055526_1028152 | |||
| 1470 | Ga0055537_1001423 | |||
| 1471 | Ga0055524_1005289 | |||
| 1472 | Ga0055524_1033973 | |||
| 1473 | Ga0055536_1011111 | |||
| 1474 | Ga0055528_1004840 | |||
| 1475 | Ga0055530_10002837 | |||
| 1476 | Ga0055530_10023172 | |||
| 1477 | Ga0055531_10001240 | |||
| 1478 | Ga0055531_10002429 | |||
| 1479 | Ga0055531_10004719 | |||
| 1480 | Ga0055531_10024439 | |||
| 1481 | Ga0055543_1018162 | |||
| 1482 | Ga0058862_12854699 | |||
| 1483 | Ga0065165_1000041 | |||
| 1484 | Ga0065165_1000633 | |||
| 1485 | Ga0065712_10253498 | |||
| 1486 | Ga0070658_10106345 | |||
| 1487 | Ga0070658_10144361 | |||
| 1488 | Ga0070658_10561700 | |||
| 1489 | Ga0070683_100072208 | |||
| 1490 | Ga0070683_100499675 | |||
| 1491 | Ga0070670_100000101 | |||
| 1492 | Ga0070670_100587604 | |||
| 1493 | Ga0070666_10067482 | |||
| 1494 | Ga0070666_10091155 | |||
| 1495 | Ga0070680_100009670 | |||
| 1496 | Ga0070680_100010206 | |||
| 1497 | Ga0070680_100116799 | |||
| 1498 | Ga0068868_100069182 | |||
| 1499 | Ga0070660_100010739 | |||
| 1500 | Ga0070660_100015321 | |||
| 1501 | Ga0070660_100069935 | |||
| 1502 | Ga0070660_100088007 | |||
| 1503 | Ga0070689_100370609 | |||
| 1504 | Ga0070691_10010631 | |||
| 1505 | Ga0070691_10044810 | |||
| 1506 | Ga0070661_100205100 | |||
| 1507 | Ga0070668_100002639 | |||
| 1508 | Ga0070668_100002804 | |||
| 1509 | Ga0070668_100006876 | |||
| 1510 | Ga0070668_100010442 | |||
| 1511 | Ga0070668_100024530 | |||
| 1512 | Ga0070668_100031453 | |||
| 1513 | Ga0070669_100299233 | |||
| 1514 | Ga0070669_100945213 | |||
| 1515 | Ga0070671_100010347 | |||
| 1516 | Ga0070674_100082069 | |||
| 1517 | Ga0070673_100294288 | |||
| 1518 | Ga0070659_100007601 | |||
| 1519 | Ga0070659_100105258 | |||
| 1520 | Ga0070659_100118253 | |||
| 1521 | Ga0070667_100000260 | |||
| 1522 | Ga0070667_100061934 | |||
| 1523 | Ga0070667_100415627 | |||
| 1524 | Ga0070714_100010680 | |||
| 1525 | Ga0070714_100027346 | |||
| 1526 | Ga0070713_100014590 | |||
| 1527 | Ga0070713_100183121 | |||
| 1528 | Ga0070710_10008646 | |||
| 1529 | Ga0070711_100022451 | |||
| 1530 | Ga0070711_100072618 | |||
| 1531 | Ga0070711_100342020 | |||
| 1532 | Ga0070663_100033825 | |||
| 1533 | Ga0070663_100702779 | |||
| 1534 | Ga0070678_100218620 | |||
| 1535 | Ga0070662_100343500 | |||
| 1536 | Ga0070681_10009749 | |||
| 1537 | Ga0070681_10020222 | |||
| 1538 | Ga0070681_10041919 | |||
| 1539 | Ga0070681_10089343 | |||
| 1540 | Ga0070681_10099566 | |||
| 1541 | Ga0070681_10441312 | |||
| 1542 | Ga0070681_11059156 | |||
| 1543 | Ga0070685_10313071 | |||
| 1544 | Ga0070706_100282188 | |||
| 1545 | Ga0070706_100320492 | |||
| 1546 | Ga0070706_100557247 | |||
| 1547 | Ga0070707_100926281 | |||
| 1548 | Ga0070698_100117512 | |||
| 1549 | Ga0070699_100130782 | |||
| 1550 | Ga0070679_100042441 | |||
| 1551 | Ga0070679_100046034 | |||
| 1552 | Ga0070679_100215694 | |||
| 1553 | Ga0070679_100267662 | |||
| 1554 | Ga0070684_100067429 | |||
| 1555 | Ga0070684_100806656 | |||
| 1556 | Ga0070697_100013902 | |||
| 1557 | Ga0070697_100231132 | |||
| 1558 | Ga0068853_100057282 | |||
| 1559 | Ga0068853_100310092 | |||
| 1560 | Ga0068853_100481855 | |||
| 1561 | Ga0068853_101570104 | |||
| 1562 | Ga0070672_100205918 | |||
| 1563 | Ga0070686_100245897 | |||
| 1564 | Ga0070695_100364240 | |||
| 1565 | Ga0070696_100169497 | |||
| 1566 | Ga0070696_100171209 | |||
| 1567 | Ga0070696_100490905 | |||
| 1568 | Ga0070696_100499431 | |||
| 1569 | Ga0070665_100000397 | |||
| 1570 | Ga0070665_100000880 | |||
| 1571 | Ga0070665_100002230 | |||
| 1572 | Ga0070665_100069160 | |||
| 1573 | Ga0070665_100502518 | |||
| 1574 | Ga0068855_100015616 | |||
| 1575 | Ga0068855_100018740 | |||
| 1576 | Ga0068855_100039947 | |||
| 1577 | Ga0068855_100123883 | |||
| 1578 | Ga0068855_100167450 | |||
| 1579 | Ga0068855_100271020 | |||
| 1580 | Ga0068855_100442475 | |||
| 1581 | Ga0070664_100033202 | |||
| 1582 | Ga0070664_100084582 | |||
| 1583 | Ga0068857_100026104 | |||
| 1584 | Ga0068857_100116325 | |||
| 1585 | Ga0068856_100134140 | |||
| 1586 | Ga0068856_100372226 | |||
| 1587 | Ga0070702_100267382 | |||
| 1588 | Ga0068852_100130708 | |||
| 1589 | Ga0068852_100135812 | |||
| 1590 | Ga0068852_100215372 | |||
| 1591 | Ga0068852_100559513 | |||
| 1592 | Ga0068852_100682386 | |||
| 1593 | Ga0068859_100000437 | |||
| 1594 | Ga0068859_100016312 | |||
| 1595 | Ga0068859_100304730 | |||
| 1596 | Ga0068864_100000496 | |||
| 1597 | Ga0068864_100000701 | |||
| 1598 | Ga0068864_100098794 | |||
| 1599 | Ga0068864_100107862 | |||
| 1600 | Ga0068861_100124429 | |||
| 1601 | Ga0068851_10207230 | |||
| 1602 | Ga0068863_100000864 | |||
| 1603 | Ga0068863_100001649 | |||
| 1604 | Ga0068863_100006085 | |||
| 1605 | Ga0068863_100009904 | |||
| 1606 | Ga0068863_100060517 | |||
| 1607 | Ga0068863_100113685 | |||
| 1608 | Ga0068863_100465067 | |||
| 1609 | Ga0068863_100482290 | |||
| 1610 | Ga0068863_100935709 | |||
| 1611 | Ga0068858_100000557 | |||
| 1612 | Ga0068860_100000070 | |||
| 1613 | Ga0068860_100000309 | |||
| 1614 | Ga0068862_100001520 | |||
| 1615 | Ga0068862_100056514 | |||
| 1616 | Ga0068862_100205590 | |||
| 1617 | Ga0068862_100345741 | |||
| 1618 | Ga0081455_10002423 | |||
| 1619 | Ga0081455_10010819 | |||
| 1620 | Ga0081538_10003068 | |||
| 1621 | Ga0081538_10022376 | |||
| 1622 | Ga0081538_10043188 | |||
| 1623 | Ga0081540_1019810 | |||
| 1624 | Ga0081540_1035967 | |||
| 1625 | Ga0081539_10000008 | |||
| 1626 | Ga0081539_10014085 | |||
| 1627 | Ga0070717_10016637 | |||
| 1628 | Ga0070717_10070743 | |||
| 1629 | Ga0075365_10093296 | |||
| 1630 | Ga0075368_10176869 | |||
| 1631 | Ga0075363_100124774 | |||
| 1632 | Ga0075364_10046198 | |||
| 1633 | Ga0075364_10370723 | |||
| 1634 | Ga0070715_10000358 | |||
| 1635 | Ga0070715_10210497 | |||
| 1636 | Ga0070716_100006533 | |||
| 1637 | Ga0070716_100242252 | |||
| 1638 | Ga0070712_100208013 | |||
| 1639 | Ga0075362_10037486 | |||
| 1640 | Ga0075367_10057233 | |||
| 1641 | Ga0075369_10076845 | |||
| 1642 | Ga0075369_10081048 | |||
| 1643 | Ga0075369_10163808 | |||
| 1644 | Ga0075366_10013172 | |||
| 1645 | Ga0075370_10069769 | |||
| 1646 | Ga0068871_100358309 | |||
| 1647 | Ga0068871_100804409 | |||
| 1648 | Ga0075428_100000612 | |||
| 1649 | Ga0075428_100006199 | |||
| 1650 | Ga0075428_100074390 | |||
| 1651 | Ga0075428_100217357 | |||
| 1652 | Ga0075430_100000371 | |||
| 1653 | Ga0075430_100007366 | |||
| 1654 | Ga0075430_100636539 | |||
| 1655 | Ga0075431_100000784 | |||
| 1656 | Ga0075431_100044588 | |||
| 1657 | Ga0075431_100120241 | |||
| 1658 | Ga0075431_100456694 | |||
| 1659 | Ga0075429_100001166 | |||
| 1660 | Ga0075429_100003441 | |||
| 1661 | Ga0075429_100115656 | |||
| 1662 | Ga0075429_100675920 | |||
| 1663 | Ga0068865_100004894 | |||
| 1664 | Ga0097620_100000437 | |||
| 1665 | Ga0097620_100016312 | |||
| 1666 | Ga0097620_100304730 | |||
| 1667 | Ga0075435_100248266 | |||
| 1668 | Ga0099794_10226604 | |||
| 1669 | Ga0099795_10014016 | |||
| 1670 | Ga0105244_10097418 | |||
| 1671 | Ga0105250_10057097 | |||
| 1672 | Ga0105240_10000870 | |||
| 1673 | Ga0105240_10027333 | |||
| 1674 | Ga0105240_10040364 | |||
| 1675 | Ga0105240_10041156 | |||
| 1676 | Ga0105240_10049045 | |||
| 1677 | Ga0105240_10123179 | |||
| 1678 | Ga0105240_10150129 | |||
| 1679 | Ga0111539_10354154 | |||
| 1680 | Ga0105247_10185132 | |||
| 1681 | Ga0114129_10033846 | |||
| 1682 | Ga0114129_10281198 | |||
| 1683 | Ga0114129_10285719 | |||
| 1684 | Ga0105243_10187333 | |||
| 1685 | Ga0105241_10473774 | |||
| 1686 | Ga0105242_10036107 | |||
| 1687 | Ga0105242_10831876 | |||
| 1688 | Ga0105242_10967200 | |||
| 1689 | Ga0105248_10002557 | |||
| 1690 | Ga0105248_10007729 | |||
| 1691 | Ga0105248_10008553 | |||
| 1692 | Ga0105248_10791780 | |||
| 1693 | Ga0105248_11792607 | |||
| 1694 | Ga0105237_10033614 | |||
| 1695 | Ga0105237_10059315 | |||
| 1696 | Ga0105238_10003129 | |||
| 1697 | Ga0105238_10006387 | |||
| 1698 | Ga0105238_10050733 | |||
| 1699 | Ga0105238_10168139 | |||
| 1700 | Ga0105249_10005538 | |||
| 1701 | Ga0105249_10423524 | |||
| 1702 | Ga0105249_10486055 | |||
| 1703 | Ga0105249_10512142 | |||
| 1704 | Ga0105249_10538176 | |||
| 1705 | Ga0099796_10005800 | |||
| 1706 | Ga0105239_10032269 | |||
| 1707 | Ga0105239_10270021 | |||
| 1708 | Ga0105239_10417378 | |||
| 1709 | Ga0157370_10050985 | |||
| 1710 | Ga0157370_10193638 | |||
| 1711 | Ga0157370_10515923 | |||
| 1712 | Ga0157369_10011431 | |||
| 1713 | Ga0157369_10020578 | |||
| 1714 | Ga0157369_10817895 | |||
| 1715 | Ga0157378_10720057 | |||
| 1716 | Ga0163162_11116593 | |||
| 1717 | Ga0157372_11417165 | |||
| 1718 | Ga0157375_10084432 | |||
| 1719 | Ga0163163_10045294 | |||
| 1720 | Ga0163163_10108001 | |||
| 1721 | Ga0163163_10180728 | |||
| 1722 | Ga0163163_10242858 | |||
| 1723 | Ga0163163_10275653 | |||
| 1724 | Ga0182008_10290951 | |||
| 1725 | Ga0157379_10000373 | |||
| 1726 | Ga0157379_10030580 | |||
| 1727 | Ga0157379_10216894 | |||
| 1728 | Ga0163161_10071187 | |||
| 1729 | Ga0163161_10401502 | |||
| 1730 | Ga0206356_11457785 | |||
| 1731 | Ga0206353_10655117 | |||
| 1732 | Ga0213874_10046890 | |||
| 1733 | Ga0213876_10000218 | |||
| 1734 | Ga0213875_10080495 | |||
| 1735 | Ga0224712_10185394 | |||
| 1736 | Ga0209026_1001465 | |||
| 1737 | Ga0209026_1012573 | |||
| 1738 | Ga0209148_1000344 | |||
| 1739 | Ga0209148_1005887 | |||
| 1740 | Ga0209233_1021012 | |||
| 1741 | Ga0209565_1000661 | |||
| 1742 | Ga0209455_1001281 | |||
| 1743 | Ga0209455_1009146 | |||
| 1744 | Ga0209673_1001807 | |||
| 1745 | Ga0209130_1042331 | |||
| 1746 | Ga0209675_1051408 | |||
| 1747 | Ga0209676_1000026 | |||
| 1748 | Ga0209676_1000067 | |||
| 1749 | Ga0209676_1000134 | |||
| 1750 | Ga0209564_1000164 | |||
| 1751 | Ga0209564_1010778 | |||
| 1752 | Ga0209758_1000555 | |||
| 1753 | Ga0209758_1000649 | |||
| 1754 | Ga0209758_1001988 | |||
| 1755 | Ga0209758_1002062 | |||
| 1756 | Ga0209758_1011655 | |||
| 1757 | Ga0209050_1000034 | |||
| 1758 | Ga0209050_1000348 | |||
| 1759 | Ga0209050_1001208 | |||
| 1760 | Ga0209050_1004246 | |||
| 1761 | Ga0209050_1035716 | |||
| 1762 | Ga0209050_1046109 | |||
| 1763 | Ga0209256_1010886 | |||
| 1764 | Ga0209256_1084284 | |||
| 1765 | Ga0209257_1000052 | |||
| 1766 | Ga0209257_1000066 | |||
| 1767 | Ga0209257_1000100 | |||
| 1768 | Ga0209257_1000424 | |||
| 1769 | Ga0209257_1000618 | |||
| 1770 | Ga0207697_10053351 | |||
| 1771 | Ga0207696_1078880 | |||
| 1772 | Ga0207682_10050958 | |||
| 1773 | Ga0207692_10147659 | |||
| 1774 | Ga0207710_10037028 | |||
| 1775 | Ga0207710_10038762 | |||
| 1776 | Ga0207710_10275677 | |||
| 1777 | Ga0207688_10041574 | |||
| 1778 | Ga0207688_10047746 | |||
| 1779 | Ga0207680_10029163 | |||
| 1780 | Ga0207680_10050436 | |||
| 1781 | Ga0207647_10003636 | |||
| 1782 | Ga0207685_10022739 | |||
| 1783 | Ga0207699_10002386 | |||
| 1784 | Ga0207699_10125930 | |||
| 1785 | Ga0207645_10181878 | |||
| 1786 | Ga0207643_10138117 | |||
| 1787 | Ga0207643_10285400 | |||
| 1788 | Ga0207705_10002082 | |||
| 1789 | Ga0207705_10088789 | |||
| 1790 | Ga0207705_10174852 | |||
| 1791 | Ga0207705_10319137 | |||
| 1792 | Ga0207684_10284644 | |||
| 1793 | Ga0207654_10027785 | |||
| 1794 | Ga0207654_10247229 | |||
| 1795 | Ga0207707_10000466 | |||
| 1796 | Ga0207707_10008012 | |||
| 1797 | Ga0207707_10035840 | |||
| 1798 | Ga0207707_10037513 | |||
| 1799 | Ga0207707_10230934 | |||
| 1800 | Ga0207707_10235479 | |||
| 1801 | Ga0207707_10293286 | |||
| 1802 | Ga0207707_10442252 | |||
| 1803 | Ga0207707_10506403 | |||
| 1804 | Ga0207695_10000029 | |||
| 1805 | Ga0207695_10001430 | |||
| 1806 | Ga0207695_10001687 | |||
| 1807 | Ga0207695_10006230 | |||
| 1808 | Ga0207695_10043806 | |||
| 1809 | Ga0207695_10057285 | |||
| 1810 | Ga0207695_10063634 | |||
| 1811 | Ga0207695_10134339 | |||
| 1812 | Ga0207695_10183143 | |||
| 1813 | Ga0207695_10446384 | |||
| 1814 | Ga0207671_10013462 | |||
| 1815 | Ga0207671_10057564 | |||
| 1816 | Ga0207671_10121542 | |||
| 1817 | Ga0207671_10175859 | |||
| 1818 | Ga0207671_10256670 | |||
| 1819 | Ga0207671_10770548 | |||
| 1820 | Ga0207693_10018646 | |||
| 1821 | Ga0207693_10215389 | |||
| 1822 | Ga0207663_10028365 | |||
| 1823 | Ga0207663_10028656 | |||
| 1824 | Ga0207663_10460513 | |||
| 1825 | Ga0207663_10815521 | |||
| 1826 | Ga0207660_10002013 | |||
| 1827 | Ga0207660_10004908 | |||
| 1828 | Ga0207660_10048121 | |||
| 1829 | Ga0207660_10049198 | |||
| 1830 | Ga0207660_10448611 | |||
| 1831 | Ga0207660_10476264 | |||
| 1832 | Ga0207662_10135662 | |||
| 1833 | Ga0207662_10403451 | |||
| 1834 | Ga0207657_10004634 | |||
| 1835 | Ga0207649_10103135 | |||
| 1836 | Ga0207649_10523330 | |||
| 1837 | Ga0207652_10002138 | |||
| 1838 | Ga0207652_10011255 | |||
| 1839 | Ga0207652_10015469 | |||
| 1840 | Ga0207652_10024322 | |||
| 1841 | Ga0207652_10150415 | |||
| 1842 | Ga0207652_10537001 | |||
| 1843 | Ga0207652_10889039 | |||
| 1844 | Ga0207646_10121935 | |||
| 1845 | Ga0207646_10765904 | |||
| 1846 | Ga0207681_10002433 | |||
| 1847 | Ga0207681_10415939 | |||
| 1848 | Ga0207694_10000131 | |||
| 1849 | Ga0207694_10014107 | |||
| 1850 | Ga0207694_10025852 | |||
| 1851 | Ga0207694_10105194 | |||
| 1852 | Ga0207694_10125480 | |||
| 1853 | Ga0207694_10160307 | |||
| 1854 | Ga0207694_10245872 | |||
| 1855 | Ga0207650_10000064 | |||
| 1856 | Ga0207650_10025375 | |||
| 1857 | Ga0207650_10098260 | |||
| 1858 | Ga0207650_10693003 | |||
| 1859 | Ga0207687_10017929 | |||
| 1860 | Ga0207687_10387715 | |||
| 1861 | Ga0207687_10964580 | |||
| 1862 | Ga0207700_10013938 | |||
| 1863 | Ga0207700_10056499 | |||
| 1864 | Ga0207664_10249595 | |||
| 1865 | Ga0207664_10524963 | |||
| 1866 | Ga0207690_10000170 | |||
| 1867 | Ga0207690_10006537 | |||
| 1868 | Ga0207690_10079124 | |||
| 1869 | Ga0207690_10359302 | |||
| 1870 | Ga0207706_10279629 | |||
| 1871 | Ga0207686_10017727 | |||
| 1872 | Ga0207670_10671700 | |||
| 1873 | Ga0207669_10325250 | |||
| 1874 | Ga0207704_10012197 | |||
| 1875 | Ga0207665_10000064 | |||
| 1876 | Ga0207665_10399042 | |||
| 1877 | Ga0207711_10001318 | |||
| 1878 | Ga0207711_10002832 | |||
| 1879 | Ga0207711_10009573 | |||
| 1880 | Ga0207711_10021129 | |||
| 1881 | Ga0207711_10995048 | |||
| 1882 | Ga0207689_10128904 | |||
| 1883 | Ga0207689_10643491 | |||
| 1884 | Ga0207689_10753412 | |||
| 1885 | Ga0207661_10043844 | |||
| 1886 | Ga0207661_10283335 | |||
| 1887 | Ga0207679_10067373 | |||
| 1888 | Ga0207679_10454341 | |||
| 1889 | Ga0207679_10566261 | |||
| 1890 | Ga0207667_10012774 | |||
| 1891 | Ga0207667_10042898 | |||
| 1892 | Ga0207667_10180188 | |||
| 1893 | Ga0207667_10200996 | |||
| 1894 | Ga0207667_10217326 | |||
| 1895 | Ga0207651_10160210 | |||
| 1896 | Ga0207651_10310825 | |||
| 1897 | Ga0207712_10000569 | |||
| 1898 | Ga0207712_10168262 | |||
| 1899 | Ga0207712_10311459 | |||
| 1900 | Ga0207712_10567989 | |||
| 1901 | Ga0207668_10000003 | |||
| 1902 | Ga0207668_10000678 | |||
| 1903 | Ga0207668_10016025 | |||
| 1904 | Ga0207668_10068169 | |||
| 1905 | Ga0207668_10092129 | |||
| 1906 | Ga0207658_10000470 | |||
| 1907 | Ga0207658_10075281 | |||
| 1908 | Ga0207658_10148121 | |||
| 1909 | Ga0207677_10061549 | |||
| 1910 | Ga0207703_10001508 | |||
| 1911 | Ga0207703_10009963 | |||
| 1912 | Ga0207703_10452893 | |||
| 1913 | Ga0207639_10005534 | |||
| 1914 | Ga0207639_10010391 | |||
| 1915 | Ga0207639_10056544 | |||
| 1916 | Ga0207639_10488418 | |||
| 1917 | Ga0207678_10637942 | |||
| 1918 | Ga0207702_10065320 | |||
| 1919 | Ga0207641_10000067 | |||
| 1920 | Ga0207641_10002338 | |||
| 1921 | Ga0207641_10002399 | |||
| 1922 | Ga0207641_10627466 | |||
| 1923 | Ga0207641_10885041 | |||
| 1924 | Ga0207676_10000285 | |||
| 1925 | Ga0207676_10001669 | |||
| 1926 | Ga0207676_10017334 | |||
| 1927 | Ga0207674_10003851 | |||
| 1928 | Ga0207674_10023460 | |||
| 1929 | Ga0207674_10064139 | |||
| 1930 | Ga0207674_11325862 | |||
| 1931 | Ga0207675_100031120 | |||
| 1932 | Ga0207675_100058131 | |||
| 1933 | Ga0207683_10091755 | |||
| 1934 | Ga0207683_10560164 | |||
| 1935 | Ga0207698_10033186 | |||
| 1936 | Ga0207698_10042590 | |||
| 1937 | Ga0207698_10139974 | |||
| 1938 | Ga0207698_10475900 | |||
| 1939 | Ga0209969_1024606 | |||
| 1940 | Ga0209981_1000340 | |||
| 1941 | Ga0209179_1031830 | |||
| 1942 | Ga0209999_1001296 | |||
| 1943 | Ga0209813_10002235 | |||
| 1944 | Ga0209813_10125183 | |||
| 1945 | Ga0268266_10000062 | |||
| 1946 | Ga0268266_10001802 | |||
| 1947 | Ga0268266_10003531 | |||
| 1948 | Ga0268266_10016020 | |||
| 1949 | Ga0268266_10016270 | |||
| 1950 | Ga0268266_10556631 | |||
| 1951 | Ga0268265_10001343 | |||
| 1952 | Ga0268265_10002488 | |||
| 1953 | Ga0268265_10016485 | |||
| 1954 | Ga0268265_10069519 | |||
| 1955 | Ga0268265_10081510 | |||
| 1956 | Ga0268265_10120918 | |||
| 1957 | Ga0268264_10000029 | |||
| 1958 | Ga0268264_10000035 | |||
| 1959 | Ga0268264_10000118 | |||
| 1960 | Ga0268264_10024356 | |||
| 1961 | Ga0268264_10053855 | |||
| 1962 | Ga0265326_10093849 | |||
| 1963 | Ga0265334_10002345 | |||
| 1964 | Ga0265334_10006982 | |||
| 1965 | Ga0265334_10134070 | |||
| 1966 | Ga0265323_10084554 | |||
| 1967 | Ga0265336_10002849 | |||
| 1968 | Ga0307517_10000049 | |||
| 1969 | Ga0307517_10004318 | |||
| 1970 | Ga0307517_10126022 | |||
| 1971 | Ga0307517_10290175 | |||
| 1972 | Ga0265338_10000065 | |||
| 1973 | Ga0265338_10011636 | |||
| 1974 | Ga0265338_10023104 | |||
| 1975 | Ga0265338_10023917 | |||
| 1976 | Ga0265338_10220362 | |||
| 1977 | Ga0265338_10396690 | |||
| 1978 | Ga0265324_10014325 | |||
| 1979 | Ga0307511_10002913 | |||
| 1980 | Ga0307511_10065390 | |||
| 1981 | Ga0265760_10018921 | |||
| 1982 | Ga0265330_10120172 | |||
| 1983 | Ga0265320_10120452 | |||
| 1984 | Ga0265325_10005453 | |||
| 1985 | Ga0265339_10001461 | |||
| 1986 | Ga0265339_10005966 | |||
| 1987 | Ga0265331_10001629 | |||
| 1988 | Ga0265331_10039828 | |||
| 1989 | Ga0265331_10112694 | |||
| 1990 | Ga0265327_10000334 | |||
| 1991 | Ga0265327_10002518 | |||
| 1992 | Ga0265327_10005115 | |||
| 1993 | Ga0265316_10090273 | |||
| 1994 | Ga0265316_10091351 | |||
| 1995 | Ga0307513_10000414 | |||
| 1996 | Ga0307513_10000431 | |||
| 1997 | Ga0307513_10019412 | |||
| 1998 | Ga0307513_10106608 | |||
| 1999 | Ga0307509_10176861 | |||
| 2000 | Ga0265313_10000270 | |||
| 2001 | Ga0265313_10000290 | |||
| 2002 | Ga0307508_10000090 | |||
| 2003 | Ga0307508_10448280 | |||
| 2004 | Ga0307514_10319746 | |||
| 2005 | Ga0265314_10035278 | |||
| 2006 | Ga0265314_10054614 | |||
| 2007 | Ga0265314_10057598 | |||
| 2008 | Ga0265314_10151527 | |||
| 2009 | Ga0265314_10245940 | |||
| 2010 | Ga0265342_10005498 | |||
| 2011 | Ga0265342_10015375 | |||
| 2012 | Ga0265342_10028716 | |||
| 2013 | Ga0307516_10000084 | |||
| 2014 | Ga0307405_10843136 | |||
| 2015 | Ga0307518_10350958 | |||
| 2016 | Ga0307407_10073331 | |||
| 2017 | Ga0307407_10074665 | |||
| 2018 | Ga0307412_10240913 | |||
| 2019 | Ga0307412_10440069 | |||
| 2020 | Ga0307409_100100735 | |||
| 2021 | Ga0307409_100318933 | |||
| 2022 | Ga0307409_100401457 | |||
| 2023 | Ga0307416_101189046 | |||
| 2024 | Ga0307414_10861920 | |||
| 2025 | Ga0307507_10167482 | |||
| 2026 | Ga0307510_10004617 | |||
| 2027 | Ga0307510_10005455 | |||
| 2028 | Ga0307510_10049660 | |||
| 2029 | Ga0307510_10180789 | |||
| 2030 | Ga0315911_1000011 | |||
| 2031 | Ga0316212_1030239 | |||
| 2032 | Ga0373948_0047216 | |||
| 2033 | Ga0373926_0078469 | |||
| 2034 | Ga0373926_0107294 | |||
| 2035 | Ga0373934_0015323 | |||
| 2036 | Ga0373934_0166516 | |||
| 2037 | Ga0373944_0002107 | |||
| 2038 | Ga0373952_0051144 | |||
| 2039 | Ga0373923_0008238 | |||
| 2040 | Ga0373923_0044399 | |||
| 2041 | Ga0373923_0346578 | |||
| 2042 | Ga0373932_0027180 | |||
| 2043 | Ga0373936_0006507 | |||
| 2044 | Ga0373936_0016751 | |||
| 2045 | Ga0373936_0034573 | |||
| 2046 | Ga0373945_0014375 | |||
| 2047 | Ga0373945_0325100 | |||
| 2048 | Ga0373953_0044097 | |||
| 2049 | Ga0373953_0058182 | |||
| 2050 | Ga0373954_0001303 | |||
| 2051 | Ga0373954_0113370 | |||
| 2052 | Ga0373956_0000726 | |||
| 2053 | Ga0373956_0044953 | |||
| 2054 | Ga0373960_0102667 | |||
| 2055 | Ga0373943_0004812 | |||
| 2056 | Ga0373943_0168271 | |||
| 2057 | Ga0373946_0008147 | |||
| 2058 | Ga0373946_0330958 | |||
| 2059 | Ga0373955_0003241 | |||
| 2060 | Ga0373955_0337575 | |||
| 2061 | Ga0373924_0069637 | |||
| 2062 | Ga0373931_0001506 | |||
| 2063 | Ga0373931_0192097 | |||
| 2064 | Ga0373935_0000746 | |||
| 2065 | Ga0373935_0142286 | |||
| 2066 | Ga0373935_0148398 | |||
| 2067 | Ga0373935_0267523 | |||
| 2068 | Ga0373927_0001005 | |||
| 2069 | Ga0373927_0005832 | |||
| 2070 | Ga0373927_0007328 | |||
| 2071 | Ga0373927_0046813 | |||
| 2072 | Ga0373927_0072459 | |||
| 2073 | Ga0373927_0140972 | |||
| 2074 | Ga0373933_0002183 | |||
| 2075 | Ga0373933_0017857 | |||
| 2076 | Ga0373933_0033690 | |||
| 2077 | Ga0373947_0005667 | |||
| 2078 | Ga0373947_0087448 | |||
| 2079 | Ga0373947_0225329 | |||
| 2080 | Ga0373947_0256246 | |||
| 2081 | Ga0373947_0297724 | |||
| 2082 | Ga0373947_0313140 | |||
| 2083 | Ga0373937_0002920 | |||
| 2084 | Ga0373937_0061629 | |||
| 2085 | Ga0373937_0101399 | |||
| 2086 | Ga0373937_0144521 | |||
| 2087 | Ga0373937_0189840 | |||
| 2088 | Ga0373937_0583978 | |||
| 2089 | Ga0310109_024461 | |||
| 2090 | Ga0373925_0000335 | |||
| 2091 | Ga0373925_0006131 | |||
| 2092 | Ga0373925_0024191 | |||
| 2093 | Ga0373925_0051552 | |||
| 2094 | Ga0373925_0058505 | |||
| 2095 | Ga0395899_0000004 | |||
| 2096 | Ga0395899_0000392 | |||
| 2097 | Ga0395899_0037553 | |||
| 2098 | Ga0395899_0149214 | |||
| 2099 | Ga0395900_0000004 | |||
| 2100 | Ga0395900_0039173 | |||
| 2101 | Ga0395900_0046235 | |||
| 2102 | Ga0395900_0063108 | |||
| 2103 | Ga0395900_0081560 | |||
| 2104 | Ga0395900_0139812 | |||
| 2105 | Ga0395900_0319424 | |||
| 2106 | Ga0395900_0511166 | |||
| 2107 | Ga0395898_0015313 | |||
| 2108 | Ga0395898_0133953 | |||
| 2109 | Ga0395898_0264804 | |||
| 2110 | Ga0395898_0273995 | |||
| 2111 | Ga0395898_0409631 | |||
| 2112 | Ga0395905_0012043 | |||
| 2113 | Ga0395905_0014075 | |||
| 2114 | Ga0395905_0329054 | |||
| 2115 | Ga0395905_0419442 | |||
| 2116 | Ga0395905_0782467 | |||
| 2117 | Ga0436364_0294495 | |||
| 2118 | Ga0436364_0765763 | |||
| 2119 | Ga0436364_0967922 | |||
| 2120 | Ga0436364_1145508 | |||
| 2121 | Ga0436364_1328893 | |||
| 2122 | Ga0436364_1523679 | |||
| 2123 | Ga0436364_1525373 | |||
| 2124 | Ga0395901_0000005 | |||
| 2125 | Ga0395901_0002466 | |||
| 2126 | Ga0395901_0039843 | |||
| 2127 | Ga0395901_0306632 | |||
| 2128 | Ga0395901_0371755 | |||
| 2129 | Ga0395901_0834628 | |||
| 2130 | Ga0400485_03320 | |||
| 2131 | Ga0400483_023760 | |||
| 2132 | Ga0400483_040634 | |||
| 2133 | Ga0400483_052412 | |||
| 2134 | Ga0400483_092856 | |||
| 2135 | Ga0400483_183320 | |||
| 2136 | Ga0400483_193625 | |||
| 2137 | Ga0400483_217638 | |||
| 2138 | Ga0400483_218418 | |||
| 2139 | Ga0400483_257882 | |||
| 2140 | Ga0400483_272292 | |||
| 2141 | Ga0400483_275881 | |||
| 2142 | Ga0436365_0442593 | |||
| 2143 | Ga0436365_0577642 | |||
| 2144 | Ga0436365_0603212 | |||
| 2145 | Ga0436365_0649797 | |||
| 2146 | Ga0436365_0751394 | |||
| 2147 | Ga0436365_0891213 | |||
| 2148 | Ga0436365_1118553 | |||
| 2149 | Ga0436365_1300363 | |||
| 2150 | Ga0436360_0164010 | |||
| 2151 | Ga0436360_0272555 | |||
| 2152 | Ga0436360_0339257 | |||
| 2153 | Ga0436360_0355615 | |||
| 2154 | Ga0436360_0412786 | |||
| 2155 | Ga0436360_0640524 | |||
| 2156 | Ga0436360_1305805 | |||
| 2157 | Ga0436360_1306958 | |||
| 2158 | Ga0436361_0223293 | |||
| 2159 | Ga0436361_0569699 | |||
| 2160 | Ga0436361_0783402 | |||
| 2161 | Ga0436361_1136221 | |||
| 2162 | Ga0436363_0225819 | |||
| 2163 | Ga0436363_0740142 | |||
| 2164 | Ga0436363_1100534 | |||
| 2165 | Ga0436363_1533112 | |||
| 2166 | Ga0436362_1014140 | |||
| 2167 | Ga0439465_0034528 | |||
| 2168 | Ga0451790_33576 | |||
| 2169 | Ga0451793_1221768 | |||
| 2170 | Ga0451793_1584844 | |||
| 2171 | Ga0451800_0349978 | |||
| 2172 | Ga0451807_1028089 | |||
| 2173 | Ga0451839_0013675 | |||
| 2174 | Ga0451851_0179760 | |||
| 2175 | Ga0439431_0053914 | |||
| 2176 | Ga0439431_0122671 | |||
| 2177 | Ga0439448_0020795 | |||
| 2178 | Ga0439448_0112534 | |||
| 2179 | Ga0439432_034533 | |||
| 2180 | Ga0439432_077648 | |||
| 2181 | Ga0439450_015569 | |||
| 2182 | Ga0439454_000646 | |||
| 2183 | Ga0439455_0004924 | |||
| 2184 | Ga0439456_083156 | |||
| 2185 | Ga0439463_001082 | |||
| 2186 | Ga0439446_0012923 | |||
| 2187 | Ga0439434_0102851 | |||
| 2188 | Ga0439434_0160628 | |||
| 2189 | Ga0439459_0009822 | |||
| 2190 | Ga0439464_0007526 | |||
| 2191 | Ga0439460_0007151 | |||
| 2192 | Ga0439440_0012915 | |||
| 2193 | Ga0466966_0001611 | |||
| 2194 | Ga0466966_0211388 | |||
| 2195 | Ga0466966_0290872 | |||
| 2196 | Ga0466961_0000729 | |||
| 2197 | Ga0466961_0176993 | |||
| 2198 | Ga0466963_0092275 | |||
| 2199 | Ga0466963_0381938 | |||
| 2200 | Ga0466968_0036681 | |||
| 2201 | Ga0466957_0288464 | |||
| 2202 | Ga0466959_0016762 | |||
| 2203 | Ga0466959_0284459 | |||
| 2204 | Ga0466967_0064758 | |||
| 2205 | Ga0466967_0140691 | |||
| 2206 | Ga0466967_0356150 | |||
| 2207 | Ga0466967_0508770 | |||
| 2208 | Ga0495617_082408 | |||
| 2209 | Ga0495592_0001015 | |||
| 2210 | Ga0495592_0160953 | |||
| 2211 | Ga0495592_0292078 | |||
| 2212 | Ga0495592_0386922 | |||
| 2213 | Ga0495603_0014076 | |||
| 2214 | Ga0495603_0096327 | |||
| 2215 | Ga0495603_0286794 | |||
| 2216 | Ga0495590_0001375 | |||
| 2217 | Ga0495629_0011592 | |||
| 2218 | Ga0495629_0054448 | |||
| 2219 | Ga0495629_0224185 | |||
| 2220 | Ga0495629_0307888 | |||
| 2221 | Ga0495638_0006134 | |||
| 2222 | Ga0495638_0054700 | |||
| 2223 | Ga0495638_0061356 | |||
| 2224 | Ga0495641_0009631 | |||
| 2225 | Ga0495651_0363585 | |||
| 2226 | Ga0495651_0526357 | |||
| 2227 | Ga0495653_0000934 | |||
| 2228 | Ga0495653_0079298 | |||
| 2229 | Ga0495653_0142684 | |||
| 2230 | Ga0495653_0335730 | |||
| 2231 | Ga0495650_0000244 | |||
| 2232 | Ga0495580_0000612 | |||
| 2233 | Ga0495580_0010282 | |||
| 2234 | Ga0495582_0019067 | |||
| 2235 | Ga0495582_0068295 | |||
| 2236 | Ga0495582_0089154 | |||
| 2237 | Ga0495639_0001536 | |||
| 2238 | Ga0495639_0038030 | |||
| 2239 | Ga0495639_0238859 | |||
| 2240 | Ga0495664_0013114 | |||
| 2241 | Ga0495664_0322198 | |||
| 2242 | Ga0495664_0330181 | |||
| 2243 | Ga0495585_0039584 | |||
| 2244 | Ga0495585_0226696 | |||
| 2245 | Ga0495594_0098647 | |||
| 2246 | Ga0495594_0209109 | |||
| 2247 | Ga0495596_0167271 | |||
| 2248 | Ga0495607_0307923 | |||
| 2249 | Ga0495583_0097502 | |||
| 2250 | Ga0495606_0005813 | |||
| 2251 | Ga0495606_0059666 | |||
| 2252 | Ga0495608_0002093 | |||
| 2253 | Ga0495608_0013352 | |||
| 2254 | Ga0495608_0393237 | |||
| 2255 | Ga0495610_0002447 | |||
| 2256 | Ga0495616_0000561 | |||
| 2257 | Ga0495618_0317127 | |||
| 2258 | Ga0495628_0020462 | |||
| 2259 | Ga0495628_0091030 | |||
| 2260 | Ga0495628_0123443 | |||
| 2261 | Ga0495628_0203866 | |||
| 2262 | Ga0495630_0035589 | |||
| 2263 | Ga0495630_0050507 | |||
| 2264 | Ga0495630_0127018 | |||
| 2265 | Ga0495631_0118568 | |||
| 2266 | Ga0495637_0023333 | |||
| 2267 | Ga0495643_0041517 | |||
| 2268 | Ga0495643_0134258 | |||
| 2269 | Ga0495644_0215384 | |||
| 2270 | Ga0495648_0000165 | |||
| 2271 | Ga0495648_0030929 | |||
| 2272 | Ga0495666_0026921 | |||
| 2273 | Ga0495642_0018614 | |||
| 2274 | Ga0495642_0036369 | |||
| 2275 | Ga0495642_0181321 | |||
| 2276 | Ga0495652_0002209 | |||
| 2277 | Ga0495652_0036404 | |||
| 2278 | Ga0495652_0049140 | |||
| 2279 | Ga0495652_0112630 | |||
| 2280 | Ga0495652_0160604 | |||
| 2281 | Ga0495652_0230424 | |||
| 2282 | Ga0495652_0401043 | |||
| 2283 | Ga0495654_0000024 | |||
| 2284 | Ga0495654_0041892 | |||
| 2285 | Ga0495665_0000866 | |||
| 2286 | Ga0495665_0243738 | |||
| 2287 | Ga0495640_0003099 | |||
| 2288 | Ga0495640_0060112 | |||
| 2289 | Ga0495640_0247644 | |||
| 2290 | Ga0495640_0353867 | |||
| 2291 | Ga0495587_0015200 | |||
| 2292 | Ga0495587_0029924 | |||
| 2293 | Ga0495587_0133003 | |||
| 2294 | Ga0495609_0023541 | |||
| 2295 | Ga0495621_0076579 | |||
| 2296 | Ga0495597_0003599 | |||
| 2297 | Ga0495597_0043380 | |||
| 2298 | Ga0495645_0012499 | |||
| 2299 | Ga0495645_0013311 | |||
| 2300 | Ga0495645_0040862 | |||
| 2301 | Ga0495645_0338967 | |||
| 2302 | Ga0495645_0358784 | |||
| 2303 | Ga0495645_0425059 | |||
| 2304 | Ga0495622_0010588 | |||
| 2305 | Ga0495622_0033434 | |||
| 2306 | Ga0495622_0054153 | |||
| 2307 | Ga0495633_0024018 | |||
| 2308 | Ga0495633_0139294 | |||
| 2309 | Ga0495667_0009515 | |||
| 2310 | Ga0495667_0023947 | |||
| 2311 | Ga0495667_0156529 | |||
| 2312 | Ga0495656_0015319 | |||
| 2313 | Ga0495656_0445946 | |||
| 2314 | Ga0495668_0000042 | |||
| 2315 | Ga0495668_0006417 | |||
| 2316 | Ga0495668_0006930 | |||
| 2317 | Ga0495668_0070100 | |||
| 2318 | Ga0495668_0135365 | |||
| 2319 | Ga0495668_0165455 | |||
| 2320 | Ga0495668_0173531 | |||
| 2321 | Ga0495634_0003047 | |||
| 2322 | Ga0495634_0045191 | |||
| 2323 | Ga0495634_0068412 | |||
| 2324 | Ga0495634_0078105 | |||
| 2325 | Ga0495611_0316360 | |||
| 2326 | Ga0495625_0029821 | |||
| 2327 | Ga0495625_0065494 | |||
| 2328 | Ga0495625_0121557 | |||
| 2329 | Ga0495625_0203516 | |||
| 2330 | Ga0495625_0289169 | |||
| 2331 | Ga0495635_0000540 | |||
| 2332 | Ga0495635_0007303 | |||
| 2333 | Ga0495635_0062629 | |||
| 2334 | Ga0495635_0065285 | |||
| 2335 | Ga0495659_0080223 | |||
| 2336 | Ga0495588_0026578 | |||
| 2337 | Ga0495588_0057027 | |||
| 2338 | Ga0495657_0001615 | |||
| 2339 | Ga0495657_0003319 | |||
| 2340 | Ga0495657_0023689 | |||
| 2341 | Ga0495599_0007666 | |||
| 2342 | Ga0495599_0071308 | |||
| 2343 | Ga0495599_0169737 | |||
| 2344 | Ga0495623_0051844 | |||
| 2345 | Ga0495623_0168305 | |||
| 2346 | Ga0495646_0010030 | |||
| 2347 | Ga0495646_0096661 | |||
| 2348 | Ga0495647_0021408 | |||
| 2349 | Ga0495658_0005259 | |||
| 2350 | Ga0495658_0215711 | |||
| 2351 | Ga0495658_0257007 | |||
| 2352 | Ga0495669_0000078 | |||
| 2353 | Ga0495669_0009879 | |||
| 2354 | Ga0495669_0045945 | |||
| 2355 | Ga0495613_0004342 | |||
| 2356 | Ga0495613_0148598 | |||
| 2357 | Ga0495613_0584005 | |||
| 2358 | Ga0495624_0000079 | |||
| 2359 | Ga0495670_0106363 | |||
| 2360 | Ga0495600_0007254 | |||
| 2361 | Ga0495600_0065595 | |||
| 2362 | Ga0495600_0085449 | |||
| 2363 | Ga0495660_0029161 | |||
| 2364 | Ga0495660_0065495 | |||
| 2365 | Ga0495581_0000260 | |||
| 2366 | Ga0495581_0108817 | |||
| 2367 | Ga0495581_0244006 | |||
| 2368 | Ga0495581_0361447 | |||
| 2369 | Ga0495604_0006608 | |||
| 2370 | Ga0495604_0021019 | |||
| 2371 | Ga0495604_0093261 | |||
| 2372 | Ga0495604_0124469 | |||
| 2373 | Ga0495636_0082612 | |||
| 2374 | Ga0495674_0039127 | |||
| 2375 | Ga0495674_0060084 | |||
| 2376 | Ga0495674_0062608 | |||
| 2377 | Ga0495672_0065581 | |||
| 2378 | Ga0495672_0103686 | |||
| 2379 | Ga0495672_0229000 | |||
| 2380 | Ga0495676_0070484 | |||
| 2381 | Ga0495680_0012504 | |||
| 2382 | Ga0495680_0032774 | |||
| 2383 | Ga0495680_0118005 | |||
| 2384 | Ga0495687_080764 | |||
| 2385 | Ga0495675_0001958 | |||
| 2386 | Ga0495675_0048595 | |||
| 2387 | Ga0495675_0086146 | |||
| 2388 | Ga0495677_0046949 | |||
| 2389 | Ga0495677_0152752 | |||
| 2390 | Ga0495673_0015936 | |||
| 2391 | Ga0495673_0028515 | |||
| 2392 | Ga0495681_0124308 | |||
| 2393 | Ga0495681_0185514 | |||
| 2394 | Ga0495684_0001865 | |||
| 2395 | Ga0495684_0007297 | |||
| 2396 | Ga0495684_0010601 | |||
| 2397 | Ga0495684_0048320 | |||
| 2398 | Ga0495686_0001646 | |||
| 2399 | Ga0495686_0003347 | |||
| 2400 | Ga0495686_0027519 | |||
| 2401 | Ga0495686_0193227 | |||
| 2402 | Ga0495686_0249230 | |||
| 2403 | Ga0495593_0002394 | |||
| 2404 | Ga0495593_0027612 | |||
| 2405 | Ga0495593_0040729 | |||
| 2406 | Ga0495602_0009374 | |||
| 2407 | Ga0495602_0040611 | |||
| 2408 | Ga0495602_0142472 | |||
| 2409 | Ga0495626_0059314 | |||
| 2410 | Ga0496100_0059701 | |||
| 2411 | Ga0496100_0232261 | |||
| 2412 | Ga0496100_0367005 | |||
| 2413 | Ga0496100_0848994 | |||
| 2414 | Ga0496101_0015844 | |||
| 2415 | Ga0496102_0000518 | |||
| 2416 | Ga0496102_0018170 | |||
| 2417 | Ga0496102_0018766 | |||
| 2418 | Ga0496102_0052840 | |||
| 2419 | Ga0496102_0739641 | |||
| 2420 | Ga0496103_0077711 | |||
| 2421 | Ga0496104_0137241 | |||
| 2422 | Ga0496105_0004162 | |||
| 2423 | Ga0496105_0004256 | |||
| 2424 | Ga0496105_0112402 | |||
| 2425 | Ga0496105_0679311 | |||
| 2426 | Ga0496106_0000116 | |||
| 2427 | Ga0496106_0013096 | |||
| 2428 | Ga0496106_0078196 | |||
| 2429 | Ga0496106_0094820 | |||
| 2430 | Ga0496106_0363639 | |||
| 2431 | Ga0496107_0001003 | |||
| 2432 | Ga0496107_0554203 | |||
| 2433 | Ga0496108_0000523 | |||
| 2434 | Ga0496108_0005230 | |||
| 2435 | Ga0496108_0034870 | |||
| 2436 | Ga0496109_0001407 | |||
| 2437 | Ga0496109_0005646 | |||
| 2438 | Ga0496109_0285204 | |||
| 2439 | Ga0496110_0018684 | |||
| 2440 | Ga0496110_0065369 | |||
| 2441 | Ga0496110_0444838 | |||
| 2442 | Ga0496110_1073373 | |||
| 2443 | Ga0496111_0078263 | |||
| 2444 | Ga0496111_0333052 | |||
| 2445 | Ga0496112_0005822 | |||
| 2446 | Ga0496112_0030428 | |||
| 2447 | Ga0496112_0069799 | |||
| 2448 | Ga0496112_0089521 | |||
| 2449 | Ga0496112_0097854 | |||
| 2450 | Ga0496112_0164043 | |||
| 2451 | Ga0496112_0220787 | |||
| 2452 | Ga0496112_0358193 | |||
| 2453 | Ga0496113_0073598 | |||
| 2454 | Ga0496113_0468122 | |||
| 2455 | Ga0496114_0023481 | |||
| 2456 | Ga0496114_0166178 | |||
| 2457 | Ga0496115_0001962 | |||
| 2458 | Ga0496115_0002796 | |||
| 2459 | Ga0496115_0010930 | |||
| 2460 | Ga0496115_0012733 | |||
| 2461 | Ga0496115_0279760 | |||
| 2462 | Ga0496115_0652816 | |||
| 2463 | Ga0496117_0039261 | |||
| 2464 | Ga0496117_0056067 | |||
| 2465 | Ga0496117_0090740 | |||
| 2466 | Ga0496118_0006091 | |||
| 2467 | Ga0496118_0010206 | |||
| 2468 | Ga0496118_0057706 | |||
| 2469 | Ga0496118_0183459 | |||
| 2470 | Ga0496119_0023537 | |||
| 2471 | Ga0496120_0291662 | |||
| 2472 | Ga0496121_0000053 | |||
| 2473 | Ga0496121_0001006 | |||
| 2474 | Ga0496121_0007140 | |||
| 2475 | Ga0496121_0012978 | |||
| 2476 | Ga0496121_0036555 | |||
| 2477 | Ga0496121_0037388 | |||
| 2478 | Ga0496121_0095890 | |||
| 2479 | Ga0496122_0028275 | |||
| 2480 | Ga0496122_0175784 | |||
| 2481 | Ga0496123_0034089 | |||
| 2482 | Ga0496123_0181302 | |||
| 2483 | Ga0496124_0027923 | |||
| 2484 | Ga0496124_0134902 | |||
| 2485 | Ga0496124_0163386 | |||
| 2486 | Ga0496124_0273170 | |||
| 2487 | Ga0496124_0490044 | |||
| 2488 | Ga0496125_0000063 | |||
| 2489 | Ga0496125_0000692 | |||
| 2490 | Ga0496125_0004834 | |||
| 2491 | Ga0496125_0206556 | |||
| 2492 | Ga0496125_0207858 | |||
| 2493 | Ga0496125_0308976 | |||
| 2494 | Ga0496126_0005437 | |||
| 2495 | Ga0496126_0005856 | |||
| 2496 | Ga0496126_0010695 | |||
| 2497 | Ga0496126_0024996 | |||
| 2498 | Ga0496126_0061522 | |||
| 2499 | Ga0496126_0084558 | |||
| 2500 | Ga0496126_0088140 | |||
| 2501 | Ga0496126_0105848 | |||
| 2502 | Ga0496126_0194926 | |||
| 2503 | Ga0496126_0221731 | |||
| 2504 | Ga0496126_0776235 | |||
| 2505 | Ga0495682_0062222 | |||
| 2506 | Ga0501314_019671 | |||
| 2507 | Ga0501317_046203 | |||
| 2508 | Ga0501323_035212 | |||
| 2509 | Ga0501329_02705 | |||
| 2510 | Ga0501335_017530 | |||
| 2511 | Ga0501336_018612 | |||
| 2512 | Ga0501031_0018753 | |||
| 2513 | Ga0501031_0040667 | |||
| 2514 | Ga0501031_0131864 | |||
| 2515 | Ga0501032_0036721 | |||
| 2516 | Ga0501032_0408136 | |||
| 2517 | Ga0501033_0010145 | |||
| 2518 | Ga0501033_0039811 | |||
| 2519 | Ga0501033_0057649 | |||
| 2520 | Ga0501033_0061003 | |||
| 2521 | Ga0501033_0062673 | |||
| 2522 | Ga0501033_0666746 | |||
| 2523 | Ga0501034_0002925 | |||
| 2524 | Ga0501034_0052520 | |||
| 2525 | Ga0501034_0891302 | |||
| 2526 | Ga0501036_0017092 | |||
| 2527 | Ga0501036_0019870 | |||
| 2528 | Ga0501036_0045518 | |||
| 2529 | Ga0501037_0018936 | |||
| 2530 | Ga0501037_0132577 | |||
| 2531 | Ga0501037_0140022 | |||
| 2532 | Ga0501037_0143231 | |||
| 2533 | Ga0501037_0194571 | |||
| 2534 | Ga0501038_0061441 | |||
| 2535 | Ga0501038_0140642 | |||
| 2536 | Ga0501038_0203618 | |||
| 2537 | Ga0501038_0210776 | |||
| 2538 | Ga0501038_0741293 | |||
| 2539 | Ga0501039_0001765 | |||
| 2540 | Ga0501039_0082192 | |||
| 2541 | Ga0501039_0099838 | |||
| 2542 | Ga0501040_0002053 | |||
| 2543 | Ga0501040_0006026 | |||
| 2544 | Ga0501040_0041569 | |||
| 2545 | Ga0501041_0031708 | |||
| 2546 | Ga0501041_0032148 | |||
| 2547 | Ga0501041_0107255 | |||
| 2548 | Ga0501041_0222424 | |||
| 2549 | Ga0501042_0006496 | |||
| 2550 | Ga0501042_0007090 | |||
| 2551 | Ga0501042_0101129 | |||
| 2552 | Ga0501042_0210836 | |||
| 2553 | Ga0501042_0856644 | |||
| 2554 | Ga0501043_0020010 | |||
| 2555 | Ga0501043_0083945 | |||
| 2556 | Ga0501043_0382572 | |||
| 2557 | Ga0501043_0462899 | |||
| 2558 | Ga0501046_0013607 | |||
| 2559 | Ga0501046_0033739 | |||
| 2560 | Ga0501046_0052251 | |||
| 2561 | Ga0501046_0104794 | |||
| 2562 | Ga0501047_0024481 | |||
| 2563 | Ga0501047_0035413 | |||
| 2564 | Ga0501047_0060948 | |||
| 2565 | Ga0501047_0394826 | |||
| 2566 | Ga0501047_0704524 | |||
| 2567 | Ga0501048_0050138 | |||
| 2568 | Ga0501048_0063127 | |||
| 2569 | Ga0501048_0071077 | |||
| 2570 | Ga0501048_0547898 | |||
| 2571 | Ga0501067_0083497 | |||
| 2572 | Ga0501068_0046288 | |||
| 2573 | Ga0501068_0166528 | |||
| 2574 | Ga0501068_0205588 | |||
| 2575 | Ga0501070_0000329 | |||
| 2576 | Ga0501071_0002499 | |||
| 2577 | Ga0501071_0043672 | |||
| 2578 | Ga0501071_0083826 | |||
| 2579 | Ga0501071_0205774 | |||
| 2580 | Ga0501072_0000404 | |||
| 2581 | Ga0501072_0005957 | |||
| 2582 | Ga0501072_0284636 | |||
| 2583 | Ga0501073_0094101 | |||
| 2584 | Ga0501073_0341263 | |||
| 2585 | Ga0501074_0020761 | |||
| 2586 | Ga0501074_0068008 | |||
| 2587 | Ga0501074_0174655 | |||
| 2588 | Ga0501074_0514973 | |||
| 2589 | Ga0501075_0003123 | |||
| 2590 | Ga0501075_0056549 | |||
| 2591 | Ga0501075_0081749 | |||
| 2592 | Ga0501075_0134392 | |||
| 2593 | Ga0501075_0143716 | |||
| 2594 | Ga0501075_0278874 | |||
| 2595 | Ga0501076_0008200 | |||
| 2596 | Ga0501076_0014532 | |||
| 2597 | Ga0501076_0051590 | |||
| 2598 | Ga0501076_0273486 | |||
| 2599 | Ga0501077_0002661 | |||
| 2600 | Ga0501077_0007349 | |||
| 2601 | Ga0501077_0014674 | |||
| 2602 | Ga0501077_0066656 | |||
| 2603 | Ga0501077_0189801 | |||
| 2604 | Ga0501077_0543500 | |||
| 2605 | Ga0501238_002774 | |||
| 2606 | Ga0501257_003510 | |||
| 2607 | Ga0501079_0017122 | |||
| 2608 | Ga0501079_0028862 | |||
| 2609 | Ga0501079_0078560 | |||
| 2610 | Ga0501080_0160907 | |||
| 2611 | Ga0501080_0230862 | |||
| 2612 | Ga0501081_0005768 | |||
| 2613 | Ga0501081_0048682 | |||
| 2614 | Ga0501081_0090285 | |||
| 2615 | Ga0501273_027996 | |||
| 2616 | Ga0501035_0001146 | |||
| 2617 | Ga0501035_0057192 | |||
| 2618 | Ga0501035_0216337 | |||
| 2619 | Ga0501035_0317235 | |||
| 2620 | Ga0501044_0014747 | |||
| 2621 | Ga0501044_0018956 | |||
| 2622 | Ga0501044_0110240 | |||
| 2623 | Ga0501044_0138142 | |||
| 2624 | Ga0501044_1029363 | |||
| 2625 | Ga0501045_0000769 | |||
| 2626 | Ga0501045_0012830 | |||
| 2627 | Ga0501045_0033121 | |||
| 2628 | Ga0501045_0064576 | |||
| 2629 | nmdc:mga03683_102815_c1 | |||
| 2630 | nmdc:mga00v17_76660_c1 | |||
| 2631 | nmdc:mga0yw44_283950_c1 | |||
| 2632 | nmdc:mga0yw44_40419_c1 | |||
| 2633 | nmdc:mga0yw44_578169_c1 | |||
| 2634 | nmdc:mga0k408_99988_c1 | |||
| 2635 | nmdc:mga06z11_2536_c1 | |||
| 2636 | nmdc:mga06z11_398842_c1 | |||
| 2637 | nmdc:mga04h51_3728_c1 | |||
| 2638 | nmdc:mga07m45_132961_c1 | |||
| 2639 | nmdc:mga07m45_154896_c1 | |||
| 2640 | nmdc:mga05p37_112203_c1 | |||
| 2641 | nmdc:mga05p37_154934_c1 | |||
| 2642 | nmdc:mga05p37_171_c1 | |||
| 2643 | nmdc:mga05p37_185239_c1 | |||
| 2644 | nmdc:mga05p37_478512_c1 | |||
| 2645 | nmdc:mga05p37_634367_c1 | |||
| 2646 | nmdc:mga05p37_94514_c1 | |||
| 2647 | nmdc:mga09592_183_c1 | |||
| 2648 | nmdc:mga09592_192657_c1 | |||
| 2649 | nmdc:mga09592_565_c1 | |||
| 2650 | nmdc:mga09592_617536_c1 | |||
| 2651 | nmdc:mga0qj67_14906_c1 | |||
| 2652 | nmdc:mga0qj67_300347_c1 | |||
| 2653 | nmdc:mga0qj67_306246_c1 | |||
| 2654 | nmdc:mga0qj67_337702_c1 | |||
| 2655 | nmdc:mga0qj67_538_c1 | |||
| 2656 | nmdc:mga06r32_102130_c1 | |||
| 2657 | nmdc:mga06r32_10511_c1 | |||
| 2658 | nmdc:mga06r32_156443_c1 | |||
| 2659 | nmdc:mga06r32_342_c1 | |||
| 2660 | nmdc:mga06r32_54803_c1 | |||
| 2661 | nmdc:mga0n895_150649_c1 | |||
| 2662 | nmdc:mga0n895_68361_c1 | |||
| 2663 | nmdc:mga0rr50_351456_c1 | |||
| 2664 | nmdc:mga0sz30_190741_c1 | |||
| 2665 | nmdc:mga0sz30_94027_c2 | |||
| 2666 | Ga0495601_0102887 | |||
| 2667 | Ga0495601_0112525 | |||
| 2668 | Ga0495601_0215294 | |||
| 2669 | Ga0495612_0007827 | |||
| 2670 | Ga0495612_0027321 | |||
| 2671 | Ga0495612_0087489 | |||
| 2672 | Ga0495612_0143475 | |||
| 2673 | Ga0500635_0000253 | |||
| 2674 | Ga0500635_0021631 | |||
| 2675 | Ga0500635_0059095 | |||
| 2676 | Ga0495595_0120370 | |||
| 2677 | Ga0495595_0231231 | |||
| 2678 | Ga0495619_0030125 | |||
| 2679 | Ga0495619_0034980 | |||
| 2680 | Ga0495619_0223782 | |||
| 2681 | Ga0495619_0232128 | |||
| 2682 | Ga0500578_0000004 | |||
| 2683 | Ga0500578_0143138 | |||
| 2684 | Ga0500643_010462 | |||
| 2685 | Ga0500643_051721 | |||
| 2686 | Ga0500644_0015838 | |||
| 2687 | Ga0500651_0290965 | |||
| 2688 | Ga0500566_0000064 | |||
| 2689 | Ga0500641_0000579 | |||
| 2690 | Ga0500641_0005464 | |||
| 2691 | Ga0500654_097567 | |||
| 2692 | Ga0500555_001693 | |||
| 2693 | Ga0500555_031479 | |||
| 2694 | Ga0500556_0032494 | |||
| 2695 | Ga0500556_0106605 | |||
| 2696 | Ga0500557_000039 | |||
| 2697 | Ga0500562_000608 | |||
| 2698 | Ga0500562_001033 | |||
| 2699 | Ga0500572_000026 | |||
| 2700 | Ga0500572_000344 | |||
| 2701 | Ga0500572_001098 | |||
| 2702 | Ga0500591_132517 | |||
| 2703 | Ga0500592_037410 | |||
| 2704 | Ga0500592_043485 | |||
| 2705 | Ga0500594_0000138 | |||
| 2706 | Ga0500595_001915 | |||
| 2707 | Ga0500595_002372 | |||
| 2708 | Ga0500595_003808 | |||
| 2709 | Ga0500595_004822 | |||
| 2710 | Ga0500595_005581 | |||
| 2711 | Ga0500595_009864 | |||
| 2712 | Ga0500595_016291 | |||
| 2713 | Ga0500597_129962 | |||
| 2714 | Ga0500607_025494 | |||
| 2715 | Ga0500608_000023 | |||
| 2716 | Ga0500608_019488 | |||
| 2717 | Ga0500608_141741 | |||
| 2718 | Ga0500614_008827 | |||
| 2719 | Ga0500614_010766 | |||
| 2720 | Ga0500621_016170 | |||
| 2721 | Ga0500642_0000063 | |||
| 2722 | Ga0500642_0019596 | |||
| 2723 | Ga0500652_079500 | |||
| 2724 | Ga0500655_034645 | |||
| 2725 | Ga0500658_0049187 | |||
| 2726 | Ga0500658_0146711 | |||
| 2727 | Ga0500559_0000002 | |||
| 2728 | Ga0500559_0001395 | |||
| 2729 | Ga0500559_0003076 | |||
| 2730 | Ga0500559_0007457 | |||
| 2731 | Ga0500559_0146195 | |||
| 2732 | Ga0500559_0180086 | |||
| 2733 | Ga0500561_0046394 | |||
| 2734 | Ga0500564_000305 | |||
| 2735 | Ga0500568_0141317 | |||
| 2736 | Ga0500577_0000092 | |||
| 2737 | Ga0500577_0223170 | |||
| 2738 | Ga0500585_141361 | |||
| 2739 | Ga0500603_025338 | |||
| 2740 | Ga0500616_0023510 | |||
| 2741 | Ga0500619_003604 | |||
| 2742 | Ga0500622_0000284 | |||
| 2743 | Ga0500622_0003739 | |||
| 2744 | Ga0500622_0017705 | |||
| 2745 | Ga0500622_0038142 | |||
| 2746 | Ga0500627_0003805 | |||
| 2747 | Ga0500627_0055665 | |||
| 2748 | Ga0500630_000572 | |||
| 2749 | Ga0500633_0120469 | |||
| 2750 | Ga0500634_0041129 | |||
| 2751 | Ga0500638_000124 | |||
| 2752 | Ga0500638_073702 | |||
| 2753 | Ga0500638_192661 | |||
| 2754 | Ga0500639_000353 | |||
| 2755 | Ga0500639_104745 | |||
| 2756 | Ga0500639_158560 | |||
| 2757 | Ga0500636_0027446 | |||
| 2758 | Ga0500636_0207102 | |||
| 2759 | Ga0500637_0000356 | |||
| 2760 | Ga0500637_0053738 | |||
| 2761 | Ga0500576_040143 | |||
| 2762 | Ga0500625_080811 | |||
| 2763 | Ga0500645_014088 | |||
| 2764 | Ga0500596_004103 | |||
| 2765 | Ga0500596_006575 | |||
| 2766 | Ga0500599_001756 | |||
| 2767 | Ga0501084_0001541 | |||
| 2768 | Ga0501084_0007455 | |||
| 2769 | Ga0501084_0045054 | |||
| 2770 | Ga0500661_000328 | |||
| 2771 | Ga0590074_010167 | |||
| 2772 | Ga0587084_036967 | |||
| 2773 | Ga0587084_048941 | |||
| 2774 | Ga0587084_051779 | |||
| 2775 | Ga0587084_072327 | |||
| 2776 | Ga0587077_083954 | |||
| 2777 | Ga0587085_051521 | |||
| 2778 | Ga0587086_030546 | |||
| 2779 | Ga0587101_051517 | |||
| 2780 | Ga0587115_040151 | |||
| 2781 | Ga0587062_041186 | |||
| 2782 | Ga0587068_031220 | |||
| 2783 | Ga0587068_054066 | |||
| 2784 | Ga0587072_070570 | |||
| 2785 | Ga0587079_080167 | |||
| 2786 | Ga0501082_0003607 | |||
| 2787 | Ga0501082_0005568 | |||
| 2788 | Ga0501082_0117648 | |||
| 2789 | Ga0501082_0273588 | |||
| 2790 | Ga0501082_0643757 | |||
| 2791 | Ga0501082_0746699 | |||
| 2792 | Ga0530510_0000429 | |||
| 2793 | Ga0530510_0005706 | |||
| 2794 | Ga0530510_0007861 | |||
| 2795 | Ga0530510_0033114 | |||
| 2796 | 2508544080 | |||
| 2797 | 2509153763 | |||
| 2798 | 2513660051 | |||
| 2799 | 2513676488 | |||
| 2800 | 2513696983 | |||
| 2801 | 2513858229 | |||
| 2802 | 2513922139 | |||
| 2803 | 2517893882 | |||
| 2804 | 2524537849 | |||
| 2805 | 2535484567 | |||
| 2806 | 2545678007 | |||
| 2807 | 2585147323 | |||
| 2808 | 2585150763 | |||
| 2809 | 2585195735 | |||
| 2810 | 2587916167 | |||
| 2811 | 2596371274 | |||
| 2812 | 2643751184 | |||
| 2813 | 2643780554 | |||
| 2814 | 2643929197 | |||
| 2815 | 2644227337 | |||
| 2816 | 2644233195 | |||
| 2817 | 2644287793 | |||
| 2818 | 2644511150 | |||
| 2819 | 2671122875 | |||
| 2820 | 2671692796 | |||
| 2821 | 2723846426 | |||
| 2822 | 2728748009 | |||
| 2823 | 2738743370 | |||
| 2824 | 2739352987 | |||
| 2825 | 2739793299 | |||
| 2826 | 2753359147 | |||
| 2827 | 2757570020 | |||
| 2828 | 2758641391 | |||
| 2829 | 2792460098 | |||
| 2830 | 2793072479 | |||
| 2831 | 2793076915 | |||
| 2832 | 2819538689 | |||
| 2833 | 2819646777 | |||
| 2834 | 2843746665 | |||
| 2835 | 2844317684 | |||
| 2836 | 2849563781 | |||
| 2837 | 2849576102 | |||
| 2838 | 2851154917 | |||
| 2839 | 2854915170 | |||
| 2840 | 2857507458 | |||
| 2841 | 2874610606 | |||
| 2842 | 2874623165 | |||
| 2843 | 2876816247 | |||
| 2844 | 2879118668 | |||
| 2845 | 2883295631 | |||
| 2846 | 2884962731 | |||
| 2847 | 2885368887 | |||
| 2848 | 2885382470 | |||
| 2849 | 2885387390 | |||
| 2850 | 2889039060 | |||
| 2851 | 2889306345 | |||
| 2852 | 2894818995 | |||
| 2853 | 2898331456 | |||
| 2854 | 2902334960 | |||
| 2855 | 2902408077 | |||
| 2856 | 2903735364 | |||
| 2857 | 2903750453 | |||
| 2858 | 2903771736 | |||
| 2859 | 2904669985 | |||
| 2860 | 2904693470 | |||
| 2861 | 2904700698 | |||
| 2862 | 2906608717 | |||
| 2863 | 2906610772 | |||
| 2864 | 2906630150 | |||
| 2865 | 2906635928 | |||
| 2866 | 2906663975 | |||
| 2867 | 2908744282 | |||
| 2868 | 2908761795 | |||
| 2869 | 2915651658 | |||
| 2870 | 2917557478 | |||
| 2871 | 2922362237 | |||
| 2872 | 2922388008 | |||
| 2873 | 2922428553 | |||
| 2874 | 2928126203 | |||
| 2875 | 2928534269 | |||
| 2876 | 2932402893 | |||
| 2877 | 2935634533 | |||
| 2878 | 2935771432 | |||
| 2879 | 2935779121 | |||
| 2880 | 2935788325 | |||
| 2881 | 2935800862 | |||
| 2882 | 2935911737 | |||
| 2883 | 2935919392 | |||
| 2884 | 2935928766 | |||
| 2885 | 2935938411 | |||
| 2886 | 2935945697 | |||
| 2887 | 2935954696 | |||
| 2888 | 2935970583 | |||
| 2889 | 2941509019 | |||
| 2890 | 2941516848 | |||
| 2891 | 2941525057 | |||
| 2892 | 2941536324 | |||
| 2893 | 3005478684 | |||
| 2894 | 3005597420 | |||
| 2895 | 3005720862 | |||
| 2896 | 641642475 | |||
| 2897 | 643598139 | |||
| 2898 | 8006942675 | |||
| 2899 | 8006964812 | |||
| 2900 | 8006982402 | |||
| 2901 | 8006991791 | |||
| 2902 | 8006995548 | |||
| 2903 | 8016522953 | |||
| 2904 | 8016536414 | |||
| 2905 | 8016540695 | |||
| 2906 | 8016560929 | |||
| 2907 | 8016574777 | |||
| 2908 | 8016578852 | |||
| 2909 | 8016590787 | |||
| 2910 | 8016598797 | |||
| 2911 | 8016612284 | |||
| 2912 | 8016628437 | |||
| 2913 | 8019536135 | |||
| 2914 | 8019543336 | |||
| 2915 | 8019555521 | |||
| 2916 | 8019558442 | |||
| 2917 | 8019566856 | |||
| 2918 | 8019656421 | |||
| 2919 | 8019688383 | |||
| 2920 | 8045865095 | |||
| 2921 | 8056676406 | |||
| 2922 | 8056691867 | |||
| 2923 | 8056969488 | |||
| 2924 | 8057530600 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.9801 | 48 | 150 |
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.9616 | 48 | 150 |
| 1qd7-assembly1.cif.gz_C | partial model for 30s ribosomal subunit | 0.9579 | 44 | 205 |
| 6vwl-assembly1.cif.gz_c | 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) | 0.9514 | 45 | 203 |
| 1qd7-assembly1.cif.gz_C | partial model for 30s ribosomal subunit | 0.9462 | 44 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LXG1_108_164_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9896 | 93 | 136 | 3.10.290.10 |
| af_A0A0P0Y445_123_179_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9842 | 95 | 136 | 3.10.290.10 |
| af_Q4DSJ7_105_180_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9778 | 93 | 136 | 3.10.290.10 |
| af_C6TBL4_107_182_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9595 | 95 | 136 | 3.10.290.10 |
| 2qalD02 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9592 | 96 | 188 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E4F994-F1-model_v4 | Small ribosomal subunit protein uS4 (30S ribosomal protein S4) | 0.9864 | 53 | 205 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A6A5LBZ0-F1-model_v4 | deleted | 0.9859 | 46 | 204 |
|
| AF-A0A358B310-F1-model_v4 | 30S ribosomal protein S4 | 0.9856 | 88 | 204 |
GO:0003735
GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A848SWC6-F1-model_v4 | Small ribosomal subunit protein uS4 (30S ribosomal protein S4) | 0.9852 | 52 | 204 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A3B8QXB5-F1-model_v4 | 30S ribosomal protein S4 | 0.9848 | 71 | 204 |
GO:0003735
GO:0015935 GO:0019843 GO:0042274 |