F494138
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1462 | 680 | 1056 | 311 |
Family's Representative Sequence
| Representative Sequence | 3300046458|Ga0495591_008225|Ga0495591_008225_1416_2519 |
| Length | 358 |
| Sequence | MHPRPNAKIRHAAHADGRRASQLFAQTQASKSVRGLPFTPLSDRRRSGNVIKPTGQSTLMTSKLEQLKKFTTVVADTGDFAAIEKLKPVDATTNPSLLLKAASSDSNADRLKEAFSGANNDIGLASDRFAVAIGQEILKVVPGRVSTEVDARISFDTNACIERAERLVELYDKAGIGRDRILIKLASTWEGIRAAEQLEKKGIQCNLTLLFSFAQAQACADAGVFLISPFVGRIYDWYKKAEGKDYVGAEDPGVKSVTDYKTVVMGASFRNLSQIEELAGCDRLTISPDLLHKLSEDTGTLVQKLKPGNGGEPRQTLNESQFRWASNEDAMATEKLAEGIRQFARDQEKLEALLSAKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 3 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 4 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 5 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 6 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 7 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 8 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 9 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 10 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 11 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 12 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 13 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 14 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 15 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 16 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 17 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 18 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 19 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 20 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 21 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 22 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 23 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 24 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 25 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 26 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 27 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 28 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 29 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 30 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 31 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 32 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 33 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 34 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 35 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 36 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 37 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 38 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 39 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 40 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 41 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 42 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 43 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 44 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 45 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 46 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 47 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 48 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 49 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 50 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 51 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 52 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 53 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 54 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 55 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 56 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 57 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 58 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 59 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 60 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 61 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 62 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 63 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 64 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 65 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 66 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 67 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 68 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 69 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 70 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 71 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 72 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 73 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 74 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 75 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 76 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 77 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 78 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 79 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 80 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 81 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 82 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 83 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 84 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 85 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 86 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 87 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 88 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 89 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 90 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 91 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 92 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 93 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 94 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 95 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 96 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 97 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 98 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 99 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 100 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 101 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 102 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 103 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 104 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 105 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 106 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 107 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 108 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 109 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 110 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 111 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 112 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 113 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 114 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 115 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 116 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 117 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 118 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 119 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 120 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 121 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 122 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 123 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 124 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 125 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 126 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 127 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 128 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 129 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 130 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 131 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 132 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 133 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 134 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 135 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 136 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 137 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 138 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 139 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 140 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 141 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 142 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 143 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 144 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 145 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 146 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 147 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 148 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 149 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 150 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 151 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 152 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 153 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 154 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 155 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 156 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 157 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 158 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 159 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 160 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 161 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 162 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 163 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 164 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 165 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 166 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 167 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 168 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 169 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 170 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 171 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 172 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 173 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 174 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 175 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 176 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 177 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 178 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 179 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 180 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 181 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 182 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 183 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 184 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 185 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 186 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 187 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 188 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 189 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 190 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 191 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 192 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 193 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 194 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 195 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 196 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 197 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 198 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 199 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 200 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 201 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 202 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 203 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 204 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 205 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 206 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 207 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 208 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 209 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 210 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 211 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 212 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 213 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 214 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 215 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 216 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 217 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 218 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 219 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 220 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 221 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 222 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 223 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 224 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 225 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 226 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 227 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 228 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 229 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 230 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 231 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 232 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 233 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 234 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 235 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 236 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 237 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 238 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 239 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 240 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 241 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 242 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 243 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 244 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 245 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 246 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 247 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 248 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 249 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 250 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 251 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 252 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 253 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 254 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 255 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 256 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 257 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 258 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 259 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 260 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 261 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 262 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 263 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 264 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 265 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 266 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 267 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 268 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 269 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 270 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 271 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 272 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 273 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 274 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 275 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 276 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 277 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 278 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 279 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 280 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 281 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 282 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 283 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 284 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 285 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 286 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 287 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 288 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 289 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 290 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 291 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 292 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 293 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 294 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 295 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 296 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 297 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 298 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 299 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 300 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 301 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 302 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 303 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 304 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 305 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 306 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 307 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 308 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 309 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 310 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 311 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 312 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 313 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 314 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 315 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 316 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 317 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 318 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 319 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 320 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 321 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 322 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 323 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 324 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 325 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 326 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 327 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 328 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 329 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 330 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 331 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 332 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 333 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 334 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 335 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 336 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 337 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 338 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 339 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 340 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 341 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 342 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 343 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 344 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 345 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 346 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 347 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 348 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 349 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 350 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 351 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 352 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 353 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 354 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 355 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 356 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 357 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 358 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 359 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 360 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 361 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 362 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 363 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 364 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 365 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 366 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 367 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 368 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 369 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 370 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 371 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 372 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 373 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 374 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 375 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 376 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 377 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 378 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 379 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 380 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 381 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 382 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 383 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 384 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 385 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 386 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 387 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 388 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 389 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 390 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 391 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 392 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 393 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 394 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 395 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 396 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 398 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 399 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 400 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 401 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 402 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 403 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 404 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 405 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 406 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 407 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 408 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 409 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 410 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 411 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 412 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 413 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 414 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 415 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 416 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 417 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 418 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 419 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 420 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 421 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 422 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 423 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 424 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 425 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 426 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 427 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 428 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 429 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 430 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 431 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 432 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 433 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 434 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 435 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 436 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 437 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 438 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 439 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 440 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 441 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 442 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 443 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 444 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 445 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 446 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 447 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 471 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 472 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 476 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 477 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 481 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 482 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 483 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 484 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 485 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 486 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 487 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 488 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 489 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 490 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 491 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 492 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 493 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 494 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 495 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 496 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 497 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 498 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 499 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 500 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 501 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 502 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 503 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 504 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 505 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 506 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 507 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 508 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 509 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 510 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 511 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 512 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 513 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 514 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 515 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 516 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 517 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 518 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 519 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 520 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 521 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 522 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 523 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 524 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 525 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 526 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 527 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 528 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 529 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 530 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 531 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 532 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 533 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 534 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 608 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 609 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 610 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 611 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 612 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 613 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 614 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 615 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 616 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 617 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 618 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 619 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 620 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 621 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 622 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 623 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 624 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 625 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 626 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 627 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 630 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 631 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 632 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 633 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 634 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 635 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 636 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 637 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 638 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 639 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 640 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 641 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 642 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 643 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 644 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 645 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 646 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 647 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 648 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 649 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 650 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 651 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 652 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 653 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 654 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 655 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 656 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 657 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 658 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 659 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 660 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 661 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 662 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 663 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 664 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 665 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 666 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 667 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 668 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 669 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 670 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 671 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 672 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 673 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 674 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 675 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 676 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 677 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 678 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 679 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 680 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.23 |
| Metatranscriptomes | 0 |
| Isolates | 27.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0.07 |
| Endosphere | 4.86 |
| Nodule | 3.21 |
| Rhizoplane | 9.44 |
| Rhizosphere | 64.5 |
| Stem | 0.07 |
| Stem Tuber | 0.41 |
| Unclassified | 17.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1682 | 2124908027 | Bacteria | 5867 |
| 2 | JGI24739J22299_10000206 | 3300001989 | Bacteria | 19601 |
| 3 | JGI25162J39368_1000006 | 3300002737 | Bacteria | 405267 |
| 4 | JGI25162J39368_1000391 | 3300002737 | Bacteria | 36980 |
| 5 | JGI25162J39368_1002479 | 3300002737 | Bacteria | 7117 |
| 6 | JGI25163J39215_1000001 | 3300002771 | Bacteria | 314282 |
| 7 | JGI25163J39215_1000255 | 3300002771 | Bacteria | 19472 |
| 8 | JGI25163J39215_1001158 | 3300002771 | Bacteria | 5136 |
| 9 | JGI25164J39214_1000001 | 3300002772 | Bacteria | 477015 |
| 10 | JGI25164J39214_1000089 | 3300002772 | Bacteria | 91309 |
| 11 | JGI25164J39214_1000279 | 3300002772 | Bacteria | 36980 |
| 12 | JGI25152J39213_1000367 | 3300002773 | Bacteria | 27850 |
| 13 | JGI25165J46597_1000191 | 3300003214 | Bacteria | 91309 |
| 14 | JGI25165J46597_1000510 | 3300003214 | Bacteria | 36980 |
| 15 | rootH2_10032116 | 3300003320 | Bacteria | 24090 |
| 16 | Ga0055538_1000004 | 3300003751 | Bacteria | 615646 |
| 17 | Ga0055538_1000078 | 3300003751 | Bacteria | 86114 |
| 18 | Ga0055539_1000004 | 3300003752 | Bacteria | 615646 |
| 19 | Ga0055533_1000007 | 3300003756 | Bacteria | 615646 |
| 20 | Ga0055525_1000007 | 3300003759 | Bacteria | 615646 |
| 21 | Ga0055536_1000089 | 3300003781 | Bacteria | 78019 |
| 22 | Ga0055530_10000230 | 3300003791 | Bacteria | 49999 |
| 23 | Ga0055530_10000462 | 3300003791 | Bacteria | 35966 |
| 24 | Ga0055530_10001861 | 3300003791 | Bacteria | 14501 |
| 25 | Ga0055540_1000163 | 3300003792 | Bacteria | 66649 |
| 26 | Ga0055540_1000241 | 3300003792 | Bacteria | 49999 |
| 27 | Ga0055540_1001061 | 3300003792 | Bacteria | 17512 |
| 28 | Ga0055531_10044352 | 3300003794 | Bacteria | 1247 |
| 29 | Ga0055541_1000004 | 3300003841 | Bacteria | 615646 |
| 30 | Ga0058692_1000154 | 3300003856 | Bacteria | 43640 |
| 31 | Ga0058692_1000657 | 3300003856 | Bacteria | 14294 |
| 32 | Ga0058692_1000730 | 3300003856 | Bacteria | 13319 |
| 33 | Ga0058692_1002498 | 3300003856 | Bacteria | 6127 |
| 34 | Ga0058692_1003910 | 3300003856 | Bacteria | 4517 |
| 35 | Ga0058692_1012084 | 3300003856 | Bacteria | 2059 |
| 36 | Ga0065703_1018920 | 3300005272 | Bacteria | 5150 |
| 37 | Ga0065714_10003160 | 3300005288 | Bacteria | 8831 |
| 38 | Ga0065714_10004034 | 3300005288 | Bacteria | 6734 |
| 39 | Ga0065714_10085992 | 3300005288 | Bacteria | 2121 |
| 40 | Ga0065714_10099170 | 3300005288 | Bacteria | 1692 |
| 41 | Ga0065714_10139196 | 3300005288 | Bacteria | 1180 |
| 42 | Ga0065704_10003841 | 3300005289 | Bacteria | 6810 |
| 43 | Ga0065704_10007594 | 3300005289 | Bacteria | 3086 |
| 44 | Ga0065704_10088469 | 3300005289 | Bacteria | 2936 |
| 45 | Ga0065712_10002471 | 3300005290 | Bacteria | 11296 |
| 46 | Ga0065712_10068141 | 3300005290 | Bacteria | 13957 |
| 47 | Ga0065712_10070283 | 3300005290 | Bacteria | 6136 |
| 48 | Ga0065712_10071164 | 3300005290 | Bacteria | 5445 |
| 49 | Ga0070670_100000052 | 3300005331 | Bacteria | 129346 |
| 50 | Ga0070670_100000751 | 3300005331 | Bacteria | 25153 |
| 51 | Ga0070670_100002027 | 3300005331 | Bacteria | 16575 |
| 52 | Ga0070661_100001228 | 3300005344 | Bacteria | 18034 |
| 53 | Ga0070668_100001689 | 3300005347 | Bacteria | 16007 |
| 54 | Ga0070669_100005813 | 3300005353 | Bacteria | 8897 |
| 55 | Ga0070671_100000055 | 3300005355 | Bacteria | 77442 |
| 56 | Ga0070688_100055182 | 3300005365 | Bacteria | 2491 |
| 57 | Ga0070667_100000021 | 3300005367 | Bacteria | 205662 |
| 58 | Ga0070662_100013363 | 3300005457 | Bacteria | 5464 |
| 59 | Ga0070662_100031548 | 3300005457 | Bacteria | 3720 |
| 60 | Ga0070685_10000003 | 3300005466 | Bacteria | 283138 |
| 61 | Ga0070665_100005453 | 3300005548 | Bacteria | 13113 |
| 62 | Ga0070665_100007189 | 3300005548 | Bacteria | 11317 |
| 63 | Ga0070665_100069632 | 3300005548 | Bacteria | 3526 |
| 64 | Ga0070665_100134082 | 3300005548 | Bacteria | 2478 |
| 65 | Ga0070665_100242711 | 3300005548 | Bacteria | 1802 |
| 66 | Ga0070664_100001616 | 3300005564 | Bacteria | 18034 |
| 67 | Ga0068857_100000386 | 3300005577 | Bacteria | 30880 |
| 68 | Ga0068857_100254231 | 3300005577 | Bacteria | 1611 |
| 69 | Ga0068859_100002966 | 3300005617 | Bacteria | 17199 |
| 70 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 71 | Ga0068858_100029359 | 3300005842 | Bacteria | 5105 |
| 72 | Ga0068860_100000695 | 3300005843 | Bacteria | 38687 |
| 73 | Ga0075364_10023611 | 3300006051 | Bacteria | 3895 |
| 74 | Ga0075364_10059248 | 3300006051 | Bacteria | 2510 |
| 75 | Ga0075432_10006397 | 3300006058 | Bacteria | 4007 |
| 76 | Ga0075362_10051079 | 3300006177 | Bacteria | 1850 |
| 77 | Ga0075366_10009474 | 3300006195 | Bacteria | 5436 |
| 78 | Ga0097620_100002966 | 3300006931 | Bacteria | 17199 |
| 79 | Ga0099823_1000050 | 3300006944 | Bacteria | 57425 |
| 80 | Ga0079104_1000099 | 3300006946 | Bacteria | 126954 |
| 81 | Ga0079104_1000213 | 3300006946 | Bacteria | 81349 |
| 82 | Ga0079104_1000222 | 3300006946 | Bacteria | 78855 |
| 83 | Ga0079104_1000403 | 3300006946 | Bacteria | 49953 |
| 84 | Ga0079104_1001515 | 3300006946 | Bacteria | 15400 |
| 85 | Ga0079104_1001820 | 3300006946 | Bacteria | 13146 |
| 86 | Ga0079104_1002919 | 3300006946 | Bacteria | 8499 |
| 87 | Ga0079104_1005396 | 3300006946 | Bacteria | 5121 |
| 88 | Ga0099826_10007176 | 3300006948 | Bacteria | 8197 |
| 89 | Ga0105251_10000158 | 3300009011 | Bacteria | 69153 |
| 90 | Ga0105251_10000401 | 3300009011 | Bacteria | 42259 |
| 91 | Ga0105251_10001649 | 3300009011 | Bacteria | 18872 |
| 92 | Ga0105251_10002215 | 3300009011 | Bacteria | 15509 |
| 93 | Ga0105251_10005690 | 3300009011 | Bacteria | 8094 |
| 94 | Ga0105251_10007932 | 3300009011 | Bacteria | 6450 |
| 95 | Ga0105251_10014126 | 3300009011 | Bacteria | 4431 |
| 96 | Ga0105251_10017931 | 3300009011 | Bacteria | 3780 |
| 97 | Ga0105251_10018857 | 3300009011 | Bacteria | 3658 |
| 98 | Ga0105251_10021619 | 3300009011 | Bacteria | 3356 |
| 99 | Ga0105251_10022596 | 3300009011 | Bacteria | 3262 |
| 100 | Ga0105251_10029529 | 3300009011 | Bacteria | 2762 |
| 101 | Ga0105251_10046254 | 3300009011 | Bacteria | 2094 |
| 102 | Ga0105251_10053006 | 3300009011 | Bacteria | 1930 |
| 103 | Ga0105251_10169024 | 3300009011 | Bacteria | 985 |
| 104 | Ga0105244_10000023 | 3300009036 | Bacteria | 233110 |
| 105 | Ga0105244_10000255 | 3300009036 | Bacteria | 54462 |
| 106 | Ga0105244_10000427 | 3300009036 | Bacteria | 38959 |
| 107 | Ga0105244_10000453 | 3300009036 | Bacteria | 37447 |
| 108 | Ga0105244_10000704 | 3300009036 | Bacteria | 29004 |
| 109 | Ga0105244_10001671 | 3300009036 | Bacteria | 17536 |
| 110 | Ga0105244_10001899 | 3300009036 | Bacteria | 16236 |
| 111 | Ga0105244_10001973 | 3300009036 | Bacteria | 15869 |
| 112 | Ga0105244_10002235 | 3300009036 | Bacteria | 14746 |
| 113 | Ga0105244_10002529 | 3300009036 | Bacteria | 13733 |
| 114 | Ga0105244_10003779 | 3300009036 | Bacteria | 10681 |
| 115 | Ga0105244_10005005 | 3300009036 | Bacteria | 8931 |
| 116 | Ga0105244_10005824 | 3300009036 | Bacteria | 8099 |
| 117 | Ga0105244_10007248 | 3300009036 | Bacteria | 7065 |
| 118 | Ga0105244_10013077 | 3300009036 | Bacteria | 4868 |
| 119 | Ga0105244_10021139 | 3300009036 | Bacteria | 3604 |
| 120 | Ga0105244_10052056 | 3300009036 | Bacteria | 2086 |
| 121 | Ga0105244_10109776 | 3300009036 | Bacteria | 1343 |
| 122 | Ga0105250_10000028 | 3300009092 | Bacteria | 204198 |
| 123 | Ga0105250_10000045 | 3300009092 | Bacteria | 127333 |
| 124 | Ga0105250_10000199 | 3300009092 | Bacteria | 51075 |
| 125 | Ga0105250_10000737 | 3300009092 | Bacteria | 19956 |
| 126 | Ga0105250_10001320 | 3300009092 | Bacteria | 13554 |
| 127 | Ga0105250_10001583 | 3300009092 | Bacteria | 12205 |
| 128 | Ga0105250_10001831 | 3300009092 | Bacteria | 11122 |
| 129 | Ga0105250_10004681 | 3300009092 | Bacteria | 6253 |
| 130 | Ga0105250_10011683 | 3300009092 | Bacteria | 3641 |
| 131 | Ga0105250_10013139 | 3300009092 | Bacteria | 3406 |
| 132 | Ga0105250_10013247 | 3300009092 | Bacteria | 3395 |
| 133 | Ga0105250_10013576 | 3300009092 | Bacteria | 3356 |
| 134 | Ga0105250_10014569 | 3300009092 | Bacteria | 3227 |
| 135 | Ga0105250_10032643 | 3300009092 | Bacteria | 2091 |
| 136 | Ga0105250_10135576 | 3300009092 | Bacteria | 1018 |
| 137 | Ga0105240_10147704 | 3300009093 | Bacteria | 2803 |
| 138 | Ga0105247_10000387 | 3300009101 | Bacteria | 37452 |
| 139 | Ga0105247_10012831 | 3300009101 | Bacteria | 5029 |
| 140 | Ga0105243_10000627 | 3300009148 | Bacteria | 35211 |
| 141 | Ga0105243_10002038 | 3300009148 | Bacteria | 17137 |
| 142 | Ga0105243_10003177 | 3300009148 | Bacteria | 13461 |
| 143 | Ga0105243_10010109 | 3300009148 | Bacteria | 7178 |
| 144 | Ga0105243_10067232 | 3300009148 | Bacteria | 2884 |
| 145 | Ga0105243_10179209 | 3300009148 | Bacteria | 1841 |
| 146 | Ga0105241_10000008 | 3300009174 | Bacteria | 334281 |
| 147 | Ga0105242_10001563 | 3300009176 | Bacteria | 18015 |
| 148 | Ga0105237_10000413 | 3300009545 | Bacteria | 60829 |
| 149 | Ga0105237_10028696 | 3300009545 | Bacteria | 5664 |
| 150 | Ga0105249_10016816 | 3300009553 | Bacteria | 6491 |
| 151 | Ga0105246_10000467 | 3300011119 | Bacteria | 21774 |
| 152 | Ga0105246_10000590 | 3300011119 | Bacteria | 20136 |
| 153 | Ga0105246_10007972 | 3300011119 | Bacteria | 6500 |
| 154 | Ga0105246_10034580 | 3300011119 | Bacteria | 3370 |
| 155 | Ga0157345_1000123 | 3300012498 | Bacteria | 15275 |
| 156 | Ga0157373_10001088 | 3300013100 | Bacteria | 20928 |
| 157 | Ga0157373_10001252 | 3300013100 | Bacteria | 19414 |
| 158 | Ga0157373_10006491 | 3300013100 | Bacteria | 8729 |
| 159 | Ga0157373_10008149 | 3300013100 | Bacteria | 7791 |
| 160 | Ga0157373_10015027 | 3300013100 | Bacteria | 5662 |
| 161 | Ga0157373_10018376 | 3300013100 | Bacteria | 5091 |
| 162 | Ga0157373_10018566 | 3300013100 | Bacteria | 5061 |
| 163 | Ga0157373_10039070 | 3300013100 | Bacteria | 3398 |
| 164 | Ga0157373_10060782 | 3300013100 | Bacteria | 2677 |
| 165 | Ga0157373_10122820 | 3300013100 | Bacteria | 1825 |
| 166 | Ga0157373_10226233 | 3300013100 | Bacteria | 1320 |
| 167 | Ga0157371_10000020 | 3300013102 | Bacteria | 304987 |
| 168 | Ga0157371_10000186 | 3300013102 | Bacteria | 91270 |
| 169 | Ga0157371_10000267 | 3300013102 | Bacteria | 71120 |
| 170 | Ga0157371_10000396 | 3300013102 | Bacteria | 54666 |
| 171 | Ga0157371_10001526 | 3300013102 | Bacteria | 23861 |
| 172 | Ga0157371_10002310 | 3300013102 | Bacteria | 18348 |
| 173 | Ga0157371_10003239 | 3300013102 | Bacteria | 14941 |
| 174 | Ga0157371_10005382 | 3300013102 | Bacteria | 10813 |
| 175 | Ga0157371_10029749 | 3300013102 | Bacteria | 3946 |
| 176 | Ga0157370_10000276 | 3300013104 | Bacteria | 65208 |
| 177 | Ga0157370_10000595 | 3300013104 | Bacteria | 45146 |
| 178 | Ga0157370_10001621 | 3300013104 | Bacteria | 27808 |
| 179 | Ga0157370_10004198 | 3300013104 | Bacteria | 16670 |
| 180 | Ga0157370_10035747 | 3300013104 | Bacteria | 4826 |
| 181 | Ga0157370_10040510 | 3300013104 | Bacteria | 4497 |
| 182 | Ga0157370_10091996 | 3300013104 | Bacteria | 2847 |
| 183 | Ga0157370_10126378 | 3300013104 | Bacteria | 2387 |
| 184 | Ga0157370_10194077 | 3300013104 | Bacteria | 1885 |
| 185 | Ga0157369_10000183 | 3300013105 | Bacteria | 86986 |
| 186 | Ga0157369_10001314 | 3300013105 | Bacteria | 30876 |
| 187 | Ga0157369_10006197 | 3300013105 | Bacteria | 13875 |
| 188 | Ga0157369_10008666 | 3300013105 | Bacteria | 11660 |
| 189 | Ga0157369_10034181 | 3300013105 | Bacteria | 5582 |
| 190 | Ga0157369_10135413 | 3300013105 | Bacteria | 2608 |
| 191 | Ga0157369_10321810 | 3300013105 | Bacteria | 1608 |
| 192 | Ga0157369_10326584 | 3300013105 | Bacteria | 1594 |
| 193 | Ga0163162_10007244 | 3300013306 | Bacteria | 10766 |
| 194 | Ga0163162_10011360 | 3300013306 | Bacteria | 8682 |
| 195 | Ga0163162_10012235 | 3300013306 | Bacteria | 8374 |
| 196 | Ga0157372_10001095 | 3300013307 | Bacteria | 29471 |
| 197 | Ga0157372_10001343 | 3300013307 | Bacteria | 26606 |
| 198 | Ga0157372_10015434 | 3300013307 | Bacteria | 8186 |
| 199 | Ga0157372_10031809 | 3300013307 | Bacteria | 5781 |
| 200 | Ga0157372_10088890 | 3300013307 | Bacteria | 3508 |
| 201 | Ga0157372_10116342 | 3300013307 | Bacteria | 3066 |
| 202 | Ga0157375_10005669 | 3300013308 | Bacteria | 10865 |
| 203 | Ga0157375_10062745 | 3300013308 | Bacteria | 3694 |
| 204 | Ga0157375_10649087 | 3300013308 | Bacteria | 1212 |
| 205 | Ga0163163_10000053 | 3300014325 | Bacteria | 126626 |
| 206 | Ga0182008_10001777 | 3300014497 | Bacteria | 14125 |
| 207 | Ga0182008_10005889 | 3300014497 | Bacteria | 6927 |
| 208 | Ga0182008_10079847 | 3300014497 | Bacteria | 1609 |
| 209 | Ga0182008_10085164 | 3300014497 | Bacteria | 1557 |
| 210 | Ga0182006_1000025 | 3300015261 | Bacteria | 255969 |
| 211 | Ga0182006_1005166 | 3300015261 | Bacteria | 6264 |
| 212 | Ga0182006_1006697 | 3300015261 | Bacteria | 5330 |
| 213 | Ga0182006_1011910 | 3300015261 | Bacteria | 3809 |
| 214 | Ga0182006_1024147 | 3300015261 | Bacteria | 2509 |
| 215 | Ga0182006_1025996 | 3300015261 | Bacteria | 2401 |
| 216 | Ga0182006_1041062 | 3300015261 | Bacteria | 1818 |
| 217 | Ga0182006_1043234 | 3300015261 | Bacteria | 1761 |
| 218 | Ga0182006_1059177 | 3300015261 | Bacteria | 1451 |
| 219 | Ga0182007_10025387 | 3300015262 | Bacteria | 2065 |
| 220 | Ga0182005_1002971 | 3300015265 | Bacteria | 5874 |
| 221 | Ga0182005_1009980 | 3300015265 | Bacteria | 2743 |
| 222 | Ga0182005_1025465 | 3300015265 | Bacteria | 1614 |
| 223 | Ga0182005_1026233 | 3300015265 | Bacteria | 1590 |
| 224 | Ga0182005_1027509 | 3300015265 | Bacteria | 1550 |
| 225 | Ga0183366_1003 | 3300015679 | Bacteria | 453474 |
| 226 | Ga0183370_1003 | 3300015680 | Bacteria | 454044 |
| 227 | Ga0183369_1005 | 3300015685 | Bacteria | 453680 |
| 228 | Ga0183368_1006 | 3300015687 | Bacteria | 551576 |
| 229 | Ga0183361_11316 | 3300016635 | Bacteria | 1268 |
| 230 | Ga0163161_10000002 | 3300017792 | Bacteria | 411983 |
| 231 | Ga0163161_10003398 | 3300017792 | Bacteria | 11173 |
| 232 | Ga0163161_10008626 | 3300017792 | Bacteria | 7047 |
| 233 | Ga0163161_10024842 | 3300017792 | Bacteria | 4236 |
| 234 | Ga0163161_10103618 | 3300017792 | Bacteria | 2120 |
| 235 | Ga0163161_10114956 | 3300017792 | Bacteria | 2016 |
| 236 | Ga0213876_10000026 | 3300021384 | Bacteria | 231892 |
| 237 | Ga0209760_100063 | 3300025207 | Bacteria | 92173 |
| 238 | Ga0209760_100087 | 3300025207 | Bacteria | 73419 |
| 239 | Ga0209760_100145 | 3300025207 | Bacteria | 44471 |
| 240 | Ga0209760_100173 | 3300025207 | Bacteria | 35497 |
| 241 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 242 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 243 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 244 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 245 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 246 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 247 | Ga0207427_100048 | 3300025231 | Bacteria | 238464 |
| 248 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 249 | Ga0209437_100046 | 3300025233 | Bacteria | 405293 |
| 250 | Ga0209437_100063 | 3300025233 | Bacteria | 335477 |
| 251 | Ga0209437_100094 | 3300025233 | Bacteria | 238465 |
| 252 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 253 | Ga0209759_1005910 | 3300025256 | Bacteria | 4187 |
| 254 | Ga0209129_1000008 | 3300025258 | Bacteria | 640959 |
| 255 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 256 | Ga0209233_1000106 | 3300025261 | Bacteria | 268795 |
| 257 | Ga0209233_1001593 | 3300025261 | Bacteria | 8872 |
| 258 | Ga0209675_1007855 | 3300025291 | Bacteria | 4011 |
| 259 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 260 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 261 | Ga0209676_1000166 | 3300025292 | Bacteria | 156596 |
| 262 | Ga0209676_1002655 | 3300025292 | Bacteria | 12151 |
| 263 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 264 | Ga0209050_1000275 | 3300025298 | Bacteria | 110235 |
| 265 | Ga0209050_1000395 | 3300025298 | Bacteria | 81719 |
| 266 | Ga0209050_1002062 | 3300025298 | Bacteria | 18497 |
| 267 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 268 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 269 | Ga0209051_1000585 | 3300025303 | Bacteria | 43163 |
| 270 | Ga0209051_1017780 | 3300025303 | Bacteria | 3168 |
| 271 | Ga0209257_1000181 | 3300025304 | Bacteria | 158039 |
| 272 | Ga0209257_1004705 | 3300025304 | Bacteria | 10244 |
| 273 | Ga0207696_1000009 | 3300025711 | Bacteria | 564405 |
| 274 | Ga0207696_1000027 | 3300025711 | Bacteria | 412783 |
| 275 | Ga0207696_1000063 | 3300025711 | Bacteria | 239123 |
| 276 | Ga0207696_1000090 | 3300025711 | Bacteria | 188474 |
| 277 | Ga0207696_1000093 | 3300025711 | Bacteria | 184278 |
| 278 | Ga0207696_1000117 | 3300025711 | Bacteria | 148004 |
| 279 | Ga0207696_1000140 | 3300025711 | Bacteria | 127393 |
| 280 | Ga0207696_1000142 | 3300025711 | Bacteria | 123519 |
| 281 | Ga0207696_1000176 | 3300025711 | Bacteria | 100134 |
| 282 | Ga0207696_1000177 | 3300025711 | Bacteria | 100134 |
| 283 | Ga0207696_1000189 | 3300025711 | Bacteria | 95393 |
| 284 | Ga0207696_1000761 | 3300025711 | Bacteria | 21277 |
| 285 | Ga0207696_1001106 | 3300025711 | Bacteria | 15723 |
| 286 | Ga0207696_1001409 | 3300025711 | Bacteria | 13121 |
| 287 | Ga0207696_1002032 | 3300025711 | Bacteria | 10239 |
| 288 | Ga0207696_1006471 | 3300025711 | Bacteria | 4718 |
| 289 | Ga0207696_1013635 | 3300025711 | Bacteria | 2820 |
| 290 | Ga0207696_1016653 | 3300025711 | Bacteria | 2454 |
| 291 | Ga0207696_1019721 | 3300025711 | Bacteria | 2188 |
| 292 | Ga0207696_1035807 | 3300025711 | Bacteria | 1476 |
| 293 | Ga0207655_1000006 | 3300025728 | Bacteria | 861092 |
| 294 | Ga0207655_1000017 | 3300025728 | Bacteria | 544403 |
| 295 | Ga0207655_1000024 | 3300025728 | Bacteria | 459774 |
| 296 | Ga0207655_1000026 | 3300025728 | Bacteria | 445528 |
| 297 | Ga0207655_1000054 | 3300025728 | Bacteria | 281894 |
| 298 | Ga0207655_1000056 | 3300025728 | Bacteria | 279166 |
| 299 | Ga0207655_1000084 | 3300025728 | Bacteria | 207679 |
| 300 | Ga0207655_1000096 | 3300025728 | Bacteria | 194292 |
| 301 | Ga0207655_1000101 | 3300025728 | Bacteria | 185883 |
| 302 | Ga0207655_1000140 | 3300025728 | Bacteria | 139110 |
| 303 | Ga0207655_1000146 | 3300025728 | Bacteria | 132221 |
| 304 | Ga0207655_1002118 | 3300025728 | Bacteria | 16607 |
| 305 | Ga0207655_1002372 | 3300025728 | Bacteria | 15380 |
| 306 | Ga0207655_1002510 | 3300025728 | Bacteria | 14790 |
| 307 | Ga0207655_1003121 | 3300025728 | Bacteria | 12552 |
| 308 | Ga0207655_1004562 | 3300025728 | Bacteria | 9766 |
| 309 | Ga0207655_1005359 | 3300025728 | Bacteria | 8750 |
| 310 | Ga0207655_1006033 | 3300025728 | Bacteria | 8099 |
| 311 | Ga0207655_1008732 | 3300025728 | Bacteria | 6383 |
| 312 | Ga0207655_1009237 | 3300025728 | Bacteria | 6150 |
| 313 | Ga0207655_1010013 | 3300025728 | Bacteria | 5809 |
| 314 | Ga0207655_1010613 | 3300025728 | Bacteria | 5570 |
| 315 | Ga0207655_1011086 | 3300025728 | Bacteria | 5403 |
| 316 | Ga0207655_1018628 | 3300025728 | Bacteria | 3671 |
| 317 | Ga0207655_1019483 | 3300025728 | Bacteria | 3542 |
| 318 | Ga0207655_1022903 | 3300025728 | Bacteria | 3113 |
| 319 | Ga0207655_1025497 | 3300025728 | Bacteria | 2868 |
| 320 | Ga0207655_1025694 | 3300025728 | Bacteria | 2852 |
| 321 | Ga0207655_1026231 | 3300025728 | Bacteria | 2802 |
| 322 | Ga0207655_1026669 | 3300025728 | Bacteria | 2770 |
| 323 | Ga0207655_1062566 | 3300025728 | Bacteria | 1430 |
| 324 | Ga0207713_1000007 | 3300025735 | Bacteria | 564979 |
| 325 | Ga0207713_1000034 | 3300025735 | Bacteria | 266214 |
| 326 | Ga0207713_1000046 | 3300025735 | Bacteria | 232796 |
| 327 | Ga0207713_1000058 | 3300025735 | Bacteria | 216911 |
| 328 | Ga0207713_1000110 | 3300025735 | Bacteria | 135907 |
| 329 | Ga0207713_1000158 | 3300025735 | Bacteria | 102081 |
| 330 | Ga0207713_1000160 | 3300025735 | Bacteria | 100682 |
| 331 | Ga0207713_1000419 | 3300025735 | Bacteria | 45136 |
| 332 | Ga0207713_1001972 | 3300025735 | Bacteria | 15450 |
| 333 | Ga0207713_1002981 | 3300025735 | Bacteria | 11834 |
| 334 | Ga0207713_1004279 | 3300025735 | Bacteria | 9310 |
| 335 | Ga0207713_1004302 | 3300025735 | Bacteria | 9280 |
| 336 | Ga0207713_1004891 | 3300025735 | Bacteria | 8576 |
| 337 | Ga0207713_1010990 | 3300025735 | Bacteria | 4963 |
| 338 | Ga0207713_1011927 | 3300025735 | Bacteria | 4687 |
| 339 | Ga0207713_1013824 | 3300025735 | Bacteria | 4229 |
| 340 | Ga0207713_1014256 | 3300025735 | Bacteria | 4143 |
| 341 | Ga0207713_1019102 | 3300025735 | Bacteria | 3367 |
| 342 | Ga0207713_1026762 | 3300025735 | Bacteria | 2635 |
| 343 | Ga0207713_1056881 | 3300025735 | Bacteria | 1516 |
| 344 | Ga0207710_10000015 | 3300025900 | Bacteria | 393018 |
| 345 | Ga0207680_10051360 | 3300025903 | Bacteria | 2465 |
| 346 | Ga0207654_10000009 | 3300025911 | Bacteria | 334291 |
| 347 | Ga0207695_10138477 | 3300025913 | Bacteria | 2385 |
| 348 | Ga0207671_10005571 | 3300025914 | Bacteria | 11559 |
| 349 | Ga0207671_10283640 | 3300025914 | Bacteria | 1306 |
| 350 | Ga0207649_10000156 | 3300025920 | Bacteria | 55743 |
| 351 | Ga0207681_10002936 | 3300025923 | Bacteria | 10759 |
| 352 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 353 | Ga0207650_10000554 | 3300025925 | Bacteria | 30405 |
| 354 | Ga0207644_10001388 | 3300025931 | Bacteria | 15629 |
| 355 | Ga0207706_10006938 | 3300025933 | Bacteria | 10477 |
| 356 | Ga0207706_10039228 | 3300025933 | Bacteria | 4198 |
| 357 | Ga0207686_10003046 | 3300025934 | Bacteria | 9021 |
| 358 | Ga0207709_10000045 | 3300025935 | Bacteria | 240671 |
| 359 | Ga0207709_10000763 | 3300025935 | Bacteria | 25375 |
| 360 | Ga0207709_10005426 | 3300025935 | Bacteria | 7246 |
| 361 | Ga0207709_10049003 | 3300025935 | Bacteria | 2576 |
| 362 | Ga0207709_10105804 | 3300025935 | Bacteria | 1870 |
| 363 | Ga0207709_10137802 | 3300025935 | Bacteria | 1673 |
| 364 | Ga0207711_10000178 | 3300025941 | Bacteria | 68438 |
| 365 | Ga0207679_10000016 | 3300025945 | Bacteria | 253494 |
| 366 | Ga0207712_10035676 | 3300025961 | Bacteria | 3381 |
| 367 | Ga0207668_10002127 | 3300025972 | Bacteria | 11553 |
| 368 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 369 | Ga0207641_10018214 | 3300026088 | Bacteria | 5756 |
| 370 | Ga0207641_10155440 | 3300026088 | Bacteria | 2074 |
| 371 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 372 | Ga0207674_10000009 | 3300026116 | Bacteria | 202730 |
| 373 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 374 | Ga0209281_1000054 | 3300027111 | Bacteria | 309505 |
| 375 | Ga0209281_1000058 | 3300027111 | Bacteria | 300244 |
| 376 | Ga0209281_1000060 | 3300027111 | Bacteria | 295683 |
| 377 | Ga0209281_1000090 | 3300027111 | Bacteria | 242950 |
| 378 | Ga0209281_1000120 | 3300027111 | Bacteria | 206692 |
| 379 | Ga0209281_1000223 | 3300027111 | Bacteria | 121161 |
| 380 | Ga0209281_1000648 | 3300027111 | Bacteria | 37573 |
| 381 | Ga0209281_1000822 | 3300027111 | Bacteria | 28039 |
| 382 | Ga0209281_1000854 | 3300027111 | Bacteria | 26809 |
| 383 | Ga0209281_1001003 | 3300027111 | Bacteria | 22148 |
| 384 | Ga0209281_1001185 | 3300027111 | Bacteria | 17897 |
| 385 | Ga0209281_1003980 | 3300027111 | Bacteria | 4580 |
| 386 | Ga0209281_1004668 | 3300027111 | Bacteria | 4031 |
| 387 | Ga0209281_1005142 | 3300027111 | Bacteria | 3700 |
| 388 | Ga0209389_1000053 | 3300027296 | Bacteria | 108874 |
| 389 | Ga0209371_1000014 | 3300027312 | Bacteria | 661118 |
| 390 | Ga0209371_1000030 | 3300027312 | Bacteria | 423605 |
| 391 | Ga0209371_1000053 | 3300027312 | Bacteria | 264616 |
| 392 | Ga0209371_1000054 | 3300027312 | Bacteria | 259676 |
| 393 | Ga0209371_1000111 | 3300027312 | Bacteria | 140093 |
| 394 | Ga0209371_1000123 | 3300027312 | Bacteria | 131854 |
| 395 | Ga0209371_1000245 | 3300027312 | Bacteria | 67465 |
| 396 | Ga0209371_1000495 | 3300027312 | Bacteria | 38270 |
| 397 | Ga0209371_1000544 | 3300027312 | Bacteria | 35405 |
| 398 | Ga0209371_1000563 | 3300027312 | Bacteria | 33948 |
| 399 | Ga0209371_1000655 | 3300027312 | Bacteria | 30194 |
| 400 | Ga0209371_1001916 | 3300027312 | Bacteria | 12706 |
| 401 | Ga0209371_1002190 | 3300027312 | Bacteria | 11391 |
| 402 | Ga0209371_1002345 | 3300027312 | Bacteria | 10767 |
| 403 | Ga0209371_1005437 | 3300027312 | Bacteria | 5065 |
| 404 | Ga0209371_1006335 | 3300027312 | Bacteria | 4407 |
| 405 | Ga0209371_1006480 | 3300027312 | Bacteria | 4325 |
| 406 | Ga0209981_1007774 | 3300027378 | Bacteria | 1450 |
| 407 | Ga0209983_1001336 | 3300027665 | Bacteria | 5495 |
| 408 | Ga0209282_1024480 | 3300027666 | Bacteria | 3784 |
| 409 | Ga0207428_10037203 | 3300027907 | Bacteria | 3962 |
| 410 | Ga0207428_10052219 | 3300027907 | Bacteria | 3266 |
| 411 | Ga0268266_10000290 | 3300028379 | Bacteria | 82154 |
| 412 | Ga0268266_10004075 | 3300028379 | Bacteria | 14128 |
| 413 | Ga0268265_10000936 | 3300028380 | Bacteria | 26856 |
| 414 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 415 | Ga0307517_10118597 | 3300028786 | Bacteria | 1969 |
| 416 | Ga0268256_1000012 | 3300030500 | Bacteria | 794553 |
| 417 | Ga0268256_1000021 | 3300030500 | Bacteria | 542735 |
| 418 | Ga0268256_1000025 | 3300030500 | Bacteria | 484317 |
| 419 | Ga0268256_1000053 | 3300030500 | Bacteria | 264616 |
| 420 | Ga0268256_1000095 | 3300030500 | Bacteria | 139698 |
| 421 | Ga0268256_1000201 | 3300030500 | Bacteria | 67997 |
| 422 | Ga0268256_1000426 | 3300030500 | Bacteria | 38063 |
| 423 | Ga0268256_1000462 | 3300030500 | Bacteria | 35405 |
| 424 | Ga0268256_1000488 | 3300030500 | Bacteria | 33948 |
| 425 | Ga0268256_1000560 | 3300030500 | Bacteria | 30194 |
| 426 | Ga0268256_1001337 | 3300030500 | Bacteria | 15090 |
| 427 | Ga0268256_1001950 | 3300030500 | Bacteria | 11283 |
| 428 | Ga0268256_1002082 | 3300030500 | Bacteria | 10767 |
| 429 | Ga0268256_1005190 | 3300030500 | Bacteria | 5172 |
| 430 | Ga0268256_1006367 | 3300030500 | Bacteria | 4407 |
| 431 | Ga0307511_10039070 | 3300030521 | Bacteria | 4061 |
| 432 | Ga0316178_1017010 | 3300030735 | Bacteria | 20955 |
| 433 | Ga0265331_10014585 | 3300031250 | Bacteria | 4176 |
| 434 | Ga0265327_10000053 | 3300031251 | Bacteria | 255002 |
| 435 | Ga0307408_100000018 | 3300031548 | Bacteria | 346872 |
| 436 | Ga0307408_100019822 | 3300031548 | Bacteria | 4530 |
| 437 | Ga0307408_100051870 | 3300031548 | Bacteria | 2957 |
| 438 | Ga0307408_100145719 | 3300031548 | Bacteria | 1863 |
| 439 | Ga0307408_100298467 | 3300031548 | Bacteria | 1348 |
| 440 | Ga0307405_10001157 | 3300031731 | Bacteria | 10852 |
| 441 | Ga0307405_10001903 | 3300031731 | Bacteria | 8985 |
| 442 | Ga0307405_10006203 | 3300031731 | Bacteria | 5859 |
| 443 | Ga0307405_10175589 | 3300031731 | Bacteria | 1532 |
| 444 | Ga0307413_10062014 | 3300031824 | Bacteria | 2310 |
| 445 | Ga0307406_10187332 | 3300031901 | Bacteria | 1512 |
| 446 | Ga0307407_10028336 | 3300031903 | Bacteria | 2993 |
| 447 | Ga0307412_10001593 | 3300031911 | Bacteria | 12493 |
| 448 | Ga0307412_10003035 | 3300031911 | Bacteria | 9295 |
| 449 | Ga0307412_10060637 | 3300031911 | Bacteria | 2539 |
| 450 | Ga0307409_100170447 | 3300031995 | Bacteria | 1915 |
| 451 | Ga0307416_100202633 | 3300032002 | Bacteria | 1884 |
| 452 | Ga0307414_10102170 | 3300032004 | Bacteria | 2160 |
| 453 | Ga0307414_10230261 | 3300032004 | Bacteria | 1527 |
| 454 | Ga0307411_10026943 | 3300032005 | Bacteria | 3468 |
| 455 | Ga0307510_10000104 | 3300033180 | Bacteria | 66463 |
| 456 | Ga0316584_0040155 | 3300036712 | Bacteria | 3486 |
| 457 | Ga0373925_0056469 | 3300037068 | Bacteria | 2941 |
| 458 | Ga0395900_0011285 | 3300037418 | Bacteria | 9138 |
| 459 | Ga0395898_0001760 | 3300037466 | Bacteria | 28357 |
| 460 | Ga0395901_0007079 | 3300038443 | Bacteria | 11337 |
| 461 | Ga0237819_00979 | 3300038705 | Bacteria | 8654 |
| 462 | Ga0400483_217404 | 3300039062 | Bacteria | 18991 |
| 463 | Ga0436365_0084998 | 3300039437 | Bacteria | 507888 |
| 464 | Ga0439438_000003 | 3300041405 | Bacteria | 464587 |
| 465 | Ga0439438_000140 | 3300041405 | Bacteria | 32855 |
| 466 | Ga0439438_000238 | 3300041405 | Bacteria | 24472 |
| 467 | Ga0439438_000536 | 3300041405 | Bacteria | 17257 |
| 468 | Ga0439438_000677 | 3300041405 | Bacteria | 15284 |
| 469 | Ga0439438_001320 | 3300041405 | Bacteria | 10978 |
| 470 | Ga0439438_008005 | 3300041405 | Bacteria | 3555 |
| 471 | Ga0439438_017178 | 3300041405 | Bacteria | 2088 |
| 472 | Ga0439438_021007 | 3300041405 | Bacteria | 1825 |
| 473 | Ga0439447_001380 | 3300041407 | Bacteria | 8889 |
| 474 | Ga0439447_002568 | 3300041407 | Bacteria | 6599 |
| 475 | Ga0439447_005955 | 3300041407 | Bacteria | 4002 |
| 476 | Ga0439447_007219 | 3300041407 | Bacteria | 3543 |
| 477 | Ga0439447_014766 | 3300041407 | Bacteria | 2180 |
| 478 | Ga0439447_017056 | 3300041407 | Bacteria | 1982 |
| 479 | Ga0439447_020436 | 3300041407 | Bacteria | 1756 |
| 480 | Ga0439447_032263 | 3300041407 | Bacteria | 1309 |
| 481 | Ga0439466_0000002 | 3300041411 | Bacteria | 494198 |
| 482 | Ga0439466_0004446 | 3300041411 | Bacteria | 5395 |
| 483 | Ga0439466_0016518 | 3300041411 | Bacteria | 2666 |
| 484 | Ga0439466_0017730 | 3300041411 | Bacteria | 2561 |
| 485 | Ga0439466_0018010 | 3300041411 | Bacteria | 2537 |
| 486 | Ga0439466_0025348 | 3300041411 | Bacteria | 2070 |
| 487 | Ga0451853_0270960 | 3300041512 | Bacteria | 2042 |
| 488 | Ga0439431_0016952 | 3300041997 | Bacteria | 1709 |
| 489 | Ga0439437_001432 | 3300042000 | Bacteria | 2513 |
| 490 | Ga0439432_000623 | 3300042006 | Bacteria | 13337 |
| 491 | Ga0439432_000869 | 3300042006 | Bacteria | 11311 |
| 492 | Ga0439432_001288 | 3300042006 | Bacteria | 9479 |
| 493 | Ga0439432_002793 | 3300042006 | Bacteria | 6509 |
| 494 | Ga0439432_005883 | 3300042006 | Bacteria | 4401 |
| 495 | Ga0439432_021203 | 3300042006 | Bacteria | 2156 |
| 496 | Ga0439451_010390 | 3300042009 | Bacteria | 1876 |
| 497 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 498 | Ga0439452_000005 | 3300042010 | Bacteria | 646919 |
| 499 | Ga0439452_000007 | 3300042010 | Bacteria | 613625 |
| 500 | Ga0439452_000056 | 3300042010 | Bacteria | 106151 |
| 501 | Ga0439452_000060 | 3300042010 | Bacteria | 101512 |
| 502 | Ga0439452_000219 | 3300042010 | Bacteria | 40298 |
| 503 | Ga0439452_001164 | 3300042010 | Bacteria | 11412 |
| 504 | Ga0439452_001457 | 3300042010 | Bacteria | 9657 |
| 505 | Ga0439452_008660 | 3300042010 | Bacteria | 3045 |
| 506 | Ga0439452_011379 | 3300042010 | Bacteria | 2559 |
| 507 | Ga0439452_012550 | 3300042010 | Bacteria | 2406 |
| 508 | Ga0439455_0007220 | 3300042012 | Bacteria | 2344 |
| 509 | Ga0439456_000070 | 3300042013 | Bacteria | 36453 |
| 510 | Ga0439463_000309 | 3300042016 | Bacteria | 13687 |
| 511 | Ga0439463_000932 | 3300042016 | Bacteria | 8025 |
| 512 | Ga0450911_000083 | 3300042115 | Bacteria | 37916 |
| 513 | Ga0450911_000709 | 3300042115 | Bacteria | 9739 |
| 514 | Ga0450911_002407 | 3300042115 | Bacteria | 3679 |
| 515 | Ga0450892_002711 | 3300042130 | Bacteria | 1481 |
| 516 | Ga0450903_011547 | 3300042138 | Bacteria | 1421 |
| 517 | Ga0450904_000082 | 3300042139 | Bacteria | 21628 |
| 518 | Ga0450905_002733 | 3300042142 | Bacteria | 2285 |
| 519 | Ga0450906_007312 | 3300042145 | Bacteria | 2184 |
| 520 | Ga0450907_000284 | 3300042146 | Bacteria | 17144 |
| 521 | Ga0450907_000766 | 3300042146 | Bacteria | 8119 |
| 522 | Ga0450907_008386 | 3300042146 | Bacteria | 1718 |
| 523 | Ga0450910_004807 | 3300042147 | Bacteria | 1833 |
| 524 | Ga0439446_0000053 | 3300042156 | Bacteria | 17695 |
| 525 | Ga0439446_0000803 | 3300042156 | Bacteria | 6668 |
| 526 | Ga0450909_006525 | 3300042185 | Bacteria | 1682 |
| 527 | Ga0439434_0000337 | 3300042435 | Bacteria | 13270 |
| 528 | Ga0439434_0027969 | 3300042435 | Bacteria | 1707 |
| 529 | Ga0439459_0001744 | 3300042438 | Bacteria | 3255 |
| 530 | Ga0439459_0028185 | 3300042438 | Bacteria | 1125 |
| 531 | Ga0439464_0003716 | 3300042439 | Bacteria | 3870 |
| 532 | Ga0439464_0014229 | 3300042439 | Bacteria | 2138 |
| 533 | Ga0439460_0011211 | 3300042461 | Bacteria | 2309 |
| 534 | Ga0450916_000109 | 3300042530 | Bacteria | 5444 |
| 535 | Ga0450893_0012600 | 3300042532 | Bacteria | 1403 |
| 536 | Ga0466981_0000014 | 3300044669 | Bacteria | 109658 |
| 537 | Ga0495617_000193 | 3300046452 | Bacteria | 38348 |
| 538 | Ga0495617_000325 | 3300046452 | Bacteria | 26752 |
| 539 | Ga0495617_009601 | 3300046452 | Bacteria | 3320 |
| 540 | Ga0495627_000042 | 3300046453 | Bacteria | 189845 |
| 541 | Ga0495627_000051 | 3300046453 | Bacteria | 158822 |
| 542 | Ga0495627_000613 | 3300046453 | Bacteria | 28326 |
| 543 | Ga0495627_003276 | 3300046453 | Bacteria | 7247 |
| 544 | Ga0495627_013784 | 3300046453 | Bacteria | 2839 |
| 545 | Ga0495627_033959 | 3300046453 | Bacteria | 1596 |
| 546 | Ga0495590_0002159 | 3300046457 | Bacteria | 8243 |
| 547 | Ga0495590_0002522 | 3300046457 | Bacteria | 7572 |
| 548 | Ga0495590_0011582 | 3300046457 | Bacteria | 3294 |
| 549 | Ga0495590_0027608 | 3300046457 | Bacteria | 1990 |
| 550 | Ga0495591_000024 | 3300046458 | Bacteria | 191134 |
| 551 | Ga0495591_000037 | 3300046458 | Bacteria | 158323 |
| 552 | Ga0495591_000231 | 3300046458 | Bacteria | 54648 |
| 553 | Ga0495591_000278 | 3300046458 | Bacteria | 47734 |
| 554 | Ga0495591_000720 | 3300046458 | Bacteria | 24007 |
| 555 | Ga0495591_005800 | 3300046458 | Bacteria | 5615 |
| 556 | Ga0495591_007119 | 3300046458 | Bacteria | 4813 |
| 557 | Ga0495591_008225 | 3300046458 | Bacteria | 4299 |
| 558 | Ga0495591_008336 | 3300046458 | Bacteria | 4262 |
| 559 | Ga0495591_011171 | 3300046458 | Bacteria | 3417 |
| 560 | Ga0495591_023066 | 3300046458 | Bacteria | 2001 |
| 561 | Ga0495591_023751 | 3300046458 | Bacteria | 1957 |
| 562 | Ga0495629_0173339 | 3300046459 | Bacteria | 1496 |
| 563 | Ga0495638_0007742 | 3300046460 | Bacteria | 7675 |
| 564 | Ga0495638_0011238 | 3300046460 | Bacteria | 6177 |
| 565 | Ga0495638_0061557 | 3300046460 | Bacteria | 2319 |
| 566 | Ga0495638_0115027 | 3300046460 | Bacteria | 1594 |
| 567 | Ga0495653_0001136 | 3300046463 | Bacteria | 20495 |
| 568 | Ga0495653_0007921 | 3300046463 | Bacteria | 8696 |
| 569 | Ga0495653_0080412 | 3300046463 | Bacteria | 2411 |
| 570 | Ga0495650_0000004 | 3300046471 | Bacteria | 779487 |
| 571 | Ga0495650_0000028 | 3300046471 | Bacteria | 473012 |
| 572 | Ga0495650_0000113 | 3300046471 | Bacteria | 196536 |
| 573 | Ga0495650_0000572 | 3300046471 | Bacteria | 51523 |
| 574 | Ga0495650_0001745 | 3300046471 | Bacteria | 19810 |
| 575 | Ga0495650_0008259 | 3300046471 | Bacteria | 6106 |
| 576 | Ga0495650_0049791 | 3300046471 | Bacteria | 1737 |
| 577 | Ga0495650_0055931 | 3300046471 | Bacteria | 1603 |
| 578 | Ga0495605_0000036 | 3300046474 | Bacteria | 203902 |
| 579 | Ga0495605_0000222 | 3300046474 | Bacteria | 70142 |
| 580 | Ga0495605_0000871 | 3300046474 | Bacteria | 20887 |
| 581 | Ga0495605_0001613 | 3300046474 | Bacteria | 14607 |
| 582 | Ga0495605_0001770 | 3300046474 | Bacteria | 13857 |
| 583 | Ga0495605_0002842 | 3300046474 | Bacteria | 10532 |
| 584 | Ga0495605_0003753 | 3300046474 | Bacteria | 9014 |
| 585 | Ga0495605_0014965 | 3300046474 | Bacteria | 4229 |
| 586 | Ga0495605_0027852 | 3300046474 | Bacteria | 2923 |
| 587 | Ga0495605_0071274 | 3300046474 | Bacteria | 1641 |
| 588 | Ga0495639_0000062 | 3300046475 | Bacteria | 48406 |
| 589 | Ga0495639_0013816 | 3300046475 | Bacteria | 3491 |
| 590 | Ga0495584_0001224 | 3300046491 | Bacteria | 15656 |
| 591 | Ga0495584_0001546 | 3300046491 | Bacteria | 13669 |
| 592 | Ga0495584_0008642 | 3300046491 | Bacteria | 5272 |
| 593 | Ga0495584_0016948 | 3300046491 | Bacteria | 3712 |
| 594 | Ga0495584_0027786 | 3300046491 | Bacteria | 2866 |
| 595 | Ga0495584_0041131 | 3300046491 | Bacteria | 2334 |
| 596 | Ga0495584_0056186 | 3300046491 | Bacteria | 1980 |
| 597 | Ga0495584_0061753 | 3300046491 | Bacteria | 1883 |
| 598 | Ga0495585_0000473 | 3300046492 | Bacteria | 38416 |
| 599 | Ga0495585_0001213 | 3300046492 | Bacteria | 20874 |
| 600 | Ga0495585_0002545 | 3300046492 | Bacteria | 12932 |
| 601 | Ga0495585_0040706 | 3300046492 | Bacteria | 2608 |
| 602 | Ga0495585_0068615 | 3300046492 | Bacteria | 1936 |
| 603 | Ga0495594_0067487 | 3300046499 | Bacteria | 1985 |
| 604 | Ga0495594_0067773 | 3300046499 | Bacteria | 1981 |
| 605 | Ga0495596_0000105 | 3300046500 | Bacteria | 59665 |
| 606 | Ga0495596_0024186 | 3300046500 | Bacteria | 2462 |
| 607 | Ga0495596_0047895 | 3300046500 | Bacteria | 1676 |
| 608 | Ga0495607_0000335 | 3300046501 | Bacteria | 48836 |
| 609 | Ga0495607_0000598 | 3300046501 | Bacteria | 35216 |
| 610 | Ga0495607_0000685 | 3300046501 | Bacteria | 32679 |
| 611 | Ga0495607_0000875 | 3300046501 | Bacteria | 28123 |
| 612 | Ga0495607_0001466 | 3300046501 | Bacteria | 21023 |
| 613 | Ga0495607_0004879 | 3300046501 | Bacteria | 9769 |
| 614 | Ga0495607_0006458 | 3300046501 | Bacteria | 8252 |
| 615 | Ga0495607_0007957 | 3300046501 | Bacteria | 7286 |
| 616 | Ga0495607_0008559 | 3300046501 | Bacteria | 6988 |
| 617 | Ga0495607_0017817 | 3300046501 | Bacteria | 4547 |
| 618 | Ga0495607_0077051 | 3300046501 | Bacteria | 1842 |
| 619 | Ga0495607_0103725 | 3300046501 | Bacteria | 1518 |
| 620 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 621 | Ga0495583_0000561 | 3300046506 | Bacteria | 51417 |
| 622 | Ga0495583_0001188 | 3300046506 | Bacteria | 28058 |
| 623 | Ga0495583_0002128 | 3300046506 | Bacteria | 17722 |
| 624 | Ga0495583_0002394 | 3300046506 | Bacteria | 16138 |
| 625 | Ga0495583_0003507 | 3300046506 | Bacteria | 11863 |
| 626 | Ga0495583_0008771 | 3300046506 | Bacteria | 6131 |
| 627 | Ga0495583_0019169 | 3300046506 | Bacteria | 3577 |
| 628 | Ga0495583_0069131 | 3300046506 | Bacteria | 1556 |
| 629 | Ga0495606_0000094 | 3300046507 | Bacteria | 151840 |
| 630 | Ga0495606_0000502 | 3300046507 | Bacteria | 63679 |
| 631 | Ga0495606_0000958 | 3300046507 | Bacteria | 42386 |
| 632 | Ga0495606_0002787 | 3300046507 | Bacteria | 19522 |
| 633 | Ga0495606_0003133 | 3300046507 | Bacteria | 17936 |
| 634 | Ga0495606_0003916 | 3300046507 | Bacteria | 15318 |
| 635 | Ga0495606_0023741 | 3300046507 | Bacteria | 4435 |
| 636 | Ga0495606_0056808 | 3300046507 | Bacteria | 2524 |
| 637 | Ga0495606_0085022 | 3300046507 | Bacteria | 1957 |
| 638 | Ga0495610_0002667 | 3300046512 | Bacteria | 14715 |
| 639 | Ga0495610_0003738 | 3300046512 | Bacteria | 11648 |
| 640 | Ga0495610_0004363 | 3300046512 | Bacteria | 10489 |
| 641 | Ga0495610_0004919 | 3300046512 | Bacteria | 9699 |
| 642 | Ga0495610_0016704 | 3300046512 | Bacteria | 4214 |
| 643 | Ga0495610_0060530 | 3300046512 | Bacteria | 1802 |
| 644 | Ga0495610_0074855 | 3300046512 | Bacteria | 1569 |
| 645 | Ga0495616_0000487 | 3300046513 | Bacteria | 30232 |
| 646 | Ga0495616_0002116 | 3300046513 | Bacteria | 13313 |
| 647 | Ga0495616_0003865 | 3300046513 | Bacteria | 9546 |
| 648 | Ga0495616_0014977 | 3300046513 | Bacteria | 4322 |
| 649 | Ga0495616_0064057 | 3300046513 | Bacteria | 1794 |
| 650 | Ga0495620_0000073 | 3300046515 | Bacteria | 83446 |
| 651 | Ga0495620_0001062 | 3300046515 | Bacteria | 16873 |
| 652 | Ga0495620_0001603 | 3300046515 | Bacteria | 13396 |
| 653 | Ga0495620_0034109 | 3300046515 | Bacteria | 2303 |
| 654 | Ga0495631_0000169 | 3300046518 | Bacteria | 44458 |
| 655 | Ga0495631_0002840 | 3300046518 | Bacteria | 9619 |
| 656 | Ga0495631_0002981 | 3300046518 | Bacteria | 9370 |
| 657 | Ga0495631_0003965 | 3300046518 | Bacteria | 7993 |
| 658 | Ga0495631_0023709 | 3300046518 | Bacteria | 2841 |
| 659 | Ga0495631_0028721 | 3300046518 | Bacteria | 2536 |
| 660 | Ga0495632_0000449 | 3300046519 | Bacteria | 39222 |
| 661 | Ga0495632_0000460 | 3300046519 | Bacteria | 38758 |
| 662 | Ga0495632_0006942 | 3300046519 | Bacteria | 7187 |
| 663 | Ga0495632_0009783 | 3300046519 | Bacteria | 5744 |
| 664 | Ga0495632_0016901 | 3300046519 | Bacteria | 4043 |
| 665 | Ga0495632_0046515 | 3300046519 | Bacteria | 2155 |
| 666 | Ga0495632_0071760 | 3300046519 | Bacteria | 1662 |
| 667 | Ga0495637_0000015 | 3300046520 | Bacteria | 228949 |
| 668 | Ga0495637_0000168 | 3300046520 | Bacteria | 50579 |
| 669 | Ga0495637_0000981 | 3300046520 | Bacteria | 18095 |
| 670 | Ga0495637_0001257 | 3300046520 | Bacteria | 15301 |
| 671 | Ga0495637_0011453 | 3300046520 | Bacteria | 4262 |
| 672 | Ga0495637_0032175 | 3300046520 | Bacteria | 2312 |
| 673 | Ga0495637_0034692 | 3300046520 | Bacteria | 2207 |
| 674 | Ga0495637_0049581 | 3300046520 | Bacteria | 1763 |
| 675 | Ga0495637_0053019 | 3300046520 | Bacteria | 1690 |
| 676 | Ga0495637_0061684 | 3300046520 | Bacteria | 1536 |
| 677 | Ga0495637_0065337 | 3300046520 | Bacteria | 1481 |
| 678 | Ga0495643_0013254 | 3300046522 | Bacteria | 4940 |
| 679 | Ga0495643_0013745 | 3300046522 | Bacteria | 4834 |
| 680 | Ga0495643_0036773 | 3300046522 | Bacteria | 2688 |
| 681 | Ga0495643_0131405 | 3300046522 | Bacteria | 1256 |
| 682 | Ga0495644_0003642 | 3300046523 | Bacteria | 6071 |
| 683 | Ga0495644_0033380 | 3300046523 | Bacteria | 1944 |
| 684 | Ga0495644_0050674 | 3300046523 | Bacteria | 1558 |
| 685 | Ga0495648_0000631 | 3300046524 | Bacteria | 37603 |
| 686 | Ga0495648_0000658 | 3300046524 | Bacteria | 36907 |
| 687 | Ga0495648_0006890 | 3300046524 | Bacteria | 9169 |
| 688 | Ga0495648_0024952 | 3300046524 | Bacteria | 4057 |
| 689 | Ga0495648_0029550 | 3300046524 | Bacteria | 3636 |
| 690 | Ga0495648_0042119 | 3300046524 | Bacteria | 2875 |
| 691 | Ga0495648_0055717 | 3300046524 | Bacteria | 2382 |
| 692 | Ga0495648_0069907 | 3300046524 | Bacteria | 2041 |
| 693 | Ga0495666_0032046 | 3300046526 | Bacteria | 2574 |
| 694 | Ga0495666_0033658 | 3300046526 | Bacteria | 2502 |
| 695 | Ga0495642_0000062 | 3300046528 | Bacteria | 64285 |
| 696 | Ga0495642_0001560 | 3300046528 | Bacteria | 10063 |
| 697 | Ga0495642_0025481 | 3300046528 | Bacteria | 2344 |
| 698 | Ga0495654_0000031 | 3300046530 | Bacteria | 206800 |
| 699 | Ga0495654_0000342 | 3300046530 | Bacteria | 40679 |
| 700 | Ga0495654_0000390 | 3300046530 | Bacteria | 37861 |
| 701 | Ga0495654_0000871 | 3300046530 | Bacteria | 22688 |
| 702 | Ga0495654_0003153 | 3300046530 | Bacteria | 10229 |
| 703 | Ga0495654_0012736 | 3300046530 | Bacteria | 4514 |
| 704 | Ga0495654_0020294 | 3300046530 | Bacteria | 3464 |
| 705 | Ga0495654_0024002 | 3300046530 | Bacteria | 3154 |
| 706 | Ga0495654_0025617 | 3300046530 | Bacteria | 3037 |
| 707 | Ga0495654_0027344 | 3300046530 | Bacteria | 2925 |
| 708 | Ga0495654_0033441 | 3300046530 | Bacteria | 2602 |
| 709 | Ga0495654_0033855 | 3300046530 | Bacteria | 2582 |
| 710 | Ga0495654_0071668 | 3300046530 | Bacteria | 1641 |
| 711 | Ga0495654_0095000 | 3300046530 | Bacteria | 1378 |
| 712 | Ga0495586_0076449 | 3300046535 | Bacteria | 1835 |
| 713 | Ga0495587_0001642 | 3300046536 | Bacteria | 14918 |
| 714 | Ga0495587_0015863 | 3300046536 | Bacteria | 4694 |
| 715 | Ga0495609_0000035 | 3300046538 | Bacteria | 196269 |
| 716 | Ga0495609_0000162 | 3300046538 | Bacteria | 69584 |
| 717 | Ga0495609_0000260 | 3300046538 | Bacteria | 49574 |
| 718 | Ga0495609_0000336 | 3300046538 | Bacteria | 41547 |
| 719 | Ga0495609_0000569 | 3300046538 | Bacteria | 28968 |
| 720 | Ga0495609_0017053 | 3300046538 | Bacteria | 3378 |
| 721 | Ga0495609_0048566 | 3300046538 | Bacteria | 1896 |
| 722 | Ga0495597_0000044 | 3300046542 | Bacteria | 106714 |
| 723 | Ga0495597_0000548 | 3300046542 | Bacteria | 31172 |
| 724 | Ga0495597_0000635 | 3300046542 | Bacteria | 28659 |
| 725 | Ga0495597_0003574 | 3300046542 | Bacteria | 8967 |
| 726 | Ga0495597_0003775 | 3300046542 | Bacteria | 8622 |
| 727 | Ga0495597_0043125 | 3300046542 | Bacteria | 2010 |
| 728 | Ga0495597_0055104 | 3300046542 | Bacteria | 1744 |
| 729 | Ga0495622_0000192 | 3300046557 | Bacteria | 48889 |
| 730 | Ga0495622_0002134 | 3300046557 | Bacteria | 9639 |
| 731 | Ga0495622_0003287 | 3300046557 | Bacteria | 7644 |
| 732 | Ga0495622_0009461 | 3300046557 | Bacteria | 4506 |
| 733 | Ga0495622_0029287 | 3300046557 | Bacteria | 2572 |
| 734 | Ga0495633_0000028 | 3300046558 | Bacteria | 203214 |
| 735 | Ga0495633_0001006 | 3300046558 | Bacteria | 23042 |
| 736 | Ga0495656_0000504 | 3300046615 | Bacteria | 12810 |
| 737 | Ga0495668_0001623 | 3300046616 | Bacteria | 21013 |
| 738 | Ga0495668_0012166 | 3300046616 | Bacteria | 5115 |
| 739 | Ga0495634_0000980 | 3300046642 | Bacteria | 26953 |
| 740 | Ga0495611_0001896 | 3300046648 | Bacteria | 9952 |
| 741 | Ga0495611_0002520 | 3300046648 | Bacteria | 8330 |
| 742 | Ga0495611_0003679 | 3300046648 | Bacteria | 6716 |
| 743 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 744 | Ga0495625_0001361 | 3300046660 | Bacteria | 30075 |
| 745 | Ga0495625_0035983 | 3300046660 | Bacteria | 3643 |
| 746 | Ga0495625_0111932 | 3300046660 | Bacteria | 1865 |
| 747 | Ga0495625_0142754 | 3300046660 | Bacteria | 1614 |
| 748 | Ga0495625_0207997 | 3300046660 | Bacteria | 1287 |
| 749 | Ga0495635_0000093 | 3300046663 | Bacteria | 52786 |
| 750 | Ga0495635_0029676 | 3300046663 | Bacteria | 3803 |
| 751 | Ga0495659_0014355 | 3300046664 | Bacteria | 2591 |
| 752 | Ga0495659_0032514 | 3300046664 | Bacteria | 1826 |
| 753 | Ga0495661_0000006 | 3300046665 | Bacteria | 427288 |
| 754 | Ga0495661_0000059 | 3300046665 | Bacteria | 131931 |
| 755 | Ga0495661_0000401 | 3300046665 | Bacteria | 46171 |
| 756 | Ga0495661_0000447 | 3300046665 | Bacteria | 43687 |
| 757 | Ga0495661_0005121 | 3300046665 | Bacteria | 9345 |
| 758 | Ga0495661_0008871 | 3300046665 | Bacteria | 6931 |
| 759 | Ga0495661_0013957 | 3300046665 | Bacteria | 5387 |
| 760 | Ga0495661_0020641 | 3300046665 | Bacteria | 4298 |
| 761 | Ga0495661_0026629 | 3300046665 | Bacteria | 3723 |
| 762 | Ga0495588_0002514 | 3300046674 | Bacteria | 7853 |
| 763 | Ga0495623_0016238 | 3300046679 | Bacteria | 4808 |
| 764 | Ga0495646_0007921 | 3300046680 | Bacteria | 6749 |
| 765 | Ga0495646_0010893 | 3300046680 | Bacteria | 5776 |
| 766 | Ga0495669_0000226 | 3300046684 | Bacteria | 33507 |
| 767 | Ga0495624_0000155 | 3300046690 | Bacteria | 50145 |
| 768 | Ga0495670_0002612 | 3300046691 | Bacteria | 8898 |
| 769 | Ga0495670_0005481 | 3300046691 | Bacteria | 6227 |
| 770 | Ga0495670_0056117 | 3300046691 | Bacteria | 1975 |
| 771 | Ga0495671_0000259 | 3300046692 | Bacteria | 44835 |
| 772 | Ga0495671_0000600 | 3300046692 | Bacteria | 26585 |
| 773 | Ga0495671_0001418 | 3300046692 | Bacteria | 16112 |
| 774 | Ga0495671_0003705 | 3300046692 | Bacteria | 9293 |
| 775 | Ga0495671_0004771 | 3300046692 | Bacteria | 8011 |
| 776 | Ga0495671_0023800 | 3300046692 | Bacteria | 3197 |
| 777 | Ga0495671_0025190 | 3300046692 | Bacteria | 3093 |
| 778 | Ga0495671_0028106 | 3300046692 | Bacteria | 2899 |
| 779 | Ga0495671_0053302 | 3300046692 | Bacteria | 2007 |
| 780 | Ga0495671_0055896 | 3300046692 | Bacteria | 1955 |
| 781 | Ga0495671_0070390 | 3300046692 | Bacteria | 1718 |
| 782 | Ga0495649_0001079 | 3300046694 | Bacteria | 21270 |
| 783 | Ga0495649_0003172 | 3300046694 | Bacteria | 11243 |
| 784 | Ga0495649_0003193 | 3300046694 | Bacteria | 11204 |
| 785 | Ga0495649_0004813 | 3300046694 | Bacteria | 8741 |
| 786 | Ga0495649_0018440 | 3300046694 | Bacteria | 3926 |
| 787 | Ga0495649_0025858 | 3300046694 | Bacteria | 3268 |
| 788 | Ga0495649_0059868 | 3300046694 | Bacteria | 2049 |
| 789 | Ga0495649_0062229 | 3300046694 | Bacteria | 2006 |
| 790 | Ga0495649_0094706 | 3300046694 | Bacteria | 1589 |
| 791 | Ga0495649_0149677 | 3300046694 | Bacteria | 1226 |
| 792 | Ga0495589_0000005 | 3300046794 | Bacteria | 405112 |
| 793 | Ga0495589_0000221 | 3300046794 | Bacteria | 48417 |
| 794 | Ga0495589_0000617 | 3300046794 | Bacteria | 23849 |
| 795 | Ga0495589_0001245 | 3300046794 | Bacteria | 15069 |
| 796 | Ga0495589_0003225 | 3300046794 | Bacteria | 8899 |
| 797 | Ga0495589_0004916 | 3300046794 | Bacteria | 7082 |
| 798 | Ga0495589_0030524 | 3300046794 | Bacteria | 2714 |
| 799 | Ga0495600_0102868 | 3300046809 | Bacteria | 1861 |
| 800 | Ga0495660_0000013 | 3300046810 | Bacteria | 350283 |
| 801 | Ga0495660_0000034 | 3300046810 | Bacteria | 201261 |
| 802 | Ga0495660_0000505 | 3300046810 | Bacteria | 32144 |
| 803 | Ga0495660_0001125 | 3300046810 | Bacteria | 19057 |
| 804 | Ga0495660_0049753 | 3300046810 | Bacteria | 2286 |
| 805 | Ga0495660_0054871 | 3300046810 | Bacteria | 2158 |
| 806 | Ga0495660_0089289 | 3300046810 | Bacteria | 1604 |
| 807 | Ga0495660_0114176 | 3300046810 | Bacteria | 1374 |
| 808 | Ga0495581_0105851 | 3300047315 | Bacteria | 1635 |
| 809 | Ga0495604_0012379 | 3300047317 | Bacteria | 6781 |
| 810 | Ga0495636_0000040 | 3300047318 | Bacteria | 55863 |
| 811 | Ga0495674_0057866 | 3300047319 | Bacteria | 3391 |
| 812 | Ga0495672_0000029 | 3300047320 | Bacteria | 305231 |
| 813 | Ga0495672_0000051 | 3300047320 | Bacteria | 237883 |
| 814 | Ga0495672_0000054 | 3300047320 | Bacteria | 230777 |
| 815 | Ga0495672_0001781 | 3300047320 | Bacteria | 20671 |
| 816 | Ga0495672_0011396 | 3300047320 | Bacteria | 6278 |
| 817 | Ga0495672_0016285 | 3300047320 | Bacteria | 5017 |
| 818 | Ga0495672_0016551 | 3300047320 | Bacteria | 4962 |
| 819 | Ga0495672_0024492 | 3300047320 | Bacteria | 3885 |
| 820 | Ga0495672_0037237 | 3300047320 | Bacteria | 2979 |
| 821 | Ga0495672_0038253 | 3300047320 | Bacteria | 2928 |
| 822 | Ga0495672_0051740 | 3300047320 | Bacteria | 2417 |
| 823 | Ga0495672_0103361 | 3300047320 | Bacteria | 1541 |
| 824 | Ga0495676_0000004 | 3300047321 | Bacteria | 313696 |
| 825 | Ga0495680_0010142 | 3300047322 | Bacteria | 8419 |
| 826 | Ga0495680_0011543 | 3300047322 | Bacteria | 7815 |
| 827 | Ga0495680_0061258 | 3300047322 | Bacteria | 2895 |
| 828 | Ga0495683_0000033 | 3300047323 | Bacteria | 149031 |
| 829 | Ga0495683_0000091 | 3300047323 | Bacteria | 91313 |
| 830 | Ga0495683_0000281 | 3300047323 | Bacteria | 44019 |
| 831 | Ga0495683_0021476 | 3300047323 | Bacteria | 3325 |
| 832 | Ga0495683_0034957 | 3300047323 | Bacteria | 2554 |
| 833 | Ga0495683_0136651 | 3300047323 | Bacteria | 1151 |
| 834 | Ga0495687_000469 | 3300047443 | Bacteria | 48871 |
| 835 | Ga0495687_000778 | 3300047443 | Bacteria | 34407 |
| 836 | Ga0495687_002429 | 3300047443 | Bacteria | 14977 |
| 837 | Ga0495675_0029015 | 3300047444 | Bacteria | 3526 |
| 838 | Ga0495675_0085775 | 3300047444 | Bacteria | 1979 |
| 839 | Ga0495677_0006008 | 3300047445 | Bacteria | 4592 |
| 840 | Ga0495679_000014 | 3300047446 | Bacteria | 292767 |
| 841 | Ga0495679_000083 | 3300047446 | Bacteria | 87051 |
| 842 | Ga0495679_000461 | 3300047446 | Bacteria | 29942 |
| 843 | Ga0495679_004274 | 3300047446 | Bacteria | 6630 |
| 844 | Ga0495679_004623 | 3300047446 | Bacteria | 6274 |
| 845 | Ga0495679_011546 | 3300047446 | Bacteria | 3402 |
| 846 | Ga0495679_023045 | 3300047446 | Bacteria | 2119 |
| 847 | Ga0495685_012178 | 3300047447 | Bacteria | 2912 |
| 848 | Ga0495673_0000047 | 3300047469 | Bacteria | 266522 |
| 849 | Ga0495673_0000181 | 3300047469 | Bacteria | 101432 |
| 850 | Ga0495673_0000572 | 3300047469 | Bacteria | 37126 |
| 851 | Ga0495673_0000686 | 3300047469 | Bacteria | 33123 |
| 852 | Ga0495673_0000788 | 3300047469 | Bacteria | 29824 |
| 853 | Ga0495673_0000820 | 3300047469 | Bacteria | 29164 |
| 854 | Ga0495673_0001593 | 3300047469 | Bacteria | 17683 |
| 855 | Ga0495673_0004150 | 3300047469 | Bacteria | 9164 |
| 856 | Ga0495673_0039986 | 3300047469 | Bacteria | 2123 |
| 857 | Ga0495673_0043763 | 3300047469 | Bacteria | 2001 |
| 858 | Ga0495673_0053781 | 3300047469 | Bacteria | 1753 |
| 859 | Ga0495673_0085087 | 3300047469 | Bacteria | 1302 |
| 860 | Ga0495681_0004349 | 3300047470 | Bacteria | 9688 |
| 861 | Ga0495681_0005920 | 3300047470 | Bacteria | 8110 |
| 862 | Ga0495681_0009043 | 3300047470 | Bacteria | 6175 |
| 863 | Ga0495681_0022117 | 3300047470 | Bacteria | 3410 |
| 864 | Ga0495681_0022644 | 3300047470 | Bacteria | 3357 |
| 865 | Ga0495681_0030339 | 3300047470 | Bacteria | 2754 |
| 866 | Ga0495681_0032312 | 3300047470 | Bacteria | 2636 |
| 867 | Ga0495681_0038867 | 3300047470 | Bacteria | 2328 |
| 868 | Ga0495681_0042745 | 3300047470 | Bacteria | 2191 |
| 869 | Ga0495681_0043667 | 3300047470 | Bacteria | 2159 |
| 870 | Ga0495681_0056625 | 3300047470 | Bacteria | 1823 |
| 871 | Ga0495681_0062240 | 3300047470 | Bacteria | 1716 |
| 872 | Ga0495681_0070287 | 3300047470 | Bacteria | 1587 |
| 873 | Ga0495684_0018999 | 3300047471 | Bacteria | 5291 |
| 874 | Ga0495686_0000252 | 3300047472 | Bacteria | 96182 |
| 875 | Ga0495686_0044409 | 3300047472 | Bacteria | 2813 |
| 876 | Ga0495593_0022607 | 3300047673 | Bacteria | 3501 |
| 877 | Ga0495626_0000173 | 3300048091 | Bacteria | 79835 |
| 878 | Ga0495626_0000302 | 3300048091 | Bacteria | 52509 |
| 879 | Ga0495626_0000469 | 3300048091 | Bacteria | 41116 |
| 880 | Ga0495626_0000579 | 3300048091 | Bacteria | 36297 |
| 881 | Ga0495626_0002795 | 3300048091 | Bacteria | 11706 |
| 882 | Ga0495626_0006768 | 3300048091 | Bacteria | 6480 |
| 883 | Ga0495626_0025732 | 3300048091 | Bacteria | 2874 |
| 884 | Ga0495626_0058032 | 3300048091 | Bacteria | 1770 |
| 885 | Ga0496101_0000123 | 3300048904 | Bacteria | 75836 |
| 886 | Ga0496101_0093010 | 3300048904 | Bacteria | 2246 |
| 887 | Ga0496102_0000781 | 3300048905 | Bacteria | 31008 |
| 888 | Ga0496102_0004986 | 3300048905 | Bacteria | 11244 |
| 889 | Ga0496103_0028765 | 3300048906 | Bacteria | 3375 |
| 890 | Ga0496103_0062817 | 3300048906 | Bacteria | 2312 |
| 891 | Ga0496104_0004669 | 3300048907 | Bacteria | 11920 |
| 892 | Ga0496104_0439975 | 3300048907 | Bacteria | 1216 |
| 893 | Ga0496105_0021587 | 3300048908 | Bacteria | 5211 |
| 894 | Ga0496110_0345209 | 3300048913 | Bacteria | 1356 |
| 895 | Ga0496112_0043774 | 3300048915 | Bacteria | 4384 |
| 896 | Ga0496114_0022077 | 3300048917 | Bacteria | 5183 |
| 897 | Ga0496115_0090249 | 3300048918 | Bacteria | 2503 |
| 898 | Ga0496116_0000015 | 3300048919 | Bacteria | 560702 |
| 899 | Ga0496116_0000016 | 3300048919 | Bacteria | 555146 |
| 900 | Ga0496116_0000217 | 3300048919 | Bacteria | 108128 |
| 901 | Ga0496116_0000574 | 3300048919 | Bacteria | 49172 |
| 902 | Ga0496116_0001156 | 3300048919 | Bacteria | 31157 |
| 903 | Ga0496116_0002461 | 3300048919 | Bacteria | 19416 |
| 904 | Ga0496116_0004729 | 3300048919 | Bacteria | 12861 |
| 905 | Ga0496116_0022832 | 3300048919 | Bacteria | 4674 |
| 906 | Ga0496116_0051296 | 3300048919 | Bacteria | 2741 |
| 907 | Ga0496116_0067088 | 3300048919 | Bacteria | 2293 |
| 908 | Ga0496116_0107545 | 3300048919 | Bacteria | 1648 |
| 909 | Ga0496117_0000103 | 3300048920 | Bacteria | 189316 |
| 910 | Ga0496117_0000238 | 3300048920 | Bacteria | 104303 |
| 911 | Ga0496117_0001296 | 3300048920 | Bacteria | 36823 |
| 912 | Ga0496117_0002432 | 3300048920 | Bacteria | 23541 |
| 913 | Ga0496117_0003210 | 3300048920 | Bacteria | 19333 |
| 914 | Ga0496117_0004436 | 3300048920 | Bacteria | 15484 |
| 915 | Ga0496117_0006695 | 3300048920 | Bacteria | 11520 |
| 916 | Ga0496117_0006936 | 3300048920 | Bacteria | 11227 |
| 917 | Ga0496117_0007956 | 3300048920 | Bacteria | 10183 |
| 918 | Ga0496117_0020301 | 3300048920 | Bacteria | 5419 |
| 919 | Ga0496117_0033079 | 3300048920 | Bacteria | 3916 |
| 920 | Ga0496117_0050855 | 3300048920 | Bacteria | 2935 |
| 921 | Ga0496117_0052055 | 3300048920 | Bacteria | 2887 |
| 922 | Ga0496117_0123053 | 3300048920 | Bacteria | 1589 |
| 923 | Ga0496117_0127791 | 3300048920 | Bacteria | 1547 |
| 924 | Ga0496117_0139260 | 3300048920 | Bacteria | 1456 |
| 925 | Ga0496117_0147387 | 3300048920 | Bacteria | 1398 |
| 926 | Ga0496118_0000046 | 3300048921 | Bacteria | 271783 |
| 927 | Ga0496118_0000959 | 3300048921 | Bacteria | 45037 |
| 928 | Ga0496118_0001062 | 3300048921 | Bacteria | 42938 |
| 929 | Ga0496118_0002877 | 3300048921 | Bacteria | 22448 |
| 930 | Ga0496118_0019224 | 3300048921 | Bacteria | 6113 |
| 931 | Ga0496118_0032073 | 3300048921 | Bacteria | 4338 |
| 932 | Ga0496118_0039355 | 3300048921 | Bacteria | 3774 |
| 933 | Ga0496118_0050528 | 3300048921 | Bacteria | 3189 |
| 934 | Ga0496118_0091542 | 3300048921 | Bacteria | 2091 |
| 935 | Ga0496118_0145316 | 3300048921 | Bacteria | 1494 |
| 936 | Ga0496119_0000026 | 3300048922 | Bacteria | 254759 |
| 937 | Ga0496119_0000031 | 3300048922 | Bacteria | 239685 |
| 938 | Ga0496119_0000086 | 3300048922 | Bacteria | 137053 |
| 939 | Ga0496119_0000270 | 3300048922 | Bacteria | 73810 |
| 940 | Ga0496119_0005618 | 3300048922 | Bacteria | 11925 |
| 941 | Ga0496119_0005727 | 3300048922 | Bacteria | 11775 |
| 942 | Ga0496119_0007715 | 3300048922 | Bacteria | 9621 |
| 943 | Ga0496119_0007722 | 3300048922 | Bacteria | 9614 |
| 944 | Ga0496119_0013656 | 3300048922 | Bacteria | 6445 |
| 945 | Ga0496119_0016128 | 3300048922 | Bacteria | 5706 |
| 946 | Ga0496119_0021763 | 3300048922 | Bacteria | 4618 |
| 947 | Ga0496119_0037132 | 3300048922 | Bacteria | 3169 |
| 948 | Ga0496120_0000017 | 3300048923 | Bacteria | 269222 |
| 949 | Ga0496120_0000130 | 3300048923 | Bacteria | 127368 |
| 950 | Ga0496120_0000344 | 3300048923 | Bacteria | 76805 |
| 951 | Ga0496120_0000361 | 3300048923 | Bacteria | 73810 |
| 952 | Ga0496120_0001012 | 3300048923 | Bacteria | 37715 |
| 953 | Ga0496120_0001279 | 3300048923 | Bacteria | 31425 |
| 954 | Ga0496120_0001280 | 3300048923 | Bacteria | 31420 |
| 955 | Ga0496120_0002535 | 3300048923 | Bacteria | 18240 |
| 956 | Ga0496120_0004434 | 3300048923 | Bacteria | 11774 |
| 957 | Ga0496120_0007521 | 3300048923 | Bacteria | 8087 |
| 958 | Ga0496120_0009560 | 3300048923 | Bacteria | 6861 |
| 959 | Ga0496120_0115219 | 3300048923 | Bacteria | 1397 |
| 960 | Ga0496121_0000299 | 3300048924 | Bacteria | 103000 |
| 961 | Ga0496121_0001130 | 3300048924 | Bacteria | 46848 |
| 962 | Ga0496121_0003112 | 3300048924 | Bacteria | 23982 |
| 963 | Ga0496121_0004378 | 3300048924 | Bacteria | 19076 |
| 964 | Ga0496121_0004701 | 3300048924 | Bacteria | 18089 |
| 965 | Ga0496121_0007020 | 3300048924 | Bacteria | 13680 |
| 966 | Ga0496121_0007313 | 3300048924 | Bacteria | 13353 |
| 967 | Ga0496121_0047057 | 3300048924 | Bacteria | 3683 |
| 968 | Ga0496121_0072537 | 3300048924 | Bacteria | 2763 |
| 969 | Ga0496121_0198182 | 3300048924 | Bacteria | 1433 |
| 970 | Ga0496122_0000075 | 3300048925 | Bacteria | 219099 |
| 971 | Ga0496122_0000125 | 3300048925 | Bacteria | 179659 |
| 972 | Ga0496122_0000156 | 3300048925 | Bacteria | 160178 |
| 973 | Ga0496122_0001095 | 3300048925 | Bacteria | 46975 |
| 974 | Ga0496122_0002193 | 3300048925 | Bacteria | 28526 |
| 975 | Ga0496122_0008894 | 3300048925 | Bacteria | 10702 |
| 976 | Ga0496122_0010035 | 3300048925 | Bacteria | 9852 |
| 977 | Ga0496122_0014085 | 3300048925 | Bacteria | 7761 |
| 978 | Ga0496122_0033711 | 3300048925 | Bacteria | 4205 |
| 979 | Ga0496122_0035757 | 3300048925 | Bacteria | 4033 |
| 980 | Ga0496122_0038666 | 3300048925 | Bacteria | 3816 |
| 981 | Ga0496122_0066774 | 3300048925 | Bacteria | 2595 |
| 982 | Ga0496122_0077106 | 3300048925 | Bacteria | 2343 |
| 983 | Ga0496123_0000019 | 3300048926 | Bacteria | 400216 |
| 984 | Ga0496123_0000087 | 3300048926 | Bacteria | 182994 |
| 985 | Ga0496123_0000092 | 3300048926 | Bacteria | 179551 |
| 986 | Ga0496123_0000377 | 3300048926 | Bacteria | 83811 |
| 987 | Ga0496123_0000774 | 3300048926 | Bacteria | 51762 |
| 988 | Ga0496123_0001657 | 3300048926 | Bacteria | 29899 |
| 989 | Ga0496123_0003302 | 3300048926 | Bacteria | 18282 |
| 990 | Ga0496123_0003347 | 3300048926 | Bacteria | 18138 |
| 991 | Ga0496123_0011307 | 3300048926 | Bacteria | 7756 |
| 992 | Ga0496123_0020170 | 3300048926 | Bacteria | 5223 |
| 993 | Ga0496123_0022363 | 3300048926 | Bacteria | 4874 |
| 994 | Ga0496123_0045186 | 3300048926 | Bacteria | 3003 |
| 995 | Ga0496123_0061320 | 3300048926 | Bacteria | 2417 |
| 996 | Ga0496123_0114334 | 3300048926 | Bacteria | 1534 |
| 997 | Ga0496124_0000031 | 3300048927 | Bacteria | 344232 |
| 998 | Ga0496124_0000058 | 3300048927 | Bacteria | 242191 |
| 999 | Ga0496124_0000142 | 3300048927 | Bacteria | 147311 |
| 1000 | Ga0496124_0000238 | 3300048927 | Bacteria | 106881 |
| 1001 | Ga0496124_0000965 | 3300048927 | Bacteria | 45797 |
| 1002 | Ga0496124_0003235 | 3300048927 | Bacteria | 20114 |
| 1003 | Ga0496124_0006756 | 3300048927 | Bacteria | 12399 |
| 1004 | Ga0496124_0007209 | 3300048927 | Bacteria | 11878 |
| 1005 | Ga0496124_0008497 | 3300048927 | Bacteria | 10725 |
| 1006 | Ga0496124_0009650 | 3300048927 | Bacteria | 9887 |
| 1007 | Ga0496124_0025262 | 3300048927 | Bacteria | 5383 |
| 1008 | Ga0496124_0085529 | 3300048927 | Bacteria | 2584 |
| 1009 | Ga0496124_0086011 | 3300048927 | Bacteria | 2575 |
| 1010 | Ga0496124_0118735 | 3300048927 | Bacteria | 2116 |
| 1011 | Ga0496124_0139543 | 3300048927 | Bacteria | 1914 |
| 1012 | Ga0496124_0148706 | 3300048927 | Bacteria | 1840 |
| 1013 | Ga0496124_0239685 | 3300048927 | Bacteria | 1349 |
| 1014 | Ga0496125_0000032 | 3300048928 | Bacteria | 354078 |
| 1015 | Ga0496125_0001495 | 3300048928 | Bacteria | 33502 |
| 1016 | Ga0496125_0012006 | 3300048928 | Bacteria | 8625 |
| 1017 | Ga0496125_0013982 | 3300048928 | Bacteria | 7847 |
| 1018 | Ga0496125_0017828 | 3300048928 | Bacteria | 6755 |
| 1019 | Ga0496125_0018128 | 3300048928 | Bacteria | 6691 |
| 1020 | Ga0496125_0018546 | 3300048928 | Bacteria | 6608 |
| 1021 | Ga0496125_0041636 | 3300048928 | Bacteria | 3924 |
| 1022 | Ga0496125_0217167 | 3300048928 | Bacteria | 1235 |
| 1023 | Ga0496126_0000109 | 3300048929 | Bacteria | 196717 |
| 1024 | Ga0496126_0017795 | 3300048929 | Bacteria | 7073 |
| 1025 | Ga0496126_0079934 | 3300048929 | Bacteria | 2893 |
| 1026 | Ga0496126_0080089 | 3300048929 | Bacteria | 2890 |
| 1027 | Ga0496126_0117729 | 3300048929 | Bacteria | 2307 |
| 1028 | Ga0496126_0188847 | 3300048929 | Bacteria | 1746 |
| 1029 | Ga0496126_0189336 | 3300048929 | Bacteria | 1743 |
| 1030 | Ga0496126_0215381 | 3300048929 | Bacteria | 1615 |
| 1031 | Ga0496126_0349505 | 3300048929 | Bacteria | 1209 |
| 1032 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 1033 | Ga0495678_000137 | 3300049459 | Bacteria | 87580 |
| 1034 | Ga0495678_000984 | 3300049459 | Bacteria | 24399 |
| 1035 | Ga0495678_002700 | 3300049459 | Bacteria | 11701 |
| 1036 | Ga0495678_003761 | 3300049459 | Bacteria | 9165 |
| 1037 | Ga0495678_012190 | 3300049459 | Bacteria | 4082 |
| 1038 | Ga0495678_017048 | 3300049459 | Bacteria | 3302 |
| 1039 | Ga0495678_023802 | 3300049459 | Bacteria | 2655 |
| 1040 | Ga0495678_041097 | 3300049459 | Bacteria | 1853 |
| 1041 | Ga0495678_047329 | 3300049459 | Bacteria | 1684 |
| 1042 | Ga0495678_049803 | 3300049459 | Bacteria | 1626 |
| 1043 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 1044 | Ga0495682_0000304 | 3300049460 | Bacteria | 37379 |
| 1045 | Ga0495682_0000492 | 3300049460 | Bacteria | 27338 |
| 1046 | Ga0495682_0000550 | 3300049460 | Bacteria | 25848 |
| 1047 | Ga0501034_0000200 | 3300049571 | Bacteria | 113556 |
| 1048 | Ga0501040_0000028 | 3300049576 | Bacteria | 64790 |
| 1049 | Ga0501042_0000283 | 3300049578 | Bacteria | 24988 |
| 1050 | Ga0501241_001640 | 3300049758 | Bacteria | 4481 |
| 1051 | Ga0501226_000009 | 3300049853 | Bacteria | 194138 |
| 1052 | nmdc:mga00v17_186920_c1 | 3300050491 | Bacteria | 1337 |
| 1053 | nmdc:mga00v17_78003_c1 | 3300050491 | Bacteria | 2064 |
| 1054 | nmdc:mga0k408_2713_c1 | 3300050493 | Bacteria | 9399 |
| 1055 | Ga0500643_006973 | 3300053087 | Bacteria | 4635 |
| 1056 | Ga0500621_000006 | 3300053126 | Bacteria | 245480 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003320 | rootH2_10032116 | rootH2_100321166 | 277 |
| 2 | 3300046530 | Ga0495654_0095000 | Ga0495654_0095000_521_1360 | 279 |
| 3 | 3300036712 | Ga0316584_0040155 | Ga0316584_0040155_2436_3383 | 284 |
| 4 | 3300005290 | Ga0065712_10068141 | Ga0065712_100681411 | 286 |
| 5 | 3300031548 | Ga0307408_100051870 | Ga0307408_1000518703 | 287 |
| 6 | 3300031901 | Ga0307406_10187332 | Ga0307406_101873322 | 287 |
| 7 | 3300047472 | Ga0495686_0000252 | Ga0495686_0000252_34796_35794 | 288 |
| 8 | 3300006946 | Ga0079104_1000213 | Ga0079104_100021311 | 289 |
| 9 | 3300006948 | Ga0099826_10007176 | Ga0099826_100071762 | 289 |
| 10 | 3300015261 | Ga0182006_1041062 | Ga0182006_10410622 | 289 |
| 11 | 3300027111 | Ga0209281_1000011 | Ga0209281_1000011107 | 289 |
| 12 | 3300027666 | Ga0209282_1024480 | Ga0209282_10244801 | 289 |
| 13 | 3300046453 | Ga0495627_003276 | Ga0495627_003276_2555_3487 | 293 |
| 14 | 3300046458 | Ga0495591_007119 | Ga0495591_007119_3592_4524 | 293 |
| 15 | 3300046471 | Ga0495650_0055931 | Ga0495650_0055931_449_1381 | 293 |
| 16 | 3300046474 | Ga0495605_0000036 | Ga0495605_0000036_99968_100900 | 293 |
| 17 | 3300046506 | Ga0495583_0000028 | Ga0495583_0000028_113217_114149 | 293 |
| 18 | 3300046512 | Ga0495610_0004363 | Ga0495610_0004363_1096_2028 | 293 |
| 19 | 3300046515 | Ga0495620_0000073 | Ga0495620_0000073_12775_13707 | 293 |
| 20 | 3300046518 | Ga0495631_0023709 | Ga0495631_0023709_612_1544 | 293 |
| 21 | 3300046524 | Ga0495648_0024952 | Ga0495648_0024952_2345_3277 | 293 |
| 22 | 3300046530 | Ga0495654_0000871 | Ga0495654_0000871_16833_17765 | 293 |
| 23 | 3300046538 | Ga0495609_0000569 | Ga0495609_0000569_21360_22292 | 293 |
| 24 | 3300046542 | Ga0495597_0000635 | Ga0495597_0000635_27273_28205 | 293 |
| 25 | 3300046558 | Ga0495633_0000028 | Ga0495633_0000028_133813_134745 | 293 |
| 26 | 3300046648 | Ga0495611_0002520 | Ga0495611_0002520_3666_4598 | 293 |
| 27 | 3300046665 | Ga0495661_0000401 | Ga0495661_0000401_42685_43617 | 293 |
| 28 | 3300046691 | Ga0495670_0002612 | Ga0495670_0002612_516_1448 | 293 |
| 29 | 3300046692 | Ga0495671_0023800 | Ga0495671_0023800_1114_2046 | 293 |
| 30 | 3300046794 | Ga0495589_0001245 | Ga0495589_0001245_10405_11337 | 293 |
| 31 | 3300047323 | Ga0495683_0000091 | Ga0495683_0000091_20659_21591 | 293 |
| 32 | 3300047446 | Ga0495679_000083 | Ga0495679_000083_16691_17623 | 293 |
| 33 | 3300047470 | Ga0495681_0030339 | Ga0495681_0030339_391_1323 | 293 |
| 34 | 3300048926 | Ga0496123_0020170 | Ga0496123_0020170_3044_3976 | 293 |
| 35 | 3300049459 | Ga0495678_000020 | Ga0495678_000020_111320_112252 | 293 |
| 36 | 3300046453 | Ga0495627_000051 | Ga0495627_000051_49108_50034 | 295 |
| 37 | 3300046471 | Ga0495650_0000572 | Ga0495650_0000572_410_1336 | 295 |
| 38 | 3300046474 | Ga0495605_0000222 | Ga0495605_0000222_18847_19842 | 295 |
| 39 | 3300046501 | Ga0495607_0000598 | Ga0495607_0000598_53_979 | 295 |
| 40 | 3300046506 | Ga0495583_0000561 | Ga0495583_0000561_21381_22442 | 295 |
| 41 | 3300046506 | Ga0495583_0002394 | Ga0495583_0002394_12272_13198 | 295 |
| 42 | 3300046512 | Ga0495610_0003738 | Ga0495610_0003738_175_1236 | 295 |
| 43 | 3300046519 | Ga0495632_0000449 | Ga0495632_0000449_27194_28120 | 295 |
| 44 | 3300046520 | Ga0495637_0034692 | Ga0495637_0034692_410_1336 | 295 |
| 45 | 3300046538 | Ga0495609_0000162 | Ga0495609_0000162_32616_33542 | 295 |
| 46 | 3300046616 | Ga0495668_0012166 | Ga0495668_0012166_619_1545 | 295 |
| 47 | 3300046665 | Ga0495661_0000059 | Ga0495661_0000059_101863_102924 | 295 |
| 48 | 3300046810 | Ga0495660_0001125 | Ga0495660_0001125_442_1368 | 295 |
| 49 | 3300047469 | Ga0495673_0000181 | Ga0495673_0000181_4669_5595 | 295 |
| 50 | 3300047469 | Ga0495673_0085087 | Ga0495673_0085087_316_1242 | 295 |
| 51 | 3300027378 | Ga0209981_1007774 | Ga0209981_10077742 | 296 |
| 52 | 3300042013 | Ga0439456_000070 | Ga0439456_000070_14686_15612 | 296 |
| 53 | 3300009036 | Ga0105244_10013077 | Ga0105244_100130773 | 297 |
| 54 | 3300025728 | Ga0207655_1004562 | Ga0207655_10045622 | 297 |
| 55 | 3300037418 | Ga0395900_0011285 | Ga0395900_0011285_1931_2884 | 297 |
| 56 | 3300037466 | Ga0395898_0001760 | Ga0395898_0001760_19304_20257 | 297 |
| 57 | 3300038443 | Ga0395901_0007079 | Ga0395901_0007079_5214_6167 | 297 |
| 58 | 3300046519 | Ga0495632_0000460 | Ga0495632_0000460_23088_24014 | 297 |
| 59 | 3300047320 | Ga0495672_0038253 | Ga0495672_0038253_590_1513 | 297 |
| 60 | 3300048919 | Ga0496116_0067088 | Ga0496116_0067088_1266_2192 | 297 |
| 61 | 3300048920 | Ga0496117_0001296 | Ga0496117_0001296_14817_15743 | 297 |
| 62 | 3300027312 | Ga0209371_1000245 | Ga0209371_100024547 | 298 |
| 63 | 3300027665 | Ga0209983_1001336 | Ga0209983_10013363 | 298 |
| 64 | 3300030500 | Ga0268256_1000201 | Ga0268256_100020147 | 298 |
| 65 | 3300032004 | Ga0307414_10102170 | Ga0307414_101021703 | 298 |
| 66 | 3300046492 | Ga0495585_0040706 | Ga0495585_0040706_16_912 | 298 |
| 67 | 3300009011 | Ga0105251_10000158 | Ga0105251_1000015818 | 299 |
| 68 | 3300015265 | Ga0182005_1009980 | Ga0182005_10099802 | 299 |
| 69 | 3300025728 | Ga0207655_1026669 | Ga0207655_10266693 | 299 |
| 70 | 3300025735 | Ga0207713_1000058 | Ga0207713_1000058126 | 299 |
| 71 | 3300046453 | Ga0495627_013784 | Ga0495627_013784_1345_2271 | 299 |
| 72 | 3300046457 | Ga0495590_0011582 | Ga0495590_0011582_1608_2534 | 299 |
| 73 | 3300046458 | Ga0495591_000037 | Ga0495591_000037_153369_154295 | 299 |
| 74 | 3300046458 | Ga0495591_000720 | Ga0495591_000720_13215_14141 | 299 |
| 75 | 3300046458 | Ga0495591_008225 | Ga0495591_008225_1416_2519 | 299 |
| 76 | 3300046458 | Ga0495591_023066 | Ga0495591_023066_741_1667 | 299 |
| 77 | 3300046458 | Ga0495591_023751 | Ga0495591_023751_227_1285 | 299 |
| 78 | 3300046471 | Ga0495650_0001745 | Ga0495650_0001745_5966_7024 | 299 |
| 79 | 3300046474 | Ga0495605_0000871 | Ga0495605_0000871_653_1579 | 299 |
| 80 | 3300046474 | Ga0495605_0001613 | Ga0495605_0001613_11311_12237 | 299 |
| 81 | 3300046474 | Ga0495605_0002842 | Ga0495605_0002842_1709_2767 | 299 |
| 82 | 3300046491 | Ga0495584_0056186 | Ga0495584_0056186_685_1743 | 299 |
| 83 | 3300046500 | Ga0495596_0024186 | Ga0495596_0024186_184_1242 | 299 |
| 84 | 3300046501 | Ga0495607_0000335 | Ga0495607_0000335_15006_15932 | 299 |
| 85 | 3300046501 | Ga0495607_0000685 | Ga0495607_0000685_22714_23640 | 299 |
| 86 | 3300046501 | Ga0495607_0006458 | Ga0495607_0006458_6737_7762 | 299 |
| 87 | 3300046501 | Ga0495607_0017817 | Ga0495607_0017817_1259_2185 | 299 |
| 88 | 3300046506 | Ga0495583_0001188 | Ga0495583_0001188_13685_14743 | 299 |
| 89 | 3300046506 | Ga0495583_0002128 | Ga0495583_0002128_7641_8567 | 299 |
| 90 | 3300046506 | Ga0495583_0003507 | Ga0495583_0003507_6258_7184 | 299 |
| 91 | 3300046507 | Ga0495606_0000094 | Ga0495606_0000094_13477_14403 | 299 |
| 92 | 3300046507 | Ga0495606_0000958 | Ga0495606_0000958_26115_27173 | 299 |
| 93 | 3300046507 | Ga0495606_0002787 | Ga0495606_0002787_18427_19353 | 299 |
| 94 | 3300046512 | Ga0495610_0002667 | Ga0495610_0002667_8855_9913 | 299 |
| 95 | 3300046515 | Ga0495620_0001062 | Ga0495620_0001062_13586_14512 | 299 |
| 96 | 3300046515 | Ga0495620_0034109 | Ga0495620_0034109_487_1545 | 299 |
| 97 | 3300046518 | Ga0495631_0002981 | Ga0495631_0002981_429_1355 | 299 |
| 98 | 3300046518 | Ga0495631_0003965 | Ga0495631_0003965_1094_2152 | 299 |
| 99 | 3300046519 | Ga0495632_0006942 | Ga0495632_0006942_5947_7005 | 299 |
| 100 | 3300046520 | Ga0495637_0000015 | Ga0495637_0000015_202349_203407 | 299 |
| 101 | 3300046520 | Ga0495637_0001257 | Ga0495637_0001257_13007_13933 | 299 |
| 102 | 3300046520 | Ga0495637_0065337 | Ga0495637_0065337_489_1415 | 299 |
| 103 | 3300046523 | Ga0495644_0050674 | Ga0495644_0050674_14_940 | 299 |
| 104 | 3300046524 | Ga0495648_0000631 | Ga0495648_0000631_28616_29719 | 299 |
| 105 | 3300046530 | Ga0495654_0024002 | Ga0495654_0024002_1375_2433 | 299 |
| 106 | 3300046530 | Ga0495654_0027344 | Ga0495654_0027344_1739_2842 | 299 |
| 107 | 3300046538 | Ga0495609_0000035 | Ga0495609_0000035_183945_185003 | 299 |
| 108 | 3300046538 | Ga0495609_0048566 | Ga0495609_0048566_397_1323 | 299 |
| 109 | 3300046542 | Ga0495597_0000044 | Ga0495597_0000044_87683_88609 | 299 |
| 110 | 3300046557 | Ga0495622_0003287 | Ga0495622_0003287_4750_5808 | 299 |
| 111 | 3300046648 | Ga0495611_0003679 | Ga0495611_0003679_3418_4476 | 299 |
| 112 | 3300046660 | Ga0495625_0000004 | Ga0495625_0000004_194707_195714 | 299 |
| 113 | 3300046665 | Ga0495661_0000006 | Ga0495661_0000006_28074_29132 | 299 |
| 114 | 3300046665 | Ga0495661_0008871 | Ga0495661_0008871_4217_5320 | 299 |
| 115 | 3300046665 | Ga0495661_0026629 | Ga0495661_0026629_342_1268 | 299 |
| 116 | 3300046692 | Ga0495671_0000600 | Ga0495671_0000600_6657_7583 | 299 |
| 117 | 3300046692 | Ga0495671_0053302 | Ga0495671_0053302_233_1291 | 299 |
| 118 | 3300046694 | Ga0495649_0059868 | Ga0495649_0059868_238_1296 | 299 |
| 119 | 3300046810 | Ga0495660_0049753 | Ga0495660_0049753_687_1613 | 299 |
| 120 | 3300046810 | Ga0495660_0114176 | Ga0495660_0114176_84_1142 | 299 |
| 121 | 3300047320 | Ga0495672_0016285 | Ga0495672_0016285_2122_3225 | 299 |
| 122 | 3300047320 | Ga0495672_0051740 | Ga0495672_0051740_416_1474 | 299 |
| 123 | 3300047321 | Ga0495676_0000004 | Ga0495676_0000004_271779_272837 | 299 |
| 124 | 3300047323 | Ga0495683_0000033 | Ga0495683_0000033_54047_54973 | 299 |
| 125 | 3300047446 | Ga0495679_000461 | Ga0495679_000461_10035_11093 | 299 |
| 126 | 3300047446 | Ga0495679_023045 | Ga0495679_023045_13_939 | 299 |
| 127 | 3300047469 | Ga0495673_0000572 | Ga0495673_0000572_28301_29404 | 299 |
| 128 | 3300047469 | Ga0495673_0001593 | Ga0495673_0001593_482_1408 | 299 |
| 129 | 3300047469 | Ga0495673_0039986 | Ga0495673_0039986_104_1030 | 299 |
| 130 | 3300047470 | Ga0495681_0038867 | Ga0495681_0038867_654_1712 | 299 |
| 131 | 3300048091 | Ga0495626_0000173 | Ga0495626_0000173_23926_24984 | 299 |
| 132 | 3300048913 | Ga0496110_0345209 | Ga0496110_0345209_395_1321 | 299 |
| 133 | 3300048915 | Ga0496112_0043774 | Ga0496112_0043774_2519_3445 | 299 |
| 134 | 3300048924 | Ga0496121_0004378 | Ga0496121_0004378_4727_5653 | 299 |
| 135 | 3300048925 | Ga0496122_0000156 | Ga0496122_0000156_106909_107835 | 299 |
| 136 | 3300048925 | Ga0496122_0033711 | Ga0496122_0033711_1610_2536 | 299 |
| 137 | 3300048926 | Ga0496123_0000087 | Ga0496123_0000087_74958_75884 | 299 |
| 138 | 3300048926 | Ga0496123_0045186 | Ga0496123_0045186_81_1007 | 299 |
| 139 | 3300048927 | Ga0496124_0000031 | Ga0496124_0000031_71071_71997 | 299 |
| 140 | 3300048927 | Ga0496124_0008497 | Ga0496124_0008497_7167_8093 | 299 |
| 141 | 3300048927 | Ga0496124_0118735 | Ga0496124_0118735_336_1262 | 299 |
| 142 | 3300049459 | Ga0495678_000137 | Ga0495678_000137_13735_14661 | 299 |
| 143 | 3300049459 | Ga0495678_002700 | Ga0495678_002700_7894_8820 | 299 |
| 144 | 3300049459 | Ga0495678_012190 | Ga0495678_012190_1433_2491 | 299 |
| 145 | 3300049460 | Ga0495682_0000550 | Ga0495682_0000550_11333_12259 | 299 |
| 146 | 3300031548 | Ga0307408_100000018 | Ga0307408_100000018200 | 300 |
| 147 | 3300046492 | Ga0495585_0000473 | Ga0495585_0000473_2114_3040 | 300 |
| 148 | 3300046501 | Ga0495607_0008559 | Ga0495607_0008559_5306_6331 | 300 |
| 149 | 3300046665 | Ga0495661_0000447 | Ga0495661_0000447_14427_15353 | 300 |
| 150 | 3300046810 | Ga0495660_0000505 | Ga0495660_0000505_9219_10145 | 300 |
| 151 | 3300048904 | Ga0496101_0093010 | Ga0496101_0093010_1302_2228 | 300 |
| 152 | 3300048924 | Ga0496121_0003112 | Ga0496121_0003112_18523_19449 | 300 |
| 153 | 3300046524 | Ga0495648_0000658 | Ga0495648_0000658_573_1499 | 301 |
| 154 | iso_pu_bacteria | 2565956521 | 2566036693 | 301 |
| 155 | iso_pu_bacteria | 2648501241 | 2649118725 | 301 |
| 156 | iso_pu_bacteria | 2651869818 | 2652976142 | 301 |
| 157 | iso_pu_bacteria | 2990196909 | 2990199140 | 301 |
| 158 | iso_pu_bacteria | 8002745576 | 8002746323 | 301 |
| 159 | 3300042156 | Ga0439446_0000053 | Ga0439446_0000053_16521_17447 | 302 |
| 160 | iso_pu_bacteria | 2506520007 | 2506576663 | 302 |
| 161 | iso_pu_bacteria | 2506520008 | 2506581801 | 302 |
| 162 | iso_pu_bacteria | 2508501071 | 2508850607 | 302 |
| 163 | iso_pu_bacteria | 2511231025 | 2511381898 | 302 |
| 164 | iso_pu_bacteria | 2511231035 | 2511432762 | 302 |
| 165 | iso_pu_bacteria | 2537561728 | 2538427034 | 302 |
| 166 | iso_pu_bacteria | 2547132181 | 2547696553 | 302 |
| 167 | iso_pu_bacteria | 2554235234 | 2555261992 | 302 |
| 168 | iso_pu_bacteria | 2561511199 | 2562465919 | 302 |
| 169 | iso_pu_bacteria | 2585427591 | 2585826192 | 302 |
| 170 | iso_pu_bacteria | 2585427592 | 2585830778 | 302 |
| 171 | iso_pu_bacteria | 2599185169 | 2599412868 | 302 |
| 172 | iso_pu_bacteria | 2599185299 | 2599928149 | 302 |
| 173 | iso_pu_bacteria | 2600255254 | 2601525661 | 302 |
| 174 | iso_pu_bacteria | 2600255255 | 2601530730 | 302 |
| 175 | iso_pu_bacteria | 2600255256 | 2601533961 | 302 |
| 176 | iso_pu_bacteria | 2600255257 | 2601540129 | 302 |
| 177 | iso_pu_bacteria | 2600255280 | 2601617781 | 302 |
| 178 | iso_pu_bacteria | 2600255281 | 2601622816 | 302 |
| 179 | iso_pu_bacteria | 2600255287 | 2601644639 | 302 |
| 180 | iso_pu_bacteria | 2600255288 | 2601651089 | 302 |
| 181 | iso_pu_bacteria | 2600255289 | 2601656138 | 302 |
| 182 | iso_pu_bacteria | 2600255290 | 2601661062 | 302 |
| 183 | iso_pu_bacteria | 2600255291 | 2601664804 | 302 |
| 184 | iso_pu_bacteria | 2600255298 | 2601697328 | 302 |
| 185 | iso_pu_bacteria | 2600255299 | 2601702716 | 302 |
| 186 | iso_pu_bacteria | 2600255300 | 2601708904 | 302 |
| 187 | iso_pu_bacteria | 2600255301 | 2601713942 | 302 |
| 188 | iso_pu_bacteria | 2600255302 | 2601718987 | 302 |
| 189 | iso_pu_bacteria | 2600255303 | 2601722625 | 302 |
| 190 | iso_pu_bacteria | 2600255304 | 2601728892 | 302 |
| 191 | iso_pu_bacteria | 2600255305 | 2601733933 | 302 |
| 192 | iso_pu_bacteria | 2600255306 | 2601738909 | 302 |
| 193 | iso_pu_bacteria | 2600255307 | 2601743283 | 302 |
| 194 | iso_pu_bacteria | 2600255309 | 2601754409 | 302 |
| 195 | iso_pu_bacteria | 2600255310 | 2601758888 | 302 |
| 196 | iso_pu_bacteria | 2600255311 | 2601762762 | 302 |
| 197 | iso_pu_bacteria | 2600255392 | 2602021350 | 302 |
| 198 | iso_pu_bacteria | 2602042046 | 2603640614 | 302 |
| 199 | iso_pu_bacteria | 2602042047 | 2603644600 | 302 |
| 200 | iso_pu_bacteria | 2602042052 | 2603662879 | 302 |
| 201 | iso_pu_bacteria | 2602042053 | 2603667776 | 302 |
| 202 | iso_pu_bacteria | 2602042066 | 2603700455 | 302 |
| 203 | iso_pu_bacteria | 2602042067 | 2603705935 | 302 |
| 204 | iso_pu_bacteria | 2602042103 | 2603841458 | 302 |
| 205 | iso_pu_bacteria | 2602042104 | 2603846413 | 302 |
| 206 | iso_pu_bacteria | 2602042105 | 2603851488 | 302 |
| 207 | iso_pu_bacteria | 2602042106 | 2603856671 | 302 |
| 208 | iso_pu_bacteria | 2602042109 | 2603868520 | 302 |
| 209 | iso_pu_bacteria | 2602042110 | 2603874135 | 302 |
| 210 | iso_pu_bacteria | 2602042111 | 2603878585 | 302 |
| 211 | iso_pu_bacteria | 2603880178 | 2606051430 | 302 |
| 212 | iso_pu_bacteria | 2603880184 | 2606072293 | 302 |
| 213 | iso_pu_bacteria | 2603880202 | 2606149116 | 302 |
| 214 | iso_pu_bacteria | 2603880211 | 2606179206 | 302 |
| 215 | iso_pu_bacteria | 2608642108 | 2608670514 | 302 |
| 216 | iso_pu_bacteria | 2609459761 | 2609911981 | 302 |
| 217 | iso_pu_bacteria | 2636415599 | 2637227164 | 302 |
| 218 | iso_pu_bacteria | 2648501693 | 2650900195 | 302 |
| 219 | iso_pu_bacteria | 2654587920 | 2656276440 | 302 |
| 220 | iso_pu_bacteria | 2667528172 | 2671103708 | 302 |
| 221 | iso_pu_bacteria | 2667528173 | 2671106501 | 302 |
| 222 | iso_pu_bacteria | 2671180115 | 2671586862 | 302 |
| 223 | iso_pu_bacteria | 2675903046 | 2676409870 | 302 |
| 224 | iso_pu_bacteria | 2681812866 | 2681996847 | 302 |
| 225 | iso_pu_bacteria | 2681812869 | 2682008628 | 302 |
| 226 | iso_pu_bacteria | 2684622997 | 2686354434 | 302 |
| 227 | iso_pu_bacteria | 2687453601 | 2689443042 | 302 |
| 228 | iso_pu_bacteria | 2690315857 | 2691331010 | 302 |
| 229 | iso_pu_bacteria | 2706794495 | 2707098366 | 302 |
| 230 | iso_pu_bacteria | 2711768156 | 2712471211 | 302 |
| 231 | iso_pu_bacteria | 2751185917 | 2753854566 | 302 |
| 232 | iso_pu_bacteria | 2765235842 | 2765587425 | 302 |
| 233 | iso_pu_bacteria | 2772190666 | 2772437200 | 302 |
| 234 | iso_pu_bacteria | 2775506706 | 2775540813 | 302 |
| 235 | iso_pu_bacteria | 2775507074 | 2777021562 | 302 |
| 236 | iso_pu_bacteria | 2791354903 | 2791924248 | 302 |
| 237 | iso_pu_bacteria | 2791355010 | 2792313328 | 302 |
| 238 | iso_pu_bacteria | 2791355275 | 2793406927 | 302 |
| 239 | iso_pu_bacteria | 2806310673 | 2807177953 | 302 |
| 240 | iso_pu_bacteria | 2808606414 | 2809124278 | 302 |
| 241 | iso_pu_bacteria | 2811995292 | 2813730625 | 302 |
| 242 | iso_pu_bacteria | 2814123068 | 2814698232 | 302 |
| 243 | iso_pu_bacteria | 2821118458 | 2821121427 | 302 |
| 244 | iso_pu_bacteria | 2823373977 | 2823377456 | 302 |
| 245 | iso_pu_bacteria | 2844425489 | 2844426117 | 302 |
| 246 | iso_pu_bacteria | 2844528606 | 2844532590 | 302 |
| 247 | iso_pu_bacteria | 2846540461 | 2846542350 | 302 |
| 248 | iso_pu_bacteria | 2847085930 | 2847089109 | 302 |
| 249 | iso_pu_bacteria | 2847797336 | 2847801287 | 302 |
| 250 | iso_pu_bacteria | 2852103415 | 2852106175 | 302 |
| 251 | iso_pu_bacteria | 2854601825 | 2854601948 | 302 |
| 252 | iso_pu_bacteria | 2855195626 | 2855195786 | 302 |
| 253 | iso_pu_bacteria | 2858466076 | 2858469548 | 302 |
| 254 | iso_pu_bacteria | 2865014394 | 2865018596 | 302 |
| 255 | iso_pu_bacteria | 2869551831 | 2869552446 | 302 |
| 256 | iso_pu_bacteria | 2871272651 | 2871273543 | 302 |
| 257 | iso_pu_bacteria | 2871282230 | 2871286891 | 302 |
| 258 | iso_pu_bacteria | 2876601092 | 2876605733 | 302 |
| 259 | iso_pu_bacteria | 2881609920 | 2881613724 | 302 |
| 260 | iso_pu_bacteria | 2884086401 | 2884090528 | 302 |
| 261 | iso_pu_bacteria | 2888366609 | 2888367248 | 302 |
| 262 | iso_pu_bacteria | 2888373701 | 2888375089 | 302 |
| 263 | iso_pu_bacteria | 2891670763 | 2891672266 | 302 |
| 264 | iso_pu_bacteria | 2900051742 | 2900053725 | 302 |
| 265 | iso_pu_bacteria | 2904474040 | 2904474351 | 302 |
| 266 | iso_pu_bacteria | 2904504865 | 2904507060 | 302 |
| 267 | iso_pu_bacteria | 2904513164 | 2904516113 | 302 |
| 268 | iso_pu_bacteria | 2908669403 | 2908673115 | 302 |
| 269 | iso_pu_bacteria | 2919108558 | 2919112827 | 302 |
| 270 | iso_pu_bacteria | 2919150387 | 2919150698 | 302 |
| 271 | iso_pu_bacteria | 2919534386 | 2919534571 | 302 |
| 272 | iso_pu_bacteria | 2919688452 | 2919689924 | 302 |
| 273 | iso_pu_bacteria | 2923634449 | 2923637956 | 302 |
| 274 | iso_pu_bacteria | 2927143783 | 2927145571 | 302 |
| 275 | iso_pu_bacteria | 2927833300 | 2927835605 | 302 |
| 276 | iso_pu_bacteria | 2932406140 | 2932406548 | 302 |
| 277 | iso_pu_bacteria | 2935625433 | 2935627918 | 302 |
| 278 | iso_pu_bacteria | 2937539931 | 2937540084 | 302 |
| 279 | iso_pu_bacteria | 2937967321 | 2937970754 | 302 |
| 280 | iso_pu_bacteria | 2939568625 | 2939571590 | 302 |
| 281 | iso_pu_bacteria | 2939573065 | 2939576021 | 302 |
| 282 | iso_pu_bacteria | 2939577877 | 2939578030 | 302 |
| 283 | iso_pu_bacteria | 2939602548 | 2939607246 | 302 |
| 284 | iso_pu_bacteria | 2939607340 | 2939609501 | 302 |
| 285 | iso_pu_bacteria | 2939617950 | 2939619662 | 302 |
| 286 | iso_pu_bacteria | 2939642701 | 2939646003 | 302 |
| 287 | iso_pu_bacteria | 2945874760 | 2945879806 | 302 |
| 288 | iso_pu_bacteria | 2945951305 | 2945954321 | 302 |
| 289 | iso_pu_bacteria | 2969079654 | 2969084178 | 302 |
| 290 | iso_pu_bacteria | 2971820967 | 2971825686 | 302 |
| 291 | iso_pu_bacteria | 2974310843 | 2974313644 | 302 |
| 292 | iso_pu_bacteria | 2974435778 | 2974436946 | 302 |
| 293 | iso_pu_bacteria | 2978975091 | 2978976805 | 302 |
| 294 | iso_pu_bacteria | 2984494565 | 2984498118 | 302 |
| 295 | iso_pu_bacteria | 2984559226 | 2984561257 | 302 |
| 296 | iso_pu_bacteria | 2984595703 | 2984599328 | 302 |
| 297 | iso_pu_bacteria | 2990261002 | 2990265184 | 302 |
| 298 | iso_pu_bacteria | 3000376612 | 3000380542 | 302 |
| 299 | iso_pu_bacteria | 3007419365 | 3007423115 | 302 |
| 300 | iso_pu_bacteria | 640753048 | 640936199 | 302 |
| 301 | iso_pu_bacteria | 8004592986 | 8004597849 | 302 |
| 302 | iso_pu_bacteria | 8011350971 | 8011351868 | 302 |
| 303 | iso_pu_bacteria | 8015394850 | 8015396126 | 302 |
| 304 | iso_pu_bacteria | 8016733728 | 8016737262 | 302 |
| 305 | iso_pu_bacteria | 8018221730 | 8018223457 | 302 |
| 306 | iso_pu_bacteria | 8018405270 | 8018410013 | 302 |
| 307 | iso_pu_bacteria | 8019499862 | 8019502463 | 302 |
| 308 | iso_pu_bacteria | 8019504834 | 8019506816 | 302 |
| 309 | iso_pu_bacteria | 8054849141 | 8054850051 | 302 |
| 310 | iso_pu_bacteria | 8055087960 | 8055092613 | 302 |
| 311 | iso_pu_bacteria | 8055092621 | 8055092828 | 302 |
| 312 | iso_pu_bacteria | 8055097453 | 8055100684 | 302 |
| 313 | iso_pu_bacteria | 8055693939 | 8055697599 | 302 |
| 314 | iso_pu_bacteria | 8056115690 | 8056118056 | 302 |
| 315 | iso_pu_bacteria | 8057304971 | 8057307364 | 302 |
| 316 | iso_pu_bacteria | 2510065053 | 2510282132 | 303 |
| 317 | iso_pu_bacteria | 2510065055 | 2510291709 | 303 |
| 318 | iso_pu_bacteria | 2510065058 | 2510310280 | 303 |
| 319 | iso_pu_bacteria | 2554235132 | 2554814587 | 303 |
| 320 | iso_pu_bacteria | 2599185191 | 2599517910 | 303 |
| 321 | iso_pu_bacteria | 2599185288 | 2599880690 | 303 |
| 322 | iso_pu_bacteria | 2599185303 | 2599949743 | 303 |
| 323 | iso_pu_bacteria | 2606217733 | 2608381971 | 303 |
| 324 | iso_pu_bacteria | 2738543015 | 2739261463 | 303 |
| 325 | iso_pu_bacteria | 2773857672 | 2774130803 | 303 |
| 326 | iso_pu_bacteria | 2808606373 | 2808907722 | 303 |
| 327 | iso_pu_bacteria | 2808606385 | 2808980327 | 303 |
| 328 | iso_pu_bacteria | 2808606388 | 2808996048 | 303 |
| 329 | iso_pu_bacteria | 2811994881 | 2812367558 | 303 |
| 330 | iso_pu_bacteria | 2852612431 | 2852613926 | 303 |
| 331 | iso_pu_bacteria | 2852667396 | 2852668337 | 303 |
| 332 | iso_pu_bacteria | 2917832318 | 2917835875 | 303 |
| 333 | iso_pu_bacteria | 2919125081 | 2919125745 | 303 |
| 334 | iso_pu_bacteria | 2923519811 | 2923521608 | 303 |
| 335 | iso_pu_bacteria | 2929189879 | 2929193031 | 303 |
| 336 | iso_pu_bacteria | 2945928738 | 2945932981 | 303 |
| 337 | iso_pu_bacteria | 2974298342 | 2974300075 | 303 |
| 338 | iso_pu_bacteria | 2984499530 | 2984502455 | 303 |
| 339 | iso_pu_bacteria | 2984504281 | 2984508933 | 303 |
| 340 | iso_pu_bacteria | 8016728285 | 8016728767 | 303 |
| 341 | iso_pu_bacteria | 8054503363 | 8054506803 | 303 |
| 342 | iso_pu_bacteria | 8056161164 | 8056165625 | 303 |
| 343 | iso_pu_bacteria | 2511231004 | 2511256518 | 304 |
| 344 | iso_pu_bacteria | 2511231006 | 2511266169 | 304 |
| 345 | iso_pu_bacteria | 2511231007 | 2511270307 | 304 |
| 346 | iso_pu_bacteria | 2511231008 | 2511276089 | 304 |
| 347 | iso_pu_bacteria | 2511231010 | 2511288342 | 304 |
| 348 | iso_pu_bacteria | 2511231011 | 2511297887 | 304 |
| 349 | iso_pu_bacteria | 2511231012 | 2511303878 | 304 |
| 350 | iso_pu_bacteria | 2511231014 | 2511312638 | 304 |
| 351 | iso_pu_bacteria | 2511231015 | 2511322815 | 304 |
| 352 | iso_pu_bacteria | 2511231016 | 2511324733 | 304 |
| 353 | iso_pu_bacteria | 2511231017 | 2511334088 | 304 |
| 354 | iso_pu_bacteria | 2511231018 | 2511338092 | 304 |
| 355 | iso_pu_bacteria | 2511231019 | 2511342877 | 304 |
| 356 | iso_pu_bacteria | 2511231020 | 2511352629 | 304 |
| 357 | iso_pu_bacteria | 2511231021 | 2511359002 | 304 |
| 358 | iso_pu_bacteria | 2511231022 | 2511365947 | 304 |
| 359 | iso_pu_bacteria | 2511231023 | 2511372119 | 304 |
| 360 | iso_pu_bacteria | 2511231031 | 2511411833 | 304 |
| 361 | iso_pu_bacteria | 2511231156 | 2511825942 | 304 |
| 362 | iso_pu_bacteria | 2512047018 | 2512326876 | 304 |
| 363 | iso_pu_bacteria | 2554235341 | 2555668972 | 304 |
| 364 | iso_pu_bacteria | 2582580891 | 2583793483 | 304 |
| 365 | iso_pu_bacteria | 2597489887 | 2597857161 | 304 |
| 366 | iso_pu_bacteria | 2597489888 | 2597862880 | 304 |
| 367 | iso_pu_bacteria | 2599185155 | 2599326512 | 304 |
| 368 | iso_pu_bacteria | 2599185160 | 2599357330 | 304 |
| 369 | iso_pu_bacteria | 2599185161 | 2599361858 | 304 |
| 370 | iso_pu_bacteria | 2599185162 | 2599368179 | 304 |
| 371 | iso_pu_bacteria | 2599185163 | 2599374968 | 304 |
| 372 | iso_pu_bacteria | 2599185164 | 2599382435 | 304 |
| 373 | iso_pu_bacteria | 2599185165 | 2599388882 | 304 |
| 374 | iso_pu_bacteria | 2599185166 | 2599393826 | 304 |
| 375 | iso_pu_bacteria | 2599185167 | 2599396563 | 304 |
| 376 | iso_pu_bacteria | 2599185168 | 2599405591 | 304 |
| 377 | iso_pu_bacteria | 2599185179 | 2599453377 | 304 |
| 378 | iso_pu_bacteria | 2599185181 | 2599464169 | 304 |
| 379 | iso_pu_bacteria | 2599185182 | 2599468465 | 304 |
| 380 | iso_pu_bacteria | 2599185185 | 2599484183 | 304 |
| 381 | iso_pu_bacteria | 2599185186 | 2599493188 | 304 |
| 382 | iso_pu_bacteria | 2599185188 | 2599504659 | 304 |
| 383 | iso_pu_bacteria | 2599185190 | 2599514709 | 304 |
| 384 | iso_pu_bacteria | 2599185191 | 2599517360 | 304 |
| 385 | iso_pu_bacteria | 2599185212 | 2599611411 | 304 |
| 386 | iso_pu_bacteria | 2599185248 | 2599771501 | 304 |
| 387 | iso_pu_bacteria | 2599185257 | 2599801834 | 304 |
| 388 | iso_pu_bacteria | 2599185288 | 2599883024 | 304 |
| 389 | iso_pu_bacteria | 2599185289 | 2599884037 | 304 |
| 390 | iso_pu_bacteria | 2599185290 | 2599894026 | 304 |
| 391 | iso_pu_bacteria | 2599185291 | 2599899042 | 304 |
| 392 | iso_pu_bacteria | 2599185300 | 2599935008 | 304 |
| 393 | iso_pu_bacteria | 2599185302 | 2599941613 | 304 |
| 394 | iso_pu_bacteria | 2599185303 | 2599952416 | 304 |
| 395 | iso_pu_bacteria | 2599185304 | 2599952867 | 304 |
| 396 | iso_pu_bacteria | 2599185305 | 2599958819 | 304 |
| 397 | iso_pu_bacteria | 2599185306 | 2599968674 | 304 |
| 398 | iso_pu_bacteria | 2599185307 | 2599970584 | 304 |
| 399 | iso_pu_bacteria | 2599185308 | 2599976931 | 304 |
| 400 | iso_pu_bacteria | 2599185309 | 2599981782 | 304 |
| 401 | iso_pu_bacteria | 2599185310 | 2599987691 | 304 |
| 402 | iso_pu_bacteria | 2599185311 | 2599995183 | 304 |
| 403 | iso_pu_bacteria | 2599185312 | 2599998417 | 304 |
| 404 | iso_pu_bacteria | 2599185313 | 2600003316 | 304 |
| 405 | iso_pu_bacteria | 2599185314 | 2600011100 | 304 |
| 406 | iso_pu_bacteria | 2599185315 | 2600017891 | 304 |
| 407 | iso_pu_bacteria | 2599185316 | 2600022398 | 304 |
| 408 | iso_pu_bacteria | 2599185317 | 2600027419 | 304 |
| 409 | iso_pu_bacteria | 2599185318 | 2600034190 | 304 |
| 410 | iso_pu_bacteria | 2599185319 | 2600039698 | 304 |
| 411 | iso_pu_bacteria | 2599185320 | 2600046021 | 304 |
| 412 | iso_pu_bacteria | 2599185321 | 2600052410 | 304 |
| 413 | iso_pu_bacteria | 2599185322 | 2600057359 | 304 |
| 414 | iso_pu_bacteria | 2599185323 | 2600064536 | 304 |
| 415 | iso_pu_bacteria | 2599185324 | 2600069653 | 304 |
| 416 | iso_pu_bacteria | 2599185325 | 2600075673 | 304 |
| 417 | iso_pu_bacteria | 2599185356 | 2600216444 | 304 |
| 418 | iso_pu_bacteria | 2600254930 | 2600356872 | 304 |
| 419 | iso_pu_bacteria | 2600254931 | 2600365483 | 304 |
| 420 | iso_pu_bacteria | 2600254954 | 2600446656 | 304 |
| 421 | iso_pu_bacteria | 2600255283 | 2601624976 | 304 |
| 422 | iso_pu_bacteria | 2600255296 | 2601691410 | 304 |
| 423 | iso_pu_bacteria | 2600255313 | 2601776963 | 304 |
| 424 | iso_pu_bacteria | 2600255318 | 2601797473 | 304 |
| 425 | iso_pu_bacteria | 2600255389 | 2602010805 | 304 |
| 426 | iso_pu_bacteria | 2603880185 | 2606075794 | 304 |
| 427 | iso_pu_bacteria | 2603880199 | 2606130918 | 304 |
| 428 | iso_pu_bacteria | 2623620443 | 2624481737 | 304 |
| 429 | iso_pu_bacteria | 2623620446 | 2624491349 | 304 |
| 430 | iso_pu_bacteria | 2643221565 | 2643846335 | 304 |
| 431 | iso_pu_bacteria | 2643221571 | 2643872944 | 304 |
| 432 | iso_pu_bacteria | 2643221589 | 2643952858 | 304 |
| 433 | iso_pu_bacteria | 2643221602 | 2644022620 | 304 |
| 434 | iso_pu_bacteria | 2643221633 | 2644188832 | 304 |
| 435 | iso_pu_bacteria | 2643221650 | 2644286755 | 304 |
| 436 | iso_pu_bacteria | 2651869719 | 2652543352 | 304 |
| 437 | iso_pu_bacteria | 2667528170 | 2671091529 | 304 |
| 438 | iso_pu_bacteria | 2667528171 | 2671098497 | 304 |
| 439 | iso_pu_bacteria | 2667528176 | 2671126214 | 304 |
| 440 | iso_pu_bacteria | 2671180172 | 2671768783 | 304 |
| 441 | iso_pu_bacteria | 2675903515 | 2678262797 | 304 |
| 442 | iso_pu_bacteria | 2713897148 | 2715751636 | 304 |
| 443 | iso_pu_bacteria | 2713897149 | 2715759805 | 304 |
| 444 | iso_pu_bacteria | 2718217725 | 2718635009 | 304 |
| 445 | iso_pu_bacteria | 2728369097 | 2729147995 | 304 |
| 446 | iso_pu_bacteria | 2738541271 | 2738688437 | 304 |
| 447 | iso_pu_bacteria | 2738541294 | 2738809615 | 304 |
| 448 | iso_pu_bacteria | 2738541309 | 2738896975 | 304 |
| 449 | iso_pu_bacteria | 2738543004 | 2739201531 | 304 |
| 450 | iso_pu_bacteria | 2738543015 | 2739259509 | 304 |
| 451 | iso_pu_bacteria | 2738543016 | 2739264169 | 304 |
| 452 | iso_pu_bacteria | 2738543020 | 2739285196 | 304 |
| 453 | iso_pu_bacteria | 2738543021 | 2739290510 | 304 |
| 454 | iso_pu_bacteria | 2738543025 | 2739313920 | 304 |
| 455 | iso_pu_bacteria | 2740892503 | 2743736580 | 304 |
| 456 | iso_pu_bacteria | 2744054620 | 2745009133 | 304 |
| 457 | iso_pu_bacteria | 2773857670 | 2774121055 | 304 |
| 458 | iso_pu_bacteria | 2773857673 | 2774137265 | 304 |
| 459 | iso_pu_bacteria | 2784132063 | 2784263526 | 304 |
| 460 | iso_pu_bacteria | 2784132072 | 2784314128 | 304 |
| 461 | iso_pu_bacteria | 2791355520 | 2794598184 | 304 |
| 462 | iso_pu_bacteria | 2808606361 | 2808854412 | 304 |
| 463 | iso_pu_bacteria | 2808606376 | 2808925765 | 304 |
| 464 | iso_pu_bacteria | 2808606377 | 2808927669 | 304 |
| 465 | iso_pu_bacteria | 2808606378 | 2808934492 | 304 |
| 466 | iso_pu_bacteria | 2808606379 | 2808943261 | 304 |
| 467 | iso_pu_bacteria | 2808606380 | 2808947866 | 304 |
| 468 | iso_pu_bacteria | 2808606381 | 2808949791 | 304 |
| 469 | iso_pu_bacteria | 2808606382 | 2808957947 | 304 |
| 470 | iso_pu_bacteria | 2808606383 | 2808962917 | 304 |
| 471 | iso_pu_bacteria | 2808606385 | 2808975757 | 304 |
| 472 | iso_pu_bacteria | 2808606388 | 2808990604 | 304 |
| 473 | iso_pu_bacteria | 2808606389 | 2808997666 | 304 |
| 474 | iso_pu_bacteria | 2808606445 | 2809216665 | 304 |
| 475 | iso_pu_bacteria | 2818991456 | 2819656328 | 304 |
| 476 | iso_pu_bacteria | 2818991464 | 2819703576 | 304 |
| 477 | iso_pu_bacteria | 2823421272 | 2823423377 | 304 |
| 478 | iso_pu_bacteria | 2825651385 | 2825652844 | 304 |
| 479 | iso_pu_bacteria | 2826581358 | 2826583198 | 304 |
| 480 | iso_pu_bacteria | 2834028612 | 2834029530 | 304 |
| 481 | iso_pu_bacteria | 2842805378 | 2842806879 | 304 |
| 482 | iso_pu_bacteria | 2842815866 | 2842817461 | 304 |
| 483 | iso_pu_bacteria | 2842832357 | 2842837578 | 304 |
| 484 | iso_pu_bacteria | 2842843487 | 2842844476 | 304 |
| 485 | iso_pu_bacteria | 2842849001 | 2842850542 | 304 |
| 486 | iso_pu_bacteria | 2842854478 | 2842857507 | 304 |
| 487 | iso_pu_bacteria | 2844665904 | 2844669461 | 304 |
| 488 | iso_pu_bacteria | 2852612431 | 2852614951 | 304 |
| 489 | iso_pu_bacteria | 2852657418 | 2852658389 | 304 |
| 490 | iso_pu_bacteria | 2852667396 | 2852669919 | 304 |
| 491 | iso_pu_bacteria | 2860339153 | 2860339705 | 304 |
| 492 | iso_pu_bacteria | 2860867994 | 2860869523 | 304 |
| 493 | iso_pu_bacteria | 2878029506 | 2878033719 | 304 |
| 494 | iso_pu_bacteria | 2880230671 | 2880234360 | 304 |
| 495 | iso_pu_bacteria | 2904518522 | 2904522896 | 304 |
| 496 | iso_pu_bacteria | 2904550169 | 2904554366 | 304 |
| 497 | iso_pu_bacteria | 2912963787 | 2912967334 | 304 |
| 498 | iso_pu_bacteria | 2913036834 | 2913038771 | 304 |
| 499 | iso_pu_bacteria | 2917070673 | 2917072761 | 304 |
| 500 | iso_pu_bacteria | 2919063839 | 2919069085 | 304 |
| 501 | iso_pu_bacteria | 2919155634 | 2919158434 | 304 |
| 502 | iso_pu_bacteria | 2919385768 | 2919387843 | 304 |
| 503 | iso_pu_bacteria | 2919456309 | 2919456799 | 304 |
| 504 | iso_pu_bacteria | 2919481497 | 2919482044 | 304 |
| 505 | iso_pu_bacteria | 2919487758 | 2919490569 | 304 |
| 506 | iso_pu_bacteria | 2919501602 | 2919505272 | 304 |
| 507 | iso_pu_bacteria | 2919697872 | 2919701141 | 304 |
| 508 | iso_pu_bacteria | 2923153595 | 2923155594 | 304 |
| 509 | iso_pu_bacteria | 2923586266 | 2923587087 | 304 |
| 510 | iso_pu_bacteria | 2926063275 | 2926066949 | 304 |
| 511 | iso_pu_bacteria | 2929144301 | 2929146223 | 304 |
| 512 | iso_pu_bacteria | 2929189879 | 2929191501 | 304 |
| 513 | iso_pu_bacteria | 2931369376 | 2931370410 | 304 |
| 514 | iso_pu_bacteria | 2931390751 | 2931392540 | 304 |
| 515 | iso_pu_bacteria | 2931396565 | 2931400395 | 304 |
| 516 | iso_pu_bacteria | 2935353572 | 2935354924 | 304 |
| 517 | iso_pu_bacteria | 2939636861 | 2939639450 | 304 |
| 518 | iso_pu_bacteria | 2939651529 | 2939652850 | 304 |
| 519 | iso_pu_bacteria | 2945961074 | 2945962048 | 304 |
| 520 | iso_pu_bacteria | 2946006987 | 2946011290 | 304 |
| 521 | iso_pu_bacteria | 2946027586 | 2946029728 | 304 |
| 522 | iso_pu_bacteria | 2947233263 | 2947236354 | 304 |
| 523 | iso_pu_bacteria | 2969304461 | 2969308506 | 304 |
| 524 | iso_pu_bacteria | 2974289157 | 2974290104 | 304 |
| 525 | iso_pu_bacteria | 2984286254 | 2984290428 | 304 |
| 526 | iso_pu_bacteria | 2988728565 | 2988733748 | 304 |
| 527 | iso_pu_bacteria | 2998139840 | 2998143826 | 304 |
| 528 | iso_pu_bacteria | 3007252601 | 3007252630 | 304 |
| 529 | iso_pu_bacteria | 3007315729 | 3007318797 | 304 |
| 530 | iso_pu_bacteria | 3007395558 | 3007401133 | 304 |
| 531 | iso_pu_bacteria | 3007511990 | 3007513324 | 304 |
| 532 | iso_pu_bacteria | 3007614139 | 3007619562 | 304 |
| 533 | iso_pu_bacteria | 3007619802 | 3007621274 | 304 |
| 534 | iso_pu_bacteria | 3007855910 | 3007861007 | 304 |
| 535 | iso_pu_bacteria | 3007861166 | 3007861245 | 304 |
| 536 | iso_pu_bacteria | 3007866637 | 3007870084 | 304 |
| 537 | iso_pu_bacteria | 637000220 | 637319313 | 304 |
| 538 | iso_pu_bacteria | 640427133 | 640487613 | 304 |
| 539 | iso_pu_bacteria | 651053060 | 651175557 | 304 |
| 540 | iso_pu_bacteria | 8015687852 | 8015689854 | 304 |
| 541 | iso_pu_bacteria | 8019769354 | 8019772902 | 304 |
| 542 | iso_pu_bacteria | 8019775933 | 8019778259 | 304 |
| 543 | iso_pu_bacteria | 8029995093 | 8029997051 | 304 |
| 544 | iso_pu_bacteria | 8034962539 | 8034963731 | 304 |
| 545 | iso_pu_bacteria | 8052494512 | 8052496351 | 304 |
| 546 | iso_pu_bacteria | 8054285046 | 8054289669 | 304 |
| 547 | iso_pu_bacteria | 8054347763 | 8054351963 | 304 |
| 548 | iso_pu_bacteria | 8055770955 | 8055772956 | 304 |
| 549 | iso_pu_bacteria | 8055817908 | 8055819571 | 304 |
| 550 | iso_pu_bacteria | 8055878733 | 8055880628 | 304 |
| 551 | iso_pu_bacteria | 8056125926 | 8056127849 | 304 |
| 552 | iso_pu_bacteria | 8056143049 | 8056145162 | 304 |
| 553 | iso_pu_bacteria | 8056155041 | 8056156611 | 304 |
| 554 | iso_pu_bacteria | 8056161164 | 8056164851 | 304 |
| 555 | iso_pu_bacteria | 8056166840 | 8056167450 | 304 |
| 556 | iso_pu_bacteria | 8056172158 | 8056173455 | 304 |
| 557 | iso_pu_bacteria | 8056177738 | 8056183607 | 304 |
| 558 | iso_pu_bacteria | 8056569372 | 8056573089 | 304 |
| 559 | iso_pu_bacteria | 8057798959 | 8057799384 | 304 |
| 560 | 3300039062 | Ga0400483_217404 | Ga0400483_217404_3860_4810 | 305 |
| 561 | 3300001989 | JGI24739J22299_10000206 | JGI24739J22299_1000020614 | 306 |
| 562 | 3300002737 | JGI25162J39368_1000006 | JGI25162J39368_1000006118 | 306 |
| 563 | 3300002737 | JGI25162J39368_1002479 | JGI25162J39368_10024796 | 306 |
| 564 | 3300002771 | JGI25163J39215_1000001 | JGI25163J39215_1000001239 | 306 |
| 565 | 3300002772 | JGI25164J39214_1000001 | JGI25164J39214_1000001189 | 306 |
| 566 | 3300002773 | JGI25152J39213_1000367 | JGI25152J39213_100036720 | 306 |
| 567 | 3300003751 | Ga0055538_1000004 | Ga0055538_1000004319 | 306 |
| 568 | 3300003752 | Ga0055539_1000004 | Ga0055539_1000004239 | 306 |
| 569 | 3300003756 | Ga0055533_1000007 | Ga0055533_1000007319 | 306 |
| 570 | 3300003759 | Ga0055525_1000007 | Ga0055525_1000007319 | 306 |
| 571 | 3300003841 | Ga0055541_1000004 | Ga0055541_1000004319 | 306 |
| 572 | 3300003856 | Ga0058692_1000154 | Ga0058692_100015430 | 306 |
| 573 | 3300003856 | Ga0058692_1000657 | Ga0058692_10006579 | 306 |
| 574 | 3300003856 | Ga0058692_1000730 | Ga0058692_10007306 | 306 |
| 575 | 3300003856 | Ga0058692_1002498 | Ga0058692_10024984 | 306 |
| 576 | 3300003856 | Ga0058692_1003910 | Ga0058692_10039103 | 306 |
| 577 | 3300003856 | Ga0058692_1012084 | Ga0058692_10120843 | 306 |
| 578 | 3300005272 | Ga0065703_1018920 | Ga0065703_10189202 | 306 |
| 579 | 3300005289 | Ga0065704_10003841 | Ga0065704_100038411 | 306 |
| 580 | 3300005289 | Ga0065704_10088469 | Ga0065704_100884692 | 306 |
| 581 | 3300005347 | Ga0070668_100001689 | Ga0070668_10000168915 | 306 |
| 582 | 3300005457 | Ga0070662_100013363 | Ga0070662_1000133633 | 306 |
| 583 | 3300005548 | Ga0070665_100005453 | Ga0070665_10000545313 | 306 |
| 584 | 3300005548 | Ga0070665_100007189 | Ga0070665_10000718912 | 306 |
| 585 | 3300005548 | Ga0070665_100069632 | Ga0070665_1000696321 | 306 |
| 586 | 3300005577 | Ga0068857_100000386 | Ga0068857_10000038611 | 306 |
| 587 | 3300006051 | Ga0075364_10023611 | Ga0075364_100236111 | 306 |
| 588 | 3300006051 | Ga0075364_10059248 | Ga0075364_100592482 | 306 |
| 589 | 3300006195 | Ga0075366_10009474 | Ga0075366_100094745 | 306 |
| 590 | 3300006946 | Ga0079104_1000099 | Ga0079104_100009922 | 306 |
| 591 | 3300006946 | Ga0079104_1000403 | Ga0079104_100040321 | 306 |
| 592 | 3300006946 | Ga0079104_1001515 | Ga0079104_10015157 | 306 |
| 593 | 3300006946 | Ga0079104_1001820 | Ga0079104_10018209 | 306 |
| 594 | 3300006946 | Ga0079104_1002919 | Ga0079104_10029199 | 306 |
| 595 | 3300006946 | Ga0079104_1005396 | Ga0079104_10053961 | 306 |
| 596 | 3300009011 | Ga0105251_10002215 | Ga0105251_1000221510 | 306 |
| 597 | 3300009011 | Ga0105251_10005690 | Ga0105251_100056905 | 306 |
| 598 | 3300009011 | Ga0105251_10007932 | Ga0105251_100079323 | 306 |
| 599 | 3300009011 | Ga0105251_10014126 | Ga0105251_100141266 | 306 |
| 600 | 3300009011 | Ga0105251_10017931 | Ga0105251_100179311 | 306 |
| 601 | 3300009011 | Ga0105251_10018857 | Ga0105251_100188574 | 306 |
| 602 | 3300009011 | Ga0105251_10021619 | Ga0105251_100216193 | 306 |
| 603 | 3300009011 | Ga0105251_10022596 | Ga0105251_100225962 | 306 |
| 604 | 3300009011 | Ga0105251_10053006 | Ga0105251_100530062 | 306 |
| 605 | 3300009036 | Ga0105244_10000023 | Ga0105244_1000002362 | 306 |
| 606 | 3300009036 | Ga0105244_10000255 | Ga0105244_1000025552 | 306 |
| 607 | 3300009036 | Ga0105244_10000427 | Ga0105244_1000042733 | 306 |
| 608 | 3300009036 | Ga0105244_10000704 | Ga0105244_1000070417 | 306 |
| 609 | 3300009036 | Ga0105244_10001671 | Ga0105244_100016719 | 306 |
| 610 | 3300009036 | Ga0105244_10001899 | Ga0105244_100018994 | 306 |
| 611 | 3300009036 | Ga0105244_10002529 | Ga0105244_100025296 | 306 |
| 612 | 3300009036 | Ga0105244_10003779 | Ga0105244_100037795 | 306 |
| 613 | 3300009036 | Ga0105244_10005824 | Ga0105244_100058242 | 306 |
| 614 | 3300009036 | Ga0105244_10007248 | Ga0105244_100072482 | 306 |
| 615 | 3300009036 | Ga0105244_10052056 | Ga0105244_100520562 | 306 |
| 616 | 3300009036 | Ga0105244_10109776 | Ga0105244_101097762 | 306 |
| 617 | 3300009092 | Ga0105250_10000028 | Ga0105250_1000002896 | 306 |
| 618 | 3300009092 | Ga0105250_10000045 | Ga0105250_10000045128 | 306 |
| 619 | 3300009092 | Ga0105250_10001583 | Ga0105250_100015839 | 306 |
| 620 | 3300009092 | Ga0105250_10001831 | Ga0105250_100018316 | 306 |
| 621 | 3300009092 | Ga0105250_10011683 | Ga0105250_100116833 | 306 |
| 622 | 3300009092 | Ga0105250_10013247 | Ga0105250_100132473 | 306 |
| 623 | 3300009092 | Ga0105250_10013576 | Ga0105250_100135762 | 306 |
| 624 | 3300009092 | Ga0105250_10014569 | Ga0105250_100145691 | 306 |
| 625 | 3300009092 | Ga0105250_10032643 | Ga0105250_100326432 | 306 |
| 626 | 3300009093 | Ga0105240_10147704 | Ga0105240_101477043 | 306 |
| 627 | 3300009101 | Ga0105247_10000387 | Ga0105247_1000038725 | 306 |
| 628 | 3300009148 | Ga0105243_10003177 | Ga0105243_100031776 | 306 |
| 629 | 3300009148 | Ga0105243_10067232 | Ga0105243_100672322 | 306 |
| 630 | 3300009174 | Ga0105241_10000008 | Ga0105241_10000008120 | 306 |
| 631 | 3300009545 | Ga0105237_10028696 | Ga0105237_100286965 | 306 |
| 632 | 3300011119 | Ga0105246_10034580 | Ga0105246_100345802 | 306 |
| 633 | 3300013100 | Ga0157373_10001252 | Ga0157373_100012523 | 306 |
| 634 | 3300013100 | Ga0157373_10006491 | Ga0157373_100064915 | 306 |
| 635 | 3300013100 | Ga0157373_10008149 | Ga0157373_100081495 | 306 |
| 636 | 3300013100 | Ga0157373_10018566 | Ga0157373_100185662 | 306 |
| 637 | 3300013102 | Ga0157371_10000020 | Ga0157371_10000020133 | 306 |
| 638 | 3300013102 | Ga0157371_10000267 | Ga0157371_1000026716 | 306 |
| 639 | 3300013102 | Ga0157371_10001526 | Ga0157371_100015267 | 306 |
| 640 | 3300013102 | Ga0157371_10003239 | Ga0157371_100032395 | 306 |
| 641 | 3300013102 | Ga0157371_10029749 | Ga0157371_100297491 | 306 |
| 642 | 3300013104 | Ga0157370_10000276 | Ga0157370_1000027632 | 306 |
| 643 | 3300013104 | Ga0157370_10004198 | Ga0157370_1000419811 | 306 |
| 644 | 3300013104 | Ga0157370_10035747 | Ga0157370_100357476 | 306 |
| 645 | 3300013105 | Ga0157369_10000183 | Ga0157369_1000018373 | 306 |
| 646 | 3300013105 | Ga0157369_10034181 | Ga0157369_100341813 | 306 |
| 647 | 3300013306 | Ga0163162_10011360 | Ga0163162_100113606 | 306 |
| 648 | 3300013307 | Ga0157372_10001095 | Ga0157372_100010953 | 306 |
| 649 | 3300013307 | Ga0157372_10015434 | Ga0157372_100154345 | 306 |
| 650 | 3300013307 | Ga0157372_10031809 | Ga0157372_100318094 | 306 |
| 651 | 3300013307 | Ga0157372_10088890 | Ga0157372_100888903 | 306 |
| 652 | 3300013307 | Ga0157372_10116342 | Ga0157372_101163421 | 306 |
| 653 | 3300013308 | Ga0157375_10649087 | Ga0157375_106490871 | 306 |
| 654 | 3300015261 | Ga0182006_1000025 | Ga0182006_1000025182 | 306 |
| 655 | 3300015261 | Ga0182006_1011910 | Ga0182006_10119103 | 306 |
| 656 | 3300015679 | Ga0183366_1003 | Ga0183366_1003178 | 306 |
| 657 | 3300015680 | Ga0183370_1003 | Ga0183370_1003242 | 306 |
| 658 | 3300015685 | Ga0183369_1005 | Ga0183369_1005242 | 306 |
| 659 | 3300015687 | Ga0183368_1006 | Ga0183368_1006177 | 306 |
| 660 | 3300016635 | Ga0183361_11316 | Ga0183361_113162 | 306 |
| 661 | 3300017792 | Ga0163161_10000002 | Ga0163161_10000002174 | 306 |
| 662 | 3300021384 | Ga0213876_10000026 | Ga0213876_100000267 | 306 |
| 663 | 3300025207 | Ga0209760_100063 | Ga0209760_10006342 | 306 |
| 664 | 3300025224 | Ga0209784_100001 | Ga0209784_100001313 | 306 |
| 665 | 3300025225 | Ga0209566_100001 | Ga0209566_100001313 | 306 |
| 666 | 3300025226 | Ga0209674_100002 | Ga0209674_100002313 | 306 |
| 667 | 3300025230 | Ga0209563_100008 | Ga0209563_100008316 | 306 |
| 668 | 3300025231 | Ga0207427_100002 | Ga0207427_100002964 | 306 |
| 669 | 3300025233 | Ga0209437_100046 | Ga0209437_100046118 | 306 |
| 670 | 3300025233 | Ga0209437_100063 | Ga0209437_100063146 | 306 |
| 671 | 3300025253 | Ga0209677_100004 | Ga0209677_100004316 | 306 |
| 672 | 3300025256 | Ga0209759_1005910 | Ga0209759_10059103 | 306 |
| 673 | 3300025258 | Ga0209129_1000008 | Ga0209129_1000008413 | 306 |
| 674 | 3300025261 | Ga0209233_1001593 | Ga0209233_10015934 | 306 |
| 675 | 3300025711 | Ga0207696_1000009 | Ga0207696_1000009199 | 306 |
| 676 | 3300025711 | Ga0207696_1000027 | Ga0207696_1000027190 | 306 |
| 677 | 3300025711 | Ga0207696_1000093 | Ga0207696_100009351 | 306 |
| 678 | 3300025711 | Ga0207696_1000140 | Ga0207696_1000140128 | 306 |
| 679 | 3300025711 | Ga0207696_1000142 | Ga0207696_1000142106 | 306 |
| 680 | 3300025711 | Ga0207696_1000761 | Ga0207696_10007617 | 306 |
| 681 | 3300025711 | Ga0207696_1001106 | Ga0207696_10011067 | 306 |
| 682 | 3300025711 | Ga0207696_1006471 | Ga0207696_10064714 | 306 |
| 683 | 3300025711 | Ga0207696_1013635 | Ga0207696_10136353 | 306 |
| 684 | 3300025711 | Ga0207696_1035807 | Ga0207696_10358071 | 306 |
| 685 | 3300025728 | Ga0207655_1000006 | Ga0207655_1000006484 | 306 |
| 686 | 3300025728 | Ga0207655_1000017 | Ga0207655_1000017324 | 306 |
| 687 | 3300025728 | Ga0207655_1000024 | Ga0207655_1000024143 | 306 |
| 688 | 3300025728 | Ga0207655_1000026 | Ga0207655_1000026316 | 306 |
| 689 | 3300025728 | Ga0207655_1000054 | Ga0207655_1000054182 | 306 |
| 690 | 3300025728 | Ga0207655_1000056 | Ga0207655_1000056137 | 306 |
| 691 | 3300025728 | Ga0207655_1000101 | Ga0207655_100010152 | 306 |
| 692 | 3300025728 | Ga0207655_1000146 | Ga0207655_100014694 | 306 |
| 693 | 3300025728 | Ga0207655_1002118 | Ga0207655_100211812 | 306 |
| 694 | 3300025728 | Ga0207655_1002372 | Ga0207655_10023727 | 306 |
| 695 | 3300025728 | Ga0207655_1003121 | Ga0207655_100312111 | 306 |
| 696 | 3300025728 | Ga0207655_1005359 | Ga0207655_10053592 | 306 |
| 697 | 3300025728 | Ga0207655_1008732 | Ga0207655_10087323 | 306 |
| 698 | 3300025728 | Ga0207655_1010013 | Ga0207655_10100135 | 306 |
| 699 | 3300025728 | Ga0207655_1010613 | Ga0207655_10106135 | 306 |
| 700 | 3300025728 | Ga0207655_1011086 | Ga0207655_10110862 | 306 |
| 701 | 3300025728 | Ga0207655_1019483 | Ga0207655_10194833 | 306 |
| 702 | 3300025728 | Ga0207655_1025694 | Ga0207655_10256941 | 306 |
| 703 | 3300025728 | Ga0207655_1062566 | Ga0207655_10625661 | 306 |
| 704 | 3300025735 | Ga0207713_1000007 | Ga0207713_1000007163 | 306 |
| 705 | 3300025735 | Ga0207713_1000034 | Ga0207713_100003422 | 306 |
| 706 | 3300025735 | Ga0207713_1000046 | Ga0207713_1000046129 | 306 |
| 707 | 3300025735 | Ga0207713_1000110 | Ga0207713_10001106 | 306 |
| 708 | 3300025735 | Ga0207713_1000158 | Ga0207713_10001584 | 306 |
| 709 | 3300025735 | Ga0207713_1000419 | Ga0207713_100041937 | 306 |
| 710 | 3300025735 | Ga0207713_1001972 | Ga0207713_100197211 | 306 |
| 711 | 3300025735 | Ga0207713_1002981 | Ga0207713_10029814 | 306 |
| 712 | 3300025735 | Ga0207713_1004891 | Ga0207713_10048916 | 306 |
| 713 | 3300025735 | Ga0207713_1010990 | Ga0207713_10109905 | 306 |
| 714 | 3300025735 | Ga0207713_1013824 | Ga0207713_10138244 | 306 |
| 715 | 3300025735 | Ga0207713_1019102 | Ga0207713_10191023 | 306 |
| 716 | 3300025900 | Ga0207710_10000015 | Ga0207710_10000015326 | 306 |
| 717 | 3300025911 | Ga0207654_10000009 | Ga0207654_10000009120 | 306 |
| 718 | 3300025913 | Ga0207695_10138477 | Ga0207695_101384772 | 306 |
| 719 | 3300025914 | Ga0207671_10283640 | Ga0207671_102836402 | 306 |
| 720 | 3300025933 | Ga0207706_10039228 | Ga0207706_100392283 | 306 |
| 721 | 3300025935 | Ga0207709_10005426 | Ga0207709_100054265 | 306 |
| 722 | 3300025935 | Ga0207709_10049003 | Ga0207709_100490032 | 306 |
| 723 | 3300025972 | Ga0207668_10002127 | Ga0207668_100021273 | 306 |
| 724 | 3300026116 | Ga0207674_10000009 | Ga0207674_1000000911 | 306 |
| 725 | 3300027111 | Ga0209281_1000054 | Ga0209281_1000054103 | 306 |
| 726 | 3300027111 | Ga0209281_1000058 | Ga0209281_100005874 | 306 |
| 727 | 3300027111 | Ga0209281_1000060 | Ga0209281_1000060132 | 306 |
| 728 | 3300027111 | Ga0209281_1000120 | Ga0209281_1000120113 | 306 |
| 729 | 3300027111 | Ga0209281_1000223 | Ga0209281_100022313 | 306 |
| 730 | 3300027111 | Ga0209281_1000648 | Ga0209281_10006488 | 306 |
| 731 | 3300027111 | Ga0209281_1000822 | Ga0209281_100082220 | 306 |
| 732 | 3300027111 | Ga0209281_1000854 | Ga0209281_10008545 | 306 |
| 733 | 3300027111 | Ga0209281_1001003 | Ga0209281_100100315 | 306 |
| 734 | 3300027111 | Ga0209281_1001185 | Ga0209281_10011859 | 306 |
| 735 | 3300027111 | Ga0209281_1005142 | Ga0209281_10051421 | 306 |
| 736 | 3300027312 | Ga0209371_1000014 | Ga0209371_1000014167 | 306 |
| 737 | 3300027312 | Ga0209371_1000030 | Ga0209371_1000030113 | 306 |
| 738 | 3300027312 | Ga0209371_1000053 | Ga0209371_1000053147 | 306 |
| 739 | 3300027312 | Ga0209371_1000054 | Ga0209371_100005493 | 306 |
| 740 | 3300027312 | Ga0209371_1000111 | Ga0209371_100011181 | 306 |
| 741 | 3300027312 | Ga0209371_1000123 | Ga0209371_100012320 | 306 |
| 742 | 3300027312 | Ga0209371_1000495 | Ga0209371_100049517 | 306 |
| 743 | 3300027312 | Ga0209371_1000544 | Ga0209371_100054412 | 306 |
| 744 | 3300027312 | Ga0209371_1000563 | Ga0209371_10005635 | 306 |
| 745 | 3300027312 | Ga0209371_1000655 | Ga0209371_10006556 | 306 |
| 746 | 3300027312 | Ga0209371_1001916 | Ga0209371_10019164 | 306 |
| 747 | 3300027312 | Ga0209371_1002190 | Ga0209371_10021906 | 306 |
| 748 | 3300027312 | Ga0209371_1002345 | Ga0209371_10023452 | 306 |
| 749 | 3300027312 | Ga0209371_1005437 | Ga0209371_10054373 | 306 |
| 750 | 3300027312 | Ga0209371_1006335 | Ga0209371_10063352 | 306 |
| 751 | 3300027312 | Ga0209371_1006480 | Ga0209371_10064804 | 306 |
| 752 | 3300028379 | Ga0268266_10000290 | Ga0268266_100002908 | 306 |
| 753 | 3300030500 | Ga0268256_1000012 | Ga0268256_1000012600 | 306 |
| 754 | 3300030500 | Ga0268256_1000021 | Ga0268256_1000021161 | 306 |
| 755 | 3300030500 | Ga0268256_1000025 | Ga0268256_1000025166 | 306 |
| 756 | 3300030500 | Ga0268256_1000053 | Ga0268256_100005387 | 306 |
| 757 | 3300030500 | Ga0268256_1000095 | Ga0268256_100009517 | 306 |
| 758 | 3300030500 | Ga0268256_1000426 | Ga0268256_100042617 | 306 |
| 759 | 3300030500 | Ga0268256_1000462 | Ga0268256_100046225 | 306 |
| 760 | 3300030500 | Ga0268256_1000488 | Ga0268256_100048829 | 306 |
| 761 | 3300030500 | Ga0268256_1000560 | Ga0268256_100056019 | 306 |
| 762 | 3300030500 | Ga0268256_1001337 | Ga0268256_100133710 | 306 |
| 763 | 3300030500 | Ga0268256_1001950 | Ga0268256_10019506 | 306 |
| 764 | 3300030500 | Ga0268256_1002082 | Ga0268256_10020822 | 306 |
| 765 | 3300030500 | Ga0268256_1005190 | Ga0268256_10051903 | 306 |
| 766 | 3300030500 | Ga0268256_1006367 | Ga0268256_10063674 | 306 |
| 767 | 3300039437 | Ga0436365_0084998 | Ga0436365_0084998_222996_223949 | 306 |
| 768 | 3300041405 | Ga0439438_000003 | Ga0439438_000003_184773_185726 | 306 |
| 769 | 3300041405 | Ga0439438_000677 | Ga0439438_000677_11841_12803 | 306 |
| 770 | 3300041405 | Ga0439438_001320 | Ga0439438_001320_6473_7426 | 306 |
| 771 | 3300041405 | Ga0439438_008005 | Ga0439438_008005_1506_2459 | 306 |
| 772 | 3300041407 | Ga0439447_001380 | Ga0439447_001380_3576_4529 | 306 |
| 773 | 3300041407 | Ga0439447_002568 | Ga0439447_002568_3796_4749 | 306 |
| 774 | 3300041407 | Ga0439447_005955 | Ga0439447_005955_2049_3011 | 306 |
| 775 | 3300041411 | Ga0439466_0000002 | Ga0439466_0000002_381085_382038 | 306 |
| 776 | 3300041512 | Ga0451853_0270960 | Ga0451853_0270960_466_1419 | 306 |
| 777 | 3300042006 | Ga0439432_001288 | Ga0439432_001288_5613_6566 | 306 |
| 778 | 3300042006 | Ga0439432_002793 | Ga0439432_002793_2931_3884 | 306 |
| 779 | 3300042010 | Ga0439452_000004 | Ga0439452_000004_569536_570489 | 306 |
| 780 | 3300042010 | Ga0439452_000005 | Ga0439452_000005_192017_193063 | 306 |
| 781 | 3300042010 | Ga0439452_000007 | Ga0439452_000007_251118_252071 | 306 |
| 782 | 3300042010 | Ga0439452_000056 | Ga0439452_000056_86065_87018 | 306 |
| 783 | 3300042010 | Ga0439452_001164 | Ga0439452_001164_7201_8154 | 306 |
| 784 | 3300042016 | Ga0439463_000932 | Ga0439463_000932_1634_2587 | 306 |
| 785 | 3300042146 | Ga0450907_000284 | Ga0450907_000284_9478_10431 | 306 |
| 786 | 3300042439 | Ga0439464_0003716 | Ga0439464_0003716_581_1534 | 306 |
| 787 | 3300042532 | Ga0450893_0012600 | Ga0450893_0012600_325_1293 | 306 |
| 788 | 3300044669 | Ga0466981_0000014 | Ga0466981_0000014_90524_91477 | 306 |
| 789 | 3300046453 | Ga0495627_000042 | Ga0495627_000042_23292_24245 | 306 |
| 790 | 3300046458 | Ga0495591_000024 | Ga0495591_000024_180453_181406 | 306 |
| 791 | 3300046458 | Ga0495591_000231 | Ga0495591_000231_30297_31250 | 306 |
| 792 | 3300046458 | Ga0495591_005800 | Ga0495591_005800_2930_3892 | 306 |
| 793 | 3300046471 | Ga0495650_0000004 | Ga0495650_0000004_352016_352984 | 306 |
| 794 | 3300046471 | Ga0495650_0000028 | Ga0495650_0000028_174380_175333 | 306 |
| 795 | 3300046471 | Ga0495650_0000113 | Ga0495650_0000113_87173_88135 | 306 |
| 796 | 3300046501 | Ga0495607_0007957 | Ga0495607_0007957_2656_3618 | 306 |
| 797 | 3300046515 | Ga0495620_0001603 | Ga0495620_0001603_9068_10021 | 306 |
| 798 | 3300046522 | Ga0495643_0036773 | Ga0495643_0036773_446_1399 | 306 |
| 799 | 3300046524 | Ga0495648_0069907 | Ga0495648_0069907_316_1278 | 306 |
| 800 | 3300046530 | Ga0495654_0000031 | Ga0495654_0000031_44710_45663 | 306 |
| 801 | 3300046530 | Ga0495654_0000342 | Ga0495654_0000342_35198_36151 | 306 |
| 802 | 3300046530 | Ga0495654_0000390 | Ga0495654_0000390_16528_17490 | 306 |
| 803 | 3300046530 | Ga0495654_0033441 | Ga0495654_0033441_782_1735 | 306 |
| 804 | 3300046542 | Ga0495597_0000548 | Ga0495597_0000548_3427_4380 | 306 |
| 805 | 3300046692 | Ga0495671_0001418 | Ga0495671_0001418_1905_2867 | 306 |
| 806 | 3300046694 | Ga0495649_0003172 | Ga0495649_0003172_8546_9508 | 306 |
| 807 | 3300046694 | Ga0495649_0003193 | Ga0495649_0003193_2693_3646 | 306 |
| 808 | 3300046694 | Ga0495649_0004813 | Ga0495649_0004813_230_1183 | 306 |
| 809 | 3300046794 | Ga0495589_0000005 | Ga0495589_0000005_373739_374692 | 306 |
| 810 | 3300046794 | Ga0495589_0004916 | Ga0495589_0004916_5878_6840 | 306 |
| 811 | 3300046810 | Ga0495660_0000013 | Ga0495660_0000013_267117_268085 | 306 |
| 812 | 3300046810 | Ga0495660_0000034 | Ga0495660_0000034_80299_81261 | 306 |
| 813 | 3300047320 | Ga0495672_0000029 | Ga0495672_0000029_97554_98516 | 306 |
| 814 | 3300047320 | Ga0495672_0000051 | Ga0495672_0000051_154298_155251 | 306 |
| 815 | 3300047320 | Ga0495672_0000054 | Ga0495672_0000054_39242_40195 | 306 |
| 816 | 3300047446 | Ga0495679_000014 | Ga0495679_000014_129619_130572 | 306 |
| 817 | 3300047469 | Ga0495673_0000047 | Ga0495673_0000047_58189_59142 | 306 |
| 818 | 3300047469 | Ga0495673_0000820 | Ga0495673_0000820_18470_19432 | 306 |
| 819 | 3300047470 | Ga0495681_0042745 | Ga0495681_0042745_969_1922 | 306 |
| 820 | 3300048904 | Ga0496101_0000123 | Ga0496101_0000123_70122_71075 | 306 |
| 821 | 3300048905 | Ga0496102_0004986 | Ga0496102_0004986_3099_4052 | 306 |
| 822 | 3300048906 | Ga0496103_0028765 | Ga0496103_0028765_2018_2971 | 306 |
| 823 | 3300048907 | Ga0496104_0004669 | Ga0496104_0004669_8074_9027 | 306 |
| 824 | 3300048908 | Ga0496105_0021587 | Ga0496105_0021587_287_1240 | 306 |
| 825 | 3300048919 | Ga0496116_0000015 | Ga0496116_0000015_218629_219582 | 306 |
| 826 | 3300048919 | Ga0496116_0000016 | Ga0496116_0000016_223160_224128 | 306 |
| 827 | 3300048919 | Ga0496116_0000217 | Ga0496116_0000217_6038_6991 | 306 |
| 828 | 3300048919 | Ga0496116_0001156 | Ga0496116_0001156_27066_28019 | 306 |
| 829 | 3300048919 | Ga0496116_0004729 | Ga0496116_0004729_5246_6199 | 306 |
| 830 | 3300048919 | Ga0496116_0022832 | Ga0496116_0022832_13_966 | 306 |
| 831 | 3300048919 | Ga0496116_0051296 | Ga0496116_0051296_36_989 | 306 |
| 832 | 3300048919 | Ga0496116_0107545 | Ga0496116_0107545_469_1422 | 306 |
| 833 | 3300048920 | Ga0496117_0000103 | Ga0496117_0000103_89195_90148 | 306 |
| 834 | 3300048920 | Ga0496117_0000238 | Ga0496117_0000238_51845_52798 | 306 |
| 835 | 3300048920 | Ga0496117_0002432 | Ga0496117_0002432_10384_11337 | 306 |
| 836 | 3300048920 | Ga0496117_0003210 | Ga0496117_0003210_1311_2264 | 306 |
| 837 | 3300048920 | Ga0496117_0006936 | Ga0496117_0006936_7917_8870 | 306 |
| 838 | 3300048920 | Ga0496117_0007956 | Ga0496117_0007956_9188_10141 | 306 |
| 839 | 3300048920 | Ga0496117_0033079 | Ga0496117_0033079_1941_2909 | 306 |
| 840 | 3300048920 | Ga0496117_0050855 | Ga0496117_0050855_941_1894 | 306 |
| 841 | 3300048920 | Ga0496117_0052055 | Ga0496117_0052055_614_1582 | 306 |
| 842 | 3300048920 | Ga0496117_0147387 | Ga0496117_0147387_181_1227 | 306 |
| 843 | 3300048921 | Ga0496118_0000046 | Ga0496118_0000046_171662_172615 | 306 |
| 844 | 3300048921 | Ga0496118_0000959 | Ga0496118_0000959_15905_16858 | 306 |
| 845 | 3300048921 | Ga0496118_0001062 | Ga0496118_0001062_2732_3685 | 306 |
| 846 | 3300048921 | Ga0496118_0002877 | Ga0496118_0002877_9188_10141 | 306 |
| 847 | 3300048921 | Ga0496118_0032073 | Ga0496118_0032073_1531_2484 | 306 |
| 848 | 3300048921 | Ga0496118_0039355 | Ga0496118_0039355_1005_1958 | 306 |
| 849 | 3300048921 | Ga0496118_0145316 | Ga0496118_0145316_268_1314 | 306 |
| 850 | 3300048922 | Ga0496119_0000026 | Ga0496119_0000026_101243_102289 | 306 |
| 851 | 3300048922 | Ga0496119_0000031 | Ga0496119_0000031_108436_109389 | 306 |
| 852 | 3300048922 | Ga0496119_0000270 | Ga0496119_0000270_2389_3342 | 306 |
| 853 | 3300048922 | Ga0496119_0005618 | Ga0496119_0005618_7662_8615 | 306 |
| 854 | 3300048922 | Ga0496119_0005727 | Ga0496119_0005727_8953_9906 | 306 |
| 855 | 3300048922 | Ga0496119_0007715 | Ga0496119_0007715_572_1525 | 306 |
| 856 | 3300048922 | Ga0496119_0007722 | Ga0496119_0007722_3534_4487 | 306 |
| 857 | 3300048922 | Ga0496119_0013656 | Ga0496119_0013656_772_1740 | 306 |
| 858 | 3300048922 | Ga0496119_0016128 | Ga0496119_0016128_3107_4060 | 306 |
| 859 | 3300048922 | Ga0496119_0021763 | Ga0496119_0021763_29_982 | 306 |
| 860 | 3300048922 | Ga0496119_0037132 | Ga0496119_0037132_577_1530 | 306 |
| 861 | 3300048923 | Ga0496120_0000017 | Ga0496120_0000017_212805_213758 | 306 |
| 862 | 3300048923 | Ga0496120_0000344 | Ga0496120_0000344_67883_68836 | 306 |
| 863 | 3300048923 | Ga0496120_0000361 | Ga0496120_0000361_70469_71422 | 306 |
| 864 | 3300048923 | Ga0496120_0001012 | Ga0496120_0001012_16498_17451 | 306 |
| 865 | 3300048923 | Ga0496120_0001279 | Ga0496120_0001279_8845_9798 | 306 |
| 866 | 3300048923 | Ga0496120_0001280 | Ga0496120_0001280_8846_9799 | 306 |
| 867 | 3300048923 | Ga0496120_0002535 | Ga0496120_0002535_3067_4020 | 306 |
| 868 | 3300048923 | Ga0496120_0004434 | Ga0496120_0004434_1869_2822 | 306 |
| 869 | 3300048923 | Ga0496120_0007521 | Ga0496120_0007521_2512_3465 | 306 |
| 870 | 3300048923 | Ga0496120_0009560 | Ga0496120_0009560_3398_4351 | 306 |
| 871 | 3300048923 | Ga0496120_0115219 | Ga0496120_0115219_180_1226 | 306 |
| 872 | 3300048924 | Ga0496121_0001130 | Ga0496121_0001130_6620_7573 | 306 |
| 873 | 3300048924 | Ga0496121_0004701 | Ga0496121_0004701_9281_10234 | 306 |
| 874 | 3300048924 | Ga0496121_0007313 | Ga0496121_0007313_10249_11202 | 306 |
| 875 | 3300048924 | Ga0496121_0047057 | Ga0496121_0047057_29_982 | 306 |
| 876 | 3300048925 | Ga0496122_0000075 | Ga0496122_0000075_13183_14136 | 306 |
| 877 | 3300048925 | Ga0496122_0000125 | Ga0496122_0000125_83935_84903 | 306 |
| 878 | 3300048925 | Ga0496122_0001095 | Ga0496122_0001095_3778_4731 | 306 |
| 879 | 3300048925 | Ga0496122_0002193 | Ga0496122_0002193_7922_8875 | 306 |
| 880 | 3300048925 | Ga0496122_0008894 | Ga0496122_0008894_2471_3424 | 306 |
| 881 | 3300048925 | Ga0496122_0010035 | Ga0496122_0010035_5658_6611 | 306 |
| 882 | 3300048925 | Ga0496122_0035757 | Ga0496122_0035757_1542_2495 | 306 |
| 883 | 3300048925 | Ga0496122_0038666 | Ga0496122_0038666_2569_3615 | 306 |
| 884 | 3300048925 | Ga0496122_0066774 | Ga0496122_0066774_916_1869 | 306 |
| 885 | 3300048926 | Ga0496123_0000019 | Ga0496123_0000019_106202_107155 | 306 |
| 886 | 3300048926 | Ga0496123_0000092 | Ga0496123_0000092_94766_95734 | 306 |
| 887 | 3300048926 | Ga0496123_0000377 | Ga0496123_0000377_41466_42419 | 306 |
| 888 | 3300048926 | Ga0496123_0000774 | Ga0496123_0000774_30551_31504 | 306 |
| 889 | 3300048926 | Ga0496123_0001657 | Ga0496123_0001657_25986_26939 | 306 |
| 890 | 3300048926 | Ga0496123_0003347 | Ga0496123_0003347_9223_10176 | 306 |
| 891 | 3300048926 | Ga0496123_0022363 | Ga0496123_0022363_916_1869 | 306 |
| 892 | 3300048926 | Ga0496123_0061320 | Ga0496123_0061320_203_1249 | 306 |
| 893 | 3300048927 | Ga0496124_0000058 | Ga0496124_0000058_43881_44834 | 306 |
| 894 | 3300048927 | Ga0496124_0000142 | Ga0496124_0000142_18094_19140 | 306 |
| 895 | 3300048927 | Ga0496124_0000238 | Ga0496124_0000238_73854_74822 | 306 |
| 896 | 3300048927 | Ga0496124_0000965 | Ga0496124_0000965_39303_40256 | 306 |
| 897 | 3300048927 | Ga0496124_0006756 | Ga0496124_0006756_9053_10006 | 306 |
| 898 | 3300048927 | Ga0496124_0007209 | Ga0496124_0007209_4964_5917 | 306 |
| 899 | 3300048927 | Ga0496124_0009650 | Ga0496124_0009650_4721_5674 | 306 |
| 900 | 3300048927 | Ga0496124_0025262 | Ga0496124_0025262_740_1693 | 306 |
| 901 | 3300048927 | Ga0496124_0086011 | Ga0496124_0086011_29_982 | 306 |
| 902 | 3300048927 | Ga0496124_0148706 | Ga0496124_0148706_493_1446 | 306 |
| 903 | 3300048928 | Ga0496125_0000032 | Ga0496125_0000032_257881_258834 | 306 |
| 904 | 3300048928 | Ga0496125_0001495 | Ga0496125_0001495_32194_33162 | 306 |
| 905 | 3300048928 | Ga0496125_0017828 | Ga0496125_0017828_2072_3118 | 306 |
| 906 | 3300048928 | Ga0496125_0018128 | Ga0496125_0018128_3473_4426 | 306 |
| 907 | 3300048928 | Ga0496125_0018546 | Ga0496125_0018546_3959_4912 | 306 |
| 908 | 3300048929 | Ga0496126_0000109 | Ga0496126_0000109_66459_67427 | 306 |
| 909 | 3300048929 | Ga0496126_0079934 | Ga0496126_0079934_910_1863 | 306 |
| 910 | 3300048929 | Ga0496126_0080089 | Ga0496126_0080089_1117_2070 | 306 |
| 911 | 3300048929 | Ga0496126_0215381 | Ga0496126_0215381_256_1209 | 306 |
| 912 | 3300048929 | Ga0496126_0349505 | Ga0496126_0349505_227_1180 | 306 |
| 913 | 3300049459 | Ga0495678_000984 | Ga0495678_000984_18444_19406 | 306 |
| 914 | 3300049460 | Ga0495682_0000003 | Ga0495682_0000003_197455_198417 | 306 |
| 915 | 3300049576 | Ga0501040_0000028 | Ga0501040_0000028_12462_13418 | 306 |
| 916 | 3300049578 | Ga0501042_0000283 | Ga0501042_0000283_8655_9611 | 306 |
| 917 | 3300050491 | nmdc:mga00v17_78003_c1 | nmdc:mga00v17_78003_c1_20_973 | 306 |
| 918 | 3300050493 | nmdc:mga0k408_2713_c1 | nmdc:mga0k408_2713_c1_3517_4470 | 306 |
| 919 | 3300053126 | Ga0500621_000006 | Ga0500621_000006_187228_188190 | 306 |
| 920 | iso_pu_bacteria | 8054844752 | 8054848645 | 306 |
| 921 | 3300005289 | Ga0065704_10007594 | Ga0065704_100075942 | 307 |
| 922 | 3300005290 | Ga0065712_10070283 | Ga0065712_100702832 | 307 |
| 923 | 3300005331 | Ga0070670_100000052 | Ga0070670_10000005234 | 307 |
| 924 | 3300005344 | Ga0070661_100001228 | Ga0070661_1000012286 | 307 |
| 925 | 3300005353 | Ga0070669_100005813 | Ga0070669_1000058138 | 307 |
| 926 | 3300005355 | Ga0070671_100000055 | Ga0070671_10000005565 | 307 |
| 927 | 3300005365 | Ga0070688_100055182 | Ga0070688_1000551823 | 307 |
| 928 | 3300005367 | Ga0070667_100000021 | Ga0070667_100000021101 | 307 |
| 929 | 3300005466 | Ga0070685_10000003 | Ga0070685_10000003213 | 307 |
| 930 | 3300005548 | Ga0070665_100134082 | Ga0070665_1001340822 | 307 |
| 931 | 3300005564 | Ga0070664_100001616 | Ga0070664_1000016166 | 307 |
| 932 | 3300005577 | Ga0068857_100254231 | Ga0068857_1002542312 | 307 |
| 933 | 3300005617 | Ga0068859_100002966 | Ga0068859_1000029667 | 307 |
| 934 | 3300005618 | Ga0068864_100000002 | Ga0068864_100000002588 | 307 |
| 935 | 3300005842 | Ga0068858_100029359 | Ga0068858_1000293595 | 307 |
| 936 | 3300005843 | Ga0068860_100000695 | Ga0068860_1000006955 | 307 |
| 937 | 3300006931 | Ga0097620_100002966 | Ga0097620_10000296616 | 307 |
| 938 | 3300009011 | Ga0105251_10001649 | Ga0105251_1000164914 | 307 |
| 939 | 3300009036 | Ga0105244_10005005 | Ga0105244_100050054 | 307 |
| 940 | 3300009092 | Ga0105250_10000199 | Ga0105250_1000019927 | 307 |
| 941 | 3300009101 | Ga0105247_10012831 | Ga0105247_100128315 | 307 |
| 942 | 3300009176 | Ga0105242_10001563 | Ga0105242_1000156312 | 307 |
| 943 | 3300009545 | Ga0105237_10000413 | Ga0105237_1000041314 | 307 |
| 944 | 3300009553 | Ga0105249_10016816 | Ga0105249_100168164 | 307 |
| 945 | 3300011119 | Ga0105246_10007972 | Ga0105246_100079724 | 307 |
| 946 | 3300013100 | Ga0157373_10015027 | Ga0157373_100150275 | 307 |
| 947 | 3300013100 | Ga0157373_10018376 | Ga0157373_100183764 | 307 |
| 948 | 3300013105 | Ga0157369_10006197 | Ga0157369_100061976 | 307 |
| 949 | 3300013105 | Ga0157369_10008666 | Ga0157369_100086666 | 307 |
| 950 | 3300013308 | Ga0157375_10005669 | Ga0157375_100056692 | 307 |
| 951 | 3300013308 | Ga0157375_10062745 | Ga0157375_100627452 | 307 |
| 952 | 3300014325 | Ga0163163_10000053 | Ga0163163_1000005373 | 307 |
| 953 | 3300017792 | Ga0163161_10114956 | Ga0163161_101149564 | 307 |
| 954 | 3300025711 | Ga0207696_1000090 | Ga0207696_1000090139 | 307 |
| 955 | 3300025711 | Ga0207696_1000176 | Ga0207696_100017627 | 307 |
| 956 | 3300025711 | Ga0207696_1000177 | Ga0207696_100017782 | 307 |
| 957 | 3300025728 | Ga0207655_1000140 | Ga0207655_100014030 | 307 |
| 958 | 3300025728 | Ga0207655_1022903 | Ga0207655_10229032 | 307 |
| 959 | 3300025903 | Ga0207680_10051360 | Ga0207680_100513602 | 307 |
| 960 | 3300025914 | Ga0207671_10005571 | Ga0207671_100055714 | 307 |
| 961 | 3300025920 | Ga0207649_10000156 | Ga0207649_1000015618 | 307 |
| 962 | 3300025923 | Ga0207681_10002936 | Ga0207681_100029364 | 307 |
| 963 | 3300025925 | Ga0207650_10000002 | Ga0207650_10000002581 | 307 |
| 964 | 3300025931 | Ga0207644_10001388 | Ga0207644_100013888 | 307 |
| 965 | 3300025934 | Ga0207686_10003046 | Ga0207686_100030467 | 307 |
| 966 | 3300025941 | Ga0207711_10000178 | Ga0207711_1000017812 | 307 |
| 967 | 3300025945 | Ga0207679_10000016 | Ga0207679_1000001681 | 307 |
| 968 | 3300025961 | Ga0207712_10035676 | Ga0207712_100356764 | 307 |
| 969 | 3300025986 | Ga0207658_10000001 | Ga0207658_10000001771 | 307 |
| 970 | 3300026088 | Ga0207641_10018214 | Ga0207641_100182145 | 307 |
| 971 | 3300026088 | Ga0207641_10155440 | Ga0207641_101554402 | 307 |
| 972 | 3300026095 | Ga0207676_10000001 | Ga0207676_10000001581 | 307 |
| 973 | 3300028379 | Ga0268266_10004075 | Ga0268266_100040752 | 307 |
| 974 | 3300028380 | Ga0268265_10000936 | Ga0268265_1000093625 | 307 |
| 975 | 3300028381 | Ga0268264_10000004 | Ga0268264_10000004585 | 307 |
| 976 | 3300031731 | Ga0307405_10001903 | Ga0307405_100019036 | 307 |
| 977 | 3300037068 | Ga0373925_0056469 | Ga0373925_0056469_115_1068 | 307 |
| 978 | 3300042000 | Ga0439437_001432 | Ga0439437_001432_1067_1990 | 307 |
| 979 | 3300042012 | Ga0439455_0007220 | Ga0439455_0007220_899_1843 | 307 |
| 980 | 3300042115 | Ga0450911_000083 | Ga0450911_000083_3614_4558 | 307 |
| 981 | 3300042130 | Ga0450892_002711 | Ga0450892_002711_42_986 | 307 |
| 982 | 3300042139 | Ga0450904_000082 | Ga0450904_000082_16668_17612 | 307 |
| 983 | 3300042156 | Ga0439446_0000803 | Ga0439446_0000803_4312_5256 | 307 |
| 984 | 3300042438 | Ga0439459_0001744 | Ga0439459_0001744_1782_2726 | 307 |
| 985 | 3300042438 | Ga0439459_0028185 | Ga0439459_0028185_80_1036 | 307 |
| 986 | 3300042530 | Ga0450916_000109 | Ga0450916_000109_3939_4883 | 307 |
| 987 | 3300046474 | Ga0495605_0014965 | Ga0495605_0014965_735_1658 | 307 |
| 988 | 3300046491 | Ga0495584_0016948 | Ga0495584_0016948_1384_2307 | 307 |
| 989 | 3300046506 | Ga0495583_0008771 | Ga0495583_0008771_3678_4601 | 307 |
| 990 | 3300046506 | Ga0495583_0069131 | Ga0495583_0069131_158_1081 | 307 |
| 991 | 3300046507 | Ga0495606_0003133 | Ga0495606_0003133_15470_16393 | 307 |
| 992 | 3300046507 | Ga0495606_0056808 | Ga0495606_0056808_713_1636 | 307 |
| 993 | 3300046524 | Ga0495648_0055717 | Ga0495648_0055717_685_1608 | 307 |
| 994 | 3300046530 | Ga0495654_0003153 | Ga0495654_0003153_7337_8260 | 307 |
| 995 | 3300046530 | Ga0495654_0012736 | Ga0495654_0012736_3195_4118 | 307 |
| 996 | 3300046664 | Ga0495659_0032514 | Ga0495659_0032514_196_1119 | 307 |
| 997 | 3300046810 | Ga0495660_0054871 | Ga0495660_0054871_783_1706 | 307 |
| 998 | 3300047320 | Ga0495672_0103361 | Ga0495672_0103361_231_1154 | 307 |
| 999 | 3300047446 | Ga0495679_011546 | Ga0495679_011546_2051_2974 | 307 |
| 1000 | 3300048920 | Ga0496117_0020301 | Ga0496117_0020301_65_988 | 307 |
| 1001 | 3300048924 | Ga0496121_0198182 | Ga0496121_0198182_449_1372 | 307 |
| 1002 | 3300048926 | Ga0496123_0114334 | Ga0496123_0114334_367_1290 | 307 |
| 1003 | 3300048927 | Ga0496124_0085529 | Ga0496124_0085529_1532_2485 | 307 |
| 1004 | 3300048927 | Ga0496124_0239685 | Ga0496124_0239685_362_1285 | 307 |
| 1005 | 3300048928 | Ga0496125_0012006 | Ga0496125_0012006_7269_8222 | 307 |
| 1006 | 3300048928 | Ga0496125_0041636 | Ga0496125_0041636_2459_3382 | 307 |
| 1007 | 3300048928 | Ga0496125_0217167 | Ga0496125_0217167_230_1153 | 307 |
| 1008 | 3300048929 | Ga0496126_0188847 | Ga0496126_0188847_302_1255 | 307 |
| 1009 | 3300048929 | Ga0496126_0189336 | Ga0496126_0189336_483_1406 | 307 |
| 1010 | 3300049460 | Ga0495682_0000304 | Ga0495682_0000304_9822_10745 | 307 |
| 1011 | 3300049853 | Ga0501226_000009 | Ga0501226_000009_59366_60310 | 307 |
| 1012 | 2124908027 | MRS2a_Contig_1682 | MRS2a_00541950 | 308 |
| 1013 | 3300002737 | JGI25162J39368_1000391 | JGI25162J39368_100039125 | 308 |
| 1014 | 3300002771 | JGI25163J39215_1000255 | JGI25163J39215_10002553 | 308 |
| 1015 | 3300002771 | JGI25163J39215_1001158 | JGI25163J39215_10011583 | 308 |
| 1016 | 3300002772 | JGI25164J39214_1000089 | JGI25164J39214_100008952 | 308 |
| 1017 | 3300002772 | JGI25164J39214_1000279 | JGI25164J39214_100027925 | 308 |
| 1018 | 3300003214 | JGI25165J46597_1000191 | JGI25165J46597_100019152 | 308 |
| 1019 | 3300003214 | JGI25165J46597_1000510 | JGI25165J46597_100051020 | 308 |
| 1020 | 3300003751 | Ga0055538_1000078 | Ga0055538_10000781 | 308 |
| 1021 | 3300003781 | Ga0055536_1000089 | Ga0055536_10000892 | 308 |
| 1022 | 3300003791 | Ga0055530_10000230 | Ga0055530_1000023013 | 308 |
| 1023 | 3300003791 | Ga0055530_10000462 | Ga0055530_1000046217 | 308 |
| 1024 | 3300003791 | Ga0055530_10001861 | Ga0055530_1000186113 | 308 |
| 1025 | 3300003792 | Ga0055540_1000163 | Ga0055540_10001632 | 308 |
| 1026 | 3300003792 | Ga0055540_1000241 | Ga0055540_100024113 | 308 |
| 1027 | 3300003792 | Ga0055540_1001061 | Ga0055540_100106114 | 308 |
| 1028 | 3300003794 | Ga0055531_10044352 | Ga0055531_100443521 | 308 |
| 1029 | 3300005288 | Ga0065714_10003160 | Ga0065714_100031602 | 308 |
| 1030 | 3300005288 | Ga0065714_10004034 | Ga0065714_100040343 | 308 |
| 1031 | 3300005288 | Ga0065714_10085992 | Ga0065714_100859922 | 308 |
| 1032 | 3300005288 | Ga0065714_10099170 | Ga0065714_100991701 | 308 |
| 1033 | 3300005288 | Ga0065714_10139196 | Ga0065714_101391961 | 308 |
| 1034 | 3300005290 | Ga0065712_10002471 | Ga0065712_100024718 | 308 |
| 1035 | 3300005290 | Ga0065712_10071164 | Ga0065712_100711648 | 308 |
| 1036 | 3300005331 | Ga0070670_100000751 | Ga0070670_10000075124 | 308 |
| 1037 | 3300005331 | Ga0070670_100002027 | Ga0070670_1000020272 | 308 |
| 1038 | 3300005457 | Ga0070662_100031548 | Ga0070662_1000315482 | 308 |
| 1039 | 3300005548 | Ga0070665_100242711 | Ga0070665_1002427113 | 308 |
| 1040 | 3300006058 | Ga0075432_10006397 | Ga0075432_100063975 | 308 |
| 1041 | 3300006177 | Ga0075362_10051079 | Ga0075362_100510792 | 308 |
| 1042 | 3300006944 | Ga0099823_1000050 | Ga0099823_100005015 | 308 |
| 1043 | 3300006946 | Ga0079104_1000222 | Ga0079104_100022259 | 308 |
| 1044 | 3300009011 | Ga0105251_10000401 | Ga0105251_1000040112 | 308 |
| 1045 | 3300009011 | Ga0105251_10029529 | Ga0105251_100295293 | 308 |
| 1046 | 3300009011 | Ga0105251_10046254 | Ga0105251_100462543 | 308 |
| 1047 | 3300009011 | Ga0105251_10169024 | Ga0105251_101690241 | 308 |
| 1048 | 3300009036 | Ga0105244_10000453 | Ga0105244_1000045335 | 308 |
| 1049 | 3300009036 | Ga0105244_10001973 | Ga0105244_1000197316 | 308 |
| 1050 | 3300009036 | Ga0105244_10002235 | Ga0105244_1000223514 | 308 |
| 1051 | 3300009036 | Ga0105244_10021139 | Ga0105244_100211392 | 308 |
| 1052 | 3300009092 | Ga0105250_10000737 | Ga0105250_100007373 | 308 |
| 1053 | 3300009092 | Ga0105250_10001320 | Ga0105250_100013202 | 308 |
| 1054 | 3300009092 | Ga0105250_10004681 | Ga0105250_100046813 | 308 |
| 1055 | 3300009092 | Ga0105250_10013139 | Ga0105250_100131392 | 308 |
| 1056 | 3300009092 | Ga0105250_10135576 | Ga0105250_101355761 | 308 |
| 1057 | 3300009148 | Ga0105243_10000627 | Ga0105243_1000062722 | 308 |
| 1058 | 3300009148 | Ga0105243_10002038 | Ga0105243_1000203814 | 308 |
| 1059 | 3300009148 | Ga0105243_10010109 | Ga0105243_100101096 | 308 |
| 1060 | 3300009148 | Ga0105243_10179209 | Ga0105243_101792093 | 308 |
| 1061 | 3300011119 | Ga0105246_10000467 | Ga0105246_1000046723 | 308 |
| 1062 | 3300011119 | Ga0105246_10000590 | Ga0105246_100005903 | 308 |
| 1063 | 3300012498 | Ga0157345_1000123 | Ga0157345_100012313 | 308 |
| 1064 | 3300013100 | Ga0157373_10001088 | Ga0157373_100010882 | 308 |
| 1065 | 3300013100 | Ga0157373_10039070 | Ga0157373_100390703 | 308 |
| 1066 | 3300013100 | Ga0157373_10060782 | Ga0157373_100607823 | 308 |
| 1067 | 3300013100 | Ga0157373_10122820 | Ga0157373_101228202 | 308 |
| 1068 | 3300013100 | Ga0157373_10226233 | Ga0157373_102262332 | 308 |
| 1069 | 3300013102 | Ga0157371_10000186 | Ga0157371_100001863 | 308 |
| 1070 | 3300013102 | Ga0157371_10000396 | Ga0157371_100003962 | 308 |
| 1071 | 3300013102 | Ga0157371_10002310 | Ga0157371_1000231016 | 308 |
| 1072 | 3300013102 | Ga0157371_10005382 | Ga0157371_100053824 | 308 |
| 1073 | 3300013104 | Ga0157370_10000595 | Ga0157370_1000059539 | 308 |
| 1074 | 3300013104 | Ga0157370_10001621 | Ga0157370_1000162125 | 308 |
| 1075 | 3300013104 | Ga0157370_10040510 | Ga0157370_100405104 | 308 |
| 1076 | 3300013104 | Ga0157370_10091996 | Ga0157370_100919962 | 308 |
| 1077 | 3300013104 | Ga0157370_10126378 | Ga0157370_101263782 | 308 |
| 1078 | 3300013104 | Ga0157370_10194077 | Ga0157370_101940772 | 308 |
| 1079 | 3300013105 | Ga0157369_10001314 | Ga0157369_1000131428 | 308 |
| 1080 | 3300013105 | Ga0157369_10135413 | Ga0157369_101354132 | 308 |
| 1081 | 3300013105 | Ga0157369_10321810 | Ga0157369_103218101 | 308 |
| 1082 | 3300013105 | Ga0157369_10326584 | Ga0157369_103265841 | 308 |
| 1083 | 3300013306 | Ga0163162_10007244 | Ga0163162_100072449 | 308 |
| 1084 | 3300013306 | Ga0163162_10012235 | Ga0163162_100122357 | 308 |
| 1085 | 3300013307 | Ga0157372_10001343 | Ga0157372_100013432 | 308 |
| 1086 | 3300014497 | Ga0182008_10001777 | Ga0182008_100017772 | 308 |
| 1087 | 3300014497 | Ga0182008_10005889 | Ga0182008_100058892 | 308 |
| 1088 | 3300014497 | Ga0182008_10079847 | Ga0182008_100798471 | 308 |
| 1089 | 3300014497 | Ga0182008_10085164 | Ga0182008_100851641 | 308 |
| 1090 | 3300015261 | Ga0182006_1005166 | Ga0182006_10051662 | 308 |
| 1091 | 3300015261 | Ga0182006_1006697 | Ga0182006_10066972 | 308 |
| 1092 | 3300015261 | Ga0182006_1024147 | Ga0182006_10241472 | 308 |
| 1093 | 3300015261 | Ga0182006_1025996 | Ga0182006_10259962 | 308 |
| 1094 | 3300015261 | Ga0182006_1043234 | Ga0182006_10432342 | 308 |
| 1095 | 3300015261 | Ga0182006_1059177 | Ga0182006_10591772 | 308 |
| 1096 | 3300015262 | Ga0182007_10025387 | Ga0182007_100253871 | 308 |
| 1097 | 3300015265 | Ga0182005_1002971 | Ga0182005_10029715 | 308 |
| 1098 | 3300015265 | Ga0182005_1025465 | Ga0182005_10254652 | 308 |
| 1099 | 3300015265 | Ga0182005_1026233 | Ga0182005_10262331 | 308 |
| 1100 | 3300015265 | Ga0182005_1027509 | Ga0182005_10275092 | 308 |
| 1101 | 3300017792 | Ga0163161_10003398 | Ga0163161_100033989 | 308 |
| 1102 | 3300017792 | Ga0163161_10008626 | Ga0163161_100086262 | 308 |
| 1103 | 3300017792 | Ga0163161_10024842 | Ga0163161_100248425 | 308 |
| 1104 | 3300017792 | Ga0163161_10103618 | Ga0163161_101036182 | 308 |
| 1105 | 3300025207 | Ga0209760_100087 | Ga0209760_10008736 | 308 |
| 1106 | 3300025207 | Ga0209760_100145 | Ga0209760_10014520 | 308 |
| 1107 | 3300025207 | Ga0209760_100173 | Ga0209760_10017319 | 308 |
| 1108 | 3300025231 | Ga0207427_100001 | Ga0207427_1000011234 | 308 |
| 1109 | 3300025231 | Ga0207427_100048 | Ga0207427_10004866 | 308 |
| 1110 | 3300025233 | Ga0209437_100003 | Ga0209437_100003138 | 308 |
| 1111 | 3300025233 | Ga0209437_100094 | Ga0209437_10009466 | 308 |
| 1112 | 3300025261 | Ga0209233_1000007 | Ga0209233_10000071234 | 308 |
| 1113 | 3300025261 | Ga0209233_1000106 | Ga0209233_1000106191 | 308 |
| 1114 | 3300025291 | Ga0209675_1007855 | Ga0209675_10078554 | 308 |
| 1115 | 3300025292 | Ga0209676_1000002 | Ga0209676_100000270 | 308 |
| 1116 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021543 | 308 |
| 1117 | 3300025292 | Ga0209676_1000166 | Ga0209676_1000166100 | 308 |
| 1118 | 3300025292 | Ga0209676_1002655 | Ga0209676_10026556 | 308 |
| 1119 | 3300025298 | Ga0209050_1000009 | Ga0209050_1000009562 | 308 |
| 1120 | 3300025298 | Ga0209050_1000275 | Ga0209050_100027572 | 308 |
| 1121 | 3300025298 | Ga0209050_1000395 | Ga0209050_100039554 | 308 |
| 1122 | 3300025298 | Ga0209050_1002062 | Ga0209050_100206219 | 308 |
| 1123 | 3300025303 | Ga0209051_1000001 | Ga0209051_100000170 | 308 |
| 1124 | 3300025303 | Ga0209051_1000008 | Ga0209051_1000008319 | 308 |
| 1125 | 3300025303 | Ga0209051_1000585 | Ga0209051_100058521 | 308 |
| 1126 | 3300025303 | Ga0209051_1017780 | Ga0209051_10177802 | 308 |
| 1127 | 3300025304 | Ga0209257_1000181 | Ga0209257_100018172 | 308 |
| 1128 | 3300025304 | Ga0209257_1004705 | Ga0209257_100470510 | 308 |
| 1129 | 3300025711 | Ga0207696_1000063 | Ga0207696_100006341 | 308 |
| 1130 | 3300025711 | Ga0207696_1000117 | Ga0207696_100011752 | 308 |
| 1131 | 3300025711 | Ga0207696_1000189 | Ga0207696_10001893 | 308 |
| 1132 | 3300025711 | Ga0207696_1001409 | Ga0207696_10014092 | 308 |
| 1133 | 3300025711 | Ga0207696_1002032 | Ga0207696_100203211 | 308 |
| 1134 | 3300025711 | Ga0207696_1016653 | Ga0207696_10166532 | 308 |
| 1135 | 3300025711 | Ga0207696_1019721 | Ga0207696_10197212 | 308 |
| 1136 | 3300025728 | Ga0207655_1000084 | Ga0207655_100008413 | 308 |
| 1137 | 3300025728 | Ga0207655_1000096 | Ga0207655_1000096163 | 308 |
| 1138 | 3300025728 | Ga0207655_1002510 | Ga0207655_10025104 | 308 |
| 1139 | 3300025728 | Ga0207655_1006033 | Ga0207655_10060333 | 308 |
| 1140 | 3300025728 | Ga0207655_1009237 | Ga0207655_10092375 | 308 |
| 1141 | 3300025728 | Ga0207655_1018628 | Ga0207655_10186282 | 308 |
| 1142 | 3300025728 | Ga0207655_1025497 | Ga0207655_10254975 | 308 |
| 1143 | 3300025728 | Ga0207655_1026231 | Ga0207655_10262312 | 308 |
| 1144 | 3300025735 | Ga0207713_1000160 | Ga0207713_100016078 | 308 |
| 1145 | 3300025735 | Ga0207713_1004279 | Ga0207713_10042792 | 308 |
| 1146 | 3300025735 | Ga0207713_1004302 | Ga0207713_10043023 | 308 |
| 1147 | 3300025735 | Ga0207713_1011927 | Ga0207713_10119275 | 308 |
| 1148 | 3300025735 | Ga0207713_1014256 | Ga0207713_10142562 | 308 |
| 1149 | 3300025735 | Ga0207713_1026762 | Ga0207713_10267622 | 308 |
| 1150 | 3300025735 | Ga0207713_1056881 | Ga0207713_10568812 | 308 |
| 1151 | 3300025925 | Ga0207650_10000554 | Ga0207650_100005543 | 308 |
| 1152 | 3300025933 | Ga0207706_10006938 | Ga0207706_100069387 | 308 |
| 1153 | 3300025935 | Ga0207709_10000045 | Ga0207709_10000045126 | 308 |
| 1154 | 3300025935 | Ga0207709_10000763 | Ga0207709_1000076314 | 308 |
| 1155 | 3300025935 | Ga0207709_10105804 | Ga0207709_101058042 | 308 |
| 1156 | 3300025935 | Ga0207709_10137802 | Ga0207709_101378022 | 308 |
| 1157 | 3300027111 | Ga0209281_1000090 | Ga0209281_100009060 | 308 |
| 1158 | 3300027111 | Ga0209281_1003980 | Ga0209281_10039802 | 308 |
| 1159 | 3300027111 | Ga0209281_1004668 | Ga0209281_10046684 | 308 |
| 1160 | 3300027296 | Ga0209389_1000053 | Ga0209389_100005323 | 308 |
| 1161 | 3300027907 | Ga0207428_10037203 | Ga0207428_100372033 | 308 |
| 1162 | 3300027907 | Ga0207428_10052219 | Ga0207428_100522194 | 308 |
| 1163 | 3300028786 | Ga0307517_10118597 | Ga0307517_101185972 | 308 |
| 1164 | 3300030521 | Ga0307511_10039070 | Ga0307511_100390702 | 308 |
| 1165 | 3300030735 | Ga0316178_1017010 | Ga0316178_101701016 | 308 |
| 1166 | 3300031250 | Ga0265331_10014585 | Ga0265331_100145852 | 308 |
| 1167 | 3300031251 | Ga0265327_10000053 | Ga0265327_10000053207 | 308 |
| 1168 | 3300031548 | Ga0307408_100019822 | Ga0307408_1000198222 | 308 |
| 1169 | 3300031548 | Ga0307408_100145719 | Ga0307408_1001457192 | 308 |
| 1170 | 3300031548 | Ga0307408_100298467 | Ga0307408_1002984672 | 308 |
| 1171 | 3300031731 | Ga0307405_10001157 | Ga0307405_1000115712 | 308 |
| 1172 | 3300031731 | Ga0307405_10006203 | Ga0307405_100062037 | 308 |
| 1173 | 3300031731 | Ga0307405_10175589 | Ga0307405_101755892 | 308 |
| 1174 | 3300031824 | Ga0307413_10062014 | Ga0307413_100620142 | 308 |
| 1175 | 3300031903 | Ga0307407_10028336 | Ga0307407_100283363 | 308 |
| 1176 | 3300031911 | Ga0307412_10001593 | Ga0307412_1000159311 | 308 |
| 1177 | 3300031911 | Ga0307412_10003035 | Ga0307412_1000303511 | 308 |
| 1178 | 3300031911 | Ga0307412_10060637 | Ga0307412_100606372 | 308 |
| 1179 | 3300031995 | Ga0307409_100170447 | Ga0307409_1001704472 | 308 |
| 1180 | 3300032002 | Ga0307416_100202633 | Ga0307416_1002026332 | 308 |
| 1181 | 3300032004 | Ga0307414_10230261 | Ga0307414_102302612 | 308 |
| 1182 | 3300032005 | Ga0307411_10026943 | Ga0307411_100269433 | 308 |
| 1183 | 3300033180 | Ga0307510_10000104 | Ga0307510_1000010461 | 308 |
| 1184 | 3300038705 | Ga0237819_00979 | Ga0237819_00979_3495_4421 | 308 |
| 1185 | 3300041405 | Ga0439438_000140 | Ga0439438_000140_584_1510 | 308 |
| 1186 | 3300041405 | Ga0439438_000238 | Ga0439438_000238_22889_23815 | 308 |
| 1187 | 3300041405 | Ga0439438_000536 | Ga0439438_000536_15012_15938 | 308 |
| 1188 | 3300041405 | Ga0439438_017178 | Ga0439438_017178_1103_2029 | 308 |
| 1189 | 3300041405 | Ga0439438_021007 | Ga0439438_021007_748_1674 | 308 |
| 1190 | 3300041407 | Ga0439447_007219 | Ga0439447_007219_956_1882 | 308 |
| 1191 | 3300041407 | Ga0439447_014766 | Ga0439447_014766_764_1690 | 308 |
| 1192 | 3300041407 | Ga0439447_017056 | Ga0439447_017056_614_1540 | 308 |
| 1193 | 3300041407 | Ga0439447_020436 | Ga0439447_020436_737_1663 | 308 |
| 1194 | 3300041407 | Ga0439447_032263 | Ga0439447_032263_239_1165 | 308 |
| 1195 | 3300041411 | Ga0439466_0004446 | Ga0439466_0004446_4295_5221 | 308 |
| 1196 | 3300041411 | Ga0439466_0016518 | Ga0439466_0016518_1721_2647 | 308 |
| 1197 | 3300041411 | Ga0439466_0017730 | Ga0439466_0017730_450_1376 | 308 |
| 1198 | 3300041411 | Ga0439466_0018010 | Ga0439466_0018010_1071_1997 | 308 |
| 1199 | 3300041411 | Ga0439466_0025348 | Ga0439466_0025348_540_1466 | 308 |
| 1200 | 3300041997 | Ga0439431_0016952 | Ga0439431_0016952_29_955 | 308 |
| 1201 | 3300042006 | Ga0439432_000623 | Ga0439432_000623_575_1501 | 308 |
| 1202 | 3300042006 | Ga0439432_000869 | Ga0439432_000869_94_1020 | 308 |
| 1203 | 3300042006 | Ga0439432_005883 | Ga0439432_005883_2399_3325 | 308 |
| 1204 | 3300042006 | Ga0439432_021203 | Ga0439432_021203_965_1891 | 308 |
| 1205 | 3300042009 | Ga0439451_010390 | Ga0439451_010390_553_1479 | 308 |
| 1206 | 3300042010 | Ga0439452_000060 | Ga0439452_000060_99985_100911 | 308 |
| 1207 | 3300042010 | Ga0439452_000219 | Ga0439452_000219_770_1696 | 308 |
| 1208 | 3300042010 | Ga0439452_001457 | Ga0439452_001457_632_1558 | 308 |
| 1209 | 3300042010 | Ga0439452_008660 | Ga0439452_008660_1175_2101 | 308 |
| 1210 | 3300042010 | Ga0439452_011379 | Ga0439452_011379_1224_2150 | 308 |
| 1211 | 3300042010 | Ga0439452_012550 | Ga0439452_012550_258_1184 | 308 |
| 1212 | 3300042016 | Ga0439463_000309 | Ga0439463_000309_12289_13215 | 308 |
| 1213 | 3300042115 | Ga0450911_000709 | Ga0450911_000709_584_1510 | 308 |
| 1214 | 3300042115 | Ga0450911_002407 | Ga0450911_002407_424_1350 | 308 |
| 1215 | 3300042138 | Ga0450903_011547 | Ga0450903_011547_15_941 | 308 |
| 1216 | 3300042142 | Ga0450905_002733 | Ga0450905_002733_1224_2150 | 308 |
| 1217 | 3300042145 | Ga0450906_007312 | Ga0450906_007312_726_1652 | 308 |
| 1218 | 3300042146 | Ga0450907_000766 | Ga0450907_000766_1356_2282 | 308 |
| 1219 | 3300042146 | Ga0450907_008386 | Ga0450907_008386_683_1609 | 308 |
| 1220 | 3300042147 | Ga0450910_004807 | Ga0450910_004807_212_1138 | 308 |
| 1221 | 3300042185 | Ga0450909_006525 | Ga0450909_006525_536_1462 | 308 |
| 1222 | 3300042435 | Ga0439434_0000337 | Ga0439434_0000337_7354_8280 | 308 |
| 1223 | 3300042435 | Ga0439434_0027969 | Ga0439434_0027969_343_1269 | 308 |
| 1224 | 3300042439 | Ga0439464_0014229 | Ga0439464_0014229_902_1828 | 308 |
| 1225 | 3300042461 | Ga0439460_0011211 | Ga0439460_0011211_1136_2062 | 308 |
| 1226 | 3300046452 | Ga0495617_000193 | Ga0495617_000193_36440_37366 | 308 |
| 1227 | 3300046452 | Ga0495617_000325 | Ga0495617_000325_584_1510 | 308 |
| 1228 | 3300046452 | Ga0495617_009601 | Ga0495617_009601_1885_2811 | 308 |
| 1229 | 3300046453 | Ga0495627_000613 | Ga0495627_000613_588_1514 | 308 |
| 1230 | 3300046453 | Ga0495627_033959 | Ga0495627_033959_92_1018 | 308 |
| 1231 | 3300046457 | Ga0495590_0002159 | Ga0495590_0002159_6647_7573 | 308 |
| 1232 | 3300046457 | Ga0495590_0002522 | Ga0495590_0002522_636_1562 | 308 |
| 1233 | 3300046457 | Ga0495590_0027608 | Ga0495590_0027608_471_1397 | 308 |
| 1234 | 3300046458 | Ga0495591_000278 | Ga0495591_000278_1623_2549 | 308 |
| 1235 | 3300046458 | Ga0495591_008336 | Ga0495591_008336_2648_3574 | 308 |
| 1236 | 3300046458 | Ga0495591_011171 | Ga0495591_011171_603_1529 | 308 |
| 1237 | 3300046459 | Ga0495629_0173339 | Ga0495629_0173339_447_1373 | 308 |
| 1238 | 3300046460 | Ga0495638_0007742 | Ga0495638_0007742_1549_2475 | 308 |
| 1239 | 3300046460 | Ga0495638_0011238 | Ga0495638_0011238_668_1594 | 308 |
| 1240 | 3300046460 | Ga0495638_0061557 | Ga0495638_0061557_567_1493 | 308 |
| 1241 | 3300046460 | Ga0495638_0115027 | Ga0495638_0115027_143_1069 | 308 |
| 1242 | 3300046463 | Ga0495653_0001136 | Ga0495653_0001136_599_1525 | 308 |
| 1243 | 3300046463 | Ga0495653_0007921 | Ga0495653_0007921_657_1583 | 308 |
| 1244 | 3300046463 | Ga0495653_0080412 | Ga0495653_0080412_405_1331 | 308 |
| 1245 | 3300046471 | Ga0495650_0008259 | Ga0495650_0008259_4498_5424 | 308 |
| 1246 | 3300046471 | Ga0495650_0049791 | Ga0495650_0049791_497_1423 | 308 |
| 1247 | 3300046474 | Ga0495605_0001770 | Ga0495605_0001770_12684_13610 | 308 |
| 1248 | 3300046474 | Ga0495605_0003753 | Ga0495605_0003753_7519_8445 | 308 |
| 1249 | 3300046474 | Ga0495605_0027852 | Ga0495605_0027852_663_1589 | 308 |
| 1250 | 3300046474 | Ga0495605_0071274 | Ga0495605_0071274_671_1597 | 308 |
| 1251 | 3300046475 | Ga0495639_0000062 | Ga0495639_0000062_639_1565 | 308 |
| 1252 | 3300046475 | Ga0495639_0013816 | Ga0495639_0013816_2347_3273 | 308 |
| 1253 | 3300046491 | Ga0495584_0001224 | Ga0495584_0001224_13966_14892 | 308 |
| 1254 | 3300046491 | Ga0495584_0001546 | Ga0495584_0001546_515_1441 | 308 |
| 1255 | 3300046491 | Ga0495584_0008642 | Ga0495584_0008642_3647_4573 | 308 |
| 1256 | 3300046491 | Ga0495584_0027786 | Ga0495584_0027786_690_1616 | 308 |
| 1257 | 3300046491 | Ga0495584_0041131 | Ga0495584_0041131_859_1785 | 308 |
| 1258 | 3300046491 | Ga0495584_0061753 | Ga0495584_0061753_639_1565 | 308 |
| 1259 | 3300046492 | Ga0495585_0001213 | Ga0495585_0001213_18951_19877 | 308 |
| 1260 | 3300046492 | Ga0495585_0002545 | Ga0495585_0002545_1434_2360 | 308 |
| 1261 | 3300046492 | Ga0495585_0068615 | Ga0495585_0068615_373_1299 | 308 |
| 1262 | 3300046499 | Ga0495594_0067487 | Ga0495594_0067487_228_1154 | 308 |
| 1263 | 3300046499 | Ga0495594_0067773 | Ga0495594_0067773_688_1614 | 308 |
| 1264 | 3300046500 | Ga0495596_0000105 | Ga0495596_0000105_11070_11996 | 308 |
| 1265 | 3300046500 | Ga0495596_0047895 | Ga0495596_0047895_558_1484 | 308 |
| 1266 | 3300046501 | Ga0495607_0000875 | Ga0495607_0000875_687_1613 | 308 |
| 1267 | 3300046501 | Ga0495607_0001466 | Ga0495607_0001466_18285_19214 | 308 |
| 1268 | 3300046501 | Ga0495607_0004879 | Ga0495607_0004879_8189_9115 | 308 |
| 1269 | 3300046501 | Ga0495607_0077051 | Ga0495607_0077051_68_994 | 308 |
| 1270 | 3300046501 | Ga0495607_0103725 | Ga0495607_0103725_533_1459 | 308 |
| 1271 | 3300046506 | Ga0495583_0019169 | Ga0495583_0019169_2104_3030 | 308 |
| 1272 | 3300046507 | Ga0495606_0000502 | Ga0495606_0000502_8957_9883 | 308 |
| 1273 | 3300046507 | Ga0495606_0003916 | Ga0495606_0003916_594_1520 | 308 |
| 1274 | 3300046507 | Ga0495606_0023741 | Ga0495606_0023741_587_1513 | 308 |
| 1275 | 3300046507 | Ga0495606_0085022 | Ga0495606_0085022_471_1397 | 308 |
| 1276 | 3300046512 | Ga0495610_0004919 | Ga0495610_0004919_552_1478 | 308 |
| 1277 | 3300046512 | Ga0495610_0016704 | Ga0495610_0016704_503_1429 | 308 |
| 1278 | 3300046512 | Ga0495610_0060530 | Ga0495610_0060530_505_1431 | 308 |
| 1279 | 3300046512 | Ga0495610_0074855 | Ga0495610_0074855_540_1466 | 308 |
| 1280 | 3300046513 | Ga0495616_0000487 | Ga0495616_0000487_477_1403 | 308 |
| 1281 | 3300046513 | Ga0495616_0002116 | Ga0495616_0002116_671_1597 | 308 |
| 1282 | 3300046513 | Ga0495616_0003865 | Ga0495616_0003865_8016_8942 | 308 |
| 1283 | 3300046513 | Ga0495616_0014977 | Ga0495616_0014977_2803_3729 | 308 |
| 1284 | 3300046513 | Ga0495616_0064057 | Ga0495616_0064057_658_1584 | 308 |
| 1285 | 3300046518 | Ga0495631_0000169 | Ga0495631_0000169_1286_2212 | 308 |
| 1286 | 3300046518 | Ga0495631_0002840 | Ga0495631_0002840_599_1525 | 308 |
| 1287 | 3300046518 | Ga0495631_0028721 | Ga0495631_0028721_1257_2183 | 308 |
| 1288 | 3300046519 | Ga0495632_0009783 | Ga0495632_0009783_557_1483 | 308 |
| 1289 | 3300046519 | Ga0495632_0016901 | Ga0495632_0016901_2452_3378 | 308 |
| 1290 | 3300046519 | Ga0495632_0046515 | Ga0495632_0046515_1193_2119 | 308 |
| 1291 | 3300046519 | Ga0495632_0071760 | Ga0495632_0071760_690_1616 | 308 |
| 1292 | 3300046520 | Ga0495637_0000168 | Ga0495637_0000168_1605_2531 | 308 |
| 1293 | 3300046520 | Ga0495637_0000981 | Ga0495637_0000981_17081_18007 | 308 |
| 1294 | 3300046520 | Ga0495637_0011453 | Ga0495637_0011453_2766_3692 | 308 |
| 1295 | 3300046520 | Ga0495637_0032175 | Ga0495637_0032175_755_1681 | 308 |
| 1296 | 3300046520 | Ga0495637_0049581 | Ga0495637_0049581_232_1158 | 308 |
| 1297 | 3300046520 | Ga0495637_0053019 | Ga0495637_0053019_290_1216 | 308 |
| 1298 | 3300046520 | Ga0495637_0061684 | Ga0495637_0061684_551_1477 | 308 |
| 1299 | 3300046522 | Ga0495643_0013254 | Ga0495643_0013254_2167_3093 | 308 |
| 1300 | 3300046522 | Ga0495643_0013745 | Ga0495643_0013745_2067_2993 | 308 |
| 1301 | 3300046522 | Ga0495643_0131405 | Ga0495643_0131405_284_1210 | 308 |
| 1302 | 3300046523 | Ga0495644_0003642 | Ga0495644_0003642_4519_5445 | 308 |
| 1303 | 3300046523 | Ga0495644_0033380 | Ga0495644_0033380_573_1499 | 308 |
| 1304 | 3300046524 | Ga0495648_0006890 | Ga0495648_0006890_458_1384 | 308 |
| 1305 | 3300046524 | Ga0495648_0029550 | Ga0495648_0029550_607_1533 | 308 |
| 1306 | 3300046524 | Ga0495648_0042119 | Ga0495648_0042119_564_1490 | 308 |
| 1307 | 3300046526 | Ga0495666_0032046 | Ga0495666_0032046_608_1534 | 308 |
| 1308 | 3300046526 | Ga0495666_0033658 | Ga0495666_0033658_885_1811 | 308 |
| 1309 | 3300046528 | Ga0495642_0000062 | Ga0495642_0000062_743_1669 | 308 |
| 1310 | 3300046528 | Ga0495642_0001560 | Ga0495642_0001560_643_1569 | 308 |
| 1311 | 3300046528 | Ga0495642_0025481 | Ga0495642_0025481_857_1783 | 308 |
| 1312 | 3300046530 | Ga0495654_0020294 | Ga0495654_0020294_343_1269 | 308 |
| 1313 | 3300046530 | Ga0495654_0025617 | Ga0495654_0025617_1586_2512 | 308 |
| 1314 | 3300046530 | Ga0495654_0033855 | Ga0495654_0033855_987_1913 | 308 |
| 1315 | 3300046530 | Ga0495654_0071668 | Ga0495654_0071668_327_1253 | 308 |
| 1316 | 3300046535 | Ga0495586_0076449 | Ga0495586_0076449_676_1602 | 308 |
| 1317 | 3300046536 | Ga0495587_0001642 | Ga0495587_0001642_61_987 | 308 |
| 1318 | 3300046536 | Ga0495587_0015863 | Ga0495587_0015863_340_1266 | 308 |
| 1319 | 3300046538 | Ga0495609_0000260 | Ga0495609_0000260_1496_2422 | 308 |
| 1320 | 3300046538 | Ga0495609_0000336 | Ga0495609_0000336_14_940 | 308 |
| 1321 | 3300046538 | Ga0495609_0017053 | Ga0495609_0017053_573_1499 | 308 |
| 1322 | 3300046542 | Ga0495597_0003574 | Ga0495597_0003574_706_1632 | 308 |
| 1323 | 3300046542 | Ga0495597_0003775 | Ga0495597_0003775_7632_8558 | 308 |
| 1324 | 3300046542 | Ga0495597_0043125 | Ga0495597_0043125_439_1365 | 308 |
| 1325 | 3300046542 | Ga0495597_0055104 | Ga0495597_0055104_255_1181 | 308 |
| 1326 | 3300046557 | Ga0495622_0000192 | Ga0495622_0000192_45072_45998 | 308 |
| 1327 | 3300046557 | Ga0495622_0002134 | Ga0495622_0002134_564_1490 | 308 |
| 1328 | 3300046557 | Ga0495622_0009461 | Ga0495622_0009461_822_1748 | 308 |
| 1329 | 3300046557 | Ga0495622_0029287 | Ga0495622_0029287_1041_1967 | 308 |
| 1330 | 3300046558 | Ga0495633_0001006 | Ga0495633_0001006_1066_1992 | 308 |
| 1331 | 3300046615 | Ga0495656_0000504 | Ga0495656_0000504_11329_12255 | 308 |
| 1332 | 3300046616 | Ga0495668_0001623 | Ga0495668_0001623_19945_20871 | 308 |
| 1333 | 3300046642 | Ga0495634_0000980 | Ga0495634_0000980_25437_26363 | 308 |
| 1334 | 3300046648 | Ga0495611_0001896 | Ga0495611_0001896_573_1499 | 308 |
| 1335 | 3300046660 | Ga0495625_0001361 | Ga0495625_0001361_512_1438 | 308 |
| 1336 | 3300046660 | Ga0495625_0035983 | Ga0495625_0035983_614_1540 | 308 |
| 1337 | 3300046660 | Ga0495625_0111932 | Ga0495625_0111932_564_1490 | 308 |
| 1338 | 3300046660 | Ga0495625_0142754 | Ga0495625_0142754_435_1361 | 308 |
| 1339 | 3300046660 | Ga0495625_0207997 | Ga0495625_0207997_227_1153 | 308 |
| 1340 | 3300046663 | Ga0495635_0000093 | Ga0495635_0000093_469_1395 | 308 |
| 1341 | 3300046663 | Ga0495635_0029676 | Ga0495635_0029676_196_1122 | 308 |
| 1342 | 3300046664 | Ga0495659_0014355 | Ga0495659_0014355_1088_2014 | 308 |
| 1343 | 3300046665 | Ga0495661_0005121 | Ga0495661_0005121_531_1457 | 308 |
| 1344 | 3300046665 | Ga0495661_0013957 | Ga0495661_0013957_3961_4887 | 308 |
| 1345 | 3300046665 | Ga0495661_0020641 | Ga0495661_0020641_2880_3806 | 308 |
| 1346 | 3300046674 | Ga0495588_0002514 | Ga0495588_0002514_6237_7163 | 308 |
| 1347 | 3300046679 | Ga0495623_0016238 | Ga0495623_0016238_3647_4573 | 308 |
| 1348 | 3300046680 | Ga0495646_0007921 | Ga0495646_0007921_1456_2382 | 308 |
| 1349 | 3300046680 | Ga0495646_0010893 | Ga0495646_0010893_608_1534 | 308 |
| 1350 | 3300046684 | Ga0495669_0000226 | Ga0495669_0000226_31378_32304 | 308 |
| 1351 | 3300046690 | Ga0495624_0000155 | Ga0495624_0000155_626_1552 | 308 |
| 1352 | 3300046691 | Ga0495670_0005481 | Ga0495670_0005481_4907_5833 | 308 |
| 1353 | 3300046691 | Ga0495670_0056117 | Ga0495670_0056117_480_1406 | 308 |
| 1354 | 3300046692 | Ga0495671_0000259 | Ga0495671_0000259_810_1736 | 308 |
| 1355 | 3300046692 | Ga0495671_0003705 | Ga0495671_0003705_6821_7747 | 308 |
| 1356 | 3300046692 | Ga0495671_0004771 | Ga0495671_0004771_6510_7436 | 308 |
| 1357 | 3300046692 | Ga0495671_0025190 | Ga0495671_0025190_1906_2832 | 308 |
| 1358 | 3300046692 | Ga0495671_0028106 | Ga0495671_0028106_540_1466 | 308 |
| 1359 | 3300046692 | Ga0495671_0055896 | Ga0495671_0055896_790_1716 | 308 |
| 1360 | 3300046692 | Ga0495671_0070390 | Ga0495671_0070390_222_1148 | 308 |
| 1361 | 3300046694 | Ga0495649_0001079 | Ga0495649_0001079_8999_9925 | 308 |
| 1362 | 3300046694 | Ga0495649_0018440 | Ga0495649_0018440_674_1600 | 308 |
| 1363 | 3300046694 | Ga0495649_0025858 | Ga0495649_0025858_1812_2738 | 308 |
| 1364 | 3300046694 | Ga0495649_0062229 | Ga0495649_0062229_442_1368 | 308 |
| 1365 | 3300046694 | Ga0495649_0094706 | Ga0495649_0094706_270_1196 | 308 |
| 1366 | 3300046694 | Ga0495649_0149677 | Ga0495649_0149677_95_1021 | 308 |
| 1367 | 3300046794 | Ga0495589_0000221 | Ga0495589_0000221_47187_48113 | 308 |
| 1368 | 3300046794 | Ga0495589_0000617 | Ga0495589_0000617_575_1501 | 308 |
| 1369 | 3300046794 | Ga0495589_0003225 | Ga0495589_0003225_5827_6753 | 308 |
| 1370 | 3300046794 | Ga0495589_0030524 | Ga0495589_0030524_1496_2422 | 308 |
| 1371 | 3300046809 | Ga0495600_0102868 | Ga0495600_0102868_742_1668 | 308 |
| 1372 | 3300046810 | Ga0495660_0089289 | Ga0495660_0089289_612_1538 | 308 |
| 1373 | 3300047315 | Ga0495581_0105851 | Ga0495581_0105851_466_1392 | 308 |
| 1374 | 3300047317 | Ga0495604_0012379 | Ga0495604_0012379_4726_5652 | 308 |
| 1375 | 3300047318 | Ga0495636_0000040 | Ga0495636_0000040_54280_55206 | 308 |
| 1376 | 3300047319 | Ga0495674_0057866 | Ga0495674_0057866_617_1543 | 308 |
| 1377 | 3300047320 | Ga0495672_0001781 | Ga0495672_0001781_596_1522 | 308 |
| 1378 | 3300047320 | Ga0495672_0011396 | Ga0495672_0011396_5037_5963 | 308 |
| 1379 | 3300047320 | Ga0495672_0016551 | Ga0495672_0016551_331_1257 | 308 |
| 1380 | 3300047320 | Ga0495672_0024492 | Ga0495672_0024492_2497_3423 | 308 |
| 1381 | 3300047320 | Ga0495672_0037237 | Ga0495672_0037237_1069_1995 | 308 |
| 1382 | 3300047322 | Ga0495680_0010142 | Ga0495680_0010142_563_1489 | 308 |
| 1383 | 3300047322 | Ga0495680_0011543 | Ga0495680_0011543_2001_2927 | 308 |
| 1384 | 3300047322 | Ga0495680_0061258 | Ga0495680_0061258_1396_2322 | 308 |
| 1385 | 3300047323 | Ga0495683_0000281 | Ga0495683_0000281_559_1485 | 308 |
| 1386 | 3300047323 | Ga0495683_0021476 | Ga0495683_0021476_1755_2681 | 308 |
| 1387 | 3300047323 | Ga0495683_0034957 | Ga0495683_0034957_1351_2277 | 308 |
| 1388 | 3300047323 | Ga0495683_0136651 | Ga0495683_0136651_140_1066 | 308 |
| 1389 | 3300047443 | Ga0495687_000469 | Ga0495687_000469_46963_47889 | 308 |
| 1390 | 3300047443 | Ga0495687_000778 | Ga0495687_000778_32803_33729 | 308 |
| 1391 | 3300047443 | Ga0495687_002429 | Ga0495687_002429_569_1495 | 308 |
| 1392 | 3300047444 | Ga0495675_0029015 | Ga0495675_0029015_1468_2394 | 308 |
| 1393 | 3300047444 | Ga0495675_0085775 | Ga0495675_0085775_742_1668 | 308 |
| 1394 | 3300047445 | Ga0495677_0006008 | Ga0495677_0006008_659_1585 | 308 |
| 1395 | 3300047446 | Ga0495679_004274 | Ga0495679_004274_259_1185 | 308 |
| 1396 | 3300047446 | Ga0495679_004623 | Ga0495679_004623_577_1503 | 308 |
| 1397 | 3300047447 | Ga0495685_012178 | Ga0495685_012178_1575_2501 | 308 |
| 1398 | 3300047469 | Ga0495673_0000686 | Ga0495673_0000686_680_1606 | 308 |
| 1399 | 3300047469 | Ga0495673_0000788 | Ga0495673_0000788_1014_1940 | 308 |
| 1400 | 3300047469 | Ga0495673_0004150 | Ga0495673_0004150_7649_8575 | 308 |
| 1401 | 3300047469 | Ga0495673_0043763 | Ga0495673_0043763_605_1531 | 308 |
| 1402 | 3300047469 | Ga0495673_0053781 | Ga0495673_0053781_440_1366 | 308 |
| 1403 | 3300047470 | Ga0495681_0004349 | Ga0495681_0004349_592_1518 | 308 |
| 1404 | 3300047470 | Ga0495681_0005920 | Ga0495681_0005920_6540_7466 | 308 |
| 1405 | 3300047470 | Ga0495681_0009043 | Ga0495681_0009043_4052_4978 | 308 |
| 1406 | 3300047470 | Ga0495681_0022117 | Ga0495681_0022117_2023_2949 | 308 |
| 1407 | 3300047470 | Ga0495681_0022644 | Ga0495681_0022644_371_1297 | 308 |
| 1408 | 3300047470 | Ga0495681_0032312 | Ga0495681_0032312_591_1517 | 308 |
| 1409 | 3300047470 | Ga0495681_0043667 | Ga0495681_0043667_694_1620 | 308 |
| 1410 | 3300047470 | Ga0495681_0056625 | Ga0495681_0056625_377_1303 | 308 |
| 1411 | 3300047470 | Ga0495681_0062240 | Ga0495681_0062240_603_1529 | 308 |
| 1412 | 3300047470 | Ga0495681_0070287 | Ga0495681_0070287_558_1484 | 308 |
| 1413 | 3300047471 | Ga0495684_0018999 | Ga0495684_0018999_397_1323 | 308 |
| 1414 | 3300047472 | Ga0495686_0044409 | Ga0495686_0044409_466_1392 | 308 |
| 1415 | 3300047673 | Ga0495593_0022607 | Ga0495593_0022607_2515_3441 | 308 |
| 1416 | 3300048091 | Ga0495626_0000302 | Ga0495626_0000302_1635_2561 | 308 |
| 1417 | 3300048091 | Ga0495626_0000469 | Ga0495626_0000469_97_1023 | 308 |
| 1418 | 3300048091 | Ga0495626_0000579 | Ga0495626_0000579_34756_35682 | 308 |
| 1419 | 3300048091 | Ga0495626_0002795 | Ga0495626_0002795_380_1306 | 308 |
| 1420 | 3300048091 | Ga0495626_0006768 | Ga0495626_0006768_556_1482 | 308 |
| 1421 | 3300048091 | Ga0495626_0025732 | Ga0495626_0025732_759_1685 | 308 |
| 1422 | 3300048091 | Ga0495626_0058032 | Ga0495626_0058032_623_1549 | 308 |
| 1423 | 3300048905 | Ga0496102_0000781 | Ga0496102_0000781_617_1543 | 308 |
| 1424 | 3300048906 | Ga0496103_0062817 | Ga0496103_0062817_513_1439 | 308 |
| 1425 | 3300048907 | Ga0496104_0439975 | Ga0496104_0439975_212_1138 | 308 |
| 1426 | 3300048917 | Ga0496114_0022077 | Ga0496114_0022077_2721_3647 | 308 |
| 1427 | 3300048918 | Ga0496115_0090249 | Ga0496115_0090249_544_1470 | 308 |
| 1428 | 3300048919 | Ga0496116_0000574 | Ga0496116_0000574_30978_31904 | 308 |
| 1429 | 3300048919 | Ga0496116_0002461 | Ga0496116_0002461_639_1565 | 308 |
| 1430 | 3300048920 | Ga0496117_0004436 | Ga0496117_0004436_3855_4781 | 308 |
| 1431 | 3300048920 | Ga0496117_0006695 | Ga0496117_0006695_639_1565 | 308 |
| 1432 | 3300048920 | Ga0496117_0123053 | Ga0496117_0123053_549_1475 | 308 |
| 1433 | 3300048920 | Ga0496117_0127791 | Ga0496117_0127791_504_1430 | 308 |
| 1434 | 3300048920 | Ga0496117_0139260 | Ga0496117_0139260_92_1018 | 308 |
| 1435 | 3300048921 | Ga0496118_0019224 | Ga0496118_0019224_521_1447 | 308 |
| 1436 | 3300048921 | Ga0496118_0050528 | Ga0496118_0050528_870_1796 | 308 |
| 1437 | 3300048921 | Ga0496118_0091542 | Ga0496118_0091542_465_1391 | 308 |
| 1438 | 3300048922 | Ga0496119_0000086 | Ga0496119_0000086_111282_112208 | 308 |
| 1439 | 3300048923 | Ga0496120_0000130 | Ga0496120_0000130_119972_120898 | 308 |
| 1440 | 3300048924 | Ga0496121_0000299 | Ga0496121_0000299_12720_13646 | 308 |
| 1441 | 3300048924 | Ga0496121_0007020 | Ga0496121_0007020_12117_13043 | 308 |
| 1442 | 3300048924 | Ga0496121_0072537 | Ga0496121_0072537_1321_2247 | 308 |
| 1443 | 3300048925 | Ga0496122_0014085 | Ga0496122_0014085_543_1469 | 308 |
| 1444 | 3300048925 | Ga0496122_0077106 | Ga0496122_0077106_467_1393 | 308 |
| 1445 | 3300048926 | Ga0496123_0003302 | Ga0496123_0003302_4822_5748 | 308 |
| 1446 | 3300048926 | Ga0496123_0011307 | Ga0496123_0011307_546_1472 | 308 |
| 1447 | 3300048927 | Ga0496124_0003235 | Ga0496124_0003235_2368_3324 | 308 |
| 1448 | 3300048927 | Ga0496124_0139543 | Ga0496124_0139543_274_1200 | 308 |
| 1449 | 3300048928 | Ga0496125_0013982 | Ga0496125_0013982_586_1512 | 308 |
| 1450 | 3300048929 | Ga0496126_0017795 | Ga0496126_0017795_4712_5638 | 308 |
| 1451 | 3300048929 | Ga0496126_0117729 | Ga0496126_0117729_57_983 | 308 |
| 1452 | 3300049459 | Ga0495678_003761 | Ga0495678_003761_591_1517 | 308 |
| 1453 | 3300049459 | Ga0495678_017048 | Ga0495678_017048_1810_2736 | 308 |
| 1454 | 3300049459 | Ga0495678_023802 | Ga0495678_023802_563_1489 | 308 |
| 1455 | 3300049459 | Ga0495678_041097 | Ga0495678_041097_472_1398 | 308 |
| 1456 | 3300049459 | Ga0495678_047329 | Ga0495678_047329_266_1192 | 308 |
| 1457 | 3300049459 | Ga0495678_049803 | Ga0495678_049803_659_1585 | 308 |
| 1458 | 3300049460 | Ga0495682_0000492 | Ga0495682_0000492_5287_6213 | 308 |
| 1459 | 3300049571 | Ga0501034_0000200 | Ga0501034_0000200_58591_59517 | 308 |
| 1460 | 3300049758 | Ga0501241_001640 | Ga0501241_001640_608_1534 | 308 |
| 1461 | 3300050491 | nmdc:mga00v17_186920_c1 | nmdc:mga00v17_186920_c1_210_1136 | 308 |
| 1462 | 3300053087 | Ga0500643_006973 | Ga0500643_006973_3040_3996 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e1d-assembly1.cif.gz_A | crystal structure of mouse transaldolase | 0.9786 | 3 | 292 |
| 1f05-assembly1.cif.gz_B | crystal structure of human transaldolase | 0.9764 | 1 | 295 |
| 4s2c-assembly1.cif.gz_B | covalent complex of e. coli transaldolase talb with fructose-6-phosphate | 0.9727 | 2 | 296 |
| 1onr-assembly2.cif.gz_B | structure of transaldolase b | 0.9707 | 2 | 296 |
| 1i2r-assembly1.cif.gz_B | crystal structure of escherichia coli transaldolase b mutant s176a | 0.9706 | 2 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37837_1_337_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9838 | 1 | 293 | 3.20.20.70 |
| af_P37837_1_337_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9707 | 1 | 293 | 3.20.20.70 |
| af_A0A1L1QZF2_1_286_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9637 | 1 | 250 | 3.20.20.70 |
| 3tk7A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9479 | 1 | 296 | 3.20.20.70 |
| 3tk7A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9448 | 1 | 296 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A376U723-F1-model_v4 | Transaldolase A (EC 2.2.1.2) | 1.006 | 66 | 152 |
GO:0004801
GO:0005829 GO:0005975 |
| AF-A0A377ZDL5-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 1.005 | 66 | 152 |
GO:0004801
GO:0005829 GO:0005975 |
| AF-A0A376U1G8-F1-model_v4 | Transaldolase B (EC 2.2.1.2) | 1.003 | 80 | 160 |
GO:0004801
GO:0005829 GO:0005975 GO:0006098 |
| AF-A0A376KQD6-F1-model_v4 | Transaldolase A (EC 2.2.1.2) | 1.001 | 70 | 141 |
GO:0004801
GO:0005829 GO:0005975 |
| AF-A0A7S2K7L2-F1-model_v4 | Transaldolase (EC 2.2.1.2) | 0.9998 | 71 | 177 |
GO:0005975
GO:0006098 GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar