F494138

General Info

Members Datasets Scaffolds Average Seq Length
1462 680 1056 311

Family's Representative Sequence

Representative Sequence 3300046458|Ga0495591_008225|Ga0495591_008225_1416_2519
Length 358
Sequence MHPRPNAKIRHAAHADGRRASQLFAQTQASKSVRGLPFTPLSDRRRSGNVIKPTGQSTLMTSKLEQLKKFTTVVADTGDFAAIEKLKPVDATTNPSLLLKAASSDSNADRLKEAFSGANNDIGLASDRFAVAIGQEILKVVPGRVSTEVDARISFDTNACIERAERLVELYDKAGIGRDRILIKLASTWEGIRAAEQLEKKGIQCNLTLLFSFAQAQACADAGVFLISPFVGRIYDWYKKAEGKDYVGAEDPGVKSVTDYKTVVMGASFRNLSQIEELAGCDRLTISPDLLHKLSEDTGTLVQKLKPGNGGEPRQTLNESQFRWASNEDAMATEKLAEGIRQFARDQEKLEALLSAKV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
6 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231006 Pseudomonas sp. GM17 Isolate Nodule
10 2511231007 Pseudomonas sp. GM18 Isolate Nodule
11 2511231008 Pseudomonas sp. GM21 Isolate Nodule
12 2511231010 Pseudomonas sp. GM25 Isolate Nodule
13 2511231011 Pseudomonas sp. GM30 Isolate Nodule
14 2511231012 Pseudomonas sp. GM33 Isolate Nodule
15 2511231014 Pseudomonas sp. GM48 Isolate Nodule
16 2511231015 Pseudomonas sp. GM49 Isolate Nodule
17 2511231016 Pseudomonas sp. GM50 Isolate Nodule
18 2511231017 Pseudomonas sp. GM55 Isolate Nodule
19 2511231018 Pseudomonas sp. GM60 Isolate Nodule
20 2511231019 Pseudomonas sp. GM67 Isolate Nodule
21 2511231020 Pseudomonas sp. GM74 Isolate Nodule
22 2511231021 Pseudomonas sp. GM78 Isolate Nodule
23 2511231022 Pseudomonas sp. GM79 Isolate Nodule
24 2511231023 Pseudomonas sp. GM80 Isolate Nodule
25 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
26 2511231031 Pseudomonas sp. GM16 Isolate Nodule
27 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
28 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
29 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
30 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
31 2547132181 Kosakonia sacchari SP1 Isolate Stem
32 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
33 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
34 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
35 2561511199 Enterobacter sp. R4-368 Isolate Nodule
36 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
37 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
38 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
39 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
40 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
41 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
42 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
43 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
44 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
45 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
46 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
47 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
48 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
49 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
50 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
51 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
52 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
53 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
54 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
55 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
56 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
57 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
58 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
59 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
60 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
61 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
62 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
63 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
64 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
65 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
66 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
67 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
68 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
69 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
70 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
71 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
72 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
73 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
74 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
75 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
76 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
77 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
78 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
79 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
80 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
81 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
82 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
83 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
84 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
85 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
86 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
87 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
88 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
89 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
90 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
91 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
92 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
93 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
94 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
95 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
96 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
97 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
98 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
99 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
100 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
101 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
102 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
103 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
104 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
105 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
106 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
107 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
108 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
109 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
110 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
111 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
112 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
113 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
114 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
115 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
116 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
117 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
118 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
119 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
120 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
121 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
122 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
123 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
124 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
125 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
126 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
127 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
128 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
129 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
130 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
131 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
132 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
133 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
134 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
135 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
136 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
137 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
138 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
139 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
140 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
141 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
142 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
143 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
144 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
145 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
146 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
147 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
148 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
149 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
150 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
151 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
152 2636415599 Klebsiella variicola DX120E Isolate Unclassified
153 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
154 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
155 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
156 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
157 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
158 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
159 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
160 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
161 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
162 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
163 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
164 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
165 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
166 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
167 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
168 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
169 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
170 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
171 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
172 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
173 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
174 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
175 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
176 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
177 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
178 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
179 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
180 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
181 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
182 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
183 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
184 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
185 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
186 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
187 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
188 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
189 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
190 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
191 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
192 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
193 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
194 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
195 2751185917 Enterobacter sp. HK169 Isolate Unclassified
196 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
197 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
198 2773857670 Pseudomonas sp. 478 Isolate Unclassified
199 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
200 2773857673 Pseudomonas sp. 443 Isolate Unclassified
201 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
202 2775507074 Klebsiella sp. D5A Isolate Unclassified
203 2784132063 Pseudomonas sp. 424 Isolate Unclassified
204 2784132072 Pseudomonas sp. 460 Isolate Unclassified
205 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
206 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
207 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
208 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
209 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
210 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
211 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
212 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
213 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
214 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
215 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
216 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
217 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
218 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
219 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
220 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
221 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
222 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
223 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
224 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
225 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
226 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
227 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
228 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
229 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
230 2821118458 Enterobacter asburiae 609 Isolate Unclassified
231 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
232 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
233 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
234 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
235 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
236 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
237 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
238 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
239 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
240 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
241 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
242 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
243 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
244 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
245 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
246 2847085930 Erwinia persicina B64 Isolate Bulb
247 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
248 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
249 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
250 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
251 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
252 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
253 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
254 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
255 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
256 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
257 2865014394 Pantoea sp. R-71966 Isolate Unclassified
258 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
259 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
260 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
261 2876601092 Pantoea endophytica 596 Isolate Unclassified
262 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
263 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
264 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
265 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
266 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
267 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
268 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
269 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
270 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
271 2904504865 Serratia marcescens 1822 Isolate Unclassified
272 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
273 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
274 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
275 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
276 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
277 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
278 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
279 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
280 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
281 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
282 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
283 2919150387 Rahnella aceris 1817 Isolate Unclassified
284 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
285 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
286 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
287 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
288 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
289 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
290 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
291 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
292 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
293 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
294 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
295 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
296 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
297 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
298 2927143783 Rahnella sp. 2050 Isolate Unclassified
299 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
300 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
301 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
302 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
303 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
304 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
305 2932406140 Serratia sp. 2723 Isolate Rhizosphere
306 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
307 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
308 2937539931 Pantoea sp. LS15 Isolate Unclassified
309 2937967321 Serratia sp. YC16 Isolate Unclassified
310 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
311 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
312 2939577877 Serratia sp. 509 Isolate Rhizosphere
313 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
314 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
315 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
316 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
317 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
318 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
319 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
320 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
321 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
322 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
323 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
324 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
325 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
326 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
327 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
328 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
329 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
330 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
331 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
332 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
333 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
334 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
335 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
336 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
337 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
338 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
339 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
340 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
341 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
342 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
343 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
344 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
345 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
346 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
347 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
348 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
349 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
350 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
351 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
352 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
353 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
354 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
355 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
356 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
357 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
358 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
359 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
360 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
361 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
362 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
363 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
364 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
365 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
366 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
367 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
368 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
369 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
370 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
371 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
372 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
373 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
374 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
375 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
376 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
377 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
378 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
379 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
380 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
381 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
382 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
383 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
384 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
385 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
386 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
387 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
388 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
389 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
390 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
391 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
392 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
393 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
394 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
395 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
396 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
397 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
398 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
399 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
400 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
401 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
402 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
403 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
404 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
405 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
406 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
407 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
408 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
409 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
410 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
411 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
412 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
413 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
414 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
415 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
416 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
417 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
418 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
419 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
420 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
421 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
422 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
423 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
424 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
425 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
426 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
427 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
428 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
429 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
430 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
431 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
432 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
433 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
435 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
436 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
437 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
438 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
439 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
440 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
441 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
442 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
443 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
444 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
445 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
446 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
447 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
469 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
471 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
472 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
473 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
474 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
475 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
476 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
477 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
481 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
482 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
483 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
484 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
485 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
486 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
487 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
488 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
489 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
490 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
491 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
492 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
493 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
494 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
495 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
496 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
497 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
498 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
499 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
500 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
501 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
502 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
503 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
504 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
505 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
506 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
507 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
508 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
509 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
510 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
511 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
512 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
513 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
514 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
515 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
516 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
517 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
518 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
519 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
520 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
521 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
522 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
523 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
524 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
525 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
526 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
527 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
528 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
529 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
530 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
531 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
532 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
533 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
534 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
535 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
536 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
537 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
538 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
539 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
540 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
541 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
542 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
543 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
544 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
545 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
546 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
547 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
548 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
549 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
550 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
551 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
552 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
553 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
554 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
555 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
556 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
557 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
558 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
559 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
560 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
561 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
562 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
563 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
564 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
565 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
566 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
567 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
568 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
569 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
570 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
571 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
572 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
573 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
574 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
575 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
576 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
577 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
578 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
579 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
580 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
581 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
582 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
583 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
584 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
585 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
586 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
587 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
588 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
589 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
590 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
591 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
592 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
593 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
594 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
595 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
596 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
597 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
598 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
599 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
600 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
601 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
602 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
603 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
604 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
605 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
606 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
607 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
608 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
609 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
610 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
611 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
612 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
613 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
614 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
615 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
616 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
617 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
618 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
619 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
620 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
621 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
622 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
623 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
624 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
625 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
626 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
627 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
628 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
629 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
630 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
631 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
632 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
633 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
634 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
635 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
636 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
637 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
638 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
639 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
640 640753048 Serratia proteamaculans 568 Isolate Endosphere
641 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
642 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
643 8004592986 Serratia sp. S119 Isolate Unclassified
644 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
645 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
646 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
647 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
648 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
649 8018221730 Enterobacter sp. CM29 Isolate Unclassified
650 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
651 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
652 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
653 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
654 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
655 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
656 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
657 8052494512 Pseudomonas putida LD6 Isolate Unclassified
658 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
659 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
660 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
661 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
662 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
663 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
664 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
665 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
666 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
667 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
668 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
669 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
670 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
671 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
672 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
673 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
674 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
675 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
676 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
677 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
678 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
679 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
680 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.23
Metatranscriptomes 0
Isolates 27.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0.07
Endosphere 4.86
Nodule 3.21
Rhizoplane 9.44
Rhizosphere 64.5
Stem 0.07
Stem Tuber 0.41
Unclassified 17.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1682 2124908027 Bacteria 5867
2 JGI24739J22299_10000206 3300001989 Bacteria 19601
3 JGI25162J39368_1000006 3300002737 Bacteria 405267
4 JGI25162J39368_1000391 3300002737 Bacteria 36980
5 JGI25162J39368_1002479 3300002737 Bacteria 7117
6 JGI25163J39215_1000001 3300002771 Bacteria 314282
7 JGI25163J39215_1000255 3300002771 Bacteria 19472
8 JGI25163J39215_1001158 3300002771 Bacteria 5136
9 JGI25164J39214_1000001 3300002772 Bacteria 477015
10 JGI25164J39214_1000089 3300002772 Bacteria 91309
11 JGI25164J39214_1000279 3300002772 Bacteria 36980
12 JGI25152J39213_1000367 3300002773 Bacteria 27850
13 JGI25165J46597_1000191 3300003214 Bacteria 91309
14 JGI25165J46597_1000510 3300003214 Bacteria 36980
15 rootH2_10032116 3300003320 Bacteria 24090
16 Ga0055538_1000004 3300003751 Bacteria 615646
17 Ga0055538_1000078 3300003751 Bacteria 86114
18 Ga0055539_1000004 3300003752 Bacteria 615646
19 Ga0055533_1000007 3300003756 Bacteria 615646
20 Ga0055525_1000007 3300003759 Bacteria 615646
21 Ga0055536_1000089 3300003781 Bacteria 78019
22 Ga0055530_10000230 3300003791 Bacteria 49999
23 Ga0055530_10000462 3300003791 Bacteria 35966
24 Ga0055530_10001861 3300003791 Bacteria 14501
25 Ga0055540_1000163 3300003792 Bacteria 66649
26 Ga0055540_1000241 3300003792 Bacteria 49999
27 Ga0055540_1001061 3300003792 Bacteria 17512
28 Ga0055531_10044352 3300003794 Bacteria 1247
29 Ga0055541_1000004 3300003841 Bacteria 615646
30 Ga0058692_1000154 3300003856 Bacteria 43640
31 Ga0058692_1000657 3300003856 Bacteria 14294
32 Ga0058692_1000730 3300003856 Bacteria 13319
33 Ga0058692_1002498 3300003856 Bacteria 6127
34 Ga0058692_1003910 3300003856 Bacteria 4517
35 Ga0058692_1012084 3300003856 Bacteria 2059
36 Ga0065703_1018920 3300005272 Bacteria 5150
37 Ga0065714_10003160 3300005288 Bacteria 8831
38 Ga0065714_10004034 3300005288 Bacteria 6734
39 Ga0065714_10085992 3300005288 Bacteria 2121
40 Ga0065714_10099170 3300005288 Bacteria 1692
41 Ga0065714_10139196 3300005288 Bacteria 1180
42 Ga0065704_10003841 3300005289 Bacteria 6810
43 Ga0065704_10007594 3300005289 Bacteria 3086
44 Ga0065704_10088469 3300005289 Bacteria 2936
45 Ga0065712_10002471 3300005290 Bacteria 11296
46 Ga0065712_10068141 3300005290 Bacteria 13957
47 Ga0065712_10070283 3300005290 Bacteria 6136
48 Ga0065712_10071164 3300005290 Bacteria 5445
49 Ga0070670_100000052 3300005331 Bacteria 129346
50 Ga0070670_100000751 3300005331 Bacteria 25153
51 Ga0070670_100002027 3300005331 Bacteria 16575
52 Ga0070661_100001228 3300005344 Bacteria 18034
53 Ga0070668_100001689 3300005347 Bacteria 16007
54 Ga0070669_100005813 3300005353 Bacteria 8897
55 Ga0070671_100000055 3300005355 Bacteria 77442
56 Ga0070688_100055182 3300005365 Bacteria 2491
57 Ga0070667_100000021 3300005367 Bacteria 205662
58 Ga0070662_100013363 3300005457 Bacteria 5464
59 Ga0070662_100031548 3300005457 Bacteria 3720
60 Ga0070685_10000003 3300005466 Bacteria 283138
61 Ga0070665_100005453 3300005548 Bacteria 13113
62 Ga0070665_100007189 3300005548 Bacteria 11317
63 Ga0070665_100069632 3300005548 Bacteria 3526
64 Ga0070665_100134082 3300005548 Bacteria 2478
65 Ga0070665_100242711 3300005548 Bacteria 1802
66 Ga0070664_100001616 3300005564 Bacteria 18034
67 Ga0068857_100000386 3300005577 Bacteria 30880
68 Ga0068857_100254231 3300005577 Bacteria 1611
69 Ga0068859_100002966 3300005617 Bacteria 17199
70 Ga0068864_100000002 3300005618 Bacteria 658857
71 Ga0068858_100029359 3300005842 Bacteria 5105
72 Ga0068860_100000695 3300005843 Bacteria 38687
73 Ga0075364_10023611 3300006051 Bacteria 3895
74 Ga0075364_10059248 3300006051 Bacteria 2510
75 Ga0075432_10006397 3300006058 Bacteria 4007
76 Ga0075362_10051079 3300006177 Bacteria 1850
77 Ga0075366_10009474 3300006195 Bacteria 5436
78 Ga0097620_100002966 3300006931 Bacteria 17199
79 Ga0099823_1000050 3300006944 Bacteria 57425
80 Ga0079104_1000099 3300006946 Bacteria 126954
81 Ga0079104_1000213 3300006946 Bacteria 81349
82 Ga0079104_1000222 3300006946 Bacteria 78855
83 Ga0079104_1000403 3300006946 Bacteria 49953
84 Ga0079104_1001515 3300006946 Bacteria 15400
85 Ga0079104_1001820 3300006946 Bacteria 13146
86 Ga0079104_1002919 3300006946 Bacteria 8499
87 Ga0079104_1005396 3300006946 Bacteria 5121
88 Ga0099826_10007176 3300006948 Bacteria 8197
89 Ga0105251_10000158 3300009011 Bacteria 69153
90 Ga0105251_10000401 3300009011 Bacteria 42259
91 Ga0105251_10001649 3300009011 Bacteria 18872
92 Ga0105251_10002215 3300009011 Bacteria 15509
93 Ga0105251_10005690 3300009011 Bacteria 8094
94 Ga0105251_10007932 3300009011 Bacteria 6450
95 Ga0105251_10014126 3300009011 Bacteria 4431
96 Ga0105251_10017931 3300009011 Bacteria 3780
97 Ga0105251_10018857 3300009011 Bacteria 3658
98 Ga0105251_10021619 3300009011 Bacteria 3356
99 Ga0105251_10022596 3300009011 Bacteria 3262
100 Ga0105251_10029529 3300009011 Bacteria 2762
101 Ga0105251_10046254 3300009011 Bacteria 2094
102 Ga0105251_10053006 3300009011 Bacteria 1930
103 Ga0105251_10169024 3300009011 Bacteria 985
104 Ga0105244_10000023 3300009036 Bacteria 233110
105 Ga0105244_10000255 3300009036 Bacteria 54462
106 Ga0105244_10000427 3300009036 Bacteria 38959
107 Ga0105244_10000453 3300009036 Bacteria 37447
108 Ga0105244_10000704 3300009036 Bacteria 29004
109 Ga0105244_10001671 3300009036 Bacteria 17536
110 Ga0105244_10001899 3300009036 Bacteria 16236
111 Ga0105244_10001973 3300009036 Bacteria 15869
112 Ga0105244_10002235 3300009036 Bacteria 14746
113 Ga0105244_10002529 3300009036 Bacteria 13733
114 Ga0105244_10003779 3300009036 Bacteria 10681
115 Ga0105244_10005005 3300009036 Bacteria 8931
116 Ga0105244_10005824 3300009036 Bacteria 8099
117 Ga0105244_10007248 3300009036 Bacteria 7065
118 Ga0105244_10013077 3300009036 Bacteria 4868
119 Ga0105244_10021139 3300009036 Bacteria 3604
120 Ga0105244_10052056 3300009036 Bacteria 2086
121 Ga0105244_10109776 3300009036 Bacteria 1343
122 Ga0105250_10000028 3300009092 Bacteria 204198
123 Ga0105250_10000045 3300009092 Bacteria 127333
124 Ga0105250_10000199 3300009092 Bacteria 51075
125 Ga0105250_10000737 3300009092 Bacteria 19956
126 Ga0105250_10001320 3300009092 Bacteria 13554
127 Ga0105250_10001583 3300009092 Bacteria 12205
128 Ga0105250_10001831 3300009092 Bacteria 11122
129 Ga0105250_10004681 3300009092 Bacteria 6253
130 Ga0105250_10011683 3300009092 Bacteria 3641
131 Ga0105250_10013139 3300009092 Bacteria 3406
132 Ga0105250_10013247 3300009092 Bacteria 3395
133 Ga0105250_10013576 3300009092 Bacteria 3356
134 Ga0105250_10014569 3300009092 Bacteria 3227
135 Ga0105250_10032643 3300009092 Bacteria 2091
136 Ga0105250_10135576 3300009092 Bacteria 1018
137 Ga0105240_10147704 3300009093 Bacteria 2803
138 Ga0105247_10000387 3300009101 Bacteria 37452
139 Ga0105247_10012831 3300009101 Bacteria 5029
140 Ga0105243_10000627 3300009148 Bacteria 35211
141 Ga0105243_10002038 3300009148 Bacteria 17137
142 Ga0105243_10003177 3300009148 Bacteria 13461
143 Ga0105243_10010109 3300009148 Bacteria 7178
144 Ga0105243_10067232 3300009148 Bacteria 2884
145 Ga0105243_10179209 3300009148 Bacteria 1841
146 Ga0105241_10000008 3300009174 Bacteria 334281
147 Ga0105242_10001563 3300009176 Bacteria 18015
148 Ga0105237_10000413 3300009545 Bacteria 60829
149 Ga0105237_10028696 3300009545 Bacteria 5664
150 Ga0105249_10016816 3300009553 Bacteria 6491
151 Ga0105246_10000467 3300011119 Bacteria 21774
152 Ga0105246_10000590 3300011119 Bacteria 20136
153 Ga0105246_10007972 3300011119 Bacteria 6500
154 Ga0105246_10034580 3300011119 Bacteria 3370
155 Ga0157345_1000123 3300012498 Bacteria 15275
156 Ga0157373_10001088 3300013100 Bacteria 20928
157 Ga0157373_10001252 3300013100 Bacteria 19414
158 Ga0157373_10006491 3300013100 Bacteria 8729
159 Ga0157373_10008149 3300013100 Bacteria 7791
160 Ga0157373_10015027 3300013100 Bacteria 5662
161 Ga0157373_10018376 3300013100 Bacteria 5091
162 Ga0157373_10018566 3300013100 Bacteria 5061
163 Ga0157373_10039070 3300013100 Bacteria 3398
164 Ga0157373_10060782 3300013100 Bacteria 2677
165 Ga0157373_10122820 3300013100 Bacteria 1825
166 Ga0157373_10226233 3300013100 Bacteria 1320
167 Ga0157371_10000020 3300013102 Bacteria 304987
168 Ga0157371_10000186 3300013102 Bacteria 91270
169 Ga0157371_10000267 3300013102 Bacteria 71120
170 Ga0157371_10000396 3300013102 Bacteria 54666
171 Ga0157371_10001526 3300013102 Bacteria 23861
172 Ga0157371_10002310 3300013102 Bacteria 18348
173 Ga0157371_10003239 3300013102 Bacteria 14941
174 Ga0157371_10005382 3300013102 Bacteria 10813
175 Ga0157371_10029749 3300013102 Bacteria 3946
176 Ga0157370_10000276 3300013104 Bacteria 65208
177 Ga0157370_10000595 3300013104 Bacteria 45146
178 Ga0157370_10001621 3300013104 Bacteria 27808
179 Ga0157370_10004198 3300013104 Bacteria 16670
180 Ga0157370_10035747 3300013104 Bacteria 4826
181 Ga0157370_10040510 3300013104 Bacteria 4497
182 Ga0157370_10091996 3300013104 Bacteria 2847
183 Ga0157370_10126378 3300013104 Bacteria 2387
184 Ga0157370_10194077 3300013104 Bacteria 1885
185 Ga0157369_10000183 3300013105 Bacteria 86986
186 Ga0157369_10001314 3300013105 Bacteria 30876
187 Ga0157369_10006197 3300013105 Bacteria 13875
188 Ga0157369_10008666 3300013105 Bacteria 11660
189 Ga0157369_10034181 3300013105 Bacteria 5582
190 Ga0157369_10135413 3300013105 Bacteria 2608
191 Ga0157369_10321810 3300013105 Bacteria 1608
192 Ga0157369_10326584 3300013105 Bacteria 1594
193 Ga0163162_10007244 3300013306 Bacteria 10766
194 Ga0163162_10011360 3300013306 Bacteria 8682
195 Ga0163162_10012235 3300013306 Bacteria 8374
196 Ga0157372_10001095 3300013307 Bacteria 29471
197 Ga0157372_10001343 3300013307 Bacteria 26606
198 Ga0157372_10015434 3300013307 Bacteria 8186
199 Ga0157372_10031809 3300013307 Bacteria 5781
200 Ga0157372_10088890 3300013307 Bacteria 3508
201 Ga0157372_10116342 3300013307 Bacteria 3066
202 Ga0157375_10005669 3300013308 Bacteria 10865
203 Ga0157375_10062745 3300013308 Bacteria 3694
204 Ga0157375_10649087 3300013308 Bacteria 1212
205 Ga0163163_10000053 3300014325 Bacteria 126626
206 Ga0182008_10001777 3300014497 Bacteria 14125
207 Ga0182008_10005889 3300014497 Bacteria 6927
208 Ga0182008_10079847 3300014497 Bacteria 1609
209 Ga0182008_10085164 3300014497 Bacteria 1557
210 Ga0182006_1000025 3300015261 Bacteria 255969
211 Ga0182006_1005166 3300015261 Bacteria 6264
212 Ga0182006_1006697 3300015261 Bacteria 5330
213 Ga0182006_1011910 3300015261 Bacteria 3809
214 Ga0182006_1024147 3300015261 Bacteria 2509
215 Ga0182006_1025996 3300015261 Bacteria 2401
216 Ga0182006_1041062 3300015261 Bacteria 1818
217 Ga0182006_1043234 3300015261 Bacteria 1761
218 Ga0182006_1059177 3300015261 Bacteria 1451
219 Ga0182007_10025387 3300015262 Bacteria 2065
220 Ga0182005_1002971 3300015265 Bacteria 5874
221 Ga0182005_1009980 3300015265 Bacteria 2743
222 Ga0182005_1025465 3300015265 Bacteria 1614
223 Ga0182005_1026233 3300015265 Bacteria 1590
224 Ga0182005_1027509 3300015265 Bacteria 1550
225 Ga0183366_1003 3300015679 Bacteria 453474
226 Ga0183370_1003 3300015680 Bacteria 454044
227 Ga0183369_1005 3300015685 Bacteria 453680
228 Ga0183368_1006 3300015687 Bacteria 551576
229 Ga0183361_11316 3300016635 Bacteria 1268
230 Ga0163161_10000002 3300017792 Bacteria 411983
231 Ga0163161_10003398 3300017792 Bacteria 11173
232 Ga0163161_10008626 3300017792 Bacteria 7047
233 Ga0163161_10024842 3300017792 Bacteria 4236
234 Ga0163161_10103618 3300017792 Bacteria 2120
235 Ga0163161_10114956 3300017792 Bacteria 2016
236 Ga0213876_10000026 3300021384 Bacteria 231892
237 Ga0209760_100063 3300025207 Bacteria 92173
238 Ga0209760_100087 3300025207 Bacteria 73419
239 Ga0209760_100145 3300025207 Bacteria 44471
240 Ga0209760_100173 3300025207 Bacteria 35497
241 Ga0209784_100001 3300025224 Bacteria 3600592
242 Ga0209566_100001 3300025225 Bacteria 3600765
243 Ga0209674_100002 3300025226 Bacteria 3600592
244 Ga0209563_100008 3300025230 Bacteria 1554545
245 Ga0207427_100001 3300025231 Bacteria 1410763
246 Ga0207427_100002 3300025231 Bacteria 1355321
247 Ga0207427_100048 3300025231 Bacteria 238464
248 Ga0209437_100003 3300025233 Bacteria 1517827
249 Ga0209437_100046 3300025233 Bacteria 405293
250 Ga0209437_100063 3300025233 Bacteria 335477
251 Ga0209437_100094 3300025233 Bacteria 238465
252 Ga0209677_100004 3300025253 Bacteria 1554545
253 Ga0209759_1005910 3300025256 Bacteria 4187
254 Ga0209129_1000008 3300025258 Bacteria 640959
255 Ga0209233_1000007 3300025261 Bacteria 1411234
256 Ga0209233_1000106 3300025261 Bacteria 268795
257 Ga0209233_1001593 3300025261 Bacteria 8872
258 Ga0209675_1007855 3300025291 Bacteria 4011
259 Ga0209676_1000002 3300025292 Bacteria 1732948
260 Ga0209676_1000021 3300025292 Bacteria 609534
261 Ga0209676_1000166 3300025292 Bacteria 156596
262 Ga0209676_1002655 3300025292 Bacteria 12151
263 Ga0209050_1000009 3300025298 Bacteria 1047265
264 Ga0209050_1000275 3300025298 Bacteria 110235
265 Ga0209050_1000395 3300025298 Bacteria 81719
266 Ga0209050_1002062 3300025298 Bacteria 18497
267 Ga0209051_1000001 3300025303 Bacteria 1732974
268 Ga0209051_1000008 3300025303 Bacteria 706935
269 Ga0209051_1000585 3300025303 Bacteria 43163
270 Ga0209051_1017780 3300025303 Bacteria 3168
271 Ga0209257_1000181 3300025304 Bacteria 158039
272 Ga0209257_1004705 3300025304 Bacteria 10244
273 Ga0207696_1000009 3300025711 Bacteria 564405
274 Ga0207696_1000027 3300025711 Bacteria 412783
275 Ga0207696_1000063 3300025711 Bacteria 239123
276 Ga0207696_1000090 3300025711 Bacteria 188474
277 Ga0207696_1000093 3300025711 Bacteria 184278
278 Ga0207696_1000117 3300025711 Bacteria 148004
279 Ga0207696_1000140 3300025711 Bacteria 127393
280 Ga0207696_1000142 3300025711 Bacteria 123519
281 Ga0207696_1000176 3300025711 Bacteria 100134
282 Ga0207696_1000177 3300025711 Bacteria 100134
283 Ga0207696_1000189 3300025711 Bacteria 95393
284 Ga0207696_1000761 3300025711 Bacteria 21277
285 Ga0207696_1001106 3300025711 Bacteria 15723
286 Ga0207696_1001409 3300025711 Bacteria 13121
287 Ga0207696_1002032 3300025711 Bacteria 10239
288 Ga0207696_1006471 3300025711 Bacteria 4718
289 Ga0207696_1013635 3300025711 Bacteria 2820
290 Ga0207696_1016653 3300025711 Bacteria 2454
291 Ga0207696_1019721 3300025711 Bacteria 2188
292 Ga0207696_1035807 3300025711 Bacteria 1476
293 Ga0207655_1000006 3300025728 Bacteria 861092
294 Ga0207655_1000017 3300025728 Bacteria 544403
295 Ga0207655_1000024 3300025728 Bacteria 459774
296 Ga0207655_1000026 3300025728 Bacteria 445528
297 Ga0207655_1000054 3300025728 Bacteria 281894
298 Ga0207655_1000056 3300025728 Bacteria 279166
299 Ga0207655_1000084 3300025728 Bacteria 207679
300 Ga0207655_1000096 3300025728 Bacteria 194292
301 Ga0207655_1000101 3300025728 Bacteria 185883
302 Ga0207655_1000140 3300025728 Bacteria 139110
303 Ga0207655_1000146 3300025728 Bacteria 132221
304 Ga0207655_1002118 3300025728 Bacteria 16607
305 Ga0207655_1002372 3300025728 Bacteria 15380
306 Ga0207655_1002510 3300025728 Bacteria 14790
307 Ga0207655_1003121 3300025728 Bacteria 12552
308 Ga0207655_1004562 3300025728 Bacteria 9766
309 Ga0207655_1005359 3300025728 Bacteria 8750
310 Ga0207655_1006033 3300025728 Bacteria 8099
311 Ga0207655_1008732 3300025728 Bacteria 6383
312 Ga0207655_1009237 3300025728 Bacteria 6150
313 Ga0207655_1010013 3300025728 Bacteria 5809
314 Ga0207655_1010613 3300025728 Bacteria 5570
315 Ga0207655_1011086 3300025728 Bacteria 5403
316 Ga0207655_1018628 3300025728 Bacteria 3671
317 Ga0207655_1019483 3300025728 Bacteria 3542
318 Ga0207655_1022903 3300025728 Bacteria 3113
319 Ga0207655_1025497 3300025728 Bacteria 2868
320 Ga0207655_1025694 3300025728 Bacteria 2852
321 Ga0207655_1026231 3300025728 Bacteria 2802
322 Ga0207655_1026669 3300025728 Bacteria 2770
323 Ga0207655_1062566 3300025728 Bacteria 1430
324 Ga0207713_1000007 3300025735 Bacteria 564979
325 Ga0207713_1000034 3300025735 Bacteria 266214
326 Ga0207713_1000046 3300025735 Bacteria 232796
327 Ga0207713_1000058 3300025735 Bacteria 216911
328 Ga0207713_1000110 3300025735 Bacteria 135907
329 Ga0207713_1000158 3300025735 Bacteria 102081
330 Ga0207713_1000160 3300025735 Bacteria 100682
331 Ga0207713_1000419 3300025735 Bacteria 45136
332 Ga0207713_1001972 3300025735 Bacteria 15450
333 Ga0207713_1002981 3300025735 Bacteria 11834
334 Ga0207713_1004279 3300025735 Bacteria 9310
335 Ga0207713_1004302 3300025735 Bacteria 9280
336 Ga0207713_1004891 3300025735 Bacteria 8576
337 Ga0207713_1010990 3300025735 Bacteria 4963
338 Ga0207713_1011927 3300025735 Bacteria 4687
339 Ga0207713_1013824 3300025735 Bacteria 4229
340 Ga0207713_1014256 3300025735 Bacteria 4143
341 Ga0207713_1019102 3300025735 Bacteria 3367
342 Ga0207713_1026762 3300025735 Bacteria 2635
343 Ga0207713_1056881 3300025735 Bacteria 1516
344 Ga0207710_10000015 3300025900 Bacteria 393018
345 Ga0207680_10051360 3300025903 Bacteria 2465
346 Ga0207654_10000009 3300025911 Bacteria 334291
347 Ga0207695_10138477 3300025913 Bacteria 2385
348 Ga0207671_10005571 3300025914 Bacteria 11559
349 Ga0207671_10283640 3300025914 Bacteria 1306
350 Ga0207649_10000156 3300025920 Bacteria 55743
351 Ga0207681_10002936 3300025923 Bacteria 10759
352 Ga0207650_10000002 3300025925 Bacteria 1439222
353 Ga0207650_10000554 3300025925 Bacteria 30405
354 Ga0207644_10001388 3300025931 Bacteria 15629
355 Ga0207706_10006938 3300025933 Bacteria 10477
356 Ga0207706_10039228 3300025933 Bacteria 4198
357 Ga0207686_10003046 3300025934 Bacteria 9021
358 Ga0207709_10000045 3300025935 Bacteria 240671
359 Ga0207709_10000763 3300025935 Bacteria 25375
360 Ga0207709_10005426 3300025935 Bacteria 7246
361 Ga0207709_10049003 3300025935 Bacteria 2576
362 Ga0207709_10105804 3300025935 Bacteria 1870
363 Ga0207709_10137802 3300025935 Bacteria 1673
364 Ga0207711_10000178 3300025941 Bacteria 68438
365 Ga0207679_10000016 3300025945 Bacteria 253494
366 Ga0207712_10035676 3300025961 Bacteria 3381
367 Ga0207668_10002127 3300025972 Bacteria 11553
368 Ga0207658_10000001 3300025986 Bacteria 1439333
369 Ga0207641_10018214 3300026088 Bacteria 5756
370 Ga0207641_10155440 3300026088 Bacteria 2074
371 Ga0207676_10000001 3300026095 Bacteria 1439222
372 Ga0207674_10000009 3300026116 Bacteria 202730
373 Ga0209281_1000011 3300027111 Bacteria 695292
374 Ga0209281_1000054 3300027111 Bacteria 309505
375 Ga0209281_1000058 3300027111 Bacteria 300244
376 Ga0209281_1000060 3300027111 Bacteria 295683
377 Ga0209281_1000090 3300027111 Bacteria 242950
378 Ga0209281_1000120 3300027111 Bacteria 206692
379 Ga0209281_1000223 3300027111 Bacteria 121161
380 Ga0209281_1000648 3300027111 Bacteria 37573
381 Ga0209281_1000822 3300027111 Bacteria 28039
382 Ga0209281_1000854 3300027111 Bacteria 26809
383 Ga0209281_1001003 3300027111 Bacteria 22148
384 Ga0209281_1001185 3300027111 Bacteria 17897
385 Ga0209281_1003980 3300027111 Bacteria 4580
386 Ga0209281_1004668 3300027111 Bacteria 4031
387 Ga0209281_1005142 3300027111 Bacteria 3700
388 Ga0209389_1000053 3300027296 Bacteria 108874
389 Ga0209371_1000014 3300027312 Bacteria 661118
390 Ga0209371_1000030 3300027312 Bacteria 423605
391 Ga0209371_1000053 3300027312 Bacteria 264616
392 Ga0209371_1000054 3300027312 Bacteria 259676
393 Ga0209371_1000111 3300027312 Bacteria 140093
394 Ga0209371_1000123 3300027312 Bacteria 131854
395 Ga0209371_1000245 3300027312 Bacteria 67465
396 Ga0209371_1000495 3300027312 Bacteria 38270
397 Ga0209371_1000544 3300027312 Bacteria 35405
398 Ga0209371_1000563 3300027312 Bacteria 33948
399 Ga0209371_1000655 3300027312 Bacteria 30194
400 Ga0209371_1001916 3300027312 Bacteria 12706
401 Ga0209371_1002190 3300027312 Bacteria 11391
402 Ga0209371_1002345 3300027312 Bacteria 10767
403 Ga0209371_1005437 3300027312 Bacteria 5065
404 Ga0209371_1006335 3300027312 Bacteria 4407
405 Ga0209371_1006480 3300027312 Bacteria 4325
406 Ga0209981_1007774 3300027378 Bacteria 1450
407 Ga0209983_1001336 3300027665 Bacteria 5495
408 Ga0209282_1024480 3300027666 Bacteria 3784
409 Ga0207428_10037203 3300027907 Bacteria 3962
410 Ga0207428_10052219 3300027907 Bacteria 3266
411 Ga0268266_10000290 3300028379 Bacteria 82154
412 Ga0268266_10004075 3300028379 Bacteria 14128
413 Ga0268265_10000936 3300028380 Bacteria 26856
414 Ga0268264_10000004 3300028381 Bacteria 1116842
415 Ga0307517_10118597 3300028786 Bacteria 1969
416 Ga0268256_1000012 3300030500 Bacteria 794553
417 Ga0268256_1000021 3300030500 Bacteria 542735
418 Ga0268256_1000025 3300030500 Bacteria 484317
419 Ga0268256_1000053 3300030500 Bacteria 264616
420 Ga0268256_1000095 3300030500 Bacteria 139698
421 Ga0268256_1000201 3300030500 Bacteria 67997
422 Ga0268256_1000426 3300030500 Bacteria 38063
423 Ga0268256_1000462 3300030500 Bacteria 35405
424 Ga0268256_1000488 3300030500 Bacteria 33948
425 Ga0268256_1000560 3300030500 Bacteria 30194
426 Ga0268256_1001337 3300030500 Bacteria 15090
427 Ga0268256_1001950 3300030500 Bacteria 11283
428 Ga0268256_1002082 3300030500 Bacteria 10767
429 Ga0268256_1005190 3300030500 Bacteria 5172
430 Ga0268256_1006367 3300030500 Bacteria 4407
431 Ga0307511_10039070 3300030521 Bacteria 4061
432 Ga0316178_1017010 3300030735 Bacteria 20955
433 Ga0265331_10014585 3300031250 Bacteria 4176
434 Ga0265327_10000053 3300031251 Bacteria 255002
435 Ga0307408_100000018 3300031548 Bacteria 346872
436 Ga0307408_100019822 3300031548 Bacteria 4530
437 Ga0307408_100051870 3300031548 Bacteria 2957
438 Ga0307408_100145719 3300031548 Bacteria 1863
439 Ga0307408_100298467 3300031548 Bacteria 1348
440 Ga0307405_10001157 3300031731 Bacteria 10852
441 Ga0307405_10001903 3300031731 Bacteria 8985
442 Ga0307405_10006203 3300031731 Bacteria 5859
443 Ga0307405_10175589 3300031731 Bacteria 1532
444 Ga0307413_10062014 3300031824 Bacteria 2310
445 Ga0307406_10187332 3300031901 Bacteria 1512
446 Ga0307407_10028336 3300031903 Bacteria 2993
447 Ga0307412_10001593 3300031911 Bacteria 12493
448 Ga0307412_10003035 3300031911 Bacteria 9295
449 Ga0307412_10060637 3300031911 Bacteria 2539
450 Ga0307409_100170447 3300031995 Bacteria 1915
451 Ga0307416_100202633 3300032002 Bacteria 1884
452 Ga0307414_10102170 3300032004 Bacteria 2160
453 Ga0307414_10230261 3300032004 Bacteria 1527
454 Ga0307411_10026943 3300032005 Bacteria 3468
455 Ga0307510_10000104 3300033180 Bacteria 66463
456 Ga0316584_0040155 3300036712 Bacteria 3486
457 Ga0373925_0056469 3300037068 Bacteria 2941
458 Ga0395900_0011285 3300037418 Bacteria 9138
459 Ga0395898_0001760 3300037466 Bacteria 28357
460 Ga0395901_0007079 3300038443 Bacteria 11337
461 Ga0237819_00979 3300038705 Bacteria 8654
462 Ga0400483_217404 3300039062 Bacteria 18991
463 Ga0436365_0084998 3300039437 Bacteria 507888
464 Ga0439438_000003 3300041405 Bacteria 464587
465 Ga0439438_000140 3300041405 Bacteria 32855
466 Ga0439438_000238 3300041405 Bacteria 24472
467 Ga0439438_000536 3300041405 Bacteria 17257
468 Ga0439438_000677 3300041405 Bacteria 15284
469 Ga0439438_001320 3300041405 Bacteria 10978
470 Ga0439438_008005 3300041405 Bacteria 3555
471 Ga0439438_017178 3300041405 Bacteria 2088
472 Ga0439438_021007 3300041405 Bacteria 1825
473 Ga0439447_001380 3300041407 Bacteria 8889
474 Ga0439447_002568 3300041407 Bacteria 6599
475 Ga0439447_005955 3300041407 Bacteria 4002
476 Ga0439447_007219 3300041407 Bacteria 3543
477 Ga0439447_014766 3300041407 Bacteria 2180
478 Ga0439447_017056 3300041407 Bacteria 1982
479 Ga0439447_020436 3300041407 Bacteria 1756
480 Ga0439447_032263 3300041407 Bacteria 1309
481 Ga0439466_0000002 3300041411 Bacteria 494198
482 Ga0439466_0004446 3300041411 Bacteria 5395
483 Ga0439466_0016518 3300041411 Bacteria 2666
484 Ga0439466_0017730 3300041411 Bacteria 2561
485 Ga0439466_0018010 3300041411 Bacteria 2537
486 Ga0439466_0025348 3300041411 Bacteria 2070
487 Ga0451853_0270960 3300041512 Bacteria 2042
488 Ga0439431_0016952 3300041997 Bacteria 1709
489 Ga0439437_001432 3300042000 Bacteria 2513
490 Ga0439432_000623 3300042006 Bacteria 13337
491 Ga0439432_000869 3300042006 Bacteria 11311
492 Ga0439432_001288 3300042006 Bacteria 9479
493 Ga0439432_002793 3300042006 Bacteria 6509
494 Ga0439432_005883 3300042006 Bacteria 4401
495 Ga0439432_021203 3300042006 Bacteria 2156
496 Ga0439451_010390 3300042009 Bacteria 1876
497 Ga0439452_000004 3300042010 Bacteria 764268
498 Ga0439452_000005 3300042010 Bacteria 646919
499 Ga0439452_000007 3300042010 Bacteria 613625
500 Ga0439452_000056 3300042010 Bacteria 106151
501 Ga0439452_000060 3300042010 Bacteria 101512
502 Ga0439452_000219 3300042010 Bacteria 40298
503 Ga0439452_001164 3300042010 Bacteria 11412
504 Ga0439452_001457 3300042010 Bacteria 9657
505 Ga0439452_008660 3300042010 Bacteria 3045
506 Ga0439452_011379 3300042010 Bacteria 2559
507 Ga0439452_012550 3300042010 Bacteria 2406
508 Ga0439455_0007220 3300042012 Bacteria 2344
509 Ga0439456_000070 3300042013 Bacteria 36453
510 Ga0439463_000309 3300042016 Bacteria 13687
511 Ga0439463_000932 3300042016 Bacteria 8025
512 Ga0450911_000083 3300042115 Bacteria 37916
513 Ga0450911_000709 3300042115 Bacteria 9739
514 Ga0450911_002407 3300042115 Bacteria 3679
515 Ga0450892_002711 3300042130 Bacteria 1481
516 Ga0450903_011547 3300042138 Bacteria 1421
517 Ga0450904_000082 3300042139 Bacteria 21628
518 Ga0450905_002733 3300042142 Bacteria 2285
519 Ga0450906_007312 3300042145 Bacteria 2184
520 Ga0450907_000284 3300042146 Bacteria 17144
521 Ga0450907_000766 3300042146 Bacteria 8119
522 Ga0450907_008386 3300042146 Bacteria 1718
523 Ga0450910_004807 3300042147 Bacteria 1833
524 Ga0439446_0000053 3300042156 Bacteria 17695
525 Ga0439446_0000803 3300042156 Bacteria 6668
526 Ga0450909_006525 3300042185 Bacteria 1682
527 Ga0439434_0000337 3300042435 Bacteria 13270
528 Ga0439434_0027969 3300042435 Bacteria 1707
529 Ga0439459_0001744 3300042438 Bacteria 3255
530 Ga0439459_0028185 3300042438 Bacteria 1125
531 Ga0439464_0003716 3300042439 Bacteria 3870
532 Ga0439464_0014229 3300042439 Bacteria 2138
533 Ga0439460_0011211 3300042461 Bacteria 2309
534 Ga0450916_000109 3300042530 Bacteria 5444
535 Ga0450893_0012600 3300042532 Bacteria 1403
536 Ga0466981_0000014 3300044669 Bacteria 109658
537 Ga0495617_000193 3300046452 Bacteria 38348
538 Ga0495617_000325 3300046452 Bacteria 26752
539 Ga0495617_009601 3300046452 Bacteria 3320
540 Ga0495627_000042 3300046453 Bacteria 189845
541 Ga0495627_000051 3300046453 Bacteria 158822
542 Ga0495627_000613 3300046453 Bacteria 28326
543 Ga0495627_003276 3300046453 Bacteria 7247
544 Ga0495627_013784 3300046453 Bacteria 2839
545 Ga0495627_033959 3300046453 Bacteria 1596
546 Ga0495590_0002159 3300046457 Bacteria 8243
547 Ga0495590_0002522 3300046457 Bacteria 7572
548 Ga0495590_0011582 3300046457 Bacteria 3294
549 Ga0495590_0027608 3300046457 Bacteria 1990
550 Ga0495591_000024 3300046458 Bacteria 191134
551 Ga0495591_000037 3300046458 Bacteria 158323
552 Ga0495591_000231 3300046458 Bacteria 54648
553 Ga0495591_000278 3300046458 Bacteria 47734
554 Ga0495591_000720 3300046458 Bacteria 24007
555 Ga0495591_005800 3300046458 Bacteria 5615
556 Ga0495591_007119 3300046458 Bacteria 4813
557 Ga0495591_008225 3300046458 Bacteria 4299
558 Ga0495591_008336 3300046458 Bacteria 4262
559 Ga0495591_011171 3300046458 Bacteria 3417
560 Ga0495591_023066 3300046458 Bacteria 2001
561 Ga0495591_023751 3300046458 Bacteria 1957
562 Ga0495629_0173339 3300046459 Bacteria 1496
563 Ga0495638_0007742 3300046460 Bacteria 7675
564 Ga0495638_0011238 3300046460 Bacteria 6177
565 Ga0495638_0061557 3300046460 Bacteria 2319
566 Ga0495638_0115027 3300046460 Bacteria 1594
567 Ga0495653_0001136 3300046463 Bacteria 20495
568 Ga0495653_0007921 3300046463 Bacteria 8696
569 Ga0495653_0080412 3300046463 Bacteria 2411
570 Ga0495650_0000004 3300046471 Bacteria 779487
571 Ga0495650_0000028 3300046471 Bacteria 473012
572 Ga0495650_0000113 3300046471 Bacteria 196536
573 Ga0495650_0000572 3300046471 Bacteria 51523
574 Ga0495650_0001745 3300046471 Bacteria 19810
575 Ga0495650_0008259 3300046471 Bacteria 6106
576 Ga0495650_0049791 3300046471 Bacteria 1737
577 Ga0495650_0055931 3300046471 Bacteria 1603
578 Ga0495605_0000036 3300046474 Bacteria 203902
579 Ga0495605_0000222 3300046474 Bacteria 70142
580 Ga0495605_0000871 3300046474 Bacteria 20887
581 Ga0495605_0001613 3300046474 Bacteria 14607
582 Ga0495605_0001770 3300046474 Bacteria 13857
583 Ga0495605_0002842 3300046474 Bacteria 10532
584 Ga0495605_0003753 3300046474 Bacteria 9014
585 Ga0495605_0014965 3300046474 Bacteria 4229
586 Ga0495605_0027852 3300046474 Bacteria 2923
587 Ga0495605_0071274 3300046474 Bacteria 1641
588 Ga0495639_0000062 3300046475 Bacteria 48406
589 Ga0495639_0013816 3300046475 Bacteria 3491
590 Ga0495584_0001224 3300046491 Bacteria 15656
591 Ga0495584_0001546 3300046491 Bacteria 13669
592 Ga0495584_0008642 3300046491 Bacteria 5272
593 Ga0495584_0016948 3300046491 Bacteria 3712
594 Ga0495584_0027786 3300046491 Bacteria 2866
595 Ga0495584_0041131 3300046491 Bacteria 2334
596 Ga0495584_0056186 3300046491 Bacteria 1980
597 Ga0495584_0061753 3300046491 Bacteria 1883
598 Ga0495585_0000473 3300046492 Bacteria 38416
599 Ga0495585_0001213 3300046492 Bacteria 20874
600 Ga0495585_0002545 3300046492 Bacteria 12932
601 Ga0495585_0040706 3300046492 Bacteria 2608
602 Ga0495585_0068615 3300046492 Bacteria 1936
603 Ga0495594_0067487 3300046499 Bacteria 1985
604 Ga0495594_0067773 3300046499 Bacteria 1981
605 Ga0495596_0000105 3300046500 Bacteria 59665
606 Ga0495596_0024186 3300046500 Bacteria 2462
607 Ga0495596_0047895 3300046500 Bacteria 1676
608 Ga0495607_0000335 3300046501 Bacteria 48836
609 Ga0495607_0000598 3300046501 Bacteria 35216
610 Ga0495607_0000685 3300046501 Bacteria 32679
611 Ga0495607_0000875 3300046501 Bacteria 28123
612 Ga0495607_0001466 3300046501 Bacteria 21023
613 Ga0495607_0004879 3300046501 Bacteria 9769
614 Ga0495607_0006458 3300046501 Bacteria 8252
615 Ga0495607_0007957 3300046501 Bacteria 7286
616 Ga0495607_0008559 3300046501 Bacteria 6988
617 Ga0495607_0017817 3300046501 Bacteria 4547
618 Ga0495607_0077051 3300046501 Bacteria 1842
619 Ga0495607_0103725 3300046501 Bacteria 1518
620 Ga0495583_0000028 3300046506 Bacteria 255787
621 Ga0495583_0000561 3300046506 Bacteria 51417
622 Ga0495583_0001188 3300046506 Bacteria 28058
623 Ga0495583_0002128 3300046506 Bacteria 17722
624 Ga0495583_0002394 3300046506 Bacteria 16138
625 Ga0495583_0003507 3300046506 Bacteria 11863
626 Ga0495583_0008771 3300046506 Bacteria 6131
627 Ga0495583_0019169 3300046506 Bacteria 3577
628 Ga0495583_0069131 3300046506 Bacteria 1556
629 Ga0495606_0000094 3300046507 Bacteria 151840
630 Ga0495606_0000502 3300046507 Bacteria 63679
631 Ga0495606_0000958 3300046507 Bacteria 42386
632 Ga0495606_0002787 3300046507 Bacteria 19522
633 Ga0495606_0003133 3300046507 Bacteria 17936
634 Ga0495606_0003916 3300046507 Bacteria 15318
635 Ga0495606_0023741 3300046507 Bacteria 4435
636 Ga0495606_0056808 3300046507 Bacteria 2524
637 Ga0495606_0085022 3300046507 Bacteria 1957
638 Ga0495610_0002667 3300046512 Bacteria 14715
639 Ga0495610_0003738 3300046512 Bacteria 11648
640 Ga0495610_0004363 3300046512 Bacteria 10489
641 Ga0495610_0004919 3300046512 Bacteria 9699
642 Ga0495610_0016704 3300046512 Bacteria 4214
643 Ga0495610_0060530 3300046512 Bacteria 1802
644 Ga0495610_0074855 3300046512 Bacteria 1569
645 Ga0495616_0000487 3300046513 Bacteria 30232
646 Ga0495616_0002116 3300046513 Bacteria 13313
647 Ga0495616_0003865 3300046513 Bacteria 9546
648 Ga0495616_0014977 3300046513 Bacteria 4322
649 Ga0495616_0064057 3300046513 Bacteria 1794
650 Ga0495620_0000073 3300046515 Bacteria 83446
651 Ga0495620_0001062 3300046515 Bacteria 16873
652 Ga0495620_0001603 3300046515 Bacteria 13396
653 Ga0495620_0034109 3300046515 Bacteria 2303
654 Ga0495631_0000169 3300046518 Bacteria 44458
655 Ga0495631_0002840 3300046518 Bacteria 9619
656 Ga0495631_0002981 3300046518 Bacteria 9370
657 Ga0495631_0003965 3300046518 Bacteria 7993
658 Ga0495631_0023709 3300046518 Bacteria 2841
659 Ga0495631_0028721 3300046518 Bacteria 2536
660 Ga0495632_0000449 3300046519 Bacteria 39222
661 Ga0495632_0000460 3300046519 Bacteria 38758
662 Ga0495632_0006942 3300046519 Bacteria 7187
663 Ga0495632_0009783 3300046519 Bacteria 5744
664 Ga0495632_0016901 3300046519 Bacteria 4043
665 Ga0495632_0046515 3300046519 Bacteria 2155
666 Ga0495632_0071760 3300046519 Bacteria 1662
667 Ga0495637_0000015 3300046520 Bacteria 228949
668 Ga0495637_0000168 3300046520 Bacteria 50579
669 Ga0495637_0000981 3300046520 Bacteria 18095
670 Ga0495637_0001257 3300046520 Bacteria 15301
671 Ga0495637_0011453 3300046520 Bacteria 4262
672 Ga0495637_0032175 3300046520 Bacteria 2312
673 Ga0495637_0034692 3300046520 Bacteria 2207
674 Ga0495637_0049581 3300046520 Bacteria 1763
675 Ga0495637_0053019 3300046520 Bacteria 1690
676 Ga0495637_0061684 3300046520 Bacteria 1536
677 Ga0495637_0065337 3300046520 Bacteria 1481
678 Ga0495643_0013254 3300046522 Bacteria 4940
679 Ga0495643_0013745 3300046522 Bacteria 4834
680 Ga0495643_0036773 3300046522 Bacteria 2688
681 Ga0495643_0131405 3300046522 Bacteria 1256
682 Ga0495644_0003642 3300046523 Bacteria 6071
683 Ga0495644_0033380 3300046523 Bacteria 1944
684 Ga0495644_0050674 3300046523 Bacteria 1558
685 Ga0495648_0000631 3300046524 Bacteria 37603
686 Ga0495648_0000658 3300046524 Bacteria 36907
687 Ga0495648_0006890 3300046524 Bacteria 9169
688 Ga0495648_0024952 3300046524 Bacteria 4057
689 Ga0495648_0029550 3300046524 Bacteria 3636
690 Ga0495648_0042119 3300046524 Bacteria 2875
691 Ga0495648_0055717 3300046524 Bacteria 2382
692 Ga0495648_0069907 3300046524 Bacteria 2041
693 Ga0495666_0032046 3300046526 Bacteria 2574
694 Ga0495666_0033658 3300046526 Bacteria 2502
695 Ga0495642_0000062 3300046528 Bacteria 64285
696 Ga0495642_0001560 3300046528 Bacteria 10063
697 Ga0495642_0025481 3300046528 Bacteria 2344
698 Ga0495654_0000031 3300046530 Bacteria 206800
699 Ga0495654_0000342 3300046530 Bacteria 40679
700 Ga0495654_0000390 3300046530 Bacteria 37861
701 Ga0495654_0000871 3300046530 Bacteria 22688
702 Ga0495654_0003153 3300046530 Bacteria 10229
703 Ga0495654_0012736 3300046530 Bacteria 4514
704 Ga0495654_0020294 3300046530 Bacteria 3464
705 Ga0495654_0024002 3300046530 Bacteria 3154
706 Ga0495654_0025617 3300046530 Bacteria 3037
707 Ga0495654_0027344 3300046530 Bacteria 2925
708 Ga0495654_0033441 3300046530 Bacteria 2602
709 Ga0495654_0033855 3300046530 Bacteria 2582
710 Ga0495654_0071668 3300046530 Bacteria 1641
711 Ga0495654_0095000 3300046530 Bacteria 1378
712 Ga0495586_0076449 3300046535 Bacteria 1835
713 Ga0495587_0001642 3300046536 Bacteria 14918
714 Ga0495587_0015863 3300046536 Bacteria 4694
715 Ga0495609_0000035 3300046538 Bacteria 196269
716 Ga0495609_0000162 3300046538 Bacteria 69584
717 Ga0495609_0000260 3300046538 Bacteria 49574
718 Ga0495609_0000336 3300046538 Bacteria 41547
719 Ga0495609_0000569 3300046538 Bacteria 28968
720 Ga0495609_0017053 3300046538 Bacteria 3378
721 Ga0495609_0048566 3300046538 Bacteria 1896
722 Ga0495597_0000044 3300046542 Bacteria 106714
723 Ga0495597_0000548 3300046542 Bacteria 31172
724 Ga0495597_0000635 3300046542 Bacteria 28659
725 Ga0495597_0003574 3300046542 Bacteria 8967
726 Ga0495597_0003775 3300046542 Bacteria 8622
727 Ga0495597_0043125 3300046542 Bacteria 2010
728 Ga0495597_0055104 3300046542 Bacteria 1744
729 Ga0495622_0000192 3300046557 Bacteria 48889
730 Ga0495622_0002134 3300046557 Bacteria 9639
731 Ga0495622_0003287 3300046557 Bacteria 7644
732 Ga0495622_0009461 3300046557 Bacteria 4506
733 Ga0495622_0029287 3300046557 Bacteria 2572
734 Ga0495633_0000028 3300046558 Bacteria 203214
735 Ga0495633_0001006 3300046558 Bacteria 23042
736 Ga0495656_0000504 3300046615 Bacteria 12810
737 Ga0495668_0001623 3300046616 Bacteria 21013
738 Ga0495668_0012166 3300046616 Bacteria 5115
739 Ga0495634_0000980 3300046642 Bacteria 26953
740 Ga0495611_0001896 3300046648 Bacteria 9952
741 Ga0495611_0002520 3300046648 Bacteria 8330
742 Ga0495611_0003679 3300046648 Bacteria 6716
743 Ga0495625_0000004 3300046660 Bacteria 611314
744 Ga0495625_0001361 3300046660 Bacteria 30075
745 Ga0495625_0035983 3300046660 Bacteria 3643
746 Ga0495625_0111932 3300046660 Bacteria 1865
747 Ga0495625_0142754 3300046660 Bacteria 1614
748 Ga0495625_0207997 3300046660 Bacteria 1287
749 Ga0495635_0000093 3300046663 Bacteria 52786
750 Ga0495635_0029676 3300046663 Bacteria 3803
751 Ga0495659_0014355 3300046664 Bacteria 2591
752 Ga0495659_0032514 3300046664 Bacteria 1826
753 Ga0495661_0000006 3300046665 Bacteria 427288
754 Ga0495661_0000059 3300046665 Bacteria 131931
755 Ga0495661_0000401 3300046665 Bacteria 46171
756 Ga0495661_0000447 3300046665 Bacteria 43687
757 Ga0495661_0005121 3300046665 Bacteria 9345
758 Ga0495661_0008871 3300046665 Bacteria 6931
759 Ga0495661_0013957 3300046665 Bacteria 5387
760 Ga0495661_0020641 3300046665 Bacteria 4298
761 Ga0495661_0026629 3300046665 Bacteria 3723
762 Ga0495588_0002514 3300046674 Bacteria 7853
763 Ga0495623_0016238 3300046679 Bacteria 4808
764 Ga0495646_0007921 3300046680 Bacteria 6749
765 Ga0495646_0010893 3300046680 Bacteria 5776
766 Ga0495669_0000226 3300046684 Bacteria 33507
767 Ga0495624_0000155 3300046690 Bacteria 50145
768 Ga0495670_0002612 3300046691 Bacteria 8898
769 Ga0495670_0005481 3300046691 Bacteria 6227
770 Ga0495670_0056117 3300046691 Bacteria 1975
771 Ga0495671_0000259 3300046692 Bacteria 44835
772 Ga0495671_0000600 3300046692 Bacteria 26585
773 Ga0495671_0001418 3300046692 Bacteria 16112
774 Ga0495671_0003705 3300046692 Bacteria 9293
775 Ga0495671_0004771 3300046692 Bacteria 8011
776 Ga0495671_0023800 3300046692 Bacteria 3197
777 Ga0495671_0025190 3300046692 Bacteria 3093
778 Ga0495671_0028106 3300046692 Bacteria 2899
779 Ga0495671_0053302 3300046692 Bacteria 2007
780 Ga0495671_0055896 3300046692 Bacteria 1955
781 Ga0495671_0070390 3300046692 Bacteria 1718
782 Ga0495649_0001079 3300046694 Bacteria 21270
783 Ga0495649_0003172 3300046694 Bacteria 11243
784 Ga0495649_0003193 3300046694 Bacteria 11204
785 Ga0495649_0004813 3300046694 Bacteria 8741
786 Ga0495649_0018440 3300046694 Bacteria 3926
787 Ga0495649_0025858 3300046694 Bacteria 3268
788 Ga0495649_0059868 3300046694 Bacteria 2049
789 Ga0495649_0062229 3300046694 Bacteria 2006
790 Ga0495649_0094706 3300046694 Bacteria 1589
791 Ga0495649_0149677 3300046694 Bacteria 1226
792 Ga0495589_0000005 3300046794 Bacteria 405112
793 Ga0495589_0000221 3300046794 Bacteria 48417
794 Ga0495589_0000617 3300046794 Bacteria 23849
795 Ga0495589_0001245 3300046794 Bacteria 15069
796 Ga0495589_0003225 3300046794 Bacteria 8899
797 Ga0495589_0004916 3300046794 Bacteria 7082
798 Ga0495589_0030524 3300046794 Bacteria 2714
799 Ga0495600_0102868 3300046809 Bacteria 1861
800 Ga0495660_0000013 3300046810 Bacteria 350283
801 Ga0495660_0000034 3300046810 Bacteria 201261
802 Ga0495660_0000505 3300046810 Bacteria 32144
803 Ga0495660_0001125 3300046810 Bacteria 19057
804 Ga0495660_0049753 3300046810 Bacteria 2286
805 Ga0495660_0054871 3300046810 Bacteria 2158
806 Ga0495660_0089289 3300046810 Bacteria 1604
807 Ga0495660_0114176 3300046810 Bacteria 1374
808 Ga0495581_0105851 3300047315 Bacteria 1635
809 Ga0495604_0012379 3300047317 Bacteria 6781
810 Ga0495636_0000040 3300047318 Bacteria 55863
811 Ga0495674_0057866 3300047319 Bacteria 3391
812 Ga0495672_0000029 3300047320 Bacteria 305231
813 Ga0495672_0000051 3300047320 Bacteria 237883
814 Ga0495672_0000054 3300047320 Bacteria 230777
815 Ga0495672_0001781 3300047320 Bacteria 20671
816 Ga0495672_0011396 3300047320 Bacteria 6278
817 Ga0495672_0016285 3300047320 Bacteria 5017
818 Ga0495672_0016551 3300047320 Bacteria 4962
819 Ga0495672_0024492 3300047320 Bacteria 3885
820 Ga0495672_0037237 3300047320 Bacteria 2979
821 Ga0495672_0038253 3300047320 Bacteria 2928
822 Ga0495672_0051740 3300047320 Bacteria 2417
823 Ga0495672_0103361 3300047320 Bacteria 1541
824 Ga0495676_0000004 3300047321 Bacteria 313696
825 Ga0495680_0010142 3300047322 Bacteria 8419
826 Ga0495680_0011543 3300047322 Bacteria 7815
827 Ga0495680_0061258 3300047322 Bacteria 2895
828 Ga0495683_0000033 3300047323 Bacteria 149031
829 Ga0495683_0000091 3300047323 Bacteria 91313
830 Ga0495683_0000281 3300047323 Bacteria 44019
831 Ga0495683_0021476 3300047323 Bacteria 3325
832 Ga0495683_0034957 3300047323 Bacteria 2554
833 Ga0495683_0136651 3300047323 Bacteria 1151
834 Ga0495687_000469 3300047443 Bacteria 48871
835 Ga0495687_000778 3300047443 Bacteria 34407
836 Ga0495687_002429 3300047443 Bacteria 14977
837 Ga0495675_0029015 3300047444 Bacteria 3526
838 Ga0495675_0085775 3300047444 Bacteria 1979
839 Ga0495677_0006008 3300047445 Bacteria 4592
840 Ga0495679_000014 3300047446 Bacteria 292767
841 Ga0495679_000083 3300047446 Bacteria 87051
842 Ga0495679_000461 3300047446 Bacteria 29942
843 Ga0495679_004274 3300047446 Bacteria 6630
844 Ga0495679_004623 3300047446 Bacteria 6274
845 Ga0495679_011546 3300047446 Bacteria 3402
846 Ga0495679_023045 3300047446 Bacteria 2119
847 Ga0495685_012178 3300047447 Bacteria 2912
848 Ga0495673_0000047 3300047469 Bacteria 266522
849 Ga0495673_0000181 3300047469 Bacteria 101432
850 Ga0495673_0000572 3300047469 Bacteria 37126
851 Ga0495673_0000686 3300047469 Bacteria 33123
852 Ga0495673_0000788 3300047469 Bacteria 29824
853 Ga0495673_0000820 3300047469 Bacteria 29164
854 Ga0495673_0001593 3300047469 Bacteria 17683
855 Ga0495673_0004150 3300047469 Bacteria 9164
856 Ga0495673_0039986 3300047469 Bacteria 2123
857 Ga0495673_0043763 3300047469 Bacteria 2001
858 Ga0495673_0053781 3300047469 Bacteria 1753
859 Ga0495673_0085087 3300047469 Bacteria 1302
860 Ga0495681_0004349 3300047470 Bacteria 9688
861 Ga0495681_0005920 3300047470 Bacteria 8110
862 Ga0495681_0009043 3300047470 Bacteria 6175
863 Ga0495681_0022117 3300047470 Bacteria 3410
864 Ga0495681_0022644 3300047470 Bacteria 3357
865 Ga0495681_0030339 3300047470 Bacteria 2754
866 Ga0495681_0032312 3300047470 Bacteria 2636
867 Ga0495681_0038867 3300047470 Bacteria 2328
868 Ga0495681_0042745 3300047470 Bacteria 2191
869 Ga0495681_0043667 3300047470 Bacteria 2159
870 Ga0495681_0056625 3300047470 Bacteria 1823
871 Ga0495681_0062240 3300047470 Bacteria 1716
872 Ga0495681_0070287 3300047470 Bacteria 1587
873 Ga0495684_0018999 3300047471 Bacteria 5291
874 Ga0495686_0000252 3300047472 Bacteria 96182
875 Ga0495686_0044409 3300047472 Bacteria 2813
876 Ga0495593_0022607 3300047673 Bacteria 3501
877 Ga0495626_0000173 3300048091 Bacteria 79835
878 Ga0495626_0000302 3300048091 Bacteria 52509
879 Ga0495626_0000469 3300048091 Bacteria 41116
880 Ga0495626_0000579 3300048091 Bacteria 36297
881 Ga0495626_0002795 3300048091 Bacteria 11706
882 Ga0495626_0006768 3300048091 Bacteria 6480
883 Ga0495626_0025732 3300048091 Bacteria 2874
884 Ga0495626_0058032 3300048091 Bacteria 1770
885 Ga0496101_0000123 3300048904 Bacteria 75836
886 Ga0496101_0093010 3300048904 Bacteria 2246
887 Ga0496102_0000781 3300048905 Bacteria 31008
888 Ga0496102_0004986 3300048905 Bacteria 11244
889 Ga0496103_0028765 3300048906 Bacteria 3375
890 Ga0496103_0062817 3300048906 Bacteria 2312
891 Ga0496104_0004669 3300048907 Bacteria 11920
892 Ga0496104_0439975 3300048907 Bacteria 1216
893 Ga0496105_0021587 3300048908 Bacteria 5211
894 Ga0496110_0345209 3300048913 Bacteria 1356
895 Ga0496112_0043774 3300048915 Bacteria 4384
896 Ga0496114_0022077 3300048917 Bacteria 5183
897 Ga0496115_0090249 3300048918 Bacteria 2503
898 Ga0496116_0000015 3300048919 Bacteria 560702
899 Ga0496116_0000016 3300048919 Bacteria 555146
900 Ga0496116_0000217 3300048919 Bacteria 108128
901 Ga0496116_0000574 3300048919 Bacteria 49172
902 Ga0496116_0001156 3300048919 Bacteria 31157
903 Ga0496116_0002461 3300048919 Bacteria 19416
904 Ga0496116_0004729 3300048919 Bacteria 12861
905 Ga0496116_0022832 3300048919 Bacteria 4674
906 Ga0496116_0051296 3300048919 Bacteria 2741
907 Ga0496116_0067088 3300048919 Bacteria 2293
908 Ga0496116_0107545 3300048919 Bacteria 1648
909 Ga0496117_0000103 3300048920 Bacteria 189316
910 Ga0496117_0000238 3300048920 Bacteria 104303
911 Ga0496117_0001296 3300048920 Bacteria 36823
912 Ga0496117_0002432 3300048920 Bacteria 23541
913 Ga0496117_0003210 3300048920 Bacteria 19333
914 Ga0496117_0004436 3300048920 Bacteria 15484
915 Ga0496117_0006695 3300048920 Bacteria 11520
916 Ga0496117_0006936 3300048920 Bacteria 11227
917 Ga0496117_0007956 3300048920 Bacteria 10183
918 Ga0496117_0020301 3300048920 Bacteria 5419
919 Ga0496117_0033079 3300048920 Bacteria 3916
920 Ga0496117_0050855 3300048920 Bacteria 2935
921 Ga0496117_0052055 3300048920 Bacteria 2887
922 Ga0496117_0123053 3300048920 Bacteria 1589
923 Ga0496117_0127791 3300048920 Bacteria 1547
924 Ga0496117_0139260 3300048920 Bacteria 1456
925 Ga0496117_0147387 3300048920 Bacteria 1398
926 Ga0496118_0000046 3300048921 Bacteria 271783
927 Ga0496118_0000959 3300048921 Bacteria 45037
928 Ga0496118_0001062 3300048921 Bacteria 42938
929 Ga0496118_0002877 3300048921 Bacteria 22448
930 Ga0496118_0019224 3300048921 Bacteria 6113
931 Ga0496118_0032073 3300048921 Bacteria 4338
932 Ga0496118_0039355 3300048921 Bacteria 3774
933 Ga0496118_0050528 3300048921 Bacteria 3189
934 Ga0496118_0091542 3300048921 Bacteria 2091
935 Ga0496118_0145316 3300048921 Bacteria 1494
936 Ga0496119_0000026 3300048922 Bacteria 254759
937 Ga0496119_0000031 3300048922 Bacteria 239685
938 Ga0496119_0000086 3300048922 Bacteria 137053
939 Ga0496119_0000270 3300048922 Bacteria 73810
940 Ga0496119_0005618 3300048922 Bacteria 11925
941 Ga0496119_0005727 3300048922 Bacteria 11775
942 Ga0496119_0007715 3300048922 Bacteria 9621
943 Ga0496119_0007722 3300048922 Bacteria 9614
944 Ga0496119_0013656 3300048922 Bacteria 6445
945 Ga0496119_0016128 3300048922 Bacteria 5706
946 Ga0496119_0021763 3300048922 Bacteria 4618
947 Ga0496119_0037132 3300048922 Bacteria 3169
948 Ga0496120_0000017 3300048923 Bacteria 269222
949 Ga0496120_0000130 3300048923 Bacteria 127368
950 Ga0496120_0000344 3300048923 Bacteria 76805
951 Ga0496120_0000361 3300048923 Bacteria 73810
952 Ga0496120_0001012 3300048923 Bacteria 37715
953 Ga0496120_0001279 3300048923 Bacteria 31425
954 Ga0496120_0001280 3300048923 Bacteria 31420
955 Ga0496120_0002535 3300048923 Bacteria 18240
956 Ga0496120_0004434 3300048923 Bacteria 11774
957 Ga0496120_0007521 3300048923 Bacteria 8087
958 Ga0496120_0009560 3300048923 Bacteria 6861
959 Ga0496120_0115219 3300048923 Bacteria 1397
960 Ga0496121_0000299 3300048924 Bacteria 103000
961 Ga0496121_0001130 3300048924 Bacteria 46848
962 Ga0496121_0003112 3300048924 Bacteria 23982
963 Ga0496121_0004378 3300048924 Bacteria 19076
964 Ga0496121_0004701 3300048924 Bacteria 18089
965 Ga0496121_0007020 3300048924 Bacteria 13680
966 Ga0496121_0007313 3300048924 Bacteria 13353
967 Ga0496121_0047057 3300048924 Bacteria 3683
968 Ga0496121_0072537 3300048924 Bacteria 2763
969 Ga0496121_0198182 3300048924 Bacteria 1433
970 Ga0496122_0000075 3300048925 Bacteria 219099
971 Ga0496122_0000125 3300048925 Bacteria 179659
972 Ga0496122_0000156 3300048925 Bacteria 160178
973 Ga0496122_0001095 3300048925 Bacteria 46975
974 Ga0496122_0002193 3300048925 Bacteria 28526
975 Ga0496122_0008894 3300048925 Bacteria 10702
976 Ga0496122_0010035 3300048925 Bacteria 9852
977 Ga0496122_0014085 3300048925 Bacteria 7761
978 Ga0496122_0033711 3300048925 Bacteria 4205
979 Ga0496122_0035757 3300048925 Bacteria 4033
980 Ga0496122_0038666 3300048925 Bacteria 3816
981 Ga0496122_0066774 3300048925 Bacteria 2595
982 Ga0496122_0077106 3300048925 Bacteria 2343
983 Ga0496123_0000019 3300048926 Bacteria 400216
984 Ga0496123_0000087 3300048926 Bacteria 182994
985 Ga0496123_0000092 3300048926 Bacteria 179551
986 Ga0496123_0000377 3300048926 Bacteria 83811
987 Ga0496123_0000774 3300048926 Bacteria 51762
988 Ga0496123_0001657 3300048926 Bacteria 29899
989 Ga0496123_0003302 3300048926 Bacteria 18282
990 Ga0496123_0003347 3300048926 Bacteria 18138
991 Ga0496123_0011307 3300048926 Bacteria 7756
992 Ga0496123_0020170 3300048926 Bacteria 5223
993 Ga0496123_0022363 3300048926 Bacteria 4874
994 Ga0496123_0045186 3300048926 Bacteria 3003
995 Ga0496123_0061320 3300048926 Bacteria 2417
996 Ga0496123_0114334 3300048926 Bacteria 1534
997 Ga0496124_0000031 3300048927 Bacteria 344232
998 Ga0496124_0000058 3300048927 Bacteria 242191
999 Ga0496124_0000142 3300048927 Bacteria 147311
1000 Ga0496124_0000238 3300048927 Bacteria 106881
1001 Ga0496124_0000965 3300048927 Bacteria 45797
1002 Ga0496124_0003235 3300048927 Bacteria 20114
1003 Ga0496124_0006756 3300048927 Bacteria 12399
1004 Ga0496124_0007209 3300048927 Bacteria 11878
1005 Ga0496124_0008497 3300048927 Bacteria 10725
1006 Ga0496124_0009650 3300048927 Bacteria 9887
1007 Ga0496124_0025262 3300048927 Bacteria 5383
1008 Ga0496124_0085529 3300048927 Bacteria 2584
1009 Ga0496124_0086011 3300048927 Bacteria 2575
1010 Ga0496124_0118735 3300048927 Bacteria 2116
1011 Ga0496124_0139543 3300048927 Bacteria 1914
1012 Ga0496124_0148706 3300048927 Bacteria 1840
1013 Ga0496124_0239685 3300048927 Bacteria 1349
1014 Ga0496125_0000032 3300048928 Bacteria 354078
1015 Ga0496125_0001495 3300048928 Bacteria 33502
1016 Ga0496125_0012006 3300048928 Bacteria 8625
1017 Ga0496125_0013982 3300048928 Bacteria 7847
1018 Ga0496125_0017828 3300048928 Bacteria 6755
1019 Ga0496125_0018128 3300048928 Bacteria 6691
1020 Ga0496125_0018546 3300048928 Bacteria 6608
1021 Ga0496125_0041636 3300048928 Bacteria 3924
1022 Ga0496125_0217167 3300048928 Bacteria 1235
1023 Ga0496126_0000109 3300048929 Bacteria 196717
1024 Ga0496126_0017795 3300048929 Bacteria 7073
1025 Ga0496126_0079934 3300048929 Bacteria 2893
1026 Ga0496126_0080089 3300048929 Bacteria 2890
1027 Ga0496126_0117729 3300048929 Bacteria 2307
1028 Ga0496126_0188847 3300048929 Bacteria 1746
1029 Ga0496126_0189336 3300048929 Bacteria 1743
1030 Ga0496126_0215381 3300048929 Bacteria 1615
1031 Ga0496126_0349505 3300048929 Bacteria 1209
1032 Ga0495678_000020 3300049459 Bacteria 253654
1033 Ga0495678_000137 3300049459 Bacteria 87580
1034 Ga0495678_000984 3300049459 Bacteria 24399
1035 Ga0495678_002700 3300049459 Bacteria 11701
1036 Ga0495678_003761 3300049459 Bacteria 9165
1037 Ga0495678_012190 3300049459 Bacteria 4082
1038 Ga0495678_017048 3300049459 Bacteria 3302
1039 Ga0495678_023802 3300049459 Bacteria 2655
1040 Ga0495678_041097 3300049459 Bacteria 1853
1041 Ga0495678_047329 3300049459 Bacteria 1684
1042 Ga0495678_049803 3300049459 Bacteria 1626
1043 Ga0495682_0000003 3300049460 Bacteria 515787
1044 Ga0495682_0000304 3300049460 Bacteria 37379
1045 Ga0495682_0000492 3300049460 Bacteria 27338
1046 Ga0495682_0000550 3300049460 Bacteria 25848
1047 Ga0501034_0000200 3300049571 Bacteria 113556
1048 Ga0501040_0000028 3300049576 Bacteria 64790
1049 Ga0501042_0000283 3300049578 Bacteria 24988
1050 Ga0501241_001640 3300049758 Bacteria 4481
1051 Ga0501226_000009 3300049853 Bacteria 194138
1052 nmdc:mga00v17_186920_c1 3300050491 Bacteria 1337
1053 nmdc:mga00v17_78003_c1 3300050491 Bacteria 2064
1054 nmdc:mga0k408_2713_c1 3300050493 Bacteria 9399
1055 Ga0500643_006973 3300053087 Bacteria 4635
1056 Ga0500621_000006 3300053126 Bacteria 245480

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10032116 rootH2_100321166 277
2 3300046530 Ga0495654_0095000 Ga0495654_0095000_521_1360 279
3 3300036712 Ga0316584_0040155 Ga0316584_0040155_2436_3383 284
4 3300005290 Ga0065712_10068141 Ga0065712_100681411 286
5 3300031548 Ga0307408_100051870 Ga0307408_1000518703 287
6 3300031901 Ga0307406_10187332 Ga0307406_101873322 287
7 3300047472 Ga0495686_0000252 Ga0495686_0000252_34796_35794 288
8 3300006946 Ga0079104_1000213 Ga0079104_100021311 289
9 3300006948 Ga0099826_10007176 Ga0099826_100071762 289
10 3300015261 Ga0182006_1041062 Ga0182006_10410622 289
11 3300027111 Ga0209281_1000011 Ga0209281_1000011107 289
12 3300027666 Ga0209282_1024480 Ga0209282_10244801 289
13 3300046453 Ga0495627_003276 Ga0495627_003276_2555_3487 293
14 3300046458 Ga0495591_007119 Ga0495591_007119_3592_4524 293
15 3300046471 Ga0495650_0055931 Ga0495650_0055931_449_1381 293
16 3300046474 Ga0495605_0000036 Ga0495605_0000036_99968_100900 293
17 3300046506 Ga0495583_0000028 Ga0495583_0000028_113217_114149 293
18 3300046512 Ga0495610_0004363 Ga0495610_0004363_1096_2028 293
19 3300046515 Ga0495620_0000073 Ga0495620_0000073_12775_13707 293
20 3300046518 Ga0495631_0023709 Ga0495631_0023709_612_1544 293
21 3300046524 Ga0495648_0024952 Ga0495648_0024952_2345_3277 293
22 3300046530 Ga0495654_0000871 Ga0495654_0000871_16833_17765 293
23 3300046538 Ga0495609_0000569 Ga0495609_0000569_21360_22292 293
24 3300046542 Ga0495597_0000635 Ga0495597_0000635_27273_28205 293
25 3300046558 Ga0495633_0000028 Ga0495633_0000028_133813_134745 293
26 3300046648 Ga0495611_0002520 Ga0495611_0002520_3666_4598 293
27 3300046665 Ga0495661_0000401 Ga0495661_0000401_42685_43617 293
28 3300046691 Ga0495670_0002612 Ga0495670_0002612_516_1448 293
29 3300046692 Ga0495671_0023800 Ga0495671_0023800_1114_2046 293
30 3300046794 Ga0495589_0001245 Ga0495589_0001245_10405_11337 293
31 3300047323 Ga0495683_0000091 Ga0495683_0000091_20659_21591 293
32 3300047446 Ga0495679_000083 Ga0495679_000083_16691_17623 293
33 3300047470 Ga0495681_0030339 Ga0495681_0030339_391_1323 293
34 3300048926 Ga0496123_0020170 Ga0496123_0020170_3044_3976 293
35 3300049459 Ga0495678_000020 Ga0495678_000020_111320_112252 293
36 3300046453 Ga0495627_000051 Ga0495627_000051_49108_50034 295
37 3300046471 Ga0495650_0000572 Ga0495650_0000572_410_1336 295
38 3300046474 Ga0495605_0000222 Ga0495605_0000222_18847_19842 295
39 3300046501 Ga0495607_0000598 Ga0495607_0000598_53_979 295
40 3300046506 Ga0495583_0000561 Ga0495583_0000561_21381_22442 295
41 3300046506 Ga0495583_0002394 Ga0495583_0002394_12272_13198 295
42 3300046512 Ga0495610_0003738 Ga0495610_0003738_175_1236 295
43 3300046519 Ga0495632_0000449 Ga0495632_0000449_27194_28120 295
44 3300046520 Ga0495637_0034692 Ga0495637_0034692_410_1336 295
45 3300046538 Ga0495609_0000162 Ga0495609_0000162_32616_33542 295
46 3300046616 Ga0495668_0012166 Ga0495668_0012166_619_1545 295
47 3300046665 Ga0495661_0000059 Ga0495661_0000059_101863_102924 295
48 3300046810 Ga0495660_0001125 Ga0495660_0001125_442_1368 295
49 3300047469 Ga0495673_0000181 Ga0495673_0000181_4669_5595 295
50 3300047469 Ga0495673_0085087 Ga0495673_0085087_316_1242 295
51 3300027378 Ga0209981_1007774 Ga0209981_10077742 296
52 3300042013 Ga0439456_000070 Ga0439456_000070_14686_15612 296
53 3300009036 Ga0105244_10013077 Ga0105244_100130773 297
54 3300025728 Ga0207655_1004562 Ga0207655_10045622 297
55 3300037418 Ga0395900_0011285 Ga0395900_0011285_1931_2884 297
56 3300037466 Ga0395898_0001760 Ga0395898_0001760_19304_20257 297
57 3300038443 Ga0395901_0007079 Ga0395901_0007079_5214_6167 297
58 3300046519 Ga0495632_0000460 Ga0495632_0000460_23088_24014 297
59 3300047320 Ga0495672_0038253 Ga0495672_0038253_590_1513 297
60 3300048919 Ga0496116_0067088 Ga0496116_0067088_1266_2192 297
61 3300048920 Ga0496117_0001296 Ga0496117_0001296_14817_15743 297
62 3300027312 Ga0209371_1000245 Ga0209371_100024547 298
63 3300027665 Ga0209983_1001336 Ga0209983_10013363 298
64 3300030500 Ga0268256_1000201 Ga0268256_100020147 298
65 3300032004 Ga0307414_10102170 Ga0307414_101021703 298
66 3300046492 Ga0495585_0040706 Ga0495585_0040706_16_912 298
67 3300009011 Ga0105251_10000158 Ga0105251_1000015818 299
68 3300015265 Ga0182005_1009980 Ga0182005_10099802 299
69 3300025728 Ga0207655_1026669 Ga0207655_10266693 299
70 3300025735 Ga0207713_1000058 Ga0207713_1000058126 299
71 3300046453 Ga0495627_013784 Ga0495627_013784_1345_2271 299
72 3300046457 Ga0495590_0011582 Ga0495590_0011582_1608_2534 299
73 3300046458 Ga0495591_000037 Ga0495591_000037_153369_154295 299
74 3300046458 Ga0495591_000720 Ga0495591_000720_13215_14141 299
75 3300046458 Ga0495591_008225 Ga0495591_008225_1416_2519 299
76 3300046458 Ga0495591_023066 Ga0495591_023066_741_1667 299
77 3300046458 Ga0495591_023751 Ga0495591_023751_227_1285 299
78 3300046471 Ga0495650_0001745 Ga0495650_0001745_5966_7024 299
79 3300046474 Ga0495605_0000871 Ga0495605_0000871_653_1579 299
80 3300046474 Ga0495605_0001613 Ga0495605_0001613_11311_12237 299
81 3300046474 Ga0495605_0002842 Ga0495605_0002842_1709_2767 299
82 3300046491 Ga0495584_0056186 Ga0495584_0056186_685_1743 299
83 3300046500 Ga0495596_0024186 Ga0495596_0024186_184_1242 299
84 3300046501 Ga0495607_0000335 Ga0495607_0000335_15006_15932 299
85 3300046501 Ga0495607_0000685 Ga0495607_0000685_22714_23640 299
86 3300046501 Ga0495607_0006458 Ga0495607_0006458_6737_7762 299
87 3300046501 Ga0495607_0017817 Ga0495607_0017817_1259_2185 299
88 3300046506 Ga0495583_0001188 Ga0495583_0001188_13685_14743 299
89 3300046506 Ga0495583_0002128 Ga0495583_0002128_7641_8567 299
90 3300046506 Ga0495583_0003507 Ga0495583_0003507_6258_7184 299
91 3300046507 Ga0495606_0000094 Ga0495606_0000094_13477_14403 299
92 3300046507 Ga0495606_0000958 Ga0495606_0000958_26115_27173 299
93 3300046507 Ga0495606_0002787 Ga0495606_0002787_18427_19353 299
94 3300046512 Ga0495610_0002667 Ga0495610_0002667_8855_9913 299
95 3300046515 Ga0495620_0001062 Ga0495620_0001062_13586_14512 299
96 3300046515 Ga0495620_0034109 Ga0495620_0034109_487_1545 299
97 3300046518 Ga0495631_0002981 Ga0495631_0002981_429_1355 299
98 3300046518 Ga0495631_0003965 Ga0495631_0003965_1094_2152 299
99 3300046519 Ga0495632_0006942 Ga0495632_0006942_5947_7005 299
100 3300046520 Ga0495637_0000015 Ga0495637_0000015_202349_203407 299
101 3300046520 Ga0495637_0001257 Ga0495637_0001257_13007_13933 299
102 3300046520 Ga0495637_0065337 Ga0495637_0065337_489_1415 299
103 3300046523 Ga0495644_0050674 Ga0495644_0050674_14_940 299
104 3300046524 Ga0495648_0000631 Ga0495648_0000631_28616_29719 299
105 3300046530 Ga0495654_0024002 Ga0495654_0024002_1375_2433 299
106 3300046530 Ga0495654_0027344 Ga0495654_0027344_1739_2842 299
107 3300046538 Ga0495609_0000035 Ga0495609_0000035_183945_185003 299
108 3300046538 Ga0495609_0048566 Ga0495609_0048566_397_1323 299
109 3300046542 Ga0495597_0000044 Ga0495597_0000044_87683_88609 299
110 3300046557 Ga0495622_0003287 Ga0495622_0003287_4750_5808 299
111 3300046648 Ga0495611_0003679 Ga0495611_0003679_3418_4476 299
112 3300046660 Ga0495625_0000004 Ga0495625_0000004_194707_195714 299
113 3300046665 Ga0495661_0000006 Ga0495661_0000006_28074_29132 299
114 3300046665 Ga0495661_0008871 Ga0495661_0008871_4217_5320 299
115 3300046665 Ga0495661_0026629 Ga0495661_0026629_342_1268 299
116 3300046692 Ga0495671_0000600 Ga0495671_0000600_6657_7583 299
117 3300046692 Ga0495671_0053302 Ga0495671_0053302_233_1291 299
118 3300046694 Ga0495649_0059868 Ga0495649_0059868_238_1296 299
119 3300046810 Ga0495660_0049753 Ga0495660_0049753_687_1613 299
120 3300046810 Ga0495660_0114176 Ga0495660_0114176_84_1142 299
121 3300047320 Ga0495672_0016285 Ga0495672_0016285_2122_3225 299
122 3300047320 Ga0495672_0051740 Ga0495672_0051740_416_1474 299
123 3300047321 Ga0495676_0000004 Ga0495676_0000004_271779_272837 299
124 3300047323 Ga0495683_0000033 Ga0495683_0000033_54047_54973 299
125 3300047446 Ga0495679_000461 Ga0495679_000461_10035_11093 299
126 3300047446 Ga0495679_023045 Ga0495679_023045_13_939 299
127 3300047469 Ga0495673_0000572 Ga0495673_0000572_28301_29404 299
128 3300047469 Ga0495673_0001593 Ga0495673_0001593_482_1408 299
129 3300047469 Ga0495673_0039986 Ga0495673_0039986_104_1030 299
130 3300047470 Ga0495681_0038867 Ga0495681_0038867_654_1712 299
131 3300048091 Ga0495626_0000173 Ga0495626_0000173_23926_24984 299
132 3300048913 Ga0496110_0345209 Ga0496110_0345209_395_1321 299
133 3300048915 Ga0496112_0043774 Ga0496112_0043774_2519_3445 299
134 3300048924 Ga0496121_0004378 Ga0496121_0004378_4727_5653 299
135 3300048925 Ga0496122_0000156 Ga0496122_0000156_106909_107835 299
136 3300048925 Ga0496122_0033711 Ga0496122_0033711_1610_2536 299
137 3300048926 Ga0496123_0000087 Ga0496123_0000087_74958_75884 299
138 3300048926 Ga0496123_0045186 Ga0496123_0045186_81_1007 299
139 3300048927 Ga0496124_0000031 Ga0496124_0000031_71071_71997 299
140 3300048927 Ga0496124_0008497 Ga0496124_0008497_7167_8093 299
141 3300048927 Ga0496124_0118735 Ga0496124_0118735_336_1262 299
142 3300049459 Ga0495678_000137 Ga0495678_000137_13735_14661 299
143 3300049459 Ga0495678_002700 Ga0495678_002700_7894_8820 299
144 3300049459 Ga0495678_012190 Ga0495678_012190_1433_2491 299
145 3300049460 Ga0495682_0000550 Ga0495682_0000550_11333_12259 299
146 3300031548 Ga0307408_100000018 Ga0307408_100000018200 300
147 3300046492 Ga0495585_0000473 Ga0495585_0000473_2114_3040 300
148 3300046501 Ga0495607_0008559 Ga0495607_0008559_5306_6331 300
149 3300046665 Ga0495661_0000447 Ga0495661_0000447_14427_15353 300
150 3300046810 Ga0495660_0000505 Ga0495660_0000505_9219_10145 300
151 3300048904 Ga0496101_0093010 Ga0496101_0093010_1302_2228 300
152 3300048924 Ga0496121_0003112 Ga0496121_0003112_18523_19449 300
153 3300046524 Ga0495648_0000658 Ga0495648_0000658_573_1499 301
154 iso_pu_bacteria 2565956521 2566036693 301
155 iso_pu_bacteria 2648501241 2649118725 301
156 iso_pu_bacteria 2651869818 2652976142 301
157 iso_pu_bacteria 2990196909 2990199140 301
158 iso_pu_bacteria 8002745576 8002746323 301
159 3300042156 Ga0439446_0000053 Ga0439446_0000053_16521_17447 302
160 iso_pu_bacteria 2506520007 2506576663 302
161 iso_pu_bacteria 2506520008 2506581801 302
162 iso_pu_bacteria 2508501071 2508850607 302
163 iso_pu_bacteria 2511231025 2511381898 302
164 iso_pu_bacteria 2511231035 2511432762 302
165 iso_pu_bacteria 2537561728 2538427034 302
166 iso_pu_bacteria 2547132181 2547696553 302
167 iso_pu_bacteria 2554235234 2555261992 302
168 iso_pu_bacteria 2561511199 2562465919 302
169 iso_pu_bacteria 2585427591 2585826192 302
170 iso_pu_bacteria 2585427592 2585830778 302
171 iso_pu_bacteria 2599185169 2599412868 302
172 iso_pu_bacteria 2599185299 2599928149 302
173 iso_pu_bacteria 2600255254 2601525661 302
174 iso_pu_bacteria 2600255255 2601530730 302
175 iso_pu_bacteria 2600255256 2601533961 302
176 iso_pu_bacteria 2600255257 2601540129 302
177 iso_pu_bacteria 2600255280 2601617781 302
178 iso_pu_bacteria 2600255281 2601622816 302
179 iso_pu_bacteria 2600255287 2601644639 302
180 iso_pu_bacteria 2600255288 2601651089 302
181 iso_pu_bacteria 2600255289 2601656138 302
182 iso_pu_bacteria 2600255290 2601661062 302
183 iso_pu_bacteria 2600255291 2601664804 302
184 iso_pu_bacteria 2600255298 2601697328 302
185 iso_pu_bacteria 2600255299 2601702716 302
186 iso_pu_bacteria 2600255300 2601708904 302
187 iso_pu_bacteria 2600255301 2601713942 302
188 iso_pu_bacteria 2600255302 2601718987 302
189 iso_pu_bacteria 2600255303 2601722625 302
190 iso_pu_bacteria 2600255304 2601728892 302
191 iso_pu_bacteria 2600255305 2601733933 302
192 iso_pu_bacteria 2600255306 2601738909 302
193 iso_pu_bacteria 2600255307 2601743283 302
194 iso_pu_bacteria 2600255309 2601754409 302
195 iso_pu_bacteria 2600255310 2601758888 302
196 iso_pu_bacteria 2600255311 2601762762 302
197 iso_pu_bacteria 2600255392 2602021350 302
198 iso_pu_bacteria 2602042046 2603640614 302
199 iso_pu_bacteria 2602042047 2603644600 302
200 iso_pu_bacteria 2602042052 2603662879 302
201 iso_pu_bacteria 2602042053 2603667776 302
202 iso_pu_bacteria 2602042066 2603700455 302
203 iso_pu_bacteria 2602042067 2603705935 302
204 iso_pu_bacteria 2602042103 2603841458 302
205 iso_pu_bacteria 2602042104 2603846413 302
206 iso_pu_bacteria 2602042105 2603851488 302
207 iso_pu_bacteria 2602042106 2603856671 302
208 iso_pu_bacteria 2602042109 2603868520 302
209 iso_pu_bacteria 2602042110 2603874135 302
210 iso_pu_bacteria 2602042111 2603878585 302
211 iso_pu_bacteria 2603880178 2606051430 302
212 iso_pu_bacteria 2603880184 2606072293 302
213 iso_pu_bacteria 2603880202 2606149116 302
214 iso_pu_bacteria 2603880211 2606179206 302
215 iso_pu_bacteria 2608642108 2608670514 302
216 iso_pu_bacteria 2609459761 2609911981 302
217 iso_pu_bacteria 2636415599 2637227164 302
218 iso_pu_bacteria 2648501693 2650900195 302
219 iso_pu_bacteria 2654587920 2656276440 302
220 iso_pu_bacteria 2667528172 2671103708 302
221 iso_pu_bacteria 2667528173 2671106501 302
222 iso_pu_bacteria 2671180115 2671586862 302
223 iso_pu_bacteria 2675903046 2676409870 302
224 iso_pu_bacteria 2681812866 2681996847 302
225 iso_pu_bacteria 2681812869 2682008628 302
226 iso_pu_bacteria 2684622997 2686354434 302
227 iso_pu_bacteria 2687453601 2689443042 302
228 iso_pu_bacteria 2690315857 2691331010 302
229 iso_pu_bacteria 2706794495 2707098366 302
230 iso_pu_bacteria 2711768156 2712471211 302
231 iso_pu_bacteria 2751185917 2753854566 302
232 iso_pu_bacteria 2765235842 2765587425 302
233 iso_pu_bacteria 2772190666 2772437200 302
234 iso_pu_bacteria 2775506706 2775540813 302
235 iso_pu_bacteria 2775507074 2777021562 302
236 iso_pu_bacteria 2791354903 2791924248 302
237 iso_pu_bacteria 2791355010 2792313328 302
238 iso_pu_bacteria 2791355275 2793406927 302
239 iso_pu_bacteria 2806310673 2807177953 302
240 iso_pu_bacteria 2808606414 2809124278 302
241 iso_pu_bacteria 2811995292 2813730625 302
242 iso_pu_bacteria 2814123068 2814698232 302
243 iso_pu_bacteria 2821118458 2821121427 302
244 iso_pu_bacteria 2823373977 2823377456 302
245 iso_pu_bacteria 2844425489 2844426117 302
246 iso_pu_bacteria 2844528606 2844532590 302
247 iso_pu_bacteria 2846540461 2846542350 302
248 iso_pu_bacteria 2847085930 2847089109 302
249 iso_pu_bacteria 2847797336 2847801287 302
250 iso_pu_bacteria 2852103415 2852106175 302
251 iso_pu_bacteria 2854601825 2854601948 302
252 iso_pu_bacteria 2855195626 2855195786 302
253 iso_pu_bacteria 2858466076 2858469548 302
254 iso_pu_bacteria 2865014394 2865018596 302
255 iso_pu_bacteria 2869551831 2869552446 302
256 iso_pu_bacteria 2871272651 2871273543 302
257 iso_pu_bacteria 2871282230 2871286891 302
258 iso_pu_bacteria 2876601092 2876605733 302
259 iso_pu_bacteria 2881609920 2881613724 302
260 iso_pu_bacteria 2884086401 2884090528 302
261 iso_pu_bacteria 2888366609 2888367248 302
262 iso_pu_bacteria 2888373701 2888375089 302
263 iso_pu_bacteria 2891670763 2891672266 302
264 iso_pu_bacteria 2900051742 2900053725 302
265 iso_pu_bacteria 2904474040 2904474351 302
266 iso_pu_bacteria 2904504865 2904507060 302
267 iso_pu_bacteria 2904513164 2904516113 302
268 iso_pu_bacteria 2908669403 2908673115 302
269 iso_pu_bacteria 2919108558 2919112827 302
270 iso_pu_bacteria 2919150387 2919150698 302
271 iso_pu_bacteria 2919534386 2919534571 302
272 iso_pu_bacteria 2919688452 2919689924 302
273 iso_pu_bacteria 2923634449 2923637956 302
274 iso_pu_bacteria 2927143783 2927145571 302
275 iso_pu_bacteria 2927833300 2927835605 302
276 iso_pu_bacteria 2932406140 2932406548 302
277 iso_pu_bacteria 2935625433 2935627918 302
278 iso_pu_bacteria 2937539931 2937540084 302
279 iso_pu_bacteria 2937967321 2937970754 302
280 iso_pu_bacteria 2939568625 2939571590 302
281 iso_pu_bacteria 2939573065 2939576021 302
282 iso_pu_bacteria 2939577877 2939578030 302
283 iso_pu_bacteria 2939602548 2939607246 302
284 iso_pu_bacteria 2939607340 2939609501 302
285 iso_pu_bacteria 2939617950 2939619662 302
286 iso_pu_bacteria 2939642701 2939646003 302
287 iso_pu_bacteria 2945874760 2945879806 302
288 iso_pu_bacteria 2945951305 2945954321 302
289 iso_pu_bacteria 2969079654 2969084178 302
290 iso_pu_bacteria 2971820967 2971825686 302
291 iso_pu_bacteria 2974310843 2974313644 302
292 iso_pu_bacteria 2974435778 2974436946 302
293 iso_pu_bacteria 2978975091 2978976805 302
294 iso_pu_bacteria 2984494565 2984498118 302
295 iso_pu_bacteria 2984559226 2984561257 302
296 iso_pu_bacteria 2984595703 2984599328 302
297 iso_pu_bacteria 2990261002 2990265184 302
298 iso_pu_bacteria 3000376612 3000380542 302
299 iso_pu_bacteria 3007419365 3007423115 302
300 iso_pu_bacteria 640753048 640936199 302
301 iso_pu_bacteria 8004592986 8004597849 302
302 iso_pu_bacteria 8011350971 8011351868 302
303 iso_pu_bacteria 8015394850 8015396126 302
304 iso_pu_bacteria 8016733728 8016737262 302
305 iso_pu_bacteria 8018221730 8018223457 302
306 iso_pu_bacteria 8018405270 8018410013 302
307 iso_pu_bacteria 8019499862 8019502463 302
308 iso_pu_bacteria 8019504834 8019506816 302
309 iso_pu_bacteria 8054849141 8054850051 302
310 iso_pu_bacteria 8055087960 8055092613 302
311 iso_pu_bacteria 8055092621 8055092828 302
312 iso_pu_bacteria 8055097453 8055100684 302
313 iso_pu_bacteria 8055693939 8055697599 302
314 iso_pu_bacteria 8056115690 8056118056 302
315 iso_pu_bacteria 8057304971 8057307364 302
316 iso_pu_bacteria 2510065053 2510282132 303
317 iso_pu_bacteria 2510065055 2510291709 303
318 iso_pu_bacteria 2510065058 2510310280 303
319 iso_pu_bacteria 2554235132 2554814587 303
320 iso_pu_bacteria 2599185191 2599517910 303
321 iso_pu_bacteria 2599185288 2599880690 303
322 iso_pu_bacteria 2599185303 2599949743 303
323 iso_pu_bacteria 2606217733 2608381971 303
324 iso_pu_bacteria 2738543015 2739261463 303
325 iso_pu_bacteria 2773857672 2774130803 303
326 iso_pu_bacteria 2808606373 2808907722 303
327 iso_pu_bacteria 2808606385 2808980327 303
328 iso_pu_bacteria 2808606388 2808996048 303
329 iso_pu_bacteria 2811994881 2812367558 303
330 iso_pu_bacteria 2852612431 2852613926 303
331 iso_pu_bacteria 2852667396 2852668337 303
332 iso_pu_bacteria 2917832318 2917835875 303
333 iso_pu_bacteria 2919125081 2919125745 303
334 iso_pu_bacteria 2923519811 2923521608 303
335 iso_pu_bacteria 2929189879 2929193031 303
336 iso_pu_bacteria 2945928738 2945932981 303
337 iso_pu_bacteria 2974298342 2974300075 303
338 iso_pu_bacteria 2984499530 2984502455 303
339 iso_pu_bacteria 2984504281 2984508933 303
340 iso_pu_bacteria 8016728285 8016728767 303
341 iso_pu_bacteria 8054503363 8054506803 303
342 iso_pu_bacteria 8056161164 8056165625 303
343 iso_pu_bacteria 2511231004 2511256518 304
344 iso_pu_bacteria 2511231006 2511266169 304
345 iso_pu_bacteria 2511231007 2511270307 304
346 iso_pu_bacteria 2511231008 2511276089 304
347 iso_pu_bacteria 2511231010 2511288342 304
348 iso_pu_bacteria 2511231011 2511297887 304
349 iso_pu_bacteria 2511231012 2511303878 304
350 iso_pu_bacteria 2511231014 2511312638 304
351 iso_pu_bacteria 2511231015 2511322815 304
352 iso_pu_bacteria 2511231016 2511324733 304
353 iso_pu_bacteria 2511231017 2511334088 304
354 iso_pu_bacteria 2511231018 2511338092 304
355 iso_pu_bacteria 2511231019 2511342877 304
356 iso_pu_bacteria 2511231020 2511352629 304
357 iso_pu_bacteria 2511231021 2511359002 304
358 iso_pu_bacteria 2511231022 2511365947 304
359 iso_pu_bacteria 2511231023 2511372119 304
360 iso_pu_bacteria 2511231031 2511411833 304
361 iso_pu_bacteria 2511231156 2511825942 304
362 iso_pu_bacteria 2512047018 2512326876 304
363 iso_pu_bacteria 2554235341 2555668972 304
364 iso_pu_bacteria 2582580891 2583793483 304
365 iso_pu_bacteria 2597489887 2597857161 304
366 iso_pu_bacteria 2597489888 2597862880 304
367 iso_pu_bacteria 2599185155 2599326512 304
368 iso_pu_bacteria 2599185160 2599357330 304
369 iso_pu_bacteria 2599185161 2599361858 304
370 iso_pu_bacteria 2599185162 2599368179 304
371 iso_pu_bacteria 2599185163 2599374968 304
372 iso_pu_bacteria 2599185164 2599382435 304
373 iso_pu_bacteria 2599185165 2599388882 304
374 iso_pu_bacteria 2599185166 2599393826 304
375 iso_pu_bacteria 2599185167 2599396563 304
376 iso_pu_bacteria 2599185168 2599405591 304
377 iso_pu_bacteria 2599185179 2599453377 304
378 iso_pu_bacteria 2599185181 2599464169 304
379 iso_pu_bacteria 2599185182 2599468465 304
380 iso_pu_bacteria 2599185185 2599484183 304
381 iso_pu_bacteria 2599185186 2599493188 304
382 iso_pu_bacteria 2599185188 2599504659 304
383 iso_pu_bacteria 2599185190 2599514709 304
384 iso_pu_bacteria 2599185191 2599517360 304
385 iso_pu_bacteria 2599185212 2599611411 304
386 iso_pu_bacteria 2599185248 2599771501 304
387 iso_pu_bacteria 2599185257 2599801834 304
388 iso_pu_bacteria 2599185288 2599883024 304
389 iso_pu_bacteria 2599185289 2599884037 304
390 iso_pu_bacteria 2599185290 2599894026 304
391 iso_pu_bacteria 2599185291 2599899042 304
392 iso_pu_bacteria 2599185300 2599935008 304
393 iso_pu_bacteria 2599185302 2599941613 304
394 iso_pu_bacteria 2599185303 2599952416 304
395 iso_pu_bacteria 2599185304 2599952867 304
396 iso_pu_bacteria 2599185305 2599958819 304
397 iso_pu_bacteria 2599185306 2599968674 304
398 iso_pu_bacteria 2599185307 2599970584 304
399 iso_pu_bacteria 2599185308 2599976931 304
400 iso_pu_bacteria 2599185309 2599981782 304
401 iso_pu_bacteria 2599185310 2599987691 304
402 iso_pu_bacteria 2599185311 2599995183 304
403 iso_pu_bacteria 2599185312 2599998417 304
404 iso_pu_bacteria 2599185313 2600003316 304
405 iso_pu_bacteria 2599185314 2600011100 304
406 iso_pu_bacteria 2599185315 2600017891 304
407 iso_pu_bacteria 2599185316 2600022398 304
408 iso_pu_bacteria 2599185317 2600027419 304
409 iso_pu_bacteria 2599185318 2600034190 304
410 iso_pu_bacteria 2599185319 2600039698 304
411 iso_pu_bacteria 2599185320 2600046021 304
412 iso_pu_bacteria 2599185321 2600052410 304
413 iso_pu_bacteria 2599185322 2600057359 304
414 iso_pu_bacteria 2599185323 2600064536 304
415 iso_pu_bacteria 2599185324 2600069653 304
416 iso_pu_bacteria 2599185325 2600075673 304
417 iso_pu_bacteria 2599185356 2600216444 304
418 iso_pu_bacteria 2600254930 2600356872 304
419 iso_pu_bacteria 2600254931 2600365483 304
420 iso_pu_bacteria 2600254954 2600446656 304
421 iso_pu_bacteria 2600255283 2601624976 304
422 iso_pu_bacteria 2600255296 2601691410 304
423 iso_pu_bacteria 2600255313 2601776963 304
424 iso_pu_bacteria 2600255318 2601797473 304
425 iso_pu_bacteria 2600255389 2602010805 304
426 iso_pu_bacteria 2603880185 2606075794 304
427 iso_pu_bacteria 2603880199 2606130918 304
428 iso_pu_bacteria 2623620443 2624481737 304
429 iso_pu_bacteria 2623620446 2624491349 304
430 iso_pu_bacteria 2643221565 2643846335 304
431 iso_pu_bacteria 2643221571 2643872944 304
432 iso_pu_bacteria 2643221589 2643952858 304
433 iso_pu_bacteria 2643221602 2644022620 304
434 iso_pu_bacteria 2643221633 2644188832 304
435 iso_pu_bacteria 2643221650 2644286755 304
436 iso_pu_bacteria 2651869719 2652543352 304
437 iso_pu_bacteria 2667528170 2671091529 304
438 iso_pu_bacteria 2667528171 2671098497 304
439 iso_pu_bacteria 2667528176 2671126214 304
440 iso_pu_bacteria 2671180172 2671768783 304
441 iso_pu_bacteria 2675903515 2678262797 304
442 iso_pu_bacteria 2713897148 2715751636 304
443 iso_pu_bacteria 2713897149 2715759805 304
444 iso_pu_bacteria 2718217725 2718635009 304
445 iso_pu_bacteria 2728369097 2729147995 304
446 iso_pu_bacteria 2738541271 2738688437 304
447 iso_pu_bacteria 2738541294 2738809615 304
448 iso_pu_bacteria 2738541309 2738896975 304
449 iso_pu_bacteria 2738543004 2739201531 304
450 iso_pu_bacteria 2738543015 2739259509 304
451 iso_pu_bacteria 2738543016 2739264169 304
452 iso_pu_bacteria 2738543020 2739285196 304
453 iso_pu_bacteria 2738543021 2739290510 304
454 iso_pu_bacteria 2738543025 2739313920 304
455 iso_pu_bacteria 2740892503 2743736580 304
456 iso_pu_bacteria 2744054620 2745009133 304
457 iso_pu_bacteria 2773857670 2774121055 304
458 iso_pu_bacteria 2773857673 2774137265 304
459 iso_pu_bacteria 2784132063 2784263526 304
460 iso_pu_bacteria 2784132072 2784314128 304
461 iso_pu_bacteria 2791355520 2794598184 304
462 iso_pu_bacteria 2808606361 2808854412 304
463 iso_pu_bacteria 2808606376 2808925765 304
464 iso_pu_bacteria 2808606377 2808927669 304
465 iso_pu_bacteria 2808606378 2808934492 304
466 iso_pu_bacteria 2808606379 2808943261 304
467 iso_pu_bacteria 2808606380 2808947866 304
468 iso_pu_bacteria 2808606381 2808949791 304
469 iso_pu_bacteria 2808606382 2808957947 304
470 iso_pu_bacteria 2808606383 2808962917 304
471 iso_pu_bacteria 2808606385 2808975757 304
472 iso_pu_bacteria 2808606388 2808990604 304
473 iso_pu_bacteria 2808606389 2808997666 304
474 iso_pu_bacteria 2808606445 2809216665 304
475 iso_pu_bacteria 2818991456 2819656328 304
476 iso_pu_bacteria 2818991464 2819703576 304
477 iso_pu_bacteria 2823421272 2823423377 304
478 iso_pu_bacteria 2825651385 2825652844 304
479 iso_pu_bacteria 2826581358 2826583198 304
480 iso_pu_bacteria 2834028612 2834029530 304
481 iso_pu_bacteria 2842805378 2842806879 304
482 iso_pu_bacteria 2842815866 2842817461 304
483 iso_pu_bacteria 2842832357 2842837578 304
484 iso_pu_bacteria 2842843487 2842844476 304
485 iso_pu_bacteria 2842849001 2842850542 304
486 iso_pu_bacteria 2842854478 2842857507 304
487 iso_pu_bacteria 2844665904 2844669461 304
488 iso_pu_bacteria 2852612431 2852614951 304
489 iso_pu_bacteria 2852657418 2852658389 304
490 iso_pu_bacteria 2852667396 2852669919 304
491 iso_pu_bacteria 2860339153 2860339705 304
492 iso_pu_bacteria 2860867994 2860869523 304
493 iso_pu_bacteria 2878029506 2878033719 304
494 iso_pu_bacteria 2880230671 2880234360 304
495 iso_pu_bacteria 2904518522 2904522896 304
496 iso_pu_bacteria 2904550169 2904554366 304
497 iso_pu_bacteria 2912963787 2912967334 304
498 iso_pu_bacteria 2913036834 2913038771 304
499 iso_pu_bacteria 2917070673 2917072761 304
500 iso_pu_bacteria 2919063839 2919069085 304
501 iso_pu_bacteria 2919155634 2919158434 304
502 iso_pu_bacteria 2919385768 2919387843 304
503 iso_pu_bacteria 2919456309 2919456799 304
504 iso_pu_bacteria 2919481497 2919482044 304
505 iso_pu_bacteria 2919487758 2919490569 304
506 iso_pu_bacteria 2919501602 2919505272 304
507 iso_pu_bacteria 2919697872 2919701141 304
508 iso_pu_bacteria 2923153595 2923155594 304
509 iso_pu_bacteria 2923586266 2923587087 304
510 iso_pu_bacteria 2926063275 2926066949 304
511 iso_pu_bacteria 2929144301 2929146223 304
512 iso_pu_bacteria 2929189879 2929191501 304
513 iso_pu_bacteria 2931369376 2931370410 304
514 iso_pu_bacteria 2931390751 2931392540 304
515 iso_pu_bacteria 2931396565 2931400395 304
516 iso_pu_bacteria 2935353572 2935354924 304
517 iso_pu_bacteria 2939636861 2939639450 304
518 iso_pu_bacteria 2939651529 2939652850 304
519 iso_pu_bacteria 2945961074 2945962048 304
520 iso_pu_bacteria 2946006987 2946011290 304
521 iso_pu_bacteria 2946027586 2946029728 304
522 iso_pu_bacteria 2947233263 2947236354 304
523 iso_pu_bacteria 2969304461 2969308506 304
524 iso_pu_bacteria 2974289157 2974290104 304
525 iso_pu_bacteria 2984286254 2984290428 304
526 iso_pu_bacteria 2988728565 2988733748 304
527 iso_pu_bacteria 2998139840 2998143826 304
528 iso_pu_bacteria 3007252601 3007252630 304
529 iso_pu_bacteria 3007315729 3007318797 304
530 iso_pu_bacteria 3007395558 3007401133 304
531 iso_pu_bacteria 3007511990 3007513324 304
532 iso_pu_bacteria 3007614139 3007619562 304
533 iso_pu_bacteria 3007619802 3007621274 304
534 iso_pu_bacteria 3007855910 3007861007 304
535 iso_pu_bacteria 3007861166 3007861245 304
536 iso_pu_bacteria 3007866637 3007870084 304
537 iso_pu_bacteria 637000220 637319313 304
538 iso_pu_bacteria 640427133 640487613 304
539 iso_pu_bacteria 651053060 651175557 304
540 iso_pu_bacteria 8015687852 8015689854 304
541 iso_pu_bacteria 8019769354 8019772902 304
542 iso_pu_bacteria 8019775933 8019778259 304
543 iso_pu_bacteria 8029995093 8029997051 304
544 iso_pu_bacteria 8034962539 8034963731 304
545 iso_pu_bacteria 8052494512 8052496351 304
546 iso_pu_bacteria 8054285046 8054289669 304
547 iso_pu_bacteria 8054347763 8054351963 304
548 iso_pu_bacteria 8055770955 8055772956 304
549 iso_pu_bacteria 8055817908 8055819571 304
550 iso_pu_bacteria 8055878733 8055880628 304
551 iso_pu_bacteria 8056125926 8056127849 304
552 iso_pu_bacteria 8056143049 8056145162 304
553 iso_pu_bacteria 8056155041 8056156611 304
554 iso_pu_bacteria 8056161164 8056164851 304
555 iso_pu_bacteria 8056166840 8056167450 304
556 iso_pu_bacteria 8056172158 8056173455 304
557 iso_pu_bacteria 8056177738 8056183607 304
558 iso_pu_bacteria 8056569372 8056573089 304
559 iso_pu_bacteria 8057798959 8057799384 304
560 3300039062 Ga0400483_217404 Ga0400483_217404_3860_4810 305
561 3300001989 JGI24739J22299_10000206 JGI24739J22299_1000020614 306
562 3300002737 JGI25162J39368_1000006 JGI25162J39368_1000006118 306
563 3300002737 JGI25162J39368_1002479 JGI25162J39368_10024796 306
564 3300002771 JGI25163J39215_1000001 JGI25163J39215_1000001239 306
565 3300002772 JGI25164J39214_1000001 JGI25164J39214_1000001189 306
566 3300002773 JGI25152J39213_1000367 JGI25152J39213_100036720 306
567 3300003751 Ga0055538_1000004 Ga0055538_1000004319 306
568 3300003752 Ga0055539_1000004 Ga0055539_1000004239 306
569 3300003756 Ga0055533_1000007 Ga0055533_1000007319 306
570 3300003759 Ga0055525_1000007 Ga0055525_1000007319 306
571 3300003841 Ga0055541_1000004 Ga0055541_1000004319 306
572 3300003856 Ga0058692_1000154 Ga0058692_100015430 306
573 3300003856 Ga0058692_1000657 Ga0058692_10006579 306
574 3300003856 Ga0058692_1000730 Ga0058692_10007306 306
575 3300003856 Ga0058692_1002498 Ga0058692_10024984 306
576 3300003856 Ga0058692_1003910 Ga0058692_10039103 306
577 3300003856 Ga0058692_1012084 Ga0058692_10120843 306
578 3300005272 Ga0065703_1018920 Ga0065703_10189202 306
579 3300005289 Ga0065704_10003841 Ga0065704_100038411 306
580 3300005289 Ga0065704_10088469 Ga0065704_100884692 306
581 3300005347 Ga0070668_100001689 Ga0070668_10000168915 306
582 3300005457 Ga0070662_100013363 Ga0070662_1000133633 306
583 3300005548 Ga0070665_100005453 Ga0070665_10000545313 306
584 3300005548 Ga0070665_100007189 Ga0070665_10000718912 306
585 3300005548 Ga0070665_100069632 Ga0070665_1000696321 306
586 3300005577 Ga0068857_100000386 Ga0068857_10000038611 306
587 3300006051 Ga0075364_10023611 Ga0075364_100236111 306
588 3300006051 Ga0075364_10059248 Ga0075364_100592482 306
589 3300006195 Ga0075366_10009474 Ga0075366_100094745 306
590 3300006946 Ga0079104_1000099 Ga0079104_100009922 306
591 3300006946 Ga0079104_1000403 Ga0079104_100040321 306
592 3300006946 Ga0079104_1001515 Ga0079104_10015157 306
593 3300006946 Ga0079104_1001820 Ga0079104_10018209 306
594 3300006946 Ga0079104_1002919 Ga0079104_10029199 306
595 3300006946 Ga0079104_1005396 Ga0079104_10053961 306
596 3300009011 Ga0105251_10002215 Ga0105251_1000221510 306
597 3300009011 Ga0105251_10005690 Ga0105251_100056905 306
598 3300009011 Ga0105251_10007932 Ga0105251_100079323 306
599 3300009011 Ga0105251_10014126 Ga0105251_100141266 306
600 3300009011 Ga0105251_10017931 Ga0105251_100179311 306
601 3300009011 Ga0105251_10018857 Ga0105251_100188574 306
602 3300009011 Ga0105251_10021619 Ga0105251_100216193 306
603 3300009011 Ga0105251_10022596 Ga0105251_100225962 306
604 3300009011 Ga0105251_10053006 Ga0105251_100530062 306
605 3300009036 Ga0105244_10000023 Ga0105244_1000002362 306
606 3300009036 Ga0105244_10000255 Ga0105244_1000025552 306
607 3300009036 Ga0105244_10000427 Ga0105244_1000042733 306
608 3300009036 Ga0105244_10000704 Ga0105244_1000070417 306
609 3300009036 Ga0105244_10001671 Ga0105244_100016719 306
610 3300009036 Ga0105244_10001899 Ga0105244_100018994 306
611 3300009036 Ga0105244_10002529 Ga0105244_100025296 306
612 3300009036 Ga0105244_10003779 Ga0105244_100037795 306
613 3300009036 Ga0105244_10005824 Ga0105244_100058242 306
614 3300009036 Ga0105244_10007248 Ga0105244_100072482 306
615 3300009036 Ga0105244_10052056 Ga0105244_100520562 306
616 3300009036 Ga0105244_10109776 Ga0105244_101097762 306
617 3300009092 Ga0105250_10000028 Ga0105250_1000002896 306
618 3300009092 Ga0105250_10000045 Ga0105250_10000045128 306
619 3300009092 Ga0105250_10001583 Ga0105250_100015839 306
620 3300009092 Ga0105250_10001831 Ga0105250_100018316 306
621 3300009092 Ga0105250_10011683 Ga0105250_100116833 306
622 3300009092 Ga0105250_10013247 Ga0105250_100132473 306
623 3300009092 Ga0105250_10013576 Ga0105250_100135762 306
624 3300009092 Ga0105250_10014569 Ga0105250_100145691 306
625 3300009092 Ga0105250_10032643 Ga0105250_100326432 306
626 3300009093 Ga0105240_10147704 Ga0105240_101477043 306
627 3300009101 Ga0105247_10000387 Ga0105247_1000038725 306
628 3300009148 Ga0105243_10003177 Ga0105243_100031776 306
629 3300009148 Ga0105243_10067232 Ga0105243_100672322 306
630 3300009174 Ga0105241_10000008 Ga0105241_10000008120 306
631 3300009545 Ga0105237_10028696 Ga0105237_100286965 306
632 3300011119 Ga0105246_10034580 Ga0105246_100345802 306
633 3300013100 Ga0157373_10001252 Ga0157373_100012523 306
634 3300013100 Ga0157373_10006491 Ga0157373_100064915 306
635 3300013100 Ga0157373_10008149 Ga0157373_100081495 306
636 3300013100 Ga0157373_10018566 Ga0157373_100185662 306
637 3300013102 Ga0157371_10000020 Ga0157371_10000020133 306
638 3300013102 Ga0157371_10000267 Ga0157371_1000026716 306
639 3300013102 Ga0157371_10001526 Ga0157371_100015267 306
640 3300013102 Ga0157371_10003239 Ga0157371_100032395 306
641 3300013102 Ga0157371_10029749 Ga0157371_100297491 306
642 3300013104 Ga0157370_10000276 Ga0157370_1000027632 306
643 3300013104 Ga0157370_10004198 Ga0157370_1000419811 306
644 3300013104 Ga0157370_10035747 Ga0157370_100357476 306
645 3300013105 Ga0157369_10000183 Ga0157369_1000018373 306
646 3300013105 Ga0157369_10034181 Ga0157369_100341813 306
647 3300013306 Ga0163162_10011360 Ga0163162_100113606 306
648 3300013307 Ga0157372_10001095 Ga0157372_100010953 306
649 3300013307 Ga0157372_10015434 Ga0157372_100154345 306
650 3300013307 Ga0157372_10031809 Ga0157372_100318094 306
651 3300013307 Ga0157372_10088890 Ga0157372_100888903 306
652 3300013307 Ga0157372_10116342 Ga0157372_101163421 306
653 3300013308 Ga0157375_10649087 Ga0157375_106490871 306
654 3300015261 Ga0182006_1000025 Ga0182006_1000025182 306
655 3300015261 Ga0182006_1011910 Ga0182006_10119103 306
656 3300015679 Ga0183366_1003 Ga0183366_1003178 306
657 3300015680 Ga0183370_1003 Ga0183370_1003242 306
658 3300015685 Ga0183369_1005 Ga0183369_1005242 306
659 3300015687 Ga0183368_1006 Ga0183368_1006177 306
660 3300016635 Ga0183361_11316 Ga0183361_113162 306
661 3300017792 Ga0163161_10000002 Ga0163161_10000002174 306
662 3300021384 Ga0213876_10000026 Ga0213876_100000267 306
663 3300025207 Ga0209760_100063 Ga0209760_10006342 306
664 3300025224 Ga0209784_100001 Ga0209784_100001313 306
665 3300025225 Ga0209566_100001 Ga0209566_100001313 306
666 3300025226 Ga0209674_100002 Ga0209674_100002313 306
667 3300025230 Ga0209563_100008 Ga0209563_100008316 306
668 3300025231 Ga0207427_100002 Ga0207427_100002964 306
669 3300025233 Ga0209437_100046 Ga0209437_100046118 306
670 3300025233 Ga0209437_100063 Ga0209437_100063146 306
671 3300025253 Ga0209677_100004 Ga0209677_100004316 306
672 3300025256 Ga0209759_1005910 Ga0209759_10059103 306
673 3300025258 Ga0209129_1000008 Ga0209129_1000008413 306
674 3300025261 Ga0209233_1001593 Ga0209233_10015934 306
675 3300025711 Ga0207696_1000009 Ga0207696_1000009199 306
676 3300025711 Ga0207696_1000027 Ga0207696_1000027190 306
677 3300025711 Ga0207696_1000093 Ga0207696_100009351 306
678 3300025711 Ga0207696_1000140 Ga0207696_1000140128 306
679 3300025711 Ga0207696_1000142 Ga0207696_1000142106 306
680 3300025711 Ga0207696_1000761 Ga0207696_10007617 306
681 3300025711 Ga0207696_1001106 Ga0207696_10011067 306
682 3300025711 Ga0207696_1006471 Ga0207696_10064714 306
683 3300025711 Ga0207696_1013635 Ga0207696_10136353 306
684 3300025711 Ga0207696_1035807 Ga0207696_10358071 306
685 3300025728 Ga0207655_1000006 Ga0207655_1000006484 306
686 3300025728 Ga0207655_1000017 Ga0207655_1000017324 306
687 3300025728 Ga0207655_1000024 Ga0207655_1000024143 306
688 3300025728 Ga0207655_1000026 Ga0207655_1000026316 306
689 3300025728 Ga0207655_1000054 Ga0207655_1000054182 306
690 3300025728 Ga0207655_1000056 Ga0207655_1000056137 306
691 3300025728 Ga0207655_1000101 Ga0207655_100010152 306
692 3300025728 Ga0207655_1000146 Ga0207655_100014694 306
693 3300025728 Ga0207655_1002118 Ga0207655_100211812 306
694 3300025728 Ga0207655_1002372 Ga0207655_10023727 306
695 3300025728 Ga0207655_1003121 Ga0207655_100312111 306
696 3300025728 Ga0207655_1005359 Ga0207655_10053592 306
697 3300025728 Ga0207655_1008732 Ga0207655_10087323 306
698 3300025728 Ga0207655_1010013 Ga0207655_10100135 306
699 3300025728 Ga0207655_1010613 Ga0207655_10106135 306
700 3300025728 Ga0207655_1011086 Ga0207655_10110862 306
701 3300025728 Ga0207655_1019483 Ga0207655_10194833 306
702 3300025728 Ga0207655_1025694 Ga0207655_10256941 306
703 3300025728 Ga0207655_1062566 Ga0207655_10625661 306
704 3300025735 Ga0207713_1000007 Ga0207713_1000007163 306
705 3300025735 Ga0207713_1000034 Ga0207713_100003422 306
706 3300025735 Ga0207713_1000046 Ga0207713_1000046129 306
707 3300025735 Ga0207713_1000110 Ga0207713_10001106 306
708 3300025735 Ga0207713_1000158 Ga0207713_10001584 306
709 3300025735 Ga0207713_1000419 Ga0207713_100041937 306
710 3300025735 Ga0207713_1001972 Ga0207713_100197211 306
711 3300025735 Ga0207713_1002981 Ga0207713_10029814 306
712 3300025735 Ga0207713_1004891 Ga0207713_10048916 306
713 3300025735 Ga0207713_1010990 Ga0207713_10109905 306
714 3300025735 Ga0207713_1013824 Ga0207713_10138244 306
715 3300025735 Ga0207713_1019102 Ga0207713_10191023 306
716 3300025900 Ga0207710_10000015 Ga0207710_10000015326 306
717 3300025911 Ga0207654_10000009 Ga0207654_10000009120 306
718 3300025913 Ga0207695_10138477 Ga0207695_101384772 306
719 3300025914 Ga0207671_10283640 Ga0207671_102836402 306
720 3300025933 Ga0207706_10039228 Ga0207706_100392283 306
721 3300025935 Ga0207709_10005426 Ga0207709_100054265 306
722 3300025935 Ga0207709_10049003 Ga0207709_100490032 306
723 3300025972 Ga0207668_10002127 Ga0207668_100021273 306
724 3300026116 Ga0207674_10000009 Ga0207674_1000000911 306
725 3300027111 Ga0209281_1000054 Ga0209281_1000054103 306
726 3300027111 Ga0209281_1000058 Ga0209281_100005874 306
727 3300027111 Ga0209281_1000060 Ga0209281_1000060132 306
728 3300027111 Ga0209281_1000120 Ga0209281_1000120113 306
729 3300027111 Ga0209281_1000223 Ga0209281_100022313 306
730 3300027111 Ga0209281_1000648 Ga0209281_10006488 306
731 3300027111 Ga0209281_1000822 Ga0209281_100082220 306
732 3300027111 Ga0209281_1000854 Ga0209281_10008545 306
733 3300027111 Ga0209281_1001003 Ga0209281_100100315 306
734 3300027111 Ga0209281_1001185 Ga0209281_10011859 306
735 3300027111 Ga0209281_1005142 Ga0209281_10051421 306
736 3300027312 Ga0209371_1000014 Ga0209371_1000014167 306
737 3300027312 Ga0209371_1000030 Ga0209371_1000030113 306
738 3300027312 Ga0209371_1000053 Ga0209371_1000053147 306
739 3300027312 Ga0209371_1000054 Ga0209371_100005493 306
740 3300027312 Ga0209371_1000111 Ga0209371_100011181 306
741 3300027312 Ga0209371_1000123 Ga0209371_100012320 306
742 3300027312 Ga0209371_1000495 Ga0209371_100049517 306
743 3300027312 Ga0209371_1000544 Ga0209371_100054412 306
744 3300027312 Ga0209371_1000563 Ga0209371_10005635 306
745 3300027312 Ga0209371_1000655 Ga0209371_10006556 306
746 3300027312 Ga0209371_1001916 Ga0209371_10019164 306
747 3300027312 Ga0209371_1002190 Ga0209371_10021906 306
748 3300027312 Ga0209371_1002345 Ga0209371_10023452 306
749 3300027312 Ga0209371_1005437 Ga0209371_10054373 306
750 3300027312 Ga0209371_1006335 Ga0209371_10063352 306
751 3300027312 Ga0209371_1006480 Ga0209371_10064804 306
752 3300028379 Ga0268266_10000290 Ga0268266_100002908 306
753 3300030500 Ga0268256_1000012 Ga0268256_1000012600 306
754 3300030500 Ga0268256_1000021 Ga0268256_1000021161 306
755 3300030500 Ga0268256_1000025 Ga0268256_1000025166 306
756 3300030500 Ga0268256_1000053 Ga0268256_100005387 306
757 3300030500 Ga0268256_1000095 Ga0268256_100009517 306
758 3300030500 Ga0268256_1000426 Ga0268256_100042617 306
759 3300030500 Ga0268256_1000462 Ga0268256_100046225 306
760 3300030500 Ga0268256_1000488 Ga0268256_100048829 306
761 3300030500 Ga0268256_1000560 Ga0268256_100056019 306
762 3300030500 Ga0268256_1001337 Ga0268256_100133710 306
763 3300030500 Ga0268256_1001950 Ga0268256_10019506 306
764 3300030500 Ga0268256_1002082 Ga0268256_10020822 306
765 3300030500 Ga0268256_1005190 Ga0268256_10051903 306
766 3300030500 Ga0268256_1006367 Ga0268256_10063674 306
767 3300039437 Ga0436365_0084998 Ga0436365_0084998_222996_223949 306
768 3300041405 Ga0439438_000003 Ga0439438_000003_184773_185726 306
769 3300041405 Ga0439438_000677 Ga0439438_000677_11841_12803 306
770 3300041405 Ga0439438_001320 Ga0439438_001320_6473_7426 306
771 3300041405 Ga0439438_008005 Ga0439438_008005_1506_2459 306
772 3300041407 Ga0439447_001380 Ga0439447_001380_3576_4529 306
773 3300041407 Ga0439447_002568 Ga0439447_002568_3796_4749 306
774 3300041407 Ga0439447_005955 Ga0439447_005955_2049_3011 306
775 3300041411 Ga0439466_0000002 Ga0439466_0000002_381085_382038 306
776 3300041512 Ga0451853_0270960 Ga0451853_0270960_466_1419 306
777 3300042006 Ga0439432_001288 Ga0439432_001288_5613_6566 306
778 3300042006 Ga0439432_002793 Ga0439432_002793_2931_3884 306
779 3300042010 Ga0439452_000004 Ga0439452_000004_569536_570489 306
780 3300042010 Ga0439452_000005 Ga0439452_000005_192017_193063 306
781 3300042010 Ga0439452_000007 Ga0439452_000007_251118_252071 306
782 3300042010 Ga0439452_000056 Ga0439452_000056_86065_87018 306
783 3300042010 Ga0439452_001164 Ga0439452_001164_7201_8154 306
784 3300042016 Ga0439463_000932 Ga0439463_000932_1634_2587 306
785 3300042146 Ga0450907_000284 Ga0450907_000284_9478_10431 306
786 3300042439 Ga0439464_0003716 Ga0439464_0003716_581_1534 306
787 3300042532 Ga0450893_0012600 Ga0450893_0012600_325_1293 306
788 3300044669 Ga0466981_0000014 Ga0466981_0000014_90524_91477 306
789 3300046453 Ga0495627_000042 Ga0495627_000042_23292_24245 306
790 3300046458 Ga0495591_000024 Ga0495591_000024_180453_181406 306
791 3300046458 Ga0495591_000231 Ga0495591_000231_30297_31250 306
792 3300046458 Ga0495591_005800 Ga0495591_005800_2930_3892 306
793 3300046471 Ga0495650_0000004 Ga0495650_0000004_352016_352984 306
794 3300046471 Ga0495650_0000028 Ga0495650_0000028_174380_175333 306
795 3300046471 Ga0495650_0000113 Ga0495650_0000113_87173_88135 306
796 3300046501 Ga0495607_0007957 Ga0495607_0007957_2656_3618 306
797 3300046515 Ga0495620_0001603 Ga0495620_0001603_9068_10021 306
798 3300046522 Ga0495643_0036773 Ga0495643_0036773_446_1399 306
799 3300046524 Ga0495648_0069907 Ga0495648_0069907_316_1278 306
800 3300046530 Ga0495654_0000031 Ga0495654_0000031_44710_45663 306
801 3300046530 Ga0495654_0000342 Ga0495654_0000342_35198_36151 306
802 3300046530 Ga0495654_0000390 Ga0495654_0000390_16528_17490 306
803 3300046530 Ga0495654_0033441 Ga0495654_0033441_782_1735 306
804 3300046542 Ga0495597_0000548 Ga0495597_0000548_3427_4380 306
805 3300046692 Ga0495671_0001418 Ga0495671_0001418_1905_2867 306
806 3300046694 Ga0495649_0003172 Ga0495649_0003172_8546_9508 306
807 3300046694 Ga0495649_0003193 Ga0495649_0003193_2693_3646 306
808 3300046694 Ga0495649_0004813 Ga0495649_0004813_230_1183 306
809 3300046794 Ga0495589_0000005 Ga0495589_0000005_373739_374692 306
810 3300046794 Ga0495589_0004916 Ga0495589_0004916_5878_6840 306
811 3300046810 Ga0495660_0000013 Ga0495660_0000013_267117_268085 306
812 3300046810 Ga0495660_0000034 Ga0495660_0000034_80299_81261 306
813 3300047320 Ga0495672_0000029 Ga0495672_0000029_97554_98516 306
814 3300047320 Ga0495672_0000051 Ga0495672_0000051_154298_155251 306
815 3300047320 Ga0495672_0000054 Ga0495672_0000054_39242_40195 306
816 3300047446 Ga0495679_000014 Ga0495679_000014_129619_130572 306
817 3300047469 Ga0495673_0000047 Ga0495673_0000047_58189_59142 306
818 3300047469 Ga0495673_0000820 Ga0495673_0000820_18470_19432 306
819 3300047470 Ga0495681_0042745 Ga0495681_0042745_969_1922 306
820 3300048904 Ga0496101_0000123 Ga0496101_0000123_70122_71075 306
821 3300048905 Ga0496102_0004986 Ga0496102_0004986_3099_4052 306
822 3300048906 Ga0496103_0028765 Ga0496103_0028765_2018_2971 306
823 3300048907 Ga0496104_0004669 Ga0496104_0004669_8074_9027 306
824 3300048908 Ga0496105_0021587 Ga0496105_0021587_287_1240 306
825 3300048919 Ga0496116_0000015 Ga0496116_0000015_218629_219582 306
826 3300048919 Ga0496116_0000016 Ga0496116_0000016_223160_224128 306
827 3300048919 Ga0496116_0000217 Ga0496116_0000217_6038_6991 306
828 3300048919 Ga0496116_0001156 Ga0496116_0001156_27066_28019 306
829 3300048919 Ga0496116_0004729 Ga0496116_0004729_5246_6199 306
830 3300048919 Ga0496116_0022832 Ga0496116_0022832_13_966 306
831 3300048919 Ga0496116_0051296 Ga0496116_0051296_36_989 306
832 3300048919 Ga0496116_0107545 Ga0496116_0107545_469_1422 306
833 3300048920 Ga0496117_0000103 Ga0496117_0000103_89195_90148 306
834 3300048920 Ga0496117_0000238 Ga0496117_0000238_51845_52798 306
835 3300048920 Ga0496117_0002432 Ga0496117_0002432_10384_11337 306
836 3300048920 Ga0496117_0003210 Ga0496117_0003210_1311_2264 306
837 3300048920 Ga0496117_0006936 Ga0496117_0006936_7917_8870 306
838 3300048920 Ga0496117_0007956 Ga0496117_0007956_9188_10141 306
839 3300048920 Ga0496117_0033079 Ga0496117_0033079_1941_2909 306
840 3300048920 Ga0496117_0050855 Ga0496117_0050855_941_1894 306
841 3300048920 Ga0496117_0052055 Ga0496117_0052055_614_1582 306
842 3300048920 Ga0496117_0147387 Ga0496117_0147387_181_1227 306
843 3300048921 Ga0496118_0000046 Ga0496118_0000046_171662_172615 306
844 3300048921 Ga0496118_0000959 Ga0496118_0000959_15905_16858 306
845 3300048921 Ga0496118_0001062 Ga0496118_0001062_2732_3685 306
846 3300048921 Ga0496118_0002877 Ga0496118_0002877_9188_10141 306
847 3300048921 Ga0496118_0032073 Ga0496118_0032073_1531_2484 306
848 3300048921 Ga0496118_0039355 Ga0496118_0039355_1005_1958 306
849 3300048921 Ga0496118_0145316 Ga0496118_0145316_268_1314 306
850 3300048922 Ga0496119_0000026 Ga0496119_0000026_101243_102289 306
851 3300048922 Ga0496119_0000031 Ga0496119_0000031_108436_109389 306
852 3300048922 Ga0496119_0000270 Ga0496119_0000270_2389_3342 306
853 3300048922 Ga0496119_0005618 Ga0496119_0005618_7662_8615 306
854 3300048922 Ga0496119_0005727 Ga0496119_0005727_8953_9906 306
855 3300048922 Ga0496119_0007715 Ga0496119_0007715_572_1525 306
856 3300048922 Ga0496119_0007722 Ga0496119_0007722_3534_4487 306
857 3300048922 Ga0496119_0013656 Ga0496119_0013656_772_1740 306
858 3300048922 Ga0496119_0016128 Ga0496119_0016128_3107_4060 306
859 3300048922 Ga0496119_0021763 Ga0496119_0021763_29_982 306
860 3300048922 Ga0496119_0037132 Ga0496119_0037132_577_1530 306
861 3300048923 Ga0496120_0000017 Ga0496120_0000017_212805_213758 306
862 3300048923 Ga0496120_0000344 Ga0496120_0000344_67883_68836 306
863 3300048923 Ga0496120_0000361 Ga0496120_0000361_70469_71422 306
864 3300048923 Ga0496120_0001012 Ga0496120_0001012_16498_17451 306
865 3300048923 Ga0496120_0001279 Ga0496120_0001279_8845_9798 306
866 3300048923 Ga0496120_0001280 Ga0496120_0001280_8846_9799 306
867 3300048923 Ga0496120_0002535 Ga0496120_0002535_3067_4020 306
868 3300048923 Ga0496120_0004434 Ga0496120_0004434_1869_2822 306
869 3300048923 Ga0496120_0007521 Ga0496120_0007521_2512_3465 306
870 3300048923 Ga0496120_0009560 Ga0496120_0009560_3398_4351 306
871 3300048923 Ga0496120_0115219 Ga0496120_0115219_180_1226 306
872 3300048924 Ga0496121_0001130 Ga0496121_0001130_6620_7573 306
873 3300048924 Ga0496121_0004701 Ga0496121_0004701_9281_10234 306
874 3300048924 Ga0496121_0007313 Ga0496121_0007313_10249_11202 306
875 3300048924 Ga0496121_0047057 Ga0496121_0047057_29_982 306
876 3300048925 Ga0496122_0000075 Ga0496122_0000075_13183_14136 306
877 3300048925 Ga0496122_0000125 Ga0496122_0000125_83935_84903 306
878 3300048925 Ga0496122_0001095 Ga0496122_0001095_3778_4731 306
879 3300048925 Ga0496122_0002193 Ga0496122_0002193_7922_8875 306
880 3300048925 Ga0496122_0008894 Ga0496122_0008894_2471_3424 306
881 3300048925 Ga0496122_0010035 Ga0496122_0010035_5658_6611 306
882 3300048925 Ga0496122_0035757 Ga0496122_0035757_1542_2495 306
883 3300048925 Ga0496122_0038666 Ga0496122_0038666_2569_3615 306
884 3300048925 Ga0496122_0066774 Ga0496122_0066774_916_1869 306
885 3300048926 Ga0496123_0000019 Ga0496123_0000019_106202_107155 306
886 3300048926 Ga0496123_0000092 Ga0496123_0000092_94766_95734 306
887 3300048926 Ga0496123_0000377 Ga0496123_0000377_41466_42419 306
888 3300048926 Ga0496123_0000774 Ga0496123_0000774_30551_31504 306
889 3300048926 Ga0496123_0001657 Ga0496123_0001657_25986_26939 306
890 3300048926 Ga0496123_0003347 Ga0496123_0003347_9223_10176 306
891 3300048926 Ga0496123_0022363 Ga0496123_0022363_916_1869 306
892 3300048926 Ga0496123_0061320 Ga0496123_0061320_203_1249 306
893 3300048927 Ga0496124_0000058 Ga0496124_0000058_43881_44834 306
894 3300048927 Ga0496124_0000142 Ga0496124_0000142_18094_19140 306
895 3300048927 Ga0496124_0000238 Ga0496124_0000238_73854_74822 306
896 3300048927 Ga0496124_0000965 Ga0496124_0000965_39303_40256 306
897 3300048927 Ga0496124_0006756 Ga0496124_0006756_9053_10006 306
898 3300048927 Ga0496124_0007209 Ga0496124_0007209_4964_5917 306
899 3300048927 Ga0496124_0009650 Ga0496124_0009650_4721_5674 306
900 3300048927 Ga0496124_0025262 Ga0496124_0025262_740_1693 306
901 3300048927 Ga0496124_0086011 Ga0496124_0086011_29_982 306
902 3300048927 Ga0496124_0148706 Ga0496124_0148706_493_1446 306
903 3300048928 Ga0496125_0000032 Ga0496125_0000032_257881_258834 306
904 3300048928 Ga0496125_0001495 Ga0496125_0001495_32194_33162 306
905 3300048928 Ga0496125_0017828 Ga0496125_0017828_2072_3118 306
906 3300048928 Ga0496125_0018128 Ga0496125_0018128_3473_4426 306
907 3300048928 Ga0496125_0018546 Ga0496125_0018546_3959_4912 306
908 3300048929 Ga0496126_0000109 Ga0496126_0000109_66459_67427 306
909 3300048929 Ga0496126_0079934 Ga0496126_0079934_910_1863 306
910 3300048929 Ga0496126_0080089 Ga0496126_0080089_1117_2070 306
911 3300048929 Ga0496126_0215381 Ga0496126_0215381_256_1209 306
912 3300048929 Ga0496126_0349505 Ga0496126_0349505_227_1180 306
913 3300049459 Ga0495678_000984 Ga0495678_000984_18444_19406 306
914 3300049460 Ga0495682_0000003 Ga0495682_0000003_197455_198417 306
915 3300049576 Ga0501040_0000028 Ga0501040_0000028_12462_13418 306
916 3300049578 Ga0501042_0000283 Ga0501042_0000283_8655_9611 306
917 3300050491 nmdc:mga00v17_78003_c1 nmdc:mga00v17_78003_c1_20_973 306
918 3300050493 nmdc:mga0k408_2713_c1 nmdc:mga0k408_2713_c1_3517_4470 306
919 3300053126 Ga0500621_000006 Ga0500621_000006_187228_188190 306
920 iso_pu_bacteria 8054844752 8054848645 306
921 3300005289 Ga0065704_10007594 Ga0065704_100075942 307
922 3300005290 Ga0065712_10070283 Ga0065712_100702832 307
923 3300005331 Ga0070670_100000052 Ga0070670_10000005234 307
924 3300005344 Ga0070661_100001228 Ga0070661_1000012286 307
925 3300005353 Ga0070669_100005813 Ga0070669_1000058138 307
926 3300005355 Ga0070671_100000055 Ga0070671_10000005565 307
927 3300005365 Ga0070688_100055182 Ga0070688_1000551823 307
928 3300005367 Ga0070667_100000021 Ga0070667_100000021101 307
929 3300005466 Ga0070685_10000003 Ga0070685_10000003213 307
930 3300005548 Ga0070665_100134082 Ga0070665_1001340822 307
931 3300005564 Ga0070664_100001616 Ga0070664_1000016166 307
932 3300005577 Ga0068857_100254231 Ga0068857_1002542312 307
933 3300005617 Ga0068859_100002966 Ga0068859_1000029667 307
934 3300005618 Ga0068864_100000002 Ga0068864_100000002588 307
935 3300005842 Ga0068858_100029359 Ga0068858_1000293595 307
936 3300005843 Ga0068860_100000695 Ga0068860_1000006955 307
937 3300006931 Ga0097620_100002966 Ga0097620_10000296616 307
938 3300009011 Ga0105251_10001649 Ga0105251_1000164914 307
939 3300009036 Ga0105244_10005005 Ga0105244_100050054 307
940 3300009092 Ga0105250_10000199 Ga0105250_1000019927 307
941 3300009101 Ga0105247_10012831 Ga0105247_100128315 307
942 3300009176 Ga0105242_10001563 Ga0105242_1000156312 307
943 3300009545 Ga0105237_10000413 Ga0105237_1000041314 307
944 3300009553 Ga0105249_10016816 Ga0105249_100168164 307
945 3300011119 Ga0105246_10007972 Ga0105246_100079724 307
946 3300013100 Ga0157373_10015027 Ga0157373_100150275 307
947 3300013100 Ga0157373_10018376 Ga0157373_100183764 307
948 3300013105 Ga0157369_10006197 Ga0157369_100061976 307
949 3300013105 Ga0157369_10008666 Ga0157369_100086666 307
950 3300013308 Ga0157375_10005669 Ga0157375_100056692 307
951 3300013308 Ga0157375_10062745 Ga0157375_100627452 307
952 3300014325 Ga0163163_10000053 Ga0163163_1000005373 307
953 3300017792 Ga0163161_10114956 Ga0163161_101149564 307
954 3300025711 Ga0207696_1000090 Ga0207696_1000090139 307
955 3300025711 Ga0207696_1000176 Ga0207696_100017627 307
956 3300025711 Ga0207696_1000177 Ga0207696_100017782 307
957 3300025728 Ga0207655_1000140 Ga0207655_100014030 307
958 3300025728 Ga0207655_1022903 Ga0207655_10229032 307
959 3300025903 Ga0207680_10051360 Ga0207680_100513602 307
960 3300025914 Ga0207671_10005571 Ga0207671_100055714 307
961 3300025920 Ga0207649_10000156 Ga0207649_1000015618 307
962 3300025923 Ga0207681_10002936 Ga0207681_100029364 307
963 3300025925 Ga0207650_10000002 Ga0207650_10000002581 307
964 3300025931 Ga0207644_10001388 Ga0207644_100013888 307
965 3300025934 Ga0207686_10003046 Ga0207686_100030467 307
966 3300025941 Ga0207711_10000178 Ga0207711_1000017812 307
967 3300025945 Ga0207679_10000016 Ga0207679_1000001681 307
968 3300025961 Ga0207712_10035676 Ga0207712_100356764 307
969 3300025986 Ga0207658_10000001 Ga0207658_10000001771 307
970 3300026088 Ga0207641_10018214 Ga0207641_100182145 307
971 3300026088 Ga0207641_10155440 Ga0207641_101554402 307
972 3300026095 Ga0207676_10000001 Ga0207676_10000001581 307
973 3300028379 Ga0268266_10004075 Ga0268266_100040752 307
974 3300028380 Ga0268265_10000936 Ga0268265_1000093625 307
975 3300028381 Ga0268264_10000004 Ga0268264_10000004585 307
976 3300031731 Ga0307405_10001903 Ga0307405_100019036 307
977 3300037068 Ga0373925_0056469 Ga0373925_0056469_115_1068 307
978 3300042000 Ga0439437_001432 Ga0439437_001432_1067_1990 307
979 3300042012 Ga0439455_0007220 Ga0439455_0007220_899_1843 307
980 3300042115 Ga0450911_000083 Ga0450911_000083_3614_4558 307
981 3300042130 Ga0450892_002711 Ga0450892_002711_42_986 307
982 3300042139 Ga0450904_000082 Ga0450904_000082_16668_17612 307
983 3300042156 Ga0439446_0000803 Ga0439446_0000803_4312_5256 307
984 3300042438 Ga0439459_0001744 Ga0439459_0001744_1782_2726 307
985 3300042438 Ga0439459_0028185 Ga0439459_0028185_80_1036 307
986 3300042530 Ga0450916_000109 Ga0450916_000109_3939_4883 307
987 3300046474 Ga0495605_0014965 Ga0495605_0014965_735_1658 307
988 3300046491 Ga0495584_0016948 Ga0495584_0016948_1384_2307 307
989 3300046506 Ga0495583_0008771 Ga0495583_0008771_3678_4601 307
990 3300046506 Ga0495583_0069131 Ga0495583_0069131_158_1081 307
991 3300046507 Ga0495606_0003133 Ga0495606_0003133_15470_16393 307
992 3300046507 Ga0495606_0056808 Ga0495606_0056808_713_1636 307
993 3300046524 Ga0495648_0055717 Ga0495648_0055717_685_1608 307
994 3300046530 Ga0495654_0003153 Ga0495654_0003153_7337_8260 307
995 3300046530 Ga0495654_0012736 Ga0495654_0012736_3195_4118 307
996 3300046664 Ga0495659_0032514 Ga0495659_0032514_196_1119 307
997 3300046810 Ga0495660_0054871 Ga0495660_0054871_783_1706 307
998 3300047320 Ga0495672_0103361 Ga0495672_0103361_231_1154 307
999 3300047446 Ga0495679_011546 Ga0495679_011546_2051_2974 307
1000 3300048920 Ga0496117_0020301 Ga0496117_0020301_65_988 307
1001 3300048924 Ga0496121_0198182 Ga0496121_0198182_449_1372 307
1002 3300048926 Ga0496123_0114334 Ga0496123_0114334_367_1290 307
1003 3300048927 Ga0496124_0085529 Ga0496124_0085529_1532_2485 307
1004 3300048927 Ga0496124_0239685 Ga0496124_0239685_362_1285 307
1005 3300048928 Ga0496125_0012006 Ga0496125_0012006_7269_8222 307
1006 3300048928 Ga0496125_0041636 Ga0496125_0041636_2459_3382 307
1007 3300048928 Ga0496125_0217167 Ga0496125_0217167_230_1153 307
1008 3300048929 Ga0496126_0188847 Ga0496126_0188847_302_1255 307
1009 3300048929 Ga0496126_0189336 Ga0496126_0189336_483_1406 307
1010 3300049460 Ga0495682_0000304 Ga0495682_0000304_9822_10745 307
1011 3300049853 Ga0501226_000009 Ga0501226_000009_59366_60310 307
1012 2124908027 MRS2a_Contig_1682 MRS2a_00541950 308
1013 3300002737 JGI25162J39368_1000391 JGI25162J39368_100039125 308
1014 3300002771 JGI25163J39215_1000255 JGI25163J39215_10002553 308
1015 3300002771 JGI25163J39215_1001158 JGI25163J39215_10011583 308
1016 3300002772 JGI25164J39214_1000089 JGI25164J39214_100008952 308
1017 3300002772 JGI25164J39214_1000279 JGI25164J39214_100027925 308
1018 3300003214 JGI25165J46597_1000191 JGI25165J46597_100019152 308
1019 3300003214 JGI25165J46597_1000510 JGI25165J46597_100051020 308
1020 3300003751 Ga0055538_1000078 Ga0055538_10000781 308
1021 3300003781 Ga0055536_1000089 Ga0055536_10000892 308
1022 3300003791 Ga0055530_10000230 Ga0055530_1000023013 308
1023 3300003791 Ga0055530_10000462 Ga0055530_1000046217 308
1024 3300003791 Ga0055530_10001861 Ga0055530_1000186113 308
1025 3300003792 Ga0055540_1000163 Ga0055540_10001632 308
1026 3300003792 Ga0055540_1000241 Ga0055540_100024113 308
1027 3300003792 Ga0055540_1001061 Ga0055540_100106114 308
1028 3300003794 Ga0055531_10044352 Ga0055531_100443521 308
1029 3300005288 Ga0065714_10003160 Ga0065714_100031602 308
1030 3300005288 Ga0065714_10004034 Ga0065714_100040343 308
1031 3300005288 Ga0065714_10085992 Ga0065714_100859922 308
1032 3300005288 Ga0065714_10099170 Ga0065714_100991701 308
1033 3300005288 Ga0065714_10139196 Ga0065714_101391961 308
1034 3300005290 Ga0065712_10002471 Ga0065712_100024718 308
1035 3300005290 Ga0065712_10071164 Ga0065712_100711648 308
1036 3300005331 Ga0070670_100000751 Ga0070670_10000075124 308
1037 3300005331 Ga0070670_100002027 Ga0070670_1000020272 308
1038 3300005457 Ga0070662_100031548 Ga0070662_1000315482 308
1039 3300005548 Ga0070665_100242711 Ga0070665_1002427113 308
1040 3300006058 Ga0075432_10006397 Ga0075432_100063975 308
1041 3300006177 Ga0075362_10051079 Ga0075362_100510792 308
1042 3300006944 Ga0099823_1000050 Ga0099823_100005015 308
1043 3300006946 Ga0079104_1000222 Ga0079104_100022259 308
1044 3300009011 Ga0105251_10000401 Ga0105251_1000040112 308
1045 3300009011 Ga0105251_10029529 Ga0105251_100295293 308
1046 3300009011 Ga0105251_10046254 Ga0105251_100462543 308
1047 3300009011 Ga0105251_10169024 Ga0105251_101690241 308
1048 3300009036 Ga0105244_10000453 Ga0105244_1000045335 308
1049 3300009036 Ga0105244_10001973 Ga0105244_1000197316 308
1050 3300009036 Ga0105244_10002235 Ga0105244_1000223514 308
1051 3300009036 Ga0105244_10021139 Ga0105244_100211392 308
1052 3300009092 Ga0105250_10000737 Ga0105250_100007373 308
1053 3300009092 Ga0105250_10001320 Ga0105250_100013202 308
1054 3300009092 Ga0105250_10004681 Ga0105250_100046813 308
1055 3300009092 Ga0105250_10013139 Ga0105250_100131392 308
1056 3300009092 Ga0105250_10135576 Ga0105250_101355761 308
1057 3300009148 Ga0105243_10000627 Ga0105243_1000062722 308
1058 3300009148 Ga0105243_10002038 Ga0105243_1000203814 308
1059 3300009148 Ga0105243_10010109 Ga0105243_100101096 308
1060 3300009148 Ga0105243_10179209 Ga0105243_101792093 308
1061 3300011119 Ga0105246_10000467 Ga0105246_1000046723 308
1062 3300011119 Ga0105246_10000590 Ga0105246_100005903 308
1063 3300012498 Ga0157345_1000123 Ga0157345_100012313 308
1064 3300013100 Ga0157373_10001088 Ga0157373_100010882 308
1065 3300013100 Ga0157373_10039070 Ga0157373_100390703 308
1066 3300013100 Ga0157373_10060782 Ga0157373_100607823 308
1067 3300013100 Ga0157373_10122820 Ga0157373_101228202 308
1068 3300013100 Ga0157373_10226233 Ga0157373_102262332 308
1069 3300013102 Ga0157371_10000186 Ga0157371_100001863 308
1070 3300013102 Ga0157371_10000396 Ga0157371_100003962 308
1071 3300013102 Ga0157371_10002310 Ga0157371_1000231016 308
1072 3300013102 Ga0157371_10005382 Ga0157371_100053824 308
1073 3300013104 Ga0157370_10000595 Ga0157370_1000059539 308
1074 3300013104 Ga0157370_10001621 Ga0157370_1000162125 308
1075 3300013104 Ga0157370_10040510 Ga0157370_100405104 308
1076 3300013104 Ga0157370_10091996 Ga0157370_100919962 308
1077 3300013104 Ga0157370_10126378 Ga0157370_101263782 308
1078 3300013104 Ga0157370_10194077 Ga0157370_101940772 308
1079 3300013105 Ga0157369_10001314 Ga0157369_1000131428 308
1080 3300013105 Ga0157369_10135413 Ga0157369_101354132 308
1081 3300013105 Ga0157369_10321810 Ga0157369_103218101 308
1082 3300013105 Ga0157369_10326584 Ga0157369_103265841 308
1083 3300013306 Ga0163162_10007244 Ga0163162_100072449 308
1084 3300013306 Ga0163162_10012235 Ga0163162_100122357 308
1085 3300013307 Ga0157372_10001343 Ga0157372_100013432 308
1086 3300014497 Ga0182008_10001777 Ga0182008_100017772 308
1087 3300014497 Ga0182008_10005889 Ga0182008_100058892 308
1088 3300014497 Ga0182008_10079847 Ga0182008_100798471 308
1089 3300014497 Ga0182008_10085164 Ga0182008_100851641 308
1090 3300015261 Ga0182006_1005166 Ga0182006_10051662 308
1091 3300015261 Ga0182006_1006697 Ga0182006_10066972 308
1092 3300015261 Ga0182006_1024147 Ga0182006_10241472 308
1093 3300015261 Ga0182006_1025996 Ga0182006_10259962 308
1094 3300015261 Ga0182006_1043234 Ga0182006_10432342 308
1095 3300015261 Ga0182006_1059177 Ga0182006_10591772 308
1096 3300015262 Ga0182007_10025387 Ga0182007_100253871 308
1097 3300015265 Ga0182005_1002971 Ga0182005_10029715 308
1098 3300015265 Ga0182005_1025465 Ga0182005_10254652 308
1099 3300015265 Ga0182005_1026233 Ga0182005_10262331 308
1100 3300015265 Ga0182005_1027509 Ga0182005_10275092 308
1101 3300017792 Ga0163161_10003398 Ga0163161_100033989 308
1102 3300017792 Ga0163161_10008626 Ga0163161_100086262 308
1103 3300017792 Ga0163161_10024842 Ga0163161_100248425 308
1104 3300017792 Ga0163161_10103618 Ga0163161_101036182 308
1105 3300025207 Ga0209760_100087 Ga0209760_10008736 308
1106 3300025207 Ga0209760_100145 Ga0209760_10014520 308
1107 3300025207 Ga0209760_100173 Ga0209760_10017319 308
1108 3300025231 Ga0207427_100001 Ga0207427_1000011234 308
1109 3300025231 Ga0207427_100048 Ga0207427_10004866 308
1110 3300025233 Ga0209437_100003 Ga0209437_100003138 308
1111 3300025233 Ga0209437_100094 Ga0209437_10009466 308
1112 3300025261 Ga0209233_1000007 Ga0209233_10000071234 308
1113 3300025261 Ga0209233_1000106 Ga0209233_1000106191 308
1114 3300025291 Ga0209675_1007855 Ga0209675_10078554 308
1115 3300025292 Ga0209676_1000002 Ga0209676_100000270 308
1116 3300025292 Ga0209676_1000021 Ga0209676_1000021543 308
1117 3300025292 Ga0209676_1000166 Ga0209676_1000166100 308
1118 3300025292 Ga0209676_1002655 Ga0209676_10026556 308
1119 3300025298 Ga0209050_1000009 Ga0209050_1000009562 308
1120 3300025298 Ga0209050_1000275 Ga0209050_100027572 308
1121 3300025298 Ga0209050_1000395 Ga0209050_100039554 308
1122 3300025298 Ga0209050_1002062 Ga0209050_100206219 308
1123 3300025303 Ga0209051_1000001 Ga0209051_100000170 308
1124 3300025303 Ga0209051_1000008 Ga0209051_1000008319 308
1125 3300025303 Ga0209051_1000585 Ga0209051_100058521 308
1126 3300025303 Ga0209051_1017780 Ga0209051_10177802 308
1127 3300025304 Ga0209257_1000181 Ga0209257_100018172 308
1128 3300025304 Ga0209257_1004705 Ga0209257_100470510 308
1129 3300025711 Ga0207696_1000063 Ga0207696_100006341 308
1130 3300025711 Ga0207696_1000117 Ga0207696_100011752 308
1131 3300025711 Ga0207696_1000189 Ga0207696_10001893 308
1132 3300025711 Ga0207696_1001409 Ga0207696_10014092 308
1133 3300025711 Ga0207696_1002032 Ga0207696_100203211 308
1134 3300025711 Ga0207696_1016653 Ga0207696_10166532 308
1135 3300025711 Ga0207696_1019721 Ga0207696_10197212 308
1136 3300025728 Ga0207655_1000084 Ga0207655_100008413 308
1137 3300025728 Ga0207655_1000096 Ga0207655_1000096163 308
1138 3300025728 Ga0207655_1002510 Ga0207655_10025104 308
1139 3300025728 Ga0207655_1006033 Ga0207655_10060333 308
1140 3300025728 Ga0207655_1009237 Ga0207655_10092375 308
1141 3300025728 Ga0207655_1018628 Ga0207655_10186282 308
1142 3300025728 Ga0207655_1025497 Ga0207655_10254975 308
1143 3300025728 Ga0207655_1026231 Ga0207655_10262312 308
1144 3300025735 Ga0207713_1000160 Ga0207713_100016078 308
1145 3300025735 Ga0207713_1004279 Ga0207713_10042792 308
1146 3300025735 Ga0207713_1004302 Ga0207713_10043023 308
1147 3300025735 Ga0207713_1011927 Ga0207713_10119275 308
1148 3300025735 Ga0207713_1014256 Ga0207713_10142562 308
1149 3300025735 Ga0207713_1026762 Ga0207713_10267622 308
1150 3300025735 Ga0207713_1056881 Ga0207713_10568812 308
1151 3300025925 Ga0207650_10000554 Ga0207650_100005543 308
1152 3300025933 Ga0207706_10006938 Ga0207706_100069387 308
1153 3300025935 Ga0207709_10000045 Ga0207709_10000045126 308
1154 3300025935 Ga0207709_10000763 Ga0207709_1000076314 308
1155 3300025935 Ga0207709_10105804 Ga0207709_101058042 308
1156 3300025935 Ga0207709_10137802 Ga0207709_101378022 308
1157 3300027111 Ga0209281_1000090 Ga0209281_100009060 308
1158 3300027111 Ga0209281_1003980 Ga0209281_10039802 308
1159 3300027111 Ga0209281_1004668 Ga0209281_10046684 308
1160 3300027296 Ga0209389_1000053 Ga0209389_100005323 308
1161 3300027907 Ga0207428_10037203 Ga0207428_100372033 308
1162 3300027907 Ga0207428_10052219 Ga0207428_100522194 308
1163 3300028786 Ga0307517_10118597 Ga0307517_101185972 308
1164 3300030521 Ga0307511_10039070 Ga0307511_100390702 308
1165 3300030735 Ga0316178_1017010 Ga0316178_101701016 308
1166 3300031250 Ga0265331_10014585 Ga0265331_100145852 308
1167 3300031251 Ga0265327_10000053 Ga0265327_10000053207 308
1168 3300031548 Ga0307408_100019822 Ga0307408_1000198222 308
1169 3300031548 Ga0307408_100145719 Ga0307408_1001457192 308
1170 3300031548 Ga0307408_100298467 Ga0307408_1002984672 308
1171 3300031731 Ga0307405_10001157 Ga0307405_1000115712 308
1172 3300031731 Ga0307405_10006203 Ga0307405_100062037 308
1173 3300031731 Ga0307405_10175589 Ga0307405_101755892 308
1174 3300031824 Ga0307413_10062014 Ga0307413_100620142 308
1175 3300031903 Ga0307407_10028336 Ga0307407_100283363 308
1176 3300031911 Ga0307412_10001593 Ga0307412_1000159311 308
1177 3300031911 Ga0307412_10003035 Ga0307412_1000303511 308
1178 3300031911 Ga0307412_10060637 Ga0307412_100606372 308
1179 3300031995 Ga0307409_100170447 Ga0307409_1001704472 308
1180 3300032002 Ga0307416_100202633 Ga0307416_1002026332 308
1181 3300032004 Ga0307414_10230261 Ga0307414_102302612 308
1182 3300032005 Ga0307411_10026943 Ga0307411_100269433 308
1183 3300033180 Ga0307510_10000104 Ga0307510_1000010461 308
1184 3300038705 Ga0237819_00979 Ga0237819_00979_3495_4421 308
1185 3300041405 Ga0439438_000140 Ga0439438_000140_584_1510 308
1186 3300041405 Ga0439438_000238 Ga0439438_000238_22889_23815 308
1187 3300041405 Ga0439438_000536 Ga0439438_000536_15012_15938 308
1188 3300041405 Ga0439438_017178 Ga0439438_017178_1103_2029 308
1189 3300041405 Ga0439438_021007 Ga0439438_021007_748_1674 308
1190 3300041407 Ga0439447_007219 Ga0439447_007219_956_1882 308
1191 3300041407 Ga0439447_014766 Ga0439447_014766_764_1690 308
1192 3300041407 Ga0439447_017056 Ga0439447_017056_614_1540 308
1193 3300041407 Ga0439447_020436 Ga0439447_020436_737_1663 308
1194 3300041407 Ga0439447_032263 Ga0439447_032263_239_1165 308
1195 3300041411 Ga0439466_0004446 Ga0439466_0004446_4295_5221 308
1196 3300041411 Ga0439466_0016518 Ga0439466_0016518_1721_2647 308
1197 3300041411 Ga0439466_0017730 Ga0439466_0017730_450_1376 308
1198 3300041411 Ga0439466_0018010 Ga0439466_0018010_1071_1997 308
1199 3300041411 Ga0439466_0025348 Ga0439466_0025348_540_1466 308
1200 3300041997 Ga0439431_0016952 Ga0439431_0016952_29_955 308
1201 3300042006 Ga0439432_000623 Ga0439432_000623_575_1501 308
1202 3300042006 Ga0439432_000869 Ga0439432_000869_94_1020 308
1203 3300042006 Ga0439432_005883 Ga0439432_005883_2399_3325 308
1204 3300042006 Ga0439432_021203 Ga0439432_021203_965_1891 308
1205 3300042009 Ga0439451_010390 Ga0439451_010390_553_1479 308
1206 3300042010 Ga0439452_000060 Ga0439452_000060_99985_100911 308
1207 3300042010 Ga0439452_000219 Ga0439452_000219_770_1696 308
1208 3300042010 Ga0439452_001457 Ga0439452_001457_632_1558 308
1209 3300042010 Ga0439452_008660 Ga0439452_008660_1175_2101 308
1210 3300042010 Ga0439452_011379 Ga0439452_011379_1224_2150 308
1211 3300042010 Ga0439452_012550 Ga0439452_012550_258_1184 308
1212 3300042016 Ga0439463_000309 Ga0439463_000309_12289_13215 308
1213 3300042115 Ga0450911_000709 Ga0450911_000709_584_1510 308
1214 3300042115 Ga0450911_002407 Ga0450911_002407_424_1350 308
1215 3300042138 Ga0450903_011547 Ga0450903_011547_15_941 308
1216 3300042142 Ga0450905_002733 Ga0450905_002733_1224_2150 308
1217 3300042145 Ga0450906_007312 Ga0450906_007312_726_1652 308
1218 3300042146 Ga0450907_000766 Ga0450907_000766_1356_2282 308
1219 3300042146 Ga0450907_008386 Ga0450907_008386_683_1609 308
1220 3300042147 Ga0450910_004807 Ga0450910_004807_212_1138 308
1221 3300042185 Ga0450909_006525 Ga0450909_006525_536_1462 308
1222 3300042435 Ga0439434_0000337 Ga0439434_0000337_7354_8280 308
1223 3300042435 Ga0439434_0027969 Ga0439434_0027969_343_1269 308
1224 3300042439 Ga0439464_0014229 Ga0439464_0014229_902_1828 308
1225 3300042461 Ga0439460_0011211 Ga0439460_0011211_1136_2062 308
1226 3300046452 Ga0495617_000193 Ga0495617_000193_36440_37366 308
1227 3300046452 Ga0495617_000325 Ga0495617_000325_584_1510 308
1228 3300046452 Ga0495617_009601 Ga0495617_009601_1885_2811 308
1229 3300046453 Ga0495627_000613 Ga0495627_000613_588_1514 308
1230 3300046453 Ga0495627_033959 Ga0495627_033959_92_1018 308
1231 3300046457 Ga0495590_0002159 Ga0495590_0002159_6647_7573 308
1232 3300046457 Ga0495590_0002522 Ga0495590_0002522_636_1562 308
1233 3300046457 Ga0495590_0027608 Ga0495590_0027608_471_1397 308
1234 3300046458 Ga0495591_000278 Ga0495591_000278_1623_2549 308
1235 3300046458 Ga0495591_008336 Ga0495591_008336_2648_3574 308
1236 3300046458 Ga0495591_011171 Ga0495591_011171_603_1529 308
1237 3300046459 Ga0495629_0173339 Ga0495629_0173339_447_1373 308
1238 3300046460 Ga0495638_0007742 Ga0495638_0007742_1549_2475 308
1239 3300046460 Ga0495638_0011238 Ga0495638_0011238_668_1594 308
1240 3300046460 Ga0495638_0061557 Ga0495638_0061557_567_1493 308
1241 3300046460 Ga0495638_0115027 Ga0495638_0115027_143_1069 308
1242 3300046463 Ga0495653_0001136 Ga0495653_0001136_599_1525 308
1243 3300046463 Ga0495653_0007921 Ga0495653_0007921_657_1583 308
1244 3300046463 Ga0495653_0080412 Ga0495653_0080412_405_1331 308
1245 3300046471 Ga0495650_0008259 Ga0495650_0008259_4498_5424 308
1246 3300046471 Ga0495650_0049791 Ga0495650_0049791_497_1423 308
1247 3300046474 Ga0495605_0001770 Ga0495605_0001770_12684_13610 308
1248 3300046474 Ga0495605_0003753 Ga0495605_0003753_7519_8445 308
1249 3300046474 Ga0495605_0027852 Ga0495605_0027852_663_1589 308
1250 3300046474 Ga0495605_0071274 Ga0495605_0071274_671_1597 308
1251 3300046475 Ga0495639_0000062 Ga0495639_0000062_639_1565 308
1252 3300046475 Ga0495639_0013816 Ga0495639_0013816_2347_3273 308
1253 3300046491 Ga0495584_0001224 Ga0495584_0001224_13966_14892 308
1254 3300046491 Ga0495584_0001546 Ga0495584_0001546_515_1441 308
1255 3300046491 Ga0495584_0008642 Ga0495584_0008642_3647_4573 308
1256 3300046491 Ga0495584_0027786 Ga0495584_0027786_690_1616 308
1257 3300046491 Ga0495584_0041131 Ga0495584_0041131_859_1785 308
1258 3300046491 Ga0495584_0061753 Ga0495584_0061753_639_1565 308
1259 3300046492 Ga0495585_0001213 Ga0495585_0001213_18951_19877 308
1260 3300046492 Ga0495585_0002545 Ga0495585_0002545_1434_2360 308
1261 3300046492 Ga0495585_0068615 Ga0495585_0068615_373_1299 308
1262 3300046499 Ga0495594_0067487 Ga0495594_0067487_228_1154 308
1263 3300046499 Ga0495594_0067773 Ga0495594_0067773_688_1614 308
1264 3300046500 Ga0495596_0000105 Ga0495596_0000105_11070_11996 308
1265 3300046500 Ga0495596_0047895 Ga0495596_0047895_558_1484 308
1266 3300046501 Ga0495607_0000875 Ga0495607_0000875_687_1613 308
1267 3300046501 Ga0495607_0001466 Ga0495607_0001466_18285_19214 308
1268 3300046501 Ga0495607_0004879 Ga0495607_0004879_8189_9115 308
1269 3300046501 Ga0495607_0077051 Ga0495607_0077051_68_994 308
1270 3300046501 Ga0495607_0103725 Ga0495607_0103725_533_1459 308
1271 3300046506 Ga0495583_0019169 Ga0495583_0019169_2104_3030 308
1272 3300046507 Ga0495606_0000502 Ga0495606_0000502_8957_9883 308
1273 3300046507 Ga0495606_0003916 Ga0495606_0003916_594_1520 308
1274 3300046507 Ga0495606_0023741 Ga0495606_0023741_587_1513 308
1275 3300046507 Ga0495606_0085022 Ga0495606_0085022_471_1397 308
1276 3300046512 Ga0495610_0004919 Ga0495610_0004919_552_1478 308
1277 3300046512 Ga0495610_0016704 Ga0495610_0016704_503_1429 308
1278 3300046512 Ga0495610_0060530 Ga0495610_0060530_505_1431 308
1279 3300046512 Ga0495610_0074855 Ga0495610_0074855_540_1466 308
1280 3300046513 Ga0495616_0000487 Ga0495616_0000487_477_1403 308
1281 3300046513 Ga0495616_0002116 Ga0495616_0002116_671_1597 308
1282 3300046513 Ga0495616_0003865 Ga0495616_0003865_8016_8942 308
1283 3300046513 Ga0495616_0014977 Ga0495616_0014977_2803_3729 308
1284 3300046513 Ga0495616_0064057 Ga0495616_0064057_658_1584 308
1285 3300046518 Ga0495631_0000169 Ga0495631_0000169_1286_2212 308
1286 3300046518 Ga0495631_0002840 Ga0495631_0002840_599_1525 308
1287 3300046518 Ga0495631_0028721 Ga0495631_0028721_1257_2183 308
1288 3300046519 Ga0495632_0009783 Ga0495632_0009783_557_1483 308
1289 3300046519 Ga0495632_0016901 Ga0495632_0016901_2452_3378 308
1290 3300046519 Ga0495632_0046515 Ga0495632_0046515_1193_2119 308
1291 3300046519 Ga0495632_0071760 Ga0495632_0071760_690_1616 308
1292 3300046520 Ga0495637_0000168 Ga0495637_0000168_1605_2531 308
1293 3300046520 Ga0495637_0000981 Ga0495637_0000981_17081_18007 308
1294 3300046520 Ga0495637_0011453 Ga0495637_0011453_2766_3692 308
1295 3300046520 Ga0495637_0032175 Ga0495637_0032175_755_1681 308
1296 3300046520 Ga0495637_0049581 Ga0495637_0049581_232_1158 308
1297 3300046520 Ga0495637_0053019 Ga0495637_0053019_290_1216 308
1298 3300046520 Ga0495637_0061684 Ga0495637_0061684_551_1477 308
1299 3300046522 Ga0495643_0013254 Ga0495643_0013254_2167_3093 308
1300 3300046522 Ga0495643_0013745 Ga0495643_0013745_2067_2993 308
1301 3300046522 Ga0495643_0131405 Ga0495643_0131405_284_1210 308
1302 3300046523 Ga0495644_0003642 Ga0495644_0003642_4519_5445 308
1303 3300046523 Ga0495644_0033380 Ga0495644_0033380_573_1499 308
1304 3300046524 Ga0495648_0006890 Ga0495648_0006890_458_1384 308
1305 3300046524 Ga0495648_0029550 Ga0495648_0029550_607_1533 308
1306 3300046524 Ga0495648_0042119 Ga0495648_0042119_564_1490 308
1307 3300046526 Ga0495666_0032046 Ga0495666_0032046_608_1534 308
1308 3300046526 Ga0495666_0033658 Ga0495666_0033658_885_1811 308
1309 3300046528 Ga0495642_0000062 Ga0495642_0000062_743_1669 308
1310 3300046528 Ga0495642_0001560 Ga0495642_0001560_643_1569 308
1311 3300046528 Ga0495642_0025481 Ga0495642_0025481_857_1783 308
1312 3300046530 Ga0495654_0020294 Ga0495654_0020294_343_1269 308
1313 3300046530 Ga0495654_0025617 Ga0495654_0025617_1586_2512 308
1314 3300046530 Ga0495654_0033855 Ga0495654_0033855_987_1913 308
1315 3300046530 Ga0495654_0071668 Ga0495654_0071668_327_1253 308
1316 3300046535 Ga0495586_0076449 Ga0495586_0076449_676_1602 308
1317 3300046536 Ga0495587_0001642 Ga0495587_0001642_61_987 308
1318 3300046536 Ga0495587_0015863 Ga0495587_0015863_340_1266 308
1319 3300046538 Ga0495609_0000260 Ga0495609_0000260_1496_2422 308
1320 3300046538 Ga0495609_0000336 Ga0495609_0000336_14_940 308
1321 3300046538 Ga0495609_0017053 Ga0495609_0017053_573_1499 308
1322 3300046542 Ga0495597_0003574 Ga0495597_0003574_706_1632 308
1323 3300046542 Ga0495597_0003775 Ga0495597_0003775_7632_8558 308
1324 3300046542 Ga0495597_0043125 Ga0495597_0043125_439_1365 308
1325 3300046542 Ga0495597_0055104 Ga0495597_0055104_255_1181 308
1326 3300046557 Ga0495622_0000192 Ga0495622_0000192_45072_45998 308
1327 3300046557 Ga0495622_0002134 Ga0495622_0002134_564_1490 308
1328 3300046557 Ga0495622_0009461 Ga0495622_0009461_822_1748 308
1329 3300046557 Ga0495622_0029287 Ga0495622_0029287_1041_1967 308
1330 3300046558 Ga0495633_0001006 Ga0495633_0001006_1066_1992 308
1331 3300046615 Ga0495656_0000504 Ga0495656_0000504_11329_12255 308
1332 3300046616 Ga0495668_0001623 Ga0495668_0001623_19945_20871 308
1333 3300046642 Ga0495634_0000980 Ga0495634_0000980_25437_26363 308
1334 3300046648 Ga0495611_0001896 Ga0495611_0001896_573_1499 308
1335 3300046660 Ga0495625_0001361 Ga0495625_0001361_512_1438 308
1336 3300046660 Ga0495625_0035983 Ga0495625_0035983_614_1540 308
1337 3300046660 Ga0495625_0111932 Ga0495625_0111932_564_1490 308
1338 3300046660 Ga0495625_0142754 Ga0495625_0142754_435_1361 308
1339 3300046660 Ga0495625_0207997 Ga0495625_0207997_227_1153 308
1340 3300046663 Ga0495635_0000093 Ga0495635_0000093_469_1395 308
1341 3300046663 Ga0495635_0029676 Ga0495635_0029676_196_1122 308
1342 3300046664 Ga0495659_0014355 Ga0495659_0014355_1088_2014 308
1343 3300046665 Ga0495661_0005121 Ga0495661_0005121_531_1457 308
1344 3300046665 Ga0495661_0013957 Ga0495661_0013957_3961_4887 308
1345 3300046665 Ga0495661_0020641 Ga0495661_0020641_2880_3806 308
1346 3300046674 Ga0495588_0002514 Ga0495588_0002514_6237_7163 308
1347 3300046679 Ga0495623_0016238 Ga0495623_0016238_3647_4573 308
1348 3300046680 Ga0495646_0007921 Ga0495646_0007921_1456_2382 308
1349 3300046680 Ga0495646_0010893 Ga0495646_0010893_608_1534 308
1350 3300046684 Ga0495669_0000226 Ga0495669_0000226_31378_32304 308
1351 3300046690 Ga0495624_0000155 Ga0495624_0000155_626_1552 308
1352 3300046691 Ga0495670_0005481 Ga0495670_0005481_4907_5833 308
1353 3300046691 Ga0495670_0056117 Ga0495670_0056117_480_1406 308
1354 3300046692 Ga0495671_0000259 Ga0495671_0000259_810_1736 308
1355 3300046692 Ga0495671_0003705 Ga0495671_0003705_6821_7747 308
1356 3300046692 Ga0495671_0004771 Ga0495671_0004771_6510_7436 308
1357 3300046692 Ga0495671_0025190 Ga0495671_0025190_1906_2832 308
1358 3300046692 Ga0495671_0028106 Ga0495671_0028106_540_1466 308
1359 3300046692 Ga0495671_0055896 Ga0495671_0055896_790_1716 308
1360 3300046692 Ga0495671_0070390 Ga0495671_0070390_222_1148 308
1361 3300046694 Ga0495649_0001079 Ga0495649_0001079_8999_9925 308
1362 3300046694 Ga0495649_0018440 Ga0495649_0018440_674_1600 308
1363 3300046694 Ga0495649_0025858 Ga0495649_0025858_1812_2738 308
1364 3300046694 Ga0495649_0062229 Ga0495649_0062229_442_1368 308
1365 3300046694 Ga0495649_0094706 Ga0495649_0094706_270_1196 308
1366 3300046694 Ga0495649_0149677 Ga0495649_0149677_95_1021 308
1367 3300046794 Ga0495589_0000221 Ga0495589_0000221_47187_48113 308
1368 3300046794 Ga0495589_0000617 Ga0495589_0000617_575_1501 308
1369 3300046794 Ga0495589_0003225 Ga0495589_0003225_5827_6753 308
1370 3300046794 Ga0495589_0030524 Ga0495589_0030524_1496_2422 308
1371 3300046809 Ga0495600_0102868 Ga0495600_0102868_742_1668 308
1372 3300046810 Ga0495660_0089289 Ga0495660_0089289_612_1538 308
1373 3300047315 Ga0495581_0105851 Ga0495581_0105851_466_1392 308
1374 3300047317 Ga0495604_0012379 Ga0495604_0012379_4726_5652 308
1375 3300047318 Ga0495636_0000040 Ga0495636_0000040_54280_55206 308
1376 3300047319 Ga0495674_0057866 Ga0495674_0057866_617_1543 308
1377 3300047320 Ga0495672_0001781 Ga0495672_0001781_596_1522 308
1378 3300047320 Ga0495672_0011396 Ga0495672_0011396_5037_5963 308
1379 3300047320 Ga0495672_0016551 Ga0495672_0016551_331_1257 308
1380 3300047320 Ga0495672_0024492 Ga0495672_0024492_2497_3423 308
1381 3300047320 Ga0495672_0037237 Ga0495672_0037237_1069_1995 308
1382 3300047322 Ga0495680_0010142 Ga0495680_0010142_563_1489 308
1383 3300047322 Ga0495680_0011543 Ga0495680_0011543_2001_2927 308
1384 3300047322 Ga0495680_0061258 Ga0495680_0061258_1396_2322 308
1385 3300047323 Ga0495683_0000281 Ga0495683_0000281_559_1485 308
1386 3300047323 Ga0495683_0021476 Ga0495683_0021476_1755_2681 308
1387 3300047323 Ga0495683_0034957 Ga0495683_0034957_1351_2277 308
1388 3300047323 Ga0495683_0136651 Ga0495683_0136651_140_1066 308
1389 3300047443 Ga0495687_000469 Ga0495687_000469_46963_47889 308
1390 3300047443 Ga0495687_000778 Ga0495687_000778_32803_33729 308
1391 3300047443 Ga0495687_002429 Ga0495687_002429_569_1495 308
1392 3300047444 Ga0495675_0029015 Ga0495675_0029015_1468_2394 308
1393 3300047444 Ga0495675_0085775 Ga0495675_0085775_742_1668 308
1394 3300047445 Ga0495677_0006008 Ga0495677_0006008_659_1585 308
1395 3300047446 Ga0495679_004274 Ga0495679_004274_259_1185 308
1396 3300047446 Ga0495679_004623 Ga0495679_004623_577_1503 308
1397 3300047447 Ga0495685_012178 Ga0495685_012178_1575_2501 308
1398 3300047469 Ga0495673_0000686 Ga0495673_0000686_680_1606 308
1399 3300047469 Ga0495673_0000788 Ga0495673_0000788_1014_1940 308
1400 3300047469 Ga0495673_0004150 Ga0495673_0004150_7649_8575 308
1401 3300047469 Ga0495673_0043763 Ga0495673_0043763_605_1531 308
1402 3300047469 Ga0495673_0053781 Ga0495673_0053781_440_1366 308
1403 3300047470 Ga0495681_0004349 Ga0495681_0004349_592_1518 308
1404 3300047470 Ga0495681_0005920 Ga0495681_0005920_6540_7466 308
1405 3300047470 Ga0495681_0009043 Ga0495681_0009043_4052_4978 308
1406 3300047470 Ga0495681_0022117 Ga0495681_0022117_2023_2949 308
1407 3300047470 Ga0495681_0022644 Ga0495681_0022644_371_1297 308
1408 3300047470 Ga0495681_0032312 Ga0495681_0032312_591_1517 308
1409 3300047470 Ga0495681_0043667 Ga0495681_0043667_694_1620 308
1410 3300047470 Ga0495681_0056625 Ga0495681_0056625_377_1303 308
1411 3300047470 Ga0495681_0062240 Ga0495681_0062240_603_1529 308
1412 3300047470 Ga0495681_0070287 Ga0495681_0070287_558_1484 308
1413 3300047471 Ga0495684_0018999 Ga0495684_0018999_397_1323 308
1414 3300047472 Ga0495686_0044409 Ga0495686_0044409_466_1392 308
1415 3300047673 Ga0495593_0022607 Ga0495593_0022607_2515_3441 308
1416 3300048091 Ga0495626_0000302 Ga0495626_0000302_1635_2561 308
1417 3300048091 Ga0495626_0000469 Ga0495626_0000469_97_1023 308
1418 3300048091 Ga0495626_0000579 Ga0495626_0000579_34756_35682 308
1419 3300048091 Ga0495626_0002795 Ga0495626_0002795_380_1306 308
1420 3300048091 Ga0495626_0006768 Ga0495626_0006768_556_1482 308
1421 3300048091 Ga0495626_0025732 Ga0495626_0025732_759_1685 308
1422 3300048091 Ga0495626_0058032 Ga0495626_0058032_623_1549 308
1423 3300048905 Ga0496102_0000781 Ga0496102_0000781_617_1543 308
1424 3300048906 Ga0496103_0062817 Ga0496103_0062817_513_1439 308
1425 3300048907 Ga0496104_0439975 Ga0496104_0439975_212_1138 308
1426 3300048917 Ga0496114_0022077 Ga0496114_0022077_2721_3647 308
1427 3300048918 Ga0496115_0090249 Ga0496115_0090249_544_1470 308
1428 3300048919 Ga0496116_0000574 Ga0496116_0000574_30978_31904 308
1429 3300048919 Ga0496116_0002461 Ga0496116_0002461_639_1565 308
1430 3300048920 Ga0496117_0004436 Ga0496117_0004436_3855_4781 308
1431 3300048920 Ga0496117_0006695 Ga0496117_0006695_639_1565 308
1432 3300048920 Ga0496117_0123053 Ga0496117_0123053_549_1475 308
1433 3300048920 Ga0496117_0127791 Ga0496117_0127791_504_1430 308
1434 3300048920 Ga0496117_0139260 Ga0496117_0139260_92_1018 308
1435 3300048921 Ga0496118_0019224 Ga0496118_0019224_521_1447 308
1436 3300048921 Ga0496118_0050528 Ga0496118_0050528_870_1796 308
1437 3300048921 Ga0496118_0091542 Ga0496118_0091542_465_1391 308
1438 3300048922 Ga0496119_0000086 Ga0496119_0000086_111282_112208 308
1439 3300048923 Ga0496120_0000130 Ga0496120_0000130_119972_120898 308
1440 3300048924 Ga0496121_0000299 Ga0496121_0000299_12720_13646 308
1441 3300048924 Ga0496121_0007020 Ga0496121_0007020_12117_13043 308
1442 3300048924 Ga0496121_0072537 Ga0496121_0072537_1321_2247 308
1443 3300048925 Ga0496122_0014085 Ga0496122_0014085_543_1469 308
1444 3300048925 Ga0496122_0077106 Ga0496122_0077106_467_1393 308
1445 3300048926 Ga0496123_0003302 Ga0496123_0003302_4822_5748 308
1446 3300048926 Ga0496123_0011307 Ga0496123_0011307_546_1472 308
1447 3300048927 Ga0496124_0003235 Ga0496124_0003235_2368_3324 308
1448 3300048927 Ga0496124_0139543 Ga0496124_0139543_274_1200 308
1449 3300048928 Ga0496125_0013982 Ga0496125_0013982_586_1512 308
1450 3300048929 Ga0496126_0017795 Ga0496126_0017795_4712_5638 308
1451 3300048929 Ga0496126_0117729 Ga0496126_0117729_57_983 308
1452 3300049459 Ga0495678_003761 Ga0495678_003761_591_1517 308
1453 3300049459 Ga0495678_017048 Ga0495678_017048_1810_2736 308
1454 3300049459 Ga0495678_023802 Ga0495678_023802_563_1489 308
1455 3300049459 Ga0495678_041097 Ga0495678_041097_472_1398 308
1456 3300049459 Ga0495678_047329 Ga0495678_047329_266_1192 308
1457 3300049459 Ga0495678_049803 Ga0495678_049803_659_1585 308
1458 3300049460 Ga0495682_0000492 Ga0495682_0000492_5287_6213 308
1459 3300049571 Ga0501034_0000200 Ga0501034_0000200_58591_59517 308
1460 3300049758 Ga0501241_001640 Ga0501241_001640_608_1534 308
1461 3300050491 nmdc:mga00v17_186920_c1 nmdc:mga00v17_186920_c1_210_1136 308
1462 3300053087 Ga0500643_006973 Ga0500643_006973_3040_3996 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00923

TAL_FSA

Transaldolase/Fructose-6-phosphate aldolase

73

354

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e1d-assembly1.cif.gz_A crystal structure of mouse transaldolase 0.9786 3 292
1f05-assembly1.cif.gz_B crystal structure of human transaldolase 0.9764 1 295
4s2c-assembly1.cif.gz_B covalent complex of e. coli transaldolase talb with fructose-6-phosphate 0.9727 2 296
1onr-assembly2.cif.gz_B structure of transaldolase b 0.9707 2 296
1i2r-assembly1.cif.gz_B crystal structure of escherichia coli transaldolase b mutant s176a 0.9706 2 296
ID Description Score Start End Superfamily
af_P37837_1_337_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9838 1 293 3.20.20.70
af_P37837_1_337_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9707 1 293 3.20.20.70
af_A0A1L1QZF2_1_286_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9637 1 250 3.20.20.70
3tk7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9479 1 296 3.20.20.70
3tk7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9448 1 296 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A376U723-F1-model_v4 Transaldolase A (EC 2.2.1.2) 1.006 66 152 GO:0004801
GO:0005829
GO:0005975
AF-A0A377ZDL5-F1-model_v4 Transaldolase (EC 2.2.1.2) 1.005 66 152 GO:0004801
GO:0005829
GO:0005975
AF-A0A376U1G8-F1-model_v4 Transaldolase B (EC 2.2.1.2) 1.003 80 160 GO:0004801
GO:0005829
GO:0005975
GO:0006098
AF-A0A376KQD6-F1-model_v4 Transaldolase A (EC 2.2.1.2) 1.001 70 141 GO:0004801
GO:0005829
GO:0005975
AF-A0A7S2K7L2-F1-model_v4 Transaldolase (EC 2.2.1.2) 0.9998 71 177 GO:0005975
GO:0006098
GO:0016740

Feature Viewer

pLDDT pTM Quality
96.71 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map