F494142
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1463 | 454 | 2926 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300025939|Ga0207665_10281142|Ga0207665_102811422 |
| Length | 145 |
| Sequence | MADPKMRFLVVDDFSTMRRIVRNLLKELGYANVDEAEDGVMALAKLRSESFDFVVSDWNMPNMDGLTMLQNIRADPALAKLPVLMVTAEAKKENIIAAAQAGANGYVSKNLPIEQLYCVLARILATCQQRKRGVPNSEPVLAGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 191 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 192 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 193 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 198 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 217 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 221 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 222 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 223 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 224 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 225 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 226 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 227 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 228 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 229 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 230 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 231 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 232 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 341 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 342 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 343 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 344 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 345 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 346 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 349 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 354 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 355 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 356 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 357 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 358 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 361 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 362 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 363 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 364 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 365 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 381 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 382 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 383 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 385 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 386 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 387 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 388 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049852 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control | Metagenome | Rhizosphere |
| 390 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 398 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 401 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 402 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 431 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 432 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 433 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 434 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 435 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 436 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 437 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 438 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 439 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 440 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 441 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 442 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 443 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 444 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 445 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 446 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 447 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 448 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 449 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 450 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 451 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 452 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 453 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 454 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.6 |
| Metatranscriptomes | 3.76 |
| Isolates | 1.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.84 |
| Nodule | 0.27 |
| Rhizoplane | 4.85 |
| Rhizosphere | 83.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207665_10281142 | 3300025939 | Bacteria | 1238 |
| 2 | MRS1b_contig_3883174 | 2162886011 | Bacteria | 873 |
| 3 | CNXas_1000109 | 3300000545 | Bacteria | 15185 |
| 4 | JGI25154J39366_1001666 | 3300002738 | Bacteria | 7369 |
| 5 | JGI25158J39367_1016024 | 3300002739 | Bacteria | 950 |
| 6 | JGI25158J39367_1026400 | 3300002739 | Bacteria | 678 |
| 7 | JGI25152J39213_1000395 | 3300002773 | Bacteria | 26530 |
| 8 | JGI25152J39213_1021195 | 3300002773 | Bacteria | 1144 |
| 9 | JGI25150J39212_1001869 | 3300002774 | Bacteria | 5551 |
| 10 | JGI25150J39212_1003324 | 3300002774 | Bacteria | 3787 |
| 11 | JGI25159J45721_1004182 | 3300002987 | Bacteria | 4878 |
| 12 | JGI25159J45721_1007879 | 3300002987 | Bacteria | 2996 |
| 13 | JGI25159J45721_1008010 | 3300002987 | Bacteria | 2955 |
| 14 | Ga0006759J45824_1074564 | 3300003163 | Bacteria | 691 |
| 15 | JGI25151J46595_10143722 | 3300003187 | Bacteria | 578 |
| 16 | JGI25406J46586_10000011 | 3300003203 | Bacteria | 104720 |
| 17 | JGI25153J46596_10016332 | 3300003215 | Bacteria | 2979 |
| 18 | Ga0006770J48903_1038274 | 3300003305 | Bacteria | 562 |
| 19 | rootL2_10109828 | 3300003322 | Bacteria | 4438 |
| 20 | JGI25160J50197_1012431 | 3300003354 | Bacteria | 2955 |
| 21 | JGI25161J50226_1004160 | 3300003374 | Bacteria | 3096 |
| 22 | JGI25161J50226_1006147 | 3300003374 | Bacteria | 2216 |
| 23 | JGI25161J50226_1008312 | 3300003374 | Bacteria | 1612 |
| 24 | Ga0007417J51691_1055251 | 3300003544 | Bacteria | 824 |
| 25 | Ga0007409J51694_1016091 | 3300003575 | Bacteria | 1464 |
| 26 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 27 | Ga0055529_1000146 | 3300003763 | Bacteria | 100947 |
| 28 | Ga0055526_1000074 | 3300003771 | Bacteria | 92854 |
| 29 | Ga0055526_1000299 | 3300003771 | Bacteria | 41248 |
| 30 | Ga0055526_1004222 | 3300003771 | Bacteria | 8724 |
| 31 | Ga0055526_1015299 | 3300003771 | Bacteria | 3088 |
| 32 | Ga0055526_1030873 | 3300003771 | Bacteria | 1552 |
| 33 | Ga0055537_1000154 | 3300003773 | Bacteria | 51753 |
| 34 | Ga0055537_1020048 | 3300003773 | Bacteria | 1024 |
| 35 | Ga0055524_1000021 | 3300003775 | Bacteria | 227578 |
| 36 | Ga0055524_1000099 | 3300003775 | Bacteria | 107171 |
| 37 | Ga0055524_1009788 | 3300003775 | Bacteria | 3867 |
| 38 | Ga0055524_1020989 | 3300003775 | Bacteria | 2181 |
| 39 | Ga0055534_1000513 | 3300003784 | Bacteria | 20944 |
| 40 | Ga0055534_1037235 | 3300003784 | Bacteria | 728 |
| 41 | Ga0055534_1046031 | 3300003784 | Bacteria | 630 |
| 42 | Ga0055528_1007230 | 3300003790 | Bacteria | 4933 |
| 43 | Ga0055528_1027547 | 3300003790 | Bacteria | 1595 |
| 44 | Ga0055530_10101324 | 3300003791 | Bacteria | 578 |
| 45 | Ga0055530_10104705 | 3300003791 | Bacteria | 564 |
| 46 | Ga0055531_10003560 | 3300003794 | Bacteria | 9889 |
| 47 | Ga0055543_1002596 | 3300004625 | Bacteria | 5842 |
| 48 | Ga0055543_1005900 | 3300004625 | Bacteria | 3053 |
| 49 | Ga0055543_1026489 | 3300004625 | Bacteria | 1030 |
| 50 | Ga0065165_1000055 | 3300005262 | Bacteria | 187003 |
| 51 | Ga0065165_1003015 | 3300005262 | Bacteria | 12716 |
| 52 | Ga0065165_1013829 | 3300005262 | Bacteria | 3175 |
| 53 | Ga0065165_1031771 | 3300005262 | Bacteria | 1664 |
| 54 | Ga0065165_1044818 | 3300005262 | Bacteria | 1292 |
| 55 | Ga0065704_10301195 | 3300005289 | Unclassified | 885 |
| 56 | Ga0065712_10098684 | 3300005290 | Unclassified | 2108 |
| 57 | Ga0065712_10381451 | 3300005290 | Bacteria | 752 |
| 58 | Ga0070676_10006530 | 3300005328 | Bacteria | 6232 |
| 59 | Ga0070676_10027936 | 3300005328 | Bacteria | 3203 |
| 60 | Ga0070676_10100217 | 3300005328 | Bacteria | 1788 |
| 61 | Ga0070690_100159858 | 3300005330 | Bacteria | 1543 |
| 62 | Ga0070690_100533002 | 3300005330 | Unclassified | 883 |
| 63 | Ga0070690_101299440 | 3300005330 | Unclassified | 583 |
| 64 | Ga0070670_100002302 | 3300005331 | Bacteria | 15736 |
| 65 | Ga0070670_100006241 | 3300005331 | Bacteria | 10083 |
| 66 | Ga0070670_100890794 | 3300005331 | Unclassified | 806 |
| 67 | Ga0070666_10041425 | 3300005335 | Bacteria | 3078 |
| 68 | Ga0070666_11129305 | 3300005335 | Unclassified | 583 |
| 69 | Ga0070680_100113297 | 3300005336 | Bacteria | 2259 |
| 70 | Ga0068868_100039996 | 3300005338 | Bacteria | 3647 |
| 71 | Ga0070660_100045119 | 3300005339 | Bacteria | 3373 |
| 72 | Ga0070689_100045940 | 3300005340 | Bacteria | 3364 |
| 73 | Ga0070689_100209478 | 3300005340 | Bacteria | 1595 |
| 74 | Ga0070661_100199014 | 3300005344 | Bacteria | 1530 |
| 75 | Ga0070661_100571449 | 3300005344 | Bacteria | 912 |
| 76 | Ga0070661_100887244 | 3300005344 | Bacteria | 735 |
| 77 | Ga0070668_100012213 | 3300005347 | Bacteria | 6398 |
| 78 | Ga0070668_101247694 | 3300005347 | Unclassified | 674 |
| 79 | Ga0070669_100014990 | 3300005353 | Bacteria | 5525 |
| 80 | Ga0070669_100050766 | 3300005353 | Bacteria | 3030 |
| 81 | Ga0070675_100033029 | 3300005354 | Bacteria | 4192 |
| 82 | Ga0070675_100327014 | 3300005354 | Bacteria | 1355 |
| 83 | Ga0070671_100015082 | 3300005355 | Bacteria | 6241 |
| 84 | Ga0070671_100022258 | 3300005355 | Bacteria | 5177 |
| 85 | Ga0070671_100750893 | 3300005355 | Unclassified | 848 |
| 86 | Ga0070671_101048816 | 3300005355 | Unclassified | 715 |
| 87 | Ga0070674_100316035 | 3300005356 | Unclassified | 1250 |
| 88 | Ga0070688_100001382 | 3300005365 | Bacteria | 12060 |
| 89 | Ga0070688_100393804 | 3300005365 | Bacteria | 1024 |
| 90 | Ga0070659_100016372 | 3300005366 | Bacteria | 5566 |
| 91 | Ga0070659_101646324 | 3300005366 | Bacteria | 573 |
| 92 | Ga0070667_100001152 | 3300005367 | Bacteria | 23990 |
| 93 | Ga0070667_100037387 | 3300005367 | Unclassified | 4070 |
| 94 | Ga0070667_100130998 | 3300005367 | Bacteria | 2189 |
| 95 | Ga0070710_11084711 | 3300005437 | Bacteria | 587 |
| 96 | Ga0070711_100309067 | 3300005439 | Bacteria | 1260 |
| 97 | Ga0070708_100069853 | 3300005445 | Bacteria | 3159 |
| 98 | Ga0070708_100095985 | 3300005445 | Bacteria | 2707 |
| 99 | Ga0070708_100151113 | 3300005445 | Bacteria | 2159 |
| 100 | Ga0070708_100678736 | 3300005445 | Unclassified | 970 |
| 101 | Ga0070708_100993817 | 3300005445 | Unclassified | 787 |
| 102 | Ga0070663_100487664 | 3300005455 | Bacteria | 1021 |
| 103 | Ga0070663_100750009 | 3300005455 | Unclassified | 833 |
| 104 | Ga0070678_100032818 | 3300005456 | Bacteria | 3597 |
| 105 | Ga0070678_101004950 | 3300005456 | Bacteria | 767 |
| 106 | Ga0070678_101026758 | 3300005456 | Bacteria | 759 |
| 107 | Ga0070662_100166473 | 3300005457 | Unclassified | 1728 |
| 108 | Ga0070662_100309108 | 3300005457 | Bacteria | 1286 |
| 109 | Ga0068867_100830696 | 3300005459 | Unclassified | 826 |
| 110 | Ga0068867_101237614 | 3300005459 | Bacteria | 687 |
| 111 | Ga0070706_100000116 | 3300005467 | Bacteria | 97606 |
| 112 | Ga0070706_100018698 | 3300005467 | Bacteria | 6389 |
| 113 | Ga0070706_100030413 | 3300005467 | Bacteria | 4976 |
| 114 | Ga0070706_100035119 | 3300005467 | Bacteria | 4629 |
| 115 | Ga0070706_100394020 | 3300005467 | Bacteria | 1289 |
| 116 | Ga0070706_101359080 | 3300005467 | Bacteria | 651 |
| 117 | Ga0070706_101692047 | 3300005467 | Unclassified | 576 |
| 118 | Ga0070707_100002729 | 3300005468 | Bacteria | 16791 |
| 119 | Ga0070707_100024521 | 3300005468 | Bacteria | 5713 |
| 120 | Ga0070707_100025365 | 3300005468 | Bacteria | 5623 |
| 121 | Ga0070707_100025898 | 3300005468 | Bacteria | 5567 |
| 122 | Ga0070707_100036840 | 3300005468 | Bacteria | 4669 |
| 123 | Ga0070707_100040136 | 3300005468 | Bacteria | 4477 |
| 124 | Ga0070707_100172499 | 3300005468 | Bacteria | 2107 |
| 125 | Ga0070707_100174613 | 3300005468 | Bacteria | 2094 |
| 126 | Ga0070707_100430691 | 3300005468 | Bacteria | 1279 |
| 127 | Ga0070707_100634912 | 3300005468 | Bacteria | 1030 |
| 128 | Ga0070707_101153467 | 3300005468 | Bacteria | 741 |
| 129 | Ga0070698_100003134 | 3300005471 | Bacteria | 18214 |
| 130 | Ga0070698_100010744 | 3300005471 | Bacteria | 9742 |
| 131 | Ga0070698_100097143 | 3300005471 | Unclassified | 2922 |
| 132 | Ga0070698_100521070 | 3300005471 | Unclassified | 1127 |
| 133 | Ga0070698_101424514 | 3300005471 | Unclassified | 644 |
| 134 | Ga0070699_100073974 | 3300005518 | Bacteria | 2964 |
| 135 | Ga0070699_100121464 | 3300005518 | Unclassified | 2297 |
| 136 | Ga0070699_100970298 | 3300005518 | Bacteria | 779 |
| 137 | Ga0070679_101207007 | 3300005530 | Bacteria | 702 |
| 138 | Ga0070697_100003060 | 3300005536 | Bacteria | 12826 |
| 139 | Ga0070697_100004215 | 3300005536 | Bacteria | 11014 |
| 140 | Ga0070697_100014381 | 3300005536 | Bacteria | 6216 |
| 141 | Ga0070697_100045646 | 3300005536 | Bacteria | 3551 |
| 142 | Ga0070697_100070956 | 3300005536 | Unclassified | 2856 |
| 143 | Ga0070697_100171703 | 3300005536 | Unclassified | 1835 |
| 144 | Ga0070697_100184858 | 3300005536 | Unclassified | 1767 |
| 145 | Ga0070697_100362220 | 3300005536 | Bacteria | 1253 |
| 146 | Ga0070697_101366158 | 3300005536 | Bacteria | 632 |
| 147 | Ga0070672_100003958 | 3300005543 | Bacteria | 9661 |
| 148 | Ga0070672_100311686 | 3300005543 | Bacteria | 1336 |
| 149 | Ga0070672_100552408 | 3300005543 | Unclassified | 1000 |
| 150 | Ga0070672_101073981 | 3300005543 | Bacteria | 715 |
| 151 | Ga0070695_100045457 | 3300005545 | Bacteria | 2798 |
| 152 | Ga0070693_100285770 | 3300005547 | Unclassified | 1106 |
| 153 | Ga0070665_100046012 | 3300005548 | Bacteria | 4383 |
| 154 | Ga0070665_100159514 | 3300005548 | Unclassified | 2257 |
| 155 | Ga0070704_100924943 | 3300005549 | Unclassified | 785 |
| 156 | Ga0070704_100937297 | 3300005549 | Bacteria | 780 |
| 157 | Ga0068855_100044300 | 3300005563 | Bacteria | 5266 |
| 158 | Ga0070664_100257608 | 3300005564 | Unclassified | 1569 |
| 159 | Ga0070664_100271830 | 3300005564 | Bacteria | 1527 |
| 160 | Ga0070664_100792839 | 3300005564 | Bacteria | 885 |
| 161 | Ga0070664_101708942 | 3300005564 | Bacteria | 596 |
| 162 | Ga0068857_100381724 | 3300005577 | Bacteria | 1308 |
| 163 | Ga0068856_100937236 | 3300005614 | Bacteria | 885 |
| 164 | Ga0068856_101631923 | 3300005614 | Bacteria | 658 |
| 165 | Ga0070702_100522835 | 3300005615 | Unclassified | 875 |
| 166 | Ga0070702_101523037 | 3300005615 | Bacteria | 551 |
| 167 | Ga0068852_100132069 | 3300005616 | Bacteria | 2300 |
| 168 | Ga0068866_10030064 | 3300005718 | Unclassified | 2603 |
| 169 | Ga0068866_10155285 | 3300005718 | Unclassified | 1329 |
| 170 | Ga0068851_10140563 | 3300005834 | Bacteria | 1313 |
| 171 | Ga0068860_100603401 | 3300005843 | Bacteria | 1103 |
| 172 | Ga0081540_1195395 | 3300005983 | Unclassified | 741 |
| 173 | Ga0081539_10000139 | 3300005985 | Bacteria | 170623 |
| 174 | Ga0081539_10002232 | 3300005985 | Bacteria | 28218 |
| 175 | Ga0081539_10012174 | 3300005985 | Bacteria | 6675 |
| 176 | Ga0081539_10052402 | 3300005985 | Bacteria | 2291 |
| 177 | Ga0081539_10052887 | 3300005985 | Bacteria | 2277 |
| 178 | Ga0070717_10002406 | 3300006028 | Bacteria | 13200 |
| 179 | Ga0070717_10006132 | 3300006028 | Bacteria | 8828 |
| 180 | Ga0070717_10148449 | 3300006028 | Bacteria | 2027 |
| 181 | Ga0075364_10477428 | 3300006051 | Bacteria | 852 |
| 182 | Ga0070716_100306864 | 3300006173 | Unclassified | 1106 |
| 183 | Ga0070716_100311420 | 3300006173 | Unclassified | 1099 |
| 184 | Ga0070716_100350730 | 3300006173 | Bacteria | 1044 |
| 185 | Ga0070716_100643389 | 3300006173 | Bacteria | 803 |
| 186 | Ga0075362_10055685 | 3300006177 | Bacteria | 1779 |
| 187 | Ga0097621_100004370 | 3300006237 | Bacteria | 9828 |
| 188 | Ga0097621_100004743 | 3300006237 | Bacteria | 9503 |
| 189 | Ga0097621_101288069 | 3300006237 | Unclassified | 690 |
| 190 | Ga0068871_100017920 | 3300006358 | Bacteria | 5370 |
| 191 | Ga0068871_100040568 | 3300006358 | Bacteria | 3729 |
| 192 | Ga0068871_100127459 | 3300006358 | Bacteria | 2155 |
| 193 | Ga0068871_100263499 | 3300006358 | Bacteria | 1504 |
| 194 | Ga0075433_10655378 | 3300006852 | Unclassified | 920 |
| 195 | Ga0075434_100073372 | 3300006871 | Bacteria | 3415 |
| 196 | Ga0075434_101182136 | 3300006871 | Unclassified | 777 |
| 197 | Ga0068865_100083101 | 3300006881 | Unclassified | 2304 |
| 198 | Ga0068865_100183875 | 3300006881 | Bacteria | 1611 |
| 199 | Ga0075436_100021119 | 3300006914 | Bacteria | 4467 |
| 200 | Ga0079104_1020522 | 3300006946 | Bacteria | 1818 |
| 201 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 202 | Ga0099794_10138050 | 3300007265 | Bacteria | 1234 |
| 203 | Ga0105244_10001358 | 3300009036 | Bacteria | 19911 |
| 204 | Ga0105244_10001435 | 3300009036 | Bacteria | 19281 |
| 205 | Ga0105244_10066484 | 3300009036 | Bacteria | 1804 |
| 206 | Ga0105244_10526848 | 3300009036 | Bacteria | 544 |
| 207 | Ga0105250_10242911 | 3300009092 | Bacteria | 768 |
| 208 | Ga0105240_10686415 | 3300009093 | Bacteria | 1119 |
| 209 | Ga0105240_10813296 | 3300009093 | Unclassified | 1011 |
| 210 | Ga0105240_11305553 | 3300009093 | Bacteria | 765 |
| 211 | Ga0111539_10260786 | 3300009094 | Unclassified | 2017 |
| 212 | Ga0105245_10084318 | 3300009098 | Bacteria | 2911 |
| 213 | Ga0105245_10119936 | 3300009098 | Bacteria | 2456 |
| 214 | Ga0105245_10167216 | 3300009098 | Bacteria | 2091 |
| 215 | Ga0105245_10651147 | 3300009098 | Unclassified | 1084 |
| 216 | Ga0105245_13006666 | 3300009098 | Bacteria | 523 |
| 217 | Ga0105243_10234788 | 3300009148 | Bacteria | 1629 |
| 218 | Ga0105243_11841945 | 3300009148 | Bacteria | 637 |
| 219 | Ga0105241_10193522 | 3300009174 | Bacteria | 1694 |
| 220 | Ga0105242_10021980 | 3300009176 | Bacteria | 5014 |
| 221 | Ga0105242_10974916 | 3300009176 | Bacteria | 854 |
| 222 | Ga0105248_11780232 | 3300009177 | Bacteria | 698 |
| 223 | Ga0105237_10302030 | 3300009545 | Unclassified | 1604 |
| 224 | Ga0105237_10856390 | 3300009545 | Bacteria | 916 |
| 225 | Ga0105238_10362340 | 3300009551 | Bacteria | 1439 |
| 226 | Ga0105239_10068393 | 3300010375 | Bacteria | 3903 |
| 227 | Ga0105239_10492732 | 3300010375 | Bacteria | 1393 |
| 228 | Ga0105239_12258985 | 3300010375 | Unclassified | 633 |
| 229 | Ga0157327_1013057 | 3300012512 | Bacteria | 829 |
| 230 | Ga0157373_10078322 | 3300013100 | Bacteria | 2331 |
| 231 | Ga0157373_10634948 | 3300013100 | Bacteria | 779 |
| 232 | Ga0157373_11009385 | 3300013100 | Bacteria | 621 |
| 233 | Ga0157371_10000078 | 3300013102 | Bacteria | 154095 |
| 234 | Ga0157370_10796901 | 3300013104 | Bacteria | 860 |
| 235 | Ga0157374_10020633 | 3300013296 | Bacteria | 5851 |
| 236 | Ga0157374_10099139 | 3300013296 | Unclassified | 2790 |
| 237 | Ga0157374_10116843 | 3300013296 | Unclassified | 2571 |
| 238 | Ga0157374_10255295 | 3300013296 | Bacteria | 1726 |
| 239 | Ga0157374_10610886 | 3300013296 | Bacteria | 1101 |
| 240 | Ga0157378_10022702 | 3300013297 | Bacteria | 5523 |
| 241 | Ga0157378_10023772 | 3300013297 | Bacteria | 5391 |
| 242 | Ga0157378_10093439 | 3300013297 | Bacteria | 2738 |
| 243 | Ga0157378_10093654 | 3300013297 | Bacteria | 2735 |
| 244 | Ga0157378_10156781 | 3300013297 | Bacteria | 2126 |
| 245 | Ga0157378_10258166 | 3300013297 | Bacteria | 1671 |
| 246 | Ga0157378_10271158 | 3300013297 | Bacteria | 1632 |
| 247 | Ga0157378_10297016 | 3300013297 | Unclassified | 1562 |
| 248 | Ga0157378_10486787 | 3300013297 | Bacteria | 1230 |
| 249 | Ga0157378_10626109 | 3300013297 | Unclassified | 1090 |
| 250 | Ga0157378_10897282 | 3300013297 | Unclassified | 917 |
| 251 | Ga0157378_12407997 | 3300013297 | Bacteria | 578 |
| 252 | Ga0163162_10004766 | 3300013306 | Bacteria | 13090 |
| 253 | Ga0163162_10112128 | 3300013306 | Bacteria | 2826 |
| 254 | Ga0163162_10262665 | 3300013306 | Bacteria | 1858 |
| 255 | Ga0157372_10224982 | 3300013307 | Unclassified | 2175 |
| 256 | Ga0157372_10877763 | 3300013307 | Bacteria | 1041 |
| 257 | Ga0157375_10000847 | 3300013308 | Bacteria | 26687 |
| 258 | Ga0157375_10016097 | 3300013308 | Bacteria | 6709 |
| 259 | Ga0157375_10168179 | 3300013308 | Bacteria | 2338 |
| 260 | Ga0157375_10387053 | 3300013308 | Bacteria | 1565 |
| 261 | Ga0157375_13139799 | 3300013308 | Bacteria | 551 |
| 262 | Ga0182008_10021358 | 3300014497 | Bacteria | 3324 |
| 263 | Ga0157377_11272339 | 3300014745 | Bacteria | 573 |
| 264 | Ga0157376_10002921 | 3300014969 | Bacteria | 11722 |
| 265 | Ga0157376_10486261 | 3300014969 | Bacteria | 1210 |
| 266 | Ga0157376_10568546 | 3300014969 | Bacteria | 1124 |
| 267 | Ga0182006_1000026 | 3300015261 | Bacteria | 253543 |
| 268 | Ga0182006_1037798 | 3300015261 | Bacteria | 1912 |
| 269 | Ga0182006_1097963 | 3300015261 | Bacteria | 1045 |
| 270 | Ga0182006_1195413 | 3300015261 | Bacteria | 671 |
| 271 | Ga0182007_10086611 | 3300015262 | Bacteria | 1030 |
| 272 | Ga0182007_10276411 | 3300015262 | Bacteria | 610 |
| 273 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 274 | Ga0182005_1081840 | 3300015265 | Bacteria | 892 |
| 275 | Ga0163161_10040505 | 3300017792 | Bacteria | 3346 |
| 276 | Ga0163161_10262967 | 3300017792 | Bacteria | 1348 |
| 277 | Ga0206351_10247105 | 3300020077 | Bacteria | 1290 |
| 278 | Ga0206353_10452765 | 3300020082 | Bacteria | 590 |
| 279 | Ga0154015_1381368 | 3300020610 | Bacteria | 982 |
| 280 | Ga0213872_10000028 | 3300021361 | Bacteria | 148766 |
| 281 | Ga0213872_10006879 | 3300021361 | Bacteria | 5659 |
| 282 | Ga0213872_10033421 | 3300021361 | Bacteria | 2356 |
| 283 | Ga0209436_100351 | 3300025208 | Bacteria | 20779 |
| 284 | Ga0209436_103199 | 3300025208 | Bacteria | 4460 |
| 285 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 286 | Ga0209437_108742 | 3300025233 | Bacteria | 1608 |
| 287 | Ga0209437_114140 | 3300025233 | Bacteria | 1121 |
| 288 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 289 | Ga0207425_1000327 | 3300025245 | Bacteria | 33618 |
| 290 | Ga0207425_1000339 | 3300025245 | Bacteria | 32468 |
| 291 | Ga0207425_1064128 | 3300025245 | Bacteria | 642 |
| 292 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 293 | Ga0209677_104764 | 3300025253 | Bacteria | 3783 |
| 294 | Ga0209148_1000360 | 3300025254 | Bacteria | 57908 |
| 295 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 296 | Ga0209129_1011719 | 3300025258 | Bacteria | 2071 |
| 297 | Ga0209565_1000057 | 3300025263 | Bacteria | 196908 |
| 298 | Ga0209565_1003411 | 3300025263 | Bacteria | 5154 |
| 299 | Ga0209565_1003951 | 3300025263 | Bacteria | 4642 |
| 300 | Ga0209565_1087400 | 3300025263 | Bacteria | 506 |
| 301 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 302 | Ga0209673_1000051 | 3300025273 | Bacteria | 282161 |
| 303 | Ga0209673_1007915 | 3300025273 | Bacteria | 4803 |
| 304 | Ga0209130_1000091 | 3300025284 | Bacteria | 149502 |
| 305 | Ga0209130_1002422 | 3300025284 | Bacteria | 9393 |
| 306 | Ga0209130_1002705 | 3300025284 | Bacteria | 8437 |
| 307 | Ga0209675_1000027 | 3300025291 | Bacteria | 282175 |
| 308 | Ga0209675_1001211 | 3300025291 | Bacteria | 15650 |
| 309 | Ga0209675_1005738 | 3300025291 | Bacteria | 5124 |
| 310 | Ga0209675_1024807 | 3300025291 | Bacteria | 1524 |
| 311 | Ga0209025_1005014 | 3300025294 | Bacteria | 11056 |
| 312 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 313 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 314 | Ga0209564_1000094 | 3300025295 | Bacteria | 243176 |
| 315 | Ga0209564_1001487 | 3300025295 | Bacteria | 23618 |
| 316 | Ga0209564_1007956 | 3300025295 | Bacteria | 5334 |
| 317 | Ga0209564_1010315 | 3300025295 | Bacteria | 4323 |
| 318 | Ga0209564_1038751 | 3300025295 | Bacteria | 1321 |
| 319 | Ga0209758_1000073 | 3300025297 | Bacteria | 276262 |
| 320 | Ga0209758_1000227 | 3300025297 | Bacteria | 120073 |
| 321 | Ga0209050_1000046 | 3300025298 | Bacteria | 386466 |
| 322 | Ga0209050_1000442 | 3300025298 | Bacteria | 75310 |
| 323 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 324 | Ga0209256_1000116 | 3300025299 | Bacteria | 169876 |
| 325 | Ga0209256_1000145 | 3300025299 | Bacteria | 150609 |
| 326 | Ga0209256_1000988 | 3300025299 | Bacteria | 34026 |
| 327 | Ga0209256_1007853 | 3300025299 | Bacteria | 5124 |
| 328 | Ga0207426_1003827 | 3300025302 | Bacteria | 7778 |
| 329 | Ga0209051_1045983 | 3300025303 | Bacteria | 1505 |
| 330 | Ga0209257_1000068 | 3300025304 | Bacteria | 341291 |
| 331 | Ga0207697_10000230 | 3300025315 | Bacteria | 30289 |
| 332 | Ga0207656_10147600 | 3300025321 | Bacteria | 1112 |
| 333 | Ga0207655_1015761 | 3300025728 | Bacteria | 4179 |
| 334 | Ga0207642_10018395 | 3300025899 | Bacteria | 2681 |
| 335 | Ga0207642_10133315 | 3300025899 | Bacteria | 1300 |
| 336 | Ga0207642_11051782 | 3300025899 | Bacteria | 525 |
| 337 | Ga0207688_10028875 | 3300025901 | Bacteria | 3051 |
| 338 | Ga0207680_10022988 | 3300025903 | Bacteria | 3398 |
| 339 | Ga0207699_10353593 | 3300025906 | Bacteria | 1037 |
| 340 | Ga0207705_10001972 | 3300025909 | Bacteria | 15970 |
| 341 | Ga0207705_10526539 | 3300025909 | Bacteria | 919 |
| 342 | Ga0207684_10000190 | 3300025910 | Bacteria | 97762 |
| 343 | Ga0207684_10030054 | 3300025910 | Bacteria | 4626 |
| 344 | Ga0207684_10031627 | 3300025910 | Bacteria | 4501 |
| 345 | Ga0207684_10059588 | 3300025910 | Bacteria | 3242 |
| 346 | Ga0207684_10070092 | 3300025910 | Bacteria | 2979 |
| 347 | Ga0207684_10539954 | 3300025910 | Bacteria | 998 |
| 348 | Ga0207684_10779762 | 3300025910 | Bacteria | 809 |
| 349 | Ga0207654_10008161 | 3300025911 | Bacteria | 5281 |
| 350 | Ga0207671_10204875 | 3300025914 | Unclassified | 1541 |
| 351 | Ga0207671_10830194 | 3300025914 | Bacteria | 732 |
| 352 | Ga0207660_10057168 | 3300025917 | Bacteria | 2794 |
| 353 | Ga0207657_10871977 | 3300025919 | Bacteria | 694 |
| 354 | Ga0207649_10228473 | 3300025920 | Bacteria | 1329 |
| 355 | Ga0207652_10809247 | 3300025921 | Bacteria | 832 |
| 356 | Ga0207646_10003785 | 3300025922 | Bacteria | 16837 |
| 357 | Ga0207646_10009717 | 3300025922 | Bacteria | 9483 |
| 358 | Ga0207646_10015435 | 3300025922 | Bacteria | 7213 |
| 359 | Ga0207646_10047841 | 3300025922 | Bacteria | 3835 |
| 360 | Ga0207646_10114655 | 3300025922 | Bacteria | 2420 |
| 361 | Ga0207646_10120029 | 3300025922 | Bacteria | 2362 |
| 362 | Ga0207646_11511300 | 3300025922 | Unclassified | 581 |
| 363 | Ga0207646_11862424 | 3300025922 | Bacteria | 513 |
| 364 | Ga0207681_10069268 | 3300025923 | Unclassified | 2453 |
| 365 | Ga0207681_10666174 | 3300025923 | Unclassified | 863 |
| 366 | Ga0207694_10368309 | 3300025924 | Bacteria | 1191 |
| 367 | Ga0207650_10015523 | 3300025925 | Bacteria | 5305 |
| 368 | Ga0207650_11819441 | 3300025925 | Bacteria | 515 |
| 369 | Ga0207659_10049775 | 3300025926 | Bacteria | 2973 |
| 370 | Ga0207659_10203549 | 3300025926 | Bacteria | 1582 |
| 371 | Ga0207687_10518458 | 3300025927 | Bacteria | 997 |
| 372 | Ga0207644_10543189 | 3300025931 | Unclassified | 961 |
| 373 | Ga0207644_11170587 | 3300025931 | Unclassified | 646 |
| 374 | Ga0207690_10010877 | 3300025932 | Bacteria | 5422 |
| 375 | Ga0207690_10152984 | 3300025932 | Bacteria | 1712 |
| 376 | Ga0207690_11221363 | 3300025932 | Bacteria | 628 |
| 377 | Ga0207706_10120143 | 3300025933 | Unclassified | 2310 |
| 378 | Ga0207706_10127098 | 3300025933 | Bacteria | 2241 |
| 379 | Ga0207706_10365512 | 3300025933 | Bacteria | 1253 |
| 380 | Ga0207686_10028891 | 3300025934 | Bacteria | 3265 |
| 381 | Ga0207686_10399664 | 3300025934 | Unclassified | 1046 |
| 382 | Ga0207709_10683063 | 3300025935 | Bacteria | 820 |
| 383 | Ga0207670_10026701 | 3300025936 | Bacteria | 3642 |
| 384 | Ga0207670_10267760 | 3300025936 | Unclassified | 1327 |
| 385 | Ga0207669_10125945 | 3300025937 | Bacteria | 1750 |
| 386 | Ga0207669_11362432 | 3300025937 | Unclassified | 603 |
| 387 | Ga0207704_10225664 | 3300025938 | Bacteria | 1389 |
| 388 | Ga0207704_10339819 | 3300025938 | Bacteria | 1165 |
| 389 | Ga0207665_10019448 | 3300025939 | Bacteria | 4465 |
| 390 | Ga0207665_10082276 | 3300025939 | Unclassified | 2218 |
| 391 | Ga0207691_10001130 | 3300025940 | Bacteria | 26498 |
| 392 | Ga0207691_10227193 | 3300025940 | Bacteria | 1617 |
| 393 | Ga0207691_10312466 | 3300025940 | Bacteria | 1348 |
| 394 | Ga0207691_11053828 | 3300025940 | Bacteria | 677 |
| 395 | Ga0207691_11186069 | 3300025940 | Unclassified | 633 |
| 396 | Ga0207679_10083312 | 3300025945 | Bacteria | 2451 |
| 397 | Ga0207679_10088846 | 3300025945 | Bacteria | 2384 |
| 398 | Ga0207667_10027566 | 3300025949 | Bacteria | 6180 |
| 399 | Ga0207651_10987501 | 3300025960 | Bacteria | 752 |
| 400 | Ga0207668_10236886 | 3300025972 | Unclassified | 1474 |
| 401 | Ga0207668_10542504 | 3300025972 | Bacteria | 1006 |
| 402 | Ga0207640_10715427 | 3300025981 | Bacteria | 860 |
| 403 | Ga0207658_10010500 | 3300025986 | Bacteria | 6289 |
| 404 | Ga0207677_10063774 | 3300026023 | Bacteria | 2563 |
| 405 | Ga0207677_12103007 | 3300026023 | Unclassified | 525 |
| 406 | Ga0207678_10063189 | 3300026067 | Bacteria | 3181 |
| 407 | Ga0207678_10295105 | 3300026067 | Unclassified | 1392 |
| 408 | Ga0207702_10880136 | 3300026078 | Bacteria | 887 |
| 409 | Ga0207702_11275697 | 3300026078 | Bacteria | 729 |
| 410 | Ga0207648_10098010 | 3300026089 | Bacteria | 2566 |
| 411 | Ga0207648_10225463 | 3300026089 | Bacteria | 1666 |
| 412 | Ga0207648_11146711 | 3300026089 | Bacteria | 729 |
| 413 | Ga0207674_11315610 | 3300026116 | Bacteria | 692 |
| 414 | Ga0207683_10006813 | 3300026121 | Bacteria | 9784 |
| 415 | Ga0207683_10336655 | 3300026121 | Bacteria | 1384 |
| 416 | Ga0207698_10222334 | 3300026142 | Bacteria | 1707 |
| 417 | Ga0209281_1005666 | 3300027111 | Bacteria | 3412 |
| 418 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 419 | Ga0268266_10013072 | 3300028379 | Bacteria | 7159 |
| 420 | Ga0316180_1109616 | 3300030736 | Bacteria | 3644 |
| 421 | Ga0316183_1134260 | 3300030742 | Bacteria | 893 |
| 422 | Ga0316181_1070955 | 3300030744 | Bacteria | 1466 |
| 423 | Ga0316181_1263623 | 3300030744 | Bacteria | 1678 |
| 424 | Ga0316182_1023982 | 3300030745 | Bacteria | 3939 |
| 425 | Ga0265316_10067224 | 3300031344 | Bacteria | 2772 |
| 426 | Ga0265316_11107695 | 3300031344 | Bacteria | 549 |
| 427 | Ga0307513_10136437 | 3300031456 | Bacteria | 2388 |
| 428 | Ga0307408_100000981 | 3300031548 | Bacteria | 22068 |
| 429 | Ga0307408_100001472 | 3300031548 | Bacteria | 17464 |
| 430 | Ga0307408_100002767 | 3300031548 | Bacteria | 12179 |
| 431 | Ga0307408_101680490 | 3300031548 | Bacteria | 604 |
| 432 | Ga0307508_10139506 | 3300031616 | Bacteria | 2027 |
| 433 | Ga0307518_10137449 | 3300031838 | Bacteria | 1709 |
| 434 | Ga0307406_12051234 | 3300031901 | Bacteria | 512 |
| 435 | Ga0307412_10476873 | 3300031911 | Bacteria | 1034 |
| 436 | Ga0307412_10502414 | 3300031911 | Bacteria | 1010 |
| 437 | Ga0307412_12064263 | 3300031911 | Bacteria | 529 |
| 438 | Ga0307416_100011426 | 3300032002 | Bacteria | 5921 |
| 439 | Ga0307416_101432393 | 3300032002 | Bacteria | 797 |
| 440 | Ga0307416_102723184 | 3300032002 | Bacteria | 591 |
| 441 | Ga0307414_10020067 | 3300032004 | Bacteria | 4156 |
| 442 | Ga0307414_10541653 | 3300032004 | Bacteria | 1036 |
| 443 | Ga0307411_10968862 | 3300032005 | Bacteria | 760 |
| 444 | Ga0307415_102043720 | 3300032126 | Bacteria | 559 |
| 445 | Ga0373943_0048876 | 3300035170 | Bacteria | 2074 |
| 446 | Ga0373943_0947714 | 3300035170 | Unclassified | 515 |
| 447 | Ga0373947_0040081 | 3300035725 | Bacteria | 2789 |
| 448 | Ga0373947_0126165 | 3300035725 | Bacteria | 1630 |
| 449 | Ga0373937_0168600 | 3300036401 | Bacteria | 2054 |
| 450 | Ga0373925_0080283 | 3300037068 | Bacteria | 2479 |
| 451 | Ga0373925_0771979 | 3300037068 | Unclassified | 792 |
| 452 | Ga0395899_0000082 | 3300037312 | Bacteria | 168513 |
| 453 | Ga0395899_0016969 | 3300037312 | Bacteria | 5549 |
| 454 | Ga0395899_0024287 | 3300037312 | Bacteria | 4584 |
| 455 | Ga0395899_0210055 | 3300037312 | Bacteria | 1353 |
| 456 | Ga0395900_0000393 | 3300037418 | Bacteria | 63296 |
| 457 | Ga0395900_0019995 | 3300037418 | Bacteria | 6826 |
| 458 | Ga0395900_0046773 | 3300037418 | Bacteria | 4455 |
| 459 | Ga0395900_0092327 | 3300037418 | Bacteria | 3110 |
| 460 | Ga0395900_0113588 | 3300037418 | Bacteria | 2779 |
| 461 | Ga0395900_0184192 | 3300037418 | Bacteria | 2120 |
| 462 | Ga0395900_1822254 | 3300037418 | Bacteria | 519 |
| 463 | Ga0395898_0106973 | 3300037466 | Bacteria | 2682 |
| 464 | Ga0395898_0152641 | 3300037466 | Bacteria | 2209 |
| 465 | Ga0395898_1003428 | 3300037466 | Bacteria | 770 |
| 466 | Ga0395898_1377172 | 3300037466 | Bacteria | 633 |
| 467 | Ga0395905_0009206 | 3300037471 | Bacteria | 9668 |
| 468 | Ga0395905_0047340 | 3300037471 | Bacteria | 4030 |
| 469 | Ga0395905_0549185 | 3300037471 | Bacteria | 1056 |
| 470 | Ga0395905_0569842 | 3300037471 | Bacteria | 1034 |
| 471 | Ga0395905_0701342 | 3300037471 | Bacteria | 914 |
| 472 | Ga0395905_1823413 | 3300037471 | Bacteria | 514 |
| 473 | Ga0395905_1847022 | 3300037471 | Bacteria | 510 |
| 474 | Ga0436364_0101037 | 3300037853 | Bacteria | 585 |
| 475 | Ga0395901_0000054 | 3300038443 | Bacteria | 160505 |
| 476 | Ga0395901_0010533 | 3300038443 | Bacteria | 9365 |
| 477 | Ga0395901_0163525 | 3300038443 | Bacteria | 2337 |
| 478 | Ga0395901_0334325 | 3300038443 | Bacteria | 1565 |
| 479 | Ga0395901_0359500 | 3300038443 | Bacteria | 1501 |
| 480 | Ga0395901_1163544 | 3300038443 | Bacteria | 739 |
| 481 | Ga0436361_0605732 | 3300039447 | Bacteria | 3541 |
| 482 | Ga0436361_0616428 | 3300039447 | Bacteria | 15855 |
| 483 | Ga0436361_1222516 | 3300039447 | Bacteria | 588 |
| 484 | Ga0439436_0045720 | 3300041404 | Bacteria | 1245 |
| 485 | Ga0451807_2769524 | 3300041486 | Unclassified | 669 |
| 486 | Ga0451835_0242121 | 3300041492 | Unclassified | 506 |
| 487 | Ga0451853_2377098 | 3300041512 | Bacteria | 678 |
| 488 | Ga0451853_2842729 | 3300041512 | Unclassified | 854 |
| 489 | Ga0451853_3225716 | 3300041512 | Bacteria | 855 |
| 490 | Ga0439448_0316470 | 3300042005 | Bacteria | 555 |
| 491 | Ga0439449_0028091 | 3300042007 | Bacteria | 2097 |
| 492 | Ga0439450_156315 | 3300042008 | Bacteria | 599 |
| 493 | Ga0439454_004952 | 3300042011 | Bacteria | 1567 |
| 494 | Ga0439455_0105379 | 3300042012 | Bacteria | 781 |
| 495 | Ga0450911_020566 | 3300042115 | Bacteria | 862 |
| 496 | Ga0450920_092727 | 3300042122 | Bacteria | 624 |
| 497 | Ga0450898_106442 | 3300042134 | Bacteria | 590 |
| 498 | Ga0450904_000438 | 3300042139 | Bacteria | 8300 |
| 499 | Ga0439446_0134383 | 3300042156 | Bacteria | 804 |
| 500 | Ga0450893_0090164 | 3300042532 | Bacteria | 615 |
| 501 | Ga0451577_0107899 | 3300042876 | Bacteria | 2489 |
| 502 | Ga0451577_1143792 | 3300042876 | Bacteria | 695 |
| 503 | Ga0466969_0062179 | 3300044656 | Bacteria | 1812 |
| 504 | Ga0466969_0205223 | 3300044656 | Bacteria | 898 |
| 505 | Ga0466972_0000042 | 3300044658 | Bacteria | 131971 |
| 506 | Ga0466972_0127184 | 3300044658 | Bacteria | 1200 |
| 507 | Ga0466972_0130545 | 3300044658 | Bacteria | 1183 |
| 508 | Ga0466982_0387196 | 3300044672 | Bacteria | 762 |
| 509 | Ga0466965_0123291 | 3300044683 | Bacteria | 1339 |
| 510 | Ga0466965_0159673 | 3300044683 | Bacteria | 1181 |
| 511 | Ga0466965_0182269 | 3300044683 | Bacteria | 1108 |
| 512 | Ga0466966_0034358 | 3300044684 | Bacteria | 3278 |
| 513 | Ga0466966_0180341 | 3300044684 | Bacteria | 1281 |
| 514 | Ga0466963_0184915 | 3300044694 | Bacteria | 1455 |
| 515 | Ga0466964_0000091 | 3300044706 | Bacteria | 21332 |
| 516 | Ga0466964_0052645 | 3300044706 | Bacteria | 1673 |
| 517 | Ga0466964_0429360 | 3300044706 | Bacteria | 696 |
| 518 | Ga0453684_0000917 | 3300044712 | Bacteria | 97990 |
| 519 | Ga0453684_1277106 | 3300044712 | Bacteria | 767 |
| 520 | Ga0466971_0210479 | 3300044719 | Bacteria | 919 |
| 521 | Ga0466971_0242506 | 3300044719 | Bacteria | 857 |
| 522 | Ga0466968_0000777 | 3300044735 | Bacteria | 11090 |
| 523 | Ga0466957_0166814 | 3300044842 | Bacteria | 1432 |
| 524 | Ga0466957_0218946 | 3300044842 | Bacteria | 1256 |
| 525 | Ga0466960_0144687 | 3300044901 | Bacteria | 1265 |
| 526 | Ga0466960_0312230 | 3300044901 | Bacteria | 888 |
| 527 | Ga0466960_0574434 | 3300044901 | Bacteria | 667 |
| 528 | Ga0466959_0028509 | 3300045049 | Bacteria | 4140 |
| 529 | Ga0466959_0220493 | 3300045049 | Bacteria | 1315 |
| 530 | Ga0451576_0365370 | 3300045051 | Bacteria | 1512 |
| 531 | Ga0466958_0208527 | 3300045836 | Bacteria | 1244 |
| 532 | Ga0466967_0015997 | 3300045976 | Bacteria | 5900 |
| 533 | Ga0466967_0118372 | 3300045976 | Bacteria | 2443 |
| 534 | Ga0466967_0181032 | 3300045976 | Bacteria | 1988 |
| 535 | Ga0495617_000041 | 3300046452 | Bacteria | 124027 |
| 536 | Ga0495617_000057 | 3300046452 | Bacteria | 100673 |
| 537 | Ga0495617_001102 | 3300046452 | Bacteria | 12291 |
| 538 | Ga0495617_026400 | 3300046452 | Bacteria | 1955 |
| 539 | Ga0495617_033783 | 3300046452 | Bacteria | 1716 |
| 540 | Ga0495617_234914 | 3300046452 | Bacteria | 567 |
| 541 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 542 | Ga0495627_001004 | 3300046453 | Bacteria | 18981 |
| 543 | Ga0495627_014641 | 3300046453 | Bacteria | 2730 |
| 544 | Ga0495603_0057009 | 3300046455 | Bacteria | 2312 |
| 545 | Ga0495603_0183470 | 3300046455 | Bacteria | 1210 |
| 546 | Ga0495603_0327998 | 3300046455 | Bacteria | 878 |
| 547 | Ga0495603_0394385 | 3300046455 | Bacteria | 793 |
| 548 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 549 | Ga0495590_0000018 | 3300046457 | Bacteria | 216375 |
| 550 | Ga0495590_0000251 | 3300046457 | Bacteria | 29217 |
| 551 | Ga0495590_0003051 | 3300046457 | Bacteria | 6864 |
| 552 | Ga0495590_0016843 | 3300046457 | Bacteria | 2637 |
| 553 | Ga0495590_0122654 | 3300046457 | Bacteria | 931 |
| 554 | Ga0495590_0186459 | 3300046457 | Bacteria | 759 |
| 555 | Ga0495591_004295 | 3300046458 | Bacteria | 7030 |
| 556 | Ga0495591_020659 | 3300046458 | Bacteria | 2169 |
| 557 | Ga0495629_0008847 | 3300046459 | Bacteria | 7403 |
| 558 | Ga0495629_0041207 | 3300046459 | Bacteria | 3249 |
| 559 | Ga0495629_0093578 | 3300046459 | Bacteria | 2097 |
| 560 | Ga0495629_0171494 | 3300046459 | Bacteria | 1505 |
| 561 | Ga0495629_0377308 | 3300046459 | Unclassified | 965 |
| 562 | Ga0495638_0000423 | 3300046460 | Bacteria | 51134 |
| 563 | Ga0495638_0001950 | 3300046460 | Bacteria | 17693 |
| 564 | Ga0495638_0002366 | 3300046460 | Bacteria | 15443 |
| 565 | Ga0495638_0025941 | 3300046460 | Bacteria | 3804 |
| 566 | Ga0495638_0097743 | 3300046460 | Bacteria | 1760 |
| 567 | Ga0495638_0125695 | 3300046460 | Bacteria | 1511 |
| 568 | Ga0495638_0148394 | 3300046460 | Bacteria | 1362 |
| 569 | Ga0495638_0287897 | 3300046460 | Bacteria | 890 |
| 570 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 571 | Ga0495653_0005312 | 3300046463 | Bacteria | 10477 |
| 572 | Ga0495653_0123169 | 3300046463 | Bacteria | 1844 |
| 573 | Ga0495653_0126365 | 3300046463 | Bacteria | 1815 |
| 574 | Ga0495653_0242459 | 3300046463 | Bacteria | 1200 |
| 575 | Ga0495650_0000108 | 3300046471 | Bacteria | 200369 |
| 576 | Ga0495650_0000118 | 3300046471 | Bacteria | 187358 |
| 577 | Ga0495650_0000156 | 3300046471 | Bacteria | 155338 |
| 578 | Ga0495650_0000166 | 3300046471 | Bacteria | 146047 |
| 579 | Ga0495650_0001417 | 3300046471 | Bacteria | 23322 |
| 580 | Ga0495650_0004758 | 3300046471 | Bacteria | 9125 |
| 581 | Ga0495650_0033948 | 3300046471 | Bacteria | 2264 |
| 582 | Ga0495650_0056190 | 3300046471 | Bacteria | 1598 |
| 583 | Ga0495650_0129330 | 3300046471 | Bacteria | 922 |
| 584 | Ga0495580_0029634 | 3300046472 | Bacteria | 3970 |
| 585 | Ga0495580_0685629 | 3300046472 | Bacteria | 672 |
| 586 | Ga0495582_0007542 | 3300046473 | Bacteria | 6017 |
| 587 | Ga0495582_0096997 | 3300046473 | Bacteria | 1648 |
| 588 | Ga0495582_0149706 | 3300046473 | Bacteria | 1325 |
| 589 | Ga0495582_0378240 | 3300046473 | Bacteria | 816 |
| 590 | Ga0495582_0717439 | 3300046473 | Bacteria | 578 |
| 591 | Ga0495605_0000059 | 3300046474 | Bacteria | 146371 |
| 592 | Ga0495605_0000260 | 3300046474 | Bacteria | 61729 |
| 593 | Ga0495605_0000598 | 3300046474 | Bacteria | 28458 |
| 594 | Ga0495605_0001111 | 3300046474 | Bacteria | 17923 |
| 595 | Ga0495605_0003011 | 3300046474 | Bacteria | 10174 |
| 596 | Ga0495605_0008745 | 3300046474 | Bacteria | 5716 |
| 597 | Ga0495605_0029751 | 3300046474 | Bacteria | 2806 |
| 598 | Ga0495605_0030368 | 3300046474 | Bacteria | 2772 |
| 599 | Ga0495605_0037060 | 3300046474 | Bacteria | 2455 |
| 600 | Ga0495605_0041669 | 3300046474 | Bacteria | 2286 |
| 601 | Ga0495605_0062056 | 3300046474 | Bacteria | 1786 |
| 602 | Ga0495605_0069744 | 3300046474 | Bacteria | 1663 |
| 603 | Ga0495605_0089022 | 3300046474 | Bacteria | 1433 |
| 604 | Ga0495605_0278526 | 3300046474 | Bacteria | 711 |
| 605 | Ga0495605_0361635 | 3300046474 | Bacteria | 607 |
| 606 | Ga0495605_0378819 | 3300046474 | Bacteria | 590 |
| 607 | Ga0495639_0250894 | 3300046475 | Bacteria | 875 |
| 608 | Ga0495664_0703930 | 3300046477 | Bacteria | 597 |
| 609 | Ga0495584_0000006 | 3300046491 | Bacteria | 301775 |
| 610 | Ga0495584_0001835 | 3300046491 | Bacteria | 12335 |
| 611 | Ga0495584_0001841 | 3300046491 | Bacteria | 12302 |
| 612 | Ga0495584_0002247 | 3300046491 | Bacteria | 11024 |
| 613 | Ga0495584_0004974 | 3300046491 | Bacteria | 7082 |
| 614 | Ga0495584_0007211 | 3300046491 | Bacteria | 5802 |
| 615 | Ga0495584_0011682 | 3300046491 | Bacteria | 4493 |
| 616 | Ga0495584_0013361 | 3300046491 | Bacteria | 4192 |
| 617 | Ga0495584_0013827 | 3300046491 | Bacteria | 4114 |
| 618 | Ga0495584_0036310 | 3300046491 | Bacteria | 2490 |
| 619 | Ga0495584_0036816 | 3300046491 | Bacteria | 2471 |
| 620 | Ga0495584_0041304 | 3300046491 | Bacteria | 2328 |
| 621 | Ga0495584_0047001 | 3300046491 | Bacteria | 2176 |
| 622 | Ga0495584_0058346 | 3300046491 | Bacteria | 1941 |
| 623 | Ga0495584_0089372 | 3300046491 | Bacteria | 1553 |
| 624 | Ga0495584_0091051 | 3300046491 | Bacteria | 1538 |
| 625 | Ga0495584_0237158 | 3300046491 | Bacteria | 927 |
| 626 | Ga0495584_0666068 | 3300046491 | Bacteria | 530 |
| 627 | Ga0495585_0000282 | 3300046492 | Bacteria | 50936 |
| 628 | Ga0495585_0003548 | 3300046492 | Bacteria | 10477 |
| 629 | Ga0495585_0004128 | 3300046492 | Bacteria | 9503 |
| 630 | Ga0495585_0004783 | 3300046492 | Bacteria | 8711 |
| 631 | Ga0495585_0007364 | 3300046492 | Bacteria | 6745 |
| 632 | Ga0495585_0008922 | 3300046492 | Bacteria | 6048 |
| 633 | Ga0495585_0011838 | 3300046492 | Bacteria | 5153 |
| 634 | Ga0495585_0014509 | 3300046492 | Bacteria | 4587 |
| 635 | Ga0495585_0016543 | 3300046492 | Bacteria | 4273 |
| 636 | Ga0495585_0023658 | 3300046492 | Bacteria | 3525 |
| 637 | Ga0495585_0042612 | 3300046492 | Bacteria | 2541 |
| 638 | Ga0495585_0047888 | 3300046492 | Bacteria | 2378 |
| 639 | Ga0495585_0097886 | 3300046492 | Bacteria | 1572 |
| 640 | Ga0495585_0101232 | 3300046492 | Bacteria | 1540 |
| 641 | Ga0495585_0120605 | 3300046492 | Bacteria | 1387 |
| 642 | Ga0495585_0134348 | 3300046492 | Bacteria | 1299 |
| 643 | Ga0495585_0144154 | 3300046492 | Bacteria | 1245 |
| 644 | Ga0495585_0146493 | 3300046492 | Bacteria | 1233 |
| 645 | Ga0495585_0181351 | 3300046492 | Bacteria | 1082 |
| 646 | Ga0495585_0208936 | 3300046492 | Bacteria | 990 |
| 647 | Ga0495585_0635359 | 3300046492 | Bacteria | 500 |
| 648 | Ga0495594_0006060 | 3300046499 | Bacteria | 6213 |
| 649 | Ga0495594_0022540 | 3300046499 | Bacteria | 3368 |
| 650 | Ga0495594_0056774 | 3300046499 | Bacteria | 2161 |
| 651 | Ga0495594_0063287 | 3300046499 | Bacteria | 2049 |
| 652 | Ga0495594_0088303 | 3300046499 | Bacteria | 1735 |
| 653 | Ga0495594_0100196 | 3300046499 | Bacteria | 1629 |
| 654 | Ga0495594_0103494 | 3300046499 | Bacteria | 1602 |
| 655 | Ga0495594_0228512 | 3300046499 | Bacteria | 1061 |
| 656 | Ga0495594_0471986 | 3300046499 | Bacteria | 713 |
| 657 | Ga0495596_0000236 | 3300046500 | Bacteria | 37630 |
| 658 | Ga0495596_0003733 | 3300046500 | Bacteria | 7608 |
| 659 | Ga0495596_0003880 | 3300046500 | Bacteria | 7419 |
| 660 | Ga0495596_0010298 | 3300046500 | Bacteria | 4076 |
| 661 | Ga0495596_0016755 | 3300046500 | Bacteria | 3041 |
| 662 | Ga0495596_0020946 | 3300046500 | Bacteria | 2672 |
| 663 | Ga0495596_0032093 | 3300046500 | Bacteria | 2095 |
| 664 | Ga0495596_0039830 | 3300046500 | Bacteria | 1855 |
| 665 | Ga0495596_0066495 | 3300046500 | Bacteria | 1401 |
| 666 | Ga0495596_0072165 | 3300046500 | Bacteria | 1340 |
| 667 | Ga0495596_0112662 | 3300046500 | Bacteria | 1056 |
| 668 | Ga0495596_0225634 | 3300046500 | Bacteria | 727 |
| 669 | Ga0495607_0002467 | 3300046501 | Bacteria | 15021 |
| 670 | Ga0495607_0003144 | 3300046501 | Bacteria | 12800 |
| 671 | Ga0495607_0003634 | 3300046501 | Bacteria | 11712 |
| 672 | Ga0495607_0008457 | 3300046501 | Bacteria | 7032 |
| 673 | Ga0495607_0014610 | 3300046501 | Bacteria | 5105 |
| 674 | Ga0495607_0014950 | 3300046501 | Bacteria | 5046 |
| 675 | Ga0495607_0027861 | 3300046501 | Bacteria | 3488 |
| 676 | Ga0495607_0038208 | 3300046501 | Bacteria | 2877 |
| 677 | Ga0495607_0040944 | 3300046501 | Bacteria | 2754 |
| 678 | Ga0495607_0051300 | 3300046501 | Bacteria | 2396 |
| 679 | Ga0495607_0147306 | 3300046501 | Bacteria | 1208 |
| 680 | Ga0495607_0226812 | 3300046501 | Bacteria | 910 |
| 681 | Ga0495607_0336100 | 3300046501 | Bacteria | 700 |
| 682 | Ga0495607_0419653 | 3300046501 | Bacteria | 605 |
| 683 | Ga0495583_0000035 | 3300046506 | Bacteria | 246849 |
| 684 | Ga0495583_0000525 | 3300046506 | Bacteria | 54370 |
| 685 | Ga0495583_0000533 | 3300046506 | Bacteria | 53778 |
| 686 | Ga0495583_0000608 | 3300046506 | Bacteria | 48449 |
| 687 | Ga0495583_0001445 | 3300046506 | Bacteria | 24126 |
| 688 | Ga0495583_0002759 | 3300046506 | Bacteria | 14503 |
| 689 | Ga0495583_0004051 | 3300046506 | Bacteria | 10773 |
| 690 | Ga0495583_0004816 | 3300046506 | Bacteria | 9459 |
| 691 | Ga0495583_0011794 | 3300046506 | Bacteria | 4998 |
| 692 | Ga0495583_0014446 | 3300046506 | Bacteria | 4356 |
| 693 | Ga0495583_0020340 | 3300046506 | Bacteria | 3441 |
| 694 | Ga0495583_0027832 | 3300046506 | Bacteria | 2785 |
| 695 | Ga0495583_0063913 | 3300046506 | Bacteria | 1634 |
| 696 | Ga0495583_0087871 | 3300046506 | Bacteria | 1342 |
| 697 | Ga0495583_0138545 | 3300046506 | Bacteria | 1014 |
| 698 | Ga0495606_0000011 | 3300046507 | Bacteria | 296816 |
| 699 | Ga0495606_0000064 | 3300046507 | Bacteria | 183631 |
| 700 | Ga0495606_0001147 | 3300046507 | Bacteria | 37572 |
| 701 | Ga0495606_0001181 | 3300046507 | Bacteria | 36855 |
| 702 | Ga0495606_0006161 | 3300046507 | Bacteria | 11164 |
| 703 | Ga0495606_0009081 | 3300046507 | Bacteria | 8472 |
| 704 | Ga0495606_0013368 | 3300046507 | Bacteria | 6489 |
| 705 | Ga0495606_0014662 | 3300046507 | Bacteria | 6097 |
| 706 | Ga0495606_0014803 | 3300046507 | Bacteria | 6059 |
| 707 | Ga0495606_0026334 | 3300046507 | Bacteria | 4146 |
| 708 | Ga0495606_0036164 | 3300046507 | Bacteria | 3367 |
| 709 | Ga0495606_0037676 | 3300046507 | Bacteria | 3281 |
| 710 | Ga0495606_0038517 | 3300046507 | Bacteria | 3233 |
| 711 | Ga0495606_0084712 | 3300046507 | Bacteria | 1962 |
| 712 | Ga0495606_0145115 | 3300046507 | Bacteria | 1398 |
| 713 | Ga0495606_0151684 | 3300046507 | Bacteria | 1359 |
| 714 | Ga0495606_0200207 | 3300046507 | Bacteria | 1138 |
| 715 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 716 | Ga0495610_0000873 | 3300046512 | Bacteria | 28152 |
| 717 | Ga0495610_0001162 | 3300046512 | Bacteria | 23954 |
| 718 | Ga0495610_0008688 | 3300046512 | Bacteria | 6540 |
| 719 | Ga0495616_0000272 | 3300046513 | Bacteria | 41986 |
| 720 | Ga0495616_0000343 | 3300046513 | Bacteria | 36983 |
| 721 | Ga0495616_0000680 | 3300046513 | Bacteria | 25142 |
| 722 | Ga0495616_0001661 | 3300046513 | Bacteria | 15228 |
| 723 | Ga0495616_0003238 | 3300046513 | Bacteria | 10474 |
| 724 | Ga0495616_0009292 | 3300046513 | Bacteria | 5762 |
| 725 | Ga0495616_0009654 | 3300046513 | Bacteria | 5625 |
| 726 | Ga0495616_0012631 | 3300046513 | Bacteria | 4787 |
| 727 | Ga0495616_0013294 | 3300046513 | Bacteria | 4649 |
| 728 | Ga0495616_0028258 | 3300046513 | Bacteria | 2969 |
| 729 | Ga0495616_0031645 | 3300046513 | Bacteria | 2768 |
| 730 | Ga0495616_0045896 | 3300046513 | Bacteria | 2209 |
| 731 | Ga0495616_0056668 | 3300046513 | Bacteria | 1934 |
| 732 | Ga0495616_0064979 | 3300046513 | Bacteria | 1779 |
| 733 | Ga0495616_0125523 | 3300046513 | Bacteria | 1180 |
| 734 | Ga0495616_0139171 | 3300046513 | Bacteria | 1106 |
| 735 | Ga0495620_0003145 | 3300046515 | Bacteria | 9470 |
| 736 | Ga0495630_0017831 | 3300046517 | Bacteria | 5207 |
| 737 | Ga0495631_0000983 | 3300046518 | Bacteria | 17719 |
| 738 | Ga0495631_0002105 | 3300046518 | Bacteria | 11552 |
| 739 | Ga0495631_0003385 | 3300046518 | Bacteria | 8732 |
| 740 | Ga0495631_0005046 | 3300046518 | Bacteria | 6953 |
| 741 | Ga0495631_0006876 | 3300046518 | Bacteria | 5836 |
| 742 | Ga0495631_0007988 | 3300046518 | Bacteria | 5350 |
| 743 | Ga0495631_0016269 | 3300046518 | Bacteria | 3551 |
| 744 | Ga0495631_0039469 | 3300046518 | Bacteria | 2094 |
| 745 | Ga0495631_0044435 | 3300046518 | Bacteria | 1957 |
| 746 | Ga0495631_0072699 | 3300046518 | Bacteria | 1485 |
| 747 | Ga0495631_0141351 | 3300046518 | Bacteria | 1033 |
| 748 | Ga0495632_0000062 | 3300046519 | Bacteria | 118205 |
| 749 | Ga0495632_0000235 | 3300046519 | Bacteria | 55317 |
| 750 | Ga0495632_0000901 | 3300046519 | Bacteria | 26017 |
| 751 | Ga0495632_0002631 | 3300046519 | Bacteria | 13521 |
| 752 | Ga0495632_0007247 | 3300046519 | Bacteria | 6999 |
| 753 | Ga0495632_0009591 | 3300046519 | Bacteria | 5820 |
| 754 | Ga0495632_0019389 | 3300046519 | Bacteria | 3707 |
| 755 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 756 | Ga0495637_0000482 | 3300046520 | Bacteria | 29077 |
| 757 | Ga0495637_0005727 | 3300046520 | Bacteria | 6296 |
| 758 | Ga0495637_0022968 | 3300046520 | Bacteria | 2839 |
| 759 | Ga0495637_0058812 | 3300046520 | Bacteria | 1583 |
| 760 | Ga0495637_0085828 | 3300046520 | Bacteria | 1248 |
| 761 | Ga0495637_0132682 | 3300046520 | Bacteria | 950 |
| 762 | Ga0495643_0000123 | 3300046522 | Bacteria | 124936 |
| 763 | Ga0495643_0000170 | 3300046522 | Bacteria | 103438 |
| 764 | Ga0495643_0000969 | 3300046522 | Bacteria | 29411 |
| 765 | Ga0495643_0001637 | 3300046522 | Bacteria | 19768 |
| 766 | Ga0495643_0004001 | 3300046522 | Bacteria | 10529 |
| 767 | Ga0495643_0007137 | 3300046522 | Bacteria | 7249 |
| 768 | Ga0495643_0011059 | 3300046522 | Bacteria | 5518 |
| 769 | Ga0495643_0014320 | 3300046522 | Bacteria | 4721 |
| 770 | Ga0495643_0173562 | 3300046522 | Bacteria | 1052 |
| 771 | Ga0495643_0195476 | 3300046522 | Bacteria | 974 |
| 772 | Ga0495644_0003684 | 3300046523 | Bacteria | 6029 |
| 773 | Ga0495644_0003719 | 3300046523 | Bacteria | 6004 |
| 774 | Ga0495644_0006986 | 3300046523 | Bacteria | 4369 |
| 775 | Ga0495644_0008087 | 3300046523 | Bacteria | 4045 |
| 776 | Ga0495644_0008241 | 3300046523 | Bacteria | 4011 |
| 777 | Ga0495644_0010379 | 3300046523 | Bacteria | 3590 |
| 778 | Ga0495644_0021058 | 3300046523 | Bacteria | 2487 |
| 779 | Ga0495644_0022081 | 3300046523 | Bacteria | 2426 |
| 780 | Ga0495644_0022349 | 3300046523 | Bacteria | 2410 |
| 781 | Ga0495644_0044530 | 3300046523 | Bacteria | 1669 |
| 782 | Ga0495644_0144985 | 3300046523 | Bacteria | 907 |
| 783 | Ga0495644_0164084 | 3300046523 | Bacteria | 852 |
| 784 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 785 | Ga0495648_0000109 | 3300046524 | Bacteria | 101519 |
| 786 | Ga0495648_0000541 | 3300046524 | Bacteria | 40809 |
| 787 | Ga0495648_0002349 | 3300046524 | Bacteria | 17563 |
| 788 | Ga0495648_0013051 | 3300046524 | Bacteria | 6163 |
| 789 | Ga0495648_0018771 | 3300046524 | Bacteria | 4881 |
| 790 | Ga0495648_0027536 | 3300046524 | Bacteria | 3802 |
| 791 | Ga0495648_0033572 | 3300046524 | Bacteria | 3349 |
| 792 | Ga0495648_0041132 | 3300046524 | Bacteria | 2922 |
| 793 | Ga0495648_0088906 | 3300046524 | Bacteria | 1735 |
| 794 | Ga0495648_0130402 | 3300046524 | Bacteria | 1337 |
| 795 | Ga0495648_0132888 | 3300046524 | Bacteria | 1321 |
| 796 | Ga0495648_0164941 | 3300046524 | Bacteria | 1141 |
| 797 | Ga0495648_0174124 | 3300046524 | Bacteria | 1100 |
| 798 | Ga0495648_0175834 | 3300046524 | Bacteria | 1093 |
| 799 | Ga0495663_0004570 | 3300046525 | Bacteria | 3881 |
| 800 | Ga0495663_0043379 | 3300046525 | Bacteria | 1373 |
| 801 | Ga0495663_0073136 | 3300046525 | Bacteria | 1094 |
| 802 | Ga0495663_0311424 | 3300046525 | Bacteria | 568 |
| 803 | Ga0495666_0000975 | 3300046526 | Bacteria | 13502 |
| 804 | Ga0495666_0001244 | 3300046526 | Bacteria | 12329 |
| 805 | Ga0495666_0022762 | 3300046526 | Bacteria | 3101 |
| 806 | Ga0495666_0024822 | 3300046526 | Bacteria | 2961 |
| 807 | Ga0495666_0088051 | 3300046526 | Bacteria | 1466 |
| 808 | Ga0495642_0000196 | 3300046528 | Bacteria | 35510 |
| 809 | Ga0495642_0002912 | 3300046528 | Bacteria | 6821 |
| 810 | Ga0495642_0003623 | 3300046528 | Bacteria | 6064 |
| 811 | Ga0495642_0006116 | 3300046528 | Bacteria | 4623 |
| 812 | Ga0495642_0008553 | 3300046528 | Bacteria | 3916 |
| 813 | Ga0495642_0008675 | 3300046528 | Bacteria | 3884 |
| 814 | Ga0495642_0008881 | 3300046528 | Bacteria | 3845 |
| 815 | Ga0495642_0018690 | 3300046528 | Bacteria | 2713 |
| 816 | Ga0495642_0020087 | 3300046528 | Bacteria | 2620 |
| 817 | Ga0495642_0021451 | 3300046528 | Bacteria | 2540 |
| 818 | Ga0495642_0027433 | 3300046528 | Bacteria | 2266 |
| 819 | Ga0495642_0032728 | 3300046528 | Bacteria | 2087 |
| 820 | Ga0495642_0077602 | 3300046528 | Bacteria | 1395 |
| 821 | Ga0495642_0088316 | 3300046528 | Bacteria | 1310 |
| 822 | Ga0495642_0101537 | 3300046528 | Bacteria | 1224 |
| 823 | Ga0495642_0116714 | 3300046528 | Bacteria | 1144 |
| 824 | Ga0495642_0205702 | 3300046528 | Bacteria | 858 |
| 825 | Ga0495642_0232419 | 3300046528 | Bacteria | 805 |
| 826 | Ga0495652_0020052 | 3300046529 | Bacteria | 5947 |
| 827 | Ga0495654_0000038 | 3300046530 | Bacteria | 185693 |
| 828 | Ga0495654_0002038 | 3300046530 | Bacteria | 13252 |
| 829 | Ga0495654_0011618 | 3300046530 | Bacteria | 4758 |
| 830 | Ga0495654_0019835 | 3300046530 | Bacteria | 3511 |
| 831 | Ga0495654_0049466 | 3300046530 | Bacteria | 2059 |
| 832 | Ga0495654_0052082 | 3300046530 | Bacteria | 1995 |
| 833 | Ga0495654_0062661 | 3300046530 | Bacteria | 1782 |
| 834 | Ga0495654_0084811 | 3300046530 | Bacteria | 1479 |
| 835 | Ga0495665_0004075 | 3300046531 | Bacteria | 7881 |
| 836 | Ga0495665_0018192 | 3300046531 | Bacteria | 3776 |
| 837 | Ga0495665_0022051 | 3300046531 | Bacteria | 3424 |
| 838 | Ga0495665_0030374 | 3300046531 | Bacteria | 2891 |
| 839 | Ga0495665_0136960 | 3300046531 | Bacteria | 1280 |
| 840 | Ga0495665_0237927 | 3300046531 | Bacteria | 939 |
| 841 | Ga0495665_0621341 | 3300046531 | Bacteria | 539 |
| 842 | Ga0495640_0096951 | 3300046533 | Bacteria | 1939 |
| 843 | Ga0495586_0010365 | 3300046535 | Bacteria | 4955 |
| 844 | Ga0495586_0014931 | 3300046535 | Bacteria | 4126 |
| 845 | Ga0495586_0197549 | 3300046535 | Bacteria | 1140 |
| 846 | Ga0495586_0427977 | 3300046535 | Bacteria | 762 |
| 847 | Ga0495587_0094550 | 3300046536 | Bacteria | 1725 |
| 848 | Ga0495587_0241029 | 3300046536 | Bacteria | 1017 |
| 849 | Ga0495587_0331613 | 3300046536 | Bacteria | 849 |
| 850 | Ga0495598_0012534 | 3300046537 | Bacteria | 2084 |
| 851 | Ga0495609_0000009 | 3300046538 | Bacteria | 354860 |
| 852 | Ga0495609_0000636 | 3300046538 | Bacteria | 27314 |
| 853 | Ga0495609_0003073 | 3300046538 | Bacteria | 9786 |
| 854 | Ga0495609_0003510 | 3300046538 | Bacteria | 8955 |
| 855 | Ga0495609_0003925 | 3300046538 | Bacteria | 8335 |
| 856 | Ga0495609_0006181 | 3300046538 | Bacteria | 6158 |
| 857 | Ga0495609_0010588 | 3300046538 | Bacteria | 4419 |
| 858 | Ga0495609_0012139 | 3300046538 | Bacteria | 4088 |
| 859 | Ga0495609_0018688 | 3300046538 | Bacteria | 3211 |
| 860 | Ga0495609_0021303 | 3300046538 | Bacteria | 2990 |
| 861 | Ga0495609_0023305 | 3300046538 | Bacteria | 2846 |
| 862 | Ga0495609_0104995 | 3300046538 | Bacteria | 1222 |
| 863 | Ga0495609_0107807 | 3300046538 | Bacteria | 1203 |
| 864 | Ga0495609_0110710 | 3300046538 | Bacteria | 1185 |
| 865 | Ga0495609_0194205 | 3300046538 | Bacteria | 850 |
| 866 | Ga0495609_0216406 | 3300046538 | Bacteria | 796 |
| 867 | Ga0495621_0207430 | 3300046539 | Bacteria | 790 |
| 868 | Ga0495597_0001393 | 3300046542 | Bacteria | 17466 |
| 869 | Ga0495597_0001520 | 3300046542 | Bacteria | 16508 |
| 870 | Ga0495597_0001796 | 3300046542 | Bacteria | 14723 |
| 871 | Ga0495597_0002277 | 3300046542 | Bacteria | 12472 |
| 872 | Ga0495597_0004290 | 3300046542 | Bacteria | 7877 |
| 873 | Ga0495597_0005992 | 3300046542 | Bacteria | 6340 |
| 874 | Ga0495597_0007074 | 3300046542 | Bacteria | 5743 |
| 875 | Ga0495597_0011554 | 3300046542 | Bacteria | 4278 |
| 876 | Ga0495597_0013569 | 3300046542 | Bacteria | 3898 |
| 877 | Ga0495597_0028551 | 3300046542 | Bacteria | 2553 |
| 878 | Ga0495597_0035996 | 3300046542 | Bacteria | 2230 |
| 879 | Ga0495597_0062840 | 3300046542 | Bacteria | 1614 |
| 880 | Ga0495597_0067467 | 3300046542 | Bacteria | 1547 |
| 881 | Ga0495597_0091483 | 3300046542 | Bacteria | 1291 |
| 882 | Ga0495597_0197927 | 3300046542 | Bacteria | 806 |
| 883 | Ga0495645_0125435 | 3300046543 | Bacteria | 1804 |
| 884 | Ga0495645_0176359 | 3300046543 | Bacteria | 1468 |
| 885 | Ga0495622_0000028 | 3300046557 | Bacteria | 133197 |
| 886 | Ga0495622_0000398 | 3300046557 | Bacteria | 29440 |
| 887 | Ga0495622_0028161 | 3300046557 | Bacteria | 2623 |
| 888 | Ga0495622_0091127 | 3300046557 | Bacteria | 1400 |
| 889 | Ga0495622_0108925 | 3300046557 | Bacteria | 1268 |
| 890 | Ga0495622_0226951 | 3300046557 | Bacteria | 826 |
| 891 | Ga0495622_0292540 | 3300046557 | Bacteria | 710 |
| 892 | Ga0495622_0411964 | 3300046557 | Bacteria | 581 |
| 893 | Ga0495633_0002074 | 3300046558 | Bacteria | 14420 |
| 894 | Ga0495633_0002390 | 3300046558 | Bacteria | 13287 |
| 895 | Ga0495633_0004129 | 3300046558 | Bacteria | 9350 |
| 896 | Ga0495633_0007239 | 3300046558 | Bacteria | 6420 |
| 897 | Ga0495633_0008374 | 3300046558 | Bacteria | 5834 |
| 898 | Ga0495633_0015513 | 3300046558 | Bacteria | 3950 |
| 899 | Ga0495633_0016604 | 3300046558 | Bacteria | 3789 |
| 900 | Ga0495633_0016656 | 3300046558 | Bacteria | 3782 |
| 901 | Ga0495633_0018775 | 3300046558 | Bacteria | 3506 |
| 902 | Ga0495633_0028145 | 3300046558 | Bacteria | 2741 |
| 903 | Ga0495633_0034928 | 3300046558 | Bacteria | 2416 |
| 904 | Ga0495633_0036808 | 3300046558 | Bacteria | 2343 |
| 905 | Ga0495633_0069418 | 3300046558 | Bacteria | 1645 |
| 906 | Ga0495633_0077381 | 3300046558 | Bacteria | 1549 |
| 907 | Ga0495633_0107297 | 3300046558 | Bacteria | 1295 |
| 908 | Ga0495633_0132449 | 3300046558 | Bacteria | 1154 |
| 909 | Ga0495633_0182335 | 3300046558 | Bacteria | 966 |
| 910 | Ga0495633_0334694 | 3300046558 | Bacteria | 686 |
| 911 | Ga0495633_0540313 | 3300046558 | Bacteria | 525 |
| 912 | Ga0495667_0301968 | 3300046559 | Bacteria | 1014 |
| 913 | Ga0495656_0003737 | 3300046615 | Bacteria | 5168 |
| 914 | Ga0495656_0015862 | 3300046615 | Bacteria | 2851 |
| 915 | Ga0495656_0043073 | 3300046615 | Bacteria | 1893 |
| 916 | Ga0495656_0048042 | 3300046615 | Bacteria | 1812 |
| 917 | Ga0495656_0120080 | 3300046615 | Bacteria | 1239 |
| 918 | Ga0495668_0000048 | 3300046616 | Bacteria | 217867 |
| 919 | Ga0495668_0001362 | 3300046616 | Bacteria | 23977 |
| 920 | Ga0495668_0002401 | 3300046616 | Bacteria | 15518 |
| 921 | Ga0495668_0002455 | 3300046616 | Bacteria | 15251 |
| 922 | Ga0495668_0004786 | 3300046616 | Bacteria | 9440 |
| 923 | Ga0495668_0005220 | 3300046616 | Bacteria | 8908 |
| 924 | Ga0495668_0007462 | 3300046616 | Bacteria | 6987 |
| 925 | Ga0495668_0010370 | 3300046616 | Bacteria | 5639 |
| 926 | Ga0495668_0013225 | 3300046616 | Bacteria | 4878 |
| 927 | Ga0495668_0013802 | 3300046616 | Bacteria | 4752 |
| 928 | Ga0495668_0022879 | 3300046616 | Bacteria | 3569 |
| 929 | Ga0495668_0025705 | 3300046616 | Bacteria | 3344 |
| 930 | Ga0495668_0026212 | 3300046616 | Bacteria | 3308 |
| 931 | Ga0495668_0027856 | 3300046616 | Bacteria | 3200 |
| 932 | Ga0495668_0031057 | 3300046616 | Bacteria | 3010 |
| 933 | Ga0495668_0045217 | 3300046616 | Bacteria | 2447 |
| 934 | Ga0495668_0069580 | 3300046616 | Bacteria | 1935 |
| 935 | Ga0495668_0151893 | 3300046616 | Bacteria | 1268 |
| 936 | Ga0495668_0184006 | 3300046616 | Bacteria | 1144 |
| 937 | Ga0495668_0531138 | 3300046616 | Bacteria | 649 |
| 938 | Ga0495634_0003145 | 3300046642 | Bacteria | 13386 |
| 939 | Ga0495634_0052778 | 3300046642 | Bacteria | 2725 |
| 940 | Ga0495611_0003052 | 3300046648 | Bacteria | 7456 |
| 941 | Ga0495611_0004232 | 3300046648 | Bacteria | 6247 |
| 942 | Ga0495611_0005048 | 3300046648 | Bacteria | 5657 |
| 943 | Ga0495611_0007604 | 3300046648 | Bacteria | 4597 |
| 944 | Ga0495611_0034181 | 3300046648 | Bacteria | 2246 |
| 945 | Ga0495611_0048649 | 3300046648 | Bacteria | 1906 |
| 946 | Ga0495611_0052940 | 3300046648 | Bacteria | 1831 |
| 947 | Ga0495611_0062572 | 3300046648 | Bacteria | 1693 |
| 948 | Ga0495611_0098119 | 3300046648 | Bacteria | 1358 |
| 949 | Ga0495611_0124226 | 3300046648 | Bacteria | 1203 |
| 950 | Ga0495611_0185804 | 3300046648 | Bacteria | 970 |
| 951 | Ga0495611_0269588 | 3300046648 | Bacteria | 787 |
| 952 | Ga0495611_0328188 | 3300046648 | Bacteria | 703 |
| 953 | Ga0495611_0357724 | 3300046648 | Bacteria | 669 |
| 954 | Ga0495611_0448255 | 3300046648 | Bacteria | 588 |
| 955 | Ga0495625_0000164 | 3300046660 | Bacteria | 103037 |
| 956 | Ga0495625_0005794 | 3300046660 | Bacteria | 11161 |
| 957 | Ga0495625_0009364 | 3300046660 | Bacteria | 8201 |
| 958 | Ga0495625_0009819 | 3300046660 | Bacteria | 7965 |
| 959 | Ga0495625_0015487 | 3300046660 | Bacteria | 6038 |
| 960 | Ga0495625_0018254 | 3300046660 | Bacteria | 5482 |
| 961 | Ga0495625_0021196 | 3300046660 | Bacteria | 5006 |
| 962 | Ga0495625_0029832 | 3300046660 | Bacteria | 4074 |
| 963 | Ga0495625_0038200 | 3300046660 | Bacteria | 3516 |
| 964 | Ga0495625_0046986 | 3300046660 | Bacteria | 3113 |
| 965 | Ga0495625_0069612 | 3300046660 | Bacteria | 2472 |
| 966 | Ga0495625_0100232 | 3300046660 | Bacteria | 1991 |
| 967 | Ga0495625_0245382 | 3300046660 | Bacteria | 1164 |
| 968 | Ga0495625_0453458 | 3300046660 | Bacteria | 792 |
| 969 | Ga0495625_0566492 | 3300046660 | Bacteria | 686 |
| 970 | Ga0495635_0006579 | 3300046663 | Bacteria | 8109 |
| 971 | Ga0495635_0619974 | 3300046663 | Bacteria | 705 |
| 972 | Ga0495659_0000289 | 3300046664 | Bacteria | 20134 |
| 973 | Ga0495659_0001247 | 3300046664 | Bacteria | 8795 |
| 974 | Ga0495659_0009392 | 3300046664 | Bacteria | 3120 |
| 975 | Ga0495659_0069126 | 3300046664 | Bacteria | 1320 |
| 976 | Ga0495659_0123825 | 3300046664 | Bacteria | 1020 |
| 977 | Ga0495661_0000368 | 3300046665 | Bacteria | 48926 |
| 978 | Ga0495661_0001167 | 3300046665 | Bacteria | 22911 |
| 979 | Ga0495661_0002363 | 3300046665 | Bacteria | 14562 |
| 980 | Ga0495661_0006427 | 3300046665 | Bacteria | 8262 |
| 981 | Ga0495661_0012089 | 3300046665 | Bacteria | 5837 |
| 982 | Ga0495661_0015517 | 3300046665 | Bacteria | 5083 |
| 983 | Ga0495661_0019494 | 3300046665 | Bacteria | 4444 |
| 984 | Ga0495661_0023664 | 3300046665 | Bacteria | 3983 |
| 985 | Ga0495661_0029376 | 3300046665 | Bacteria | 3509 |
| 986 | Ga0495661_0037274 | 3300046665 | Bacteria | 3036 |
| 987 | Ga0495661_0040171 | 3300046665 | Bacteria | 2903 |
| 988 | Ga0495661_0052747 | 3300046665 | Bacteria | 2448 |
| 989 | Ga0495661_0067409 | 3300046665 | Bacteria | 2102 |
| 990 | Ga0495661_0072941 | 3300046665 | Bacteria | 2001 |
| 991 | Ga0495661_0083536 | 3300046665 | Bacteria | 1835 |
| 992 | Ga0495661_0103370 | 3300046665 | Bacteria | 1599 |
| 993 | Ga0495661_0104872 | 3300046665 | Bacteria | 1584 |
| 994 | Ga0495661_0124413 | 3300046665 | Bacteria | 1420 |
| 995 | Ga0495661_0141254 | 3300046665 | Bacteria | 1309 |
| 996 | Ga0495661_0147861 | 3300046665 | Bacteria | 1271 |
| 997 | Ga0495661_0235293 | 3300046665 | Bacteria | 942 |
| 998 | Ga0495661_0256340 | 3300046665 | Bacteria | 890 |
| 999 | Ga0495661_0267876 | 3300046665 | Bacteria | 865 |
| 1000 | Ga0495588_0000077 | 3300046674 | Bacteria | 215338 |
| 1001 | Ga0495588_0035172 | 3300046674 | Bacteria | 2537 |
| 1002 | Ga0495588_0045378 | 3300046674 | Bacteria | 2252 |
| 1003 | Ga0495588_0064739 | 3300046674 | Bacteria | 1896 |
| 1004 | Ga0495588_0065381 | 3300046674 | Bacteria | 1886 |
| 1005 | Ga0495588_0071146 | 3300046674 | Bacteria | 1808 |
| 1006 | Ga0495588_0080651 | 3300046674 | Bacteria | 1698 |
| 1007 | Ga0495588_0109500 | 3300046674 | Bacteria | 1454 |
| 1008 | Ga0495588_0121903 | 3300046674 | Bacteria | 1374 |
| 1009 | Ga0495588_0123522 | 3300046674 | Unclassified | 1365 |
| 1010 | Ga0495588_0164135 | 3300046674 | Bacteria | 1174 |
| 1011 | Ga0495588_0173649 | 3300046674 | Bacteria | 1139 |
| 1012 | Ga0495588_0708148 | 3300046674 | Bacteria | 526 |
| 1013 | Ga0495599_0266621 | 3300046678 | Bacteria | 1040 |
| 1014 | Ga0495623_0007712 | 3300046679 | Bacteria | 6995 |
| 1015 | Ga0495623_0027846 | 3300046679 | Bacteria | 3638 |
| 1016 | Ga0495623_0091002 | 3300046679 | Bacteria | 1872 |
| 1017 | Ga0495623_0220094 | 3300046679 | Bacteria | 1082 |
| 1018 | Ga0495646_0190750 | 3300046680 | Bacteria | 1120 |
| 1019 | Ga0495669_0000217 | 3300046684 | Bacteria | 34603 |
| 1020 | Ga0495669_0001851 | 3300046684 | Bacteria | 8677 |
| 1021 | Ga0495669_0010502 | 3300046684 | Bacteria | 3914 |
| 1022 | Ga0495669_0017194 | 3300046684 | Bacteria | 3101 |
| 1023 | Ga0495669_0033212 | 3300046684 | Bacteria | 2270 |
| 1024 | Ga0495669_0036868 | 3300046684 | Bacteria | 2162 |
| 1025 | Ga0495669_0053078 | 3300046684 | Bacteria | 1822 |
| 1026 | Ga0495669_0538708 | 3300046684 | Unclassified | 568 |
| 1027 | Ga0495613_0069142 | 3300046689 | Bacteria | 2575 |
| 1028 | Ga0495613_0793672 | 3300046689 | Bacteria | 618 |
| 1029 | Ga0495624_0007752 | 3300046690 | Bacteria | 7532 |
| 1030 | Ga0495624_0340855 | 3300046690 | Bacteria | 902 |
| 1031 | Ga0495670_0009961 | 3300046691 | Bacteria | 4671 |
| 1032 | Ga0495670_0021082 | 3300046691 | Bacteria | 3213 |
| 1033 | Ga0495670_0021157 | 3300046691 | Bacteria | 3208 |
| 1034 | Ga0495670_0022494 | 3300046691 | Bacteria | 3112 |
| 1035 | Ga0495670_0031986 | 3300046691 | Bacteria | 2615 |
| 1036 | Ga0495670_0034737 | 3300046691 | Bacteria | 2512 |
| 1037 | Ga0495670_0039198 | 3300046691 | Bacteria | 2362 |
| 1038 | Ga0495670_0195811 | 3300046691 | Bacteria | 1069 |
| 1039 | Ga0495670_0199854 | 3300046691 | Bacteria | 1058 |
| 1040 | Ga0495670_0274896 | 3300046691 | Bacteria | 900 |
| 1041 | Ga0495670_0391270 | 3300046691 | Bacteria | 750 |
| 1042 | Ga0495670_0408214 | 3300046691 | Bacteria | 734 |
| 1043 | Ga0495670_0421933 | 3300046691 | Bacteria | 721 |
| 1044 | Ga0495670_0464390 | 3300046691 | Bacteria | 686 |
| 1045 | Ga0495670_0523431 | 3300046691 | Bacteria | 645 |
| 1046 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 1047 | Ga0495671_0000744 | 3300046692 | Bacteria | 23455 |
| 1048 | Ga0495671_0000848 | 3300046692 | Bacteria | 21841 |
| 1049 | Ga0495671_0022004 | 3300046692 | Bacteria | 3344 |
| 1050 | Ga0495671_0023568 | 3300046692 | Bacteria | 3214 |
| 1051 | Ga0495671_0027348 | 3300046692 | Bacteria | 2947 |
| 1052 | Ga0495671_0028223 | 3300046692 | Bacteria | 2893 |
| 1053 | Ga0495671_0079765 | 3300046692 | Bacteria | 1604 |
| 1054 | Ga0495671_0112690 | 3300046692 | Bacteria | 1328 |
| 1055 | Ga0495671_0180502 | 3300046692 | Bacteria | 1025 |
| 1056 | Ga0495671_0397099 | 3300046692 | Bacteria | 660 |
| 1057 | Ga0495649_0002149 | 3300046694 | Bacteria | 14104 |
| 1058 | Ga0495649_0007989 | 3300046694 | Bacteria | 6396 |
| 1059 | Ga0495649_0019739 | 3300046694 | Bacteria | 3784 |
| 1060 | Ga0495649_0031292 | 3300046694 | Bacteria | 2935 |
| 1061 | Ga0495649_0051556 | 3300046694 | Bacteria | 2231 |
| 1062 | Ga0495649_0133357 | 3300046694 | Bacteria | 1310 |
| 1063 | Ga0495649_0159202 | 3300046694 | Bacteria | 1184 |
| 1064 | Ga0495649_0206303 | 3300046694 | Bacteria | 1019 |
| 1065 | Ga0495649_0218901 | 3300046694 | Bacteria | 985 |
| 1066 | Ga0495589_0000037 | 3300046794 | Bacteria | 150603 |
| 1067 | Ga0495589_0001177 | 3300046794 | Bacteria | 15597 |
| 1068 | Ga0495589_0001260 | 3300046794 | Bacteria | 14998 |
| 1069 | Ga0495589_0010118 | 3300046794 | Bacteria | 4900 |
| 1070 | Ga0495589_0014498 | 3300046794 | Bacteria | 4056 |
| 1071 | Ga0495589_0017796 | 3300046794 | Bacteria | 3645 |
| 1072 | Ga0495589_0026334 | 3300046794 | Bacteria | 2947 |
| 1073 | Ga0495589_0038794 | 3300046794 | Bacteria | 2382 |
| 1074 | Ga0495589_0042313 | 3300046794 | Bacteria | 2270 |
| 1075 | Ga0495589_0085592 | 3300046794 | Bacteria | 1531 |
| 1076 | Ga0495589_0163846 | 3300046794 | Bacteria | 1058 |
| 1077 | Ga0495589_0180011 | 3300046794 | Bacteria | 1003 |
| 1078 | Ga0495589_0241467 | 3300046794 | Bacteria | 845 |
| 1079 | Ga0495600_0002155 | 3300046809 | Bacteria | 11161 |
| 1080 | Ga0495600_0104154 | 3300046809 | Bacteria | 1849 |
| 1081 | Ga0495660_0000178 | 3300046810 | Bacteria | 68956 |
| 1082 | Ga0495660_0001476 | 3300046810 | Bacteria | 15998 |
| 1083 | Ga0495660_0003120 | 3300046810 | Bacteria | 10328 |
| 1084 | Ga0495660_0003323 | 3300046810 | Bacteria | 9978 |
| 1085 | Ga0495660_0017672 | 3300046810 | Bacteria | 4103 |
| 1086 | Ga0495660_0022155 | 3300046810 | Bacteria | 3630 |
| 1087 | Ga0495660_0043740 | 3300046810 | Bacteria | 2467 |
| 1088 | Ga0495660_0044082 | 3300046810 | Bacteria | 2456 |
| 1089 | Ga0495660_0059138 | 3300046810 | Bacteria | 2062 |
| 1090 | Ga0495660_0095189 | 3300046810 | Bacteria | 1541 |
| 1091 | Ga0495660_0118619 | 3300046810 | Bacteria | 1341 |
| 1092 | Ga0495660_0124887 | 3300046810 | Bacteria | 1297 |
| 1093 | Ga0495660_0128231 | 3300046810 | Bacteria | 1275 |
| 1094 | Ga0495581_0008712 | 3300047315 | Bacteria | 5876 |
| 1095 | Ga0495581_0066676 | 3300047315 | Bacteria | 2081 |
| 1096 | Ga0495581_0078795 | 3300047315 | Bacteria | 1906 |
| 1097 | Ga0495581_0287595 | 3300047315 | Bacteria | 961 |
| 1098 | Ga0495604_0036530 | 3300047317 | Bacteria | 3873 |
| 1099 | Ga0495604_0085661 | 3300047317 | Bacteria | 2351 |
| 1100 | Ga0495604_0148305 | 3300047317 | Bacteria | 1669 |
| 1101 | Ga0495604_0192669 | 3300047317 | Bacteria | 1419 |
| 1102 | Ga0495604_0223117 | 3300047317 | Bacteria | 1296 |
| 1103 | Ga0495604_0262021 | 3300047317 | Bacteria | 1174 |
| 1104 | Ga0495636_0006148 | 3300047318 | Bacteria | 4715 |
| 1105 | Ga0495636_0012768 | 3300047318 | Bacteria | 3327 |
| 1106 | Ga0495636_0017608 | 3300047318 | Bacteria | 2860 |
| 1107 | Ga0495636_0069736 | 3300047318 | Bacteria | 1498 |
| 1108 | Ga0495636_0087023 | 3300047318 | Bacteria | 1352 |
| 1109 | Ga0495636_0094728 | 3300047318 | Bacteria | 1299 |
| 1110 | Ga0495636_0104862 | 3300047318 | Bacteria | 1239 |
| 1111 | Ga0495636_0180386 | 3300047318 | Bacteria | 958 |
| 1112 | Ga0495636_0367497 | 3300047318 | Bacteria | 681 |
| 1113 | Ga0495636_0445788 | 3300047318 | Bacteria | 621 |
| 1114 | Ga0495674_0003394 | 3300047319 | Bacteria | 15471 |
| 1115 | Ga0495674_0784125 | 3300047319 | Bacteria | 742 |
| 1116 | Ga0495672_0000097 | 3300047320 | Bacteria | 141608 |
| 1117 | Ga0495672_0000424 | 3300047320 | Bacteria | 50607 |
| 1118 | Ga0495672_0000590 | 3300047320 | Bacteria | 41027 |
| 1119 | Ga0495672_0000758 | 3300047320 | Bacteria | 35256 |
| 1120 | Ga0495672_0001440 | 3300047320 | Bacteria | 23361 |
| 1121 | Ga0495672_0001672 | 3300047320 | Bacteria | 21505 |
| 1122 | Ga0495672_0002152 | 3300047320 | Bacteria | 18417 |
| 1123 | Ga0495672_0011872 | 3300047320 | Bacteria | 6114 |
| 1124 | Ga0495672_0098796 | 3300047320 | Bacteria | 1587 |
| 1125 | Ga0495672_0108065 | 3300047320 | Bacteria | 1497 |
| 1126 | Ga0495676_0000342 | 3300047321 | Bacteria | 38031 |
| 1127 | Ga0495676_0014902 | 3300047321 | Bacteria | 6942 |
| 1128 | Ga0495676_0077540 | 3300047321 | Bacteria | 2534 |
| 1129 | Ga0495676_0108382 | 3300047321 | Bacteria | 2043 |
| 1130 | Ga0495676_0123990 | 3300047321 | Bacteria | 1875 |
| 1131 | Ga0495676_0169465 | 3300047321 | Bacteria | 1538 |
| 1132 | Ga0495676_0202693 | 3300047321 | Bacteria | 1378 |
| 1133 | Ga0495680_0005344 | 3300047322 | Bacteria | 12118 |
| 1134 | Ga0495680_0086272 | 3300047322 | Bacteria | 2362 |
| 1135 | Ga0495680_0909474 | 3300047322 | Bacteria | 568 |
| 1136 | Ga0495683_0000144 | 3300047323 | Bacteria | 69959 |
| 1137 | Ga0495683_0000952 | 3300047323 | Bacteria | 20358 |
| 1138 | Ga0495683_0001039 | 3300047323 | Bacteria | 19287 |
| 1139 | Ga0495683_0016641 | 3300047323 | Bacteria | 3816 |
| 1140 | Ga0495683_0017608 | 3300047323 | Bacteria | 3701 |
| 1141 | Ga0495683_0029959 | 3300047323 | Bacteria | 2779 |
| 1142 | Ga0495683_0035711 | 3300047323 | Bacteria | 2526 |
| 1143 | Ga0495683_0087662 | 3300047323 | Bacteria | 1511 |
| 1144 | Ga0495683_0095436 | 3300047323 | Bacteria | 1436 |
| 1145 | Ga0495683_0169338 | 3300047323 | Bacteria | 1005 |
| 1146 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 1147 | Ga0495687_000017 | 3300047443 | Bacteria | 350429 |
| 1148 | Ga0495687_000024 | 3300047443 | Bacteria | 316676 |
| 1149 | Ga0495687_000148 | 3300047443 | Bacteria | 106947 |
| 1150 | Ga0495687_001539 | 3300047443 | Bacteria | 20979 |
| 1151 | Ga0495687_005580 | 3300047443 | Bacteria | 7970 |
| 1152 | Ga0495687_005608 | 3300047443 | Bacteria | 7936 |
| 1153 | Ga0495687_010840 | 3300047443 | Bacteria | 4952 |
| 1154 | Ga0495687_015538 | 3300047443 | Bacteria | 3867 |
| 1155 | Ga0495687_029001 | 3300047443 | Bacteria | 2566 |
| 1156 | Ga0495687_076171 | 3300047443 | Bacteria | 1328 |
| 1157 | Ga0495675_0002413 | 3300047444 | Bacteria | 11164 |
| 1158 | Ga0495675_0004400 | 3300047444 | Bacteria | 8527 |
| 1159 | Ga0495675_0147236 | 3300047444 | Bacteria | 1456 |
| 1160 | Ga0495677_0000011 | 3300047445 | Bacteria | 149837 |
| 1161 | Ga0495677_0000979 | 3300047445 | Bacteria | 11487 |
| 1162 | Ga0495677_0001358 | 3300047445 | Bacteria | 9771 |
| 1163 | Ga0495677_0003050 | 3300047445 | Bacteria | 6513 |
| 1164 | Ga0495677_0004099 | 3300047445 | Bacteria | 5626 |
| 1165 | Ga0495677_0006130 | 3300047445 | Bacteria | 4549 |
| 1166 | Ga0495677_0007985 | 3300047445 | Bacteria | 3932 |
| 1167 | Ga0495677_0011203 | 3300047445 | Bacteria | 3282 |
| 1168 | Ga0495677_0016146 | 3300047445 | Bacteria | 2709 |
| 1169 | Ga0495677_0074320 | 3300047445 | Bacteria | 1268 |
| 1170 | Ga0495677_0139302 | 3300047445 | Bacteria | 931 |
| 1171 | Ga0495677_0141551 | 3300047445 | Bacteria | 924 |
| 1172 | Ga0495677_0149027 | 3300047445 | Bacteria | 900 |
| 1173 | Ga0495677_0165097 | 3300047445 | Bacteria | 855 |
| 1174 | Ga0495679_003113 | 3300047446 | Bacteria | 8123 |
| 1175 | Ga0495679_003957 | 3300047446 | Bacteria | 6981 |
| 1176 | Ga0495679_009988 | 3300047446 | Bacteria | 3760 |
| 1177 | Ga0495679_016017 | 3300047446 | Bacteria | 2723 |
| 1178 | Ga0495679_017414 | 3300047446 | Bacteria | 2572 |
| 1179 | Ga0495679_050542 | 3300047446 | Bacteria | 1249 |
| 1180 | Ga0495685_000077 | 3300047447 | Bacteria | 37238 |
| 1181 | Ga0495685_006760 | 3300047447 | Bacteria | 3769 |
| 1182 | Ga0495685_010360 | 3300047447 | Bacteria | 3124 |
| 1183 | Ga0495685_024841 | 3300047447 | Bacteria | 2062 |
| 1184 | Ga0495685_034772 | 3300047447 | Bacteria | 1731 |
| 1185 | Ga0495685_095119 | 3300047447 | Bacteria | 985 |
| 1186 | Ga0495685_175374 | 3300047447 | Bacteria | 692 |
| 1187 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 1188 | Ga0495673_0000097 | 3300047469 | Bacteria | 182247 |
| 1189 | Ga0495673_0000100 | 3300047469 | Bacteria | 173962 |
| 1190 | Ga0495673_0002730 | 3300047469 | Bacteria | 12103 |
| 1191 | Ga0495673_0010183 | 3300047469 | Bacteria | 5136 |
| 1192 | Ga0495681_0002294 | 3300047470 | Bacteria | 13753 |
| 1193 | Ga0495681_0002968 | 3300047470 | Bacteria | 11956 |
| 1194 | Ga0495681_0007086 | 3300047470 | Bacteria | 7235 |
| 1195 | Ga0495681_0009449 | 3300047470 | Bacteria | 6007 |
| 1196 | Ga0495681_0011139 | 3300047470 | Bacteria | 5385 |
| 1197 | Ga0495681_0011368 | 3300047470 | Bacteria | 5304 |
| 1198 | Ga0495681_0011590 | 3300047470 | Bacteria | 5236 |
| 1199 | Ga0495681_0014249 | 3300047470 | Bacteria | 4569 |
| 1200 | Ga0495681_0020183 | 3300047470 | Bacteria | 3620 |
| 1201 | Ga0495681_0020331 | 3300047470 | Bacteria | 3605 |
| 1202 | Ga0495681_0048194 | 3300047470 | Bacteria | 2021 |
| 1203 | Ga0495681_0155420 | 3300047470 | Bacteria | 956 |
| 1204 | Ga0495686_0000428 | 3300047472 | Bacteria | 65588 |
| 1205 | Ga0495686_0001462 | 3300047472 | Bacteria | 25726 |
| 1206 | Ga0495686_0001479 | 3300047472 | Bacteria | 25538 |
| 1207 | Ga0495686_0003365 | 3300047472 | Bacteria | 13932 |
| 1208 | Ga0495686_0008053 | 3300047472 | Bacteria | 7807 |
| 1209 | Ga0495686_0049892 | 3300047472 | Bacteria | 2631 |
| 1210 | Ga0495686_0121758 | 3300047472 | Bacteria | 1554 |
| 1211 | Ga0495686_0184539 | 3300047472 | Bacteria | 1206 |
| 1212 | Ga0495686_0189731 | 3300047472 | Bacteria | 1185 |
| 1213 | Ga0495686_0228281 | 3300047472 | Bacteria | 1055 |
| 1214 | Ga0495686_0293147 | 3300047472 | Bacteria | 900 |
| 1215 | Ga0495686_0377640 | 3300047472 | Bacteria | 765 |
| 1216 | Ga0495593_0002473 | 3300047673 | Bacteria | 11113 |
| 1217 | Ga0495593_0021073 | 3300047673 | Bacteria | 3644 |
| 1218 | Ga0495593_0128819 | 3300047673 | Bacteria | 1285 |
| 1219 | Ga0495602_0086299 | 3300048088 | Bacteria | 2620 |
| 1220 | Ga0495602_0128484 | 3300048088 | Bacteria | 2025 |
| 1221 | Ga0495602_0459422 | 3300048088 | Bacteria | 897 |
| 1222 | Ga0495614_0002563 | 3300048089 | Bacteria | 8081 |
| 1223 | Ga0495614_0162459 | 3300048089 | Bacteria | 1000 |
| 1224 | Ga0495614_0181823 | 3300048089 | Bacteria | 946 |
| 1225 | Ga0495614_0205280 | 3300048089 | Bacteria | 893 |
| 1226 | Ga0495614_0251407 | 3300048089 | Bacteria | 808 |
| 1227 | Ga0495615_0000530 | 3300048090 | Bacteria | 5448 |
| 1228 | Ga0495615_0080961 | 3300048090 | Bacteria | 890 |
| 1229 | Ga0495626_0000004 | 3300048091 | Bacteria | 356599 |
| 1230 | Ga0495626_0000016 | 3300048091 | Bacteria | 232214 |
| 1231 | Ga0495626_0000569 | 3300048091 | Bacteria | 36626 |
| 1232 | Ga0495626_0005849 | 3300048091 | Bacteria | 7094 |
| 1233 | Ga0495626_0008239 | 3300048091 | Bacteria | 5734 |
| 1234 | Ga0495626_0009582 | 3300048091 | Bacteria | 5226 |
| 1235 | Ga0495626_0027385 | 3300048091 | Bacteria | 2772 |
| 1236 | Ga0495626_0033635 | 3300048091 | Bacteria | 2455 |
| 1237 | Ga0495626_0040645 | 3300048091 | Bacteria | 2195 |
| 1238 | Ga0495626_0054570 | 3300048091 | Bacteria | 1834 |
| 1239 | Ga0495626_0069092 | 3300048091 | Bacteria | 1591 |
| 1240 | Ga0495626_0091745 | 3300048091 | Bacteria | 1335 |
| 1241 | Ga0495626_0092145 | 3300048091 | Bacteria | 1331 |
| 1242 | Ga0495626_0118149 | 3300048091 | Bacteria | 1142 |
| 1243 | Ga0495626_0176147 | 3300048091 | Bacteria | 889 |
| 1244 | Ga0496100_0004475 | 3300048903 | Bacteria | 7416 |
| 1245 | Ga0496100_0266561 | 3300048903 | Bacteria | 1272 |
| 1246 | Ga0496100_0332721 | 3300048903 | Bacteria | 1143 |
| 1247 | Ga0496100_0380203 | 3300048903 | Bacteria | 1072 |
| 1248 | Ga0496101_0106911 | 3300048904 | Bacteria | 2101 |
| 1249 | Ga0496101_0108970 | 3300048904 | Bacteria | 2083 |
| 1250 | Ga0496101_0702507 | 3300048904 | Bacteria | 798 |
| 1251 | Ga0496101_0820075 | 3300048904 | Bacteria | 733 |
| 1252 | Ga0496102_0000461 | 3300048905 | Bacteria | 45293 |
| 1253 | Ga0496102_0016630 | 3300048905 | Bacteria | 6431 |
| 1254 | Ga0496102_0020653 | 3300048905 | Bacteria | 5820 |
| 1255 | Ga0496102_0023210 | 3300048905 | Bacteria | 5506 |
| 1256 | Ga0496102_0040178 | 3300048905 | Bacteria | 4230 |
| 1257 | Ga0496102_0069033 | 3300048905 | Bacteria | 3244 |
| 1258 | Ga0496102_0076786 | 3300048905 | Bacteria | 3073 |
| 1259 | Ga0496102_0178602 | 3300048905 | Bacteria | 1999 |
| 1260 | Ga0496102_0205505 | 3300048905 | Bacteria | 1857 |
| 1261 | Ga0496102_0760861 | 3300048905 | Bacteria | 891 |
| 1262 | Ga0496102_0941197 | 3300048905 | Bacteria | 785 |
| 1263 | Ga0496102_1447319 | 3300048905 | Bacteria | 606 |
| 1264 | Ga0496103_0001321 | 3300048906 | Bacteria | 16822 |
| 1265 | Ga0496103_0002752 | 3300048906 | Bacteria | 10969 |
| 1266 | Ga0496103_0006660 | 3300048906 | Bacteria | 6896 |
| 1267 | Ga0496103_0007974 | 3300048906 | Bacteria | 6290 |
| 1268 | Ga0496103_0045259 | 3300048906 | Bacteria | 2716 |
| 1269 | Ga0496103_0143904 | 3300048906 | Bacteria | 1525 |
| 1270 | Ga0496104_0616755 | 3300048907 | Bacteria | 995 |
| 1271 | Ga0496104_0668275 | 3300048907 | Bacteria | 947 |
| 1272 | Ga0496104_1316698 | 3300048907 | Bacteria | 625 |
| 1273 | Ga0496105_0077123 | 3300048908 | Bacteria | 2752 |
| 1274 | Ga0496105_0113339 | 3300048908 | Bacteria | 2238 |
| 1275 | Ga0496105_0747240 | 3300048908 | Bacteria | 747 |
| 1276 | Ga0496106_0230450 | 3300048909 | Bacteria | 1479 |
| 1277 | Ga0496106_0268693 | 3300048909 | Bacteria | 1365 |
| 1278 | Ga0496107_0021795 | 3300048910 | Bacteria | 4527 |
| 1279 | Ga0496108_0010622 | 3300048911 | Bacteria | 7469 |
| 1280 | Ga0496108_0023299 | 3300048911 | Bacteria | 5093 |
| 1281 | Ga0496108_0394878 | 3300048911 | Unclassified | 1208 |
| 1282 | Ga0496108_0483826 | 3300048911 | Bacteria | 1081 |
| 1283 | Ga0496109_0081610 | 3300048912 | Unclassified | 2980 |
| 1284 | Ga0496109_0149594 | 3300048912 | Bacteria | 2186 |
| 1285 | Ga0496109_0321254 | 3300048912 | Bacteria | 1461 |
| 1286 | Ga0496109_0656844 | 3300048912 | Bacteria | 985 |
| 1287 | Ga0496109_1427618 | 3300048912 | Bacteria | 627 |
| 1288 | Ga0496110_0000019 | 3300048913 | Bacteria | 79137 |
| 1289 | Ga0496110_0003499 | 3300048913 | Bacteria | 12050 |
| 1290 | Ga0496110_0807477 | 3300048913 | Bacteria | 842 |
| 1291 | Ga0496111_0031224 | 3300048914 | Bacteria | 3794 |
| 1292 | Ga0496111_0246770 | 3300048914 | Bacteria | 1325 |
| 1293 | Ga0496112_0032351 | 3300048915 | Bacteria | 5079 |
| 1294 | Ga0496112_0037388 | 3300048915 | Bacteria | 4739 |
| 1295 | Ga0496112_0037948 | 3300048915 | Bacteria | 4705 |
| 1296 | Ga0496112_0246092 | 3300048915 | Bacteria | 1740 |
| 1297 | Ga0496112_0252691 | 3300048915 | Bacteria | 1714 |
| 1298 | Ga0496112_1095950 | 3300048915 | Bacteria | 715 |
| 1299 | Ga0496113_0037686 | 3300048916 | Bacteria | 3550 |
| 1300 | Ga0496113_0123029 | 3300048916 | Bacteria | 2030 |
| 1301 | Ga0496113_0328300 | 3300048916 | Bacteria | 1227 |
| 1302 | Ga0496113_0421049 | 3300048916 | Bacteria | 1073 |
| 1303 | Ga0496113_0738842 | 3300048916 | Bacteria | 784 |
| 1304 | Ga0496113_0782382 | 3300048916 | Unclassified | 759 |
| 1305 | Ga0496114_0436287 | 3300048917 | Bacteria | 1160 |
| 1306 | Ga0496114_0475759 | 3300048917 | Bacteria | 1105 |
| 1307 | Ga0496114_0532190 | 3300048917 | Unclassified | 1039 |
| 1308 | Ga0496115_0011854 | 3300048918 | Bacteria | 6548 |
| 1309 | Ga0496115_0034428 | 3300048918 | Bacteria | 4003 |
| 1310 | Ga0496115_0060772 | 3300048918 | Bacteria | 3045 |
| 1311 | Ga0496115_0251481 | 3300048918 | Bacteria | 1455 |
| 1312 | Ga0496115_0282915 | 3300048918 | Bacteria | 1361 |
| 1313 | Ga0496115_0712674 | 3300048918 | Bacteria | 788 |
| 1314 | Ga0496116_0039030 | 3300048919 | Bacteria | 3288 |
| 1315 | Ga0496116_0080004 | 3300048919 | Bacteria | 2031 |
| 1316 | Ga0496117_0000132 | 3300048920 | Bacteria | 162117 |
| 1317 | Ga0496118_0000099 | 3300048921 | Bacteria | 160412 |
| 1318 | Ga0496119_0321679 | 3300048922 | Bacteria | 757 |
| 1319 | Ga0496120_0105101 | 3300048923 | Bacteria | 1485 |
| 1320 | Ga0496121_0080423 | 3300048924 | Bacteria | 2583 |
| 1321 | Ga0496121_0127464 | 3300048924 | Bacteria | 1911 |
| 1322 | Ga0496121_0210954 | 3300048924 | Bacteria | 1376 |
| 1323 | Ga0496121_0236303 | 3300048924 | Bacteria | 1276 |
| 1324 | Ga0496121_0615776 | 3300048924 | Bacteria | 667 |
| 1325 | Ga0496122_0000835 | 3300048925 | Bacteria | 58311 |
| 1326 | Ga0496122_0001402 | 3300048925 | Bacteria | 39141 |
| 1327 | Ga0496122_0036243 | 3300048925 | Bacteria | 3993 |
| 1328 | Ga0496122_0477397 | 3300048925 | Bacteria | 611 |
| 1329 | Ga0496123_0001003 | 3300048926 | Bacteria | 43216 |
| 1330 | Ga0496123_0004574 | 3300048926 | Bacteria | 14422 |
| 1331 | Ga0496123_0051903 | 3300048926 | Bacteria | 2726 |
| 1332 | Ga0496123_0053089 | 3300048926 | Bacteria | 2682 |
| 1333 | Ga0496123_0299454 | 3300048926 | Bacteria | 768 |
| 1334 | Ga0496124_0008384 | 3300048927 | Bacteria | 10812 |
| 1335 | Ga0496124_0017479 | 3300048927 | Bacteria | 6757 |
| 1336 | Ga0496124_0041651 | 3300048927 | Bacteria | 3961 |
| 1337 | Ga0496124_0061626 | 3300048927 | Bacteria | 3144 |
| 1338 | Ga0496124_0118308 | 3300048927 | Bacteria | 2121 |
| 1339 | Ga0496124_0143321 | 3300048927 | Bacteria | 1883 |
| 1340 | Ga0496124_0173038 | 3300048927 | Bacteria | 1670 |
| 1341 | Ga0496124_0218266 | 3300048927 | Bacteria | 1436 |
| 1342 | Ga0496124_0295788 | 3300048927 | Bacteria | 1172 |
| 1343 | Ga0496124_0731909 | 3300048927 | Bacteria | 622 |
| 1344 | Ga0496125_0001280 | 3300048928 | Bacteria | 37321 |
| 1345 | Ga0496125_0023719 | 3300048928 | Bacteria | 5656 |
| 1346 | Ga0496125_0381725 | 3300048928 | Bacteria | 830 |
| 1347 | Ga0496126_0015539 | 3300048929 | Bacteria | 7649 |
| 1348 | Ga0501308_001629 | 3300049128 | Bacteria | 1839 |
| 1349 | Ga0501309_047482 | 3300049129 | Bacteria | 668 |
| 1350 | Ga0501310_022591 | 3300049130 | Bacteria | 795 |
| 1351 | Ga0501310_073953 | 3300049130 | Bacteria | 526 |
| 1352 | Ga0501304_002381 | 3300049160 | Bacteria | 1301 |
| 1353 | Ga0501305_098766 | 3300049161 | Bacteria | 542 |
| 1354 | Ga0501307_014325 | 3300049162 | Bacteria | 967 |
| 1355 | Ga0501307_033547 | 3300049162 | Bacteria | 722 |
| 1356 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 1357 | Ga0495678_000384 | 3300049459 | Bacteria | 44841 |
| 1358 | Ga0495678_000515 | 3300049459 | Bacteria | 37716 |
| 1359 | Ga0495678_000866 | 3300049459 | Bacteria | 26949 |
| 1360 | Ga0495678_001499 | 3300049459 | Bacteria | 18192 |
| 1361 | Ga0495678_017736 | 3300049459 | Bacteria | 3217 |
| 1362 | Ga0495678_024378 | 3300049459 | Bacteria | 2612 |
| 1363 | Ga0495678_040952 | 3300049459 | Bacteria | 1857 |
| 1364 | Ga0495678_043619 | 3300049459 | Bacteria | 1779 |
| 1365 | Ga0495678_045351 | 3300049459 | Bacteria | 1734 |
| 1366 | Ga0495678_156665 | 3300049459 | Bacteria | 731 |
| 1367 | Ga0495678_209202 | 3300049459 | Bacteria | 597 |
| 1368 | Ga0495682_0000869 | 3300049460 | Bacteria | 18741 |
| 1369 | Ga0495682_0001115 | 3300049460 | Bacteria | 15630 |
| 1370 | Ga0495682_0006435 | 3300049460 | Bacteria | 4749 |
| 1371 | Ga0495682_0031927 | 3300049460 | Bacteria | 1945 |
| 1372 | Ga0501312_034371 | 3300049528 | Bacteria | 808 |
| 1373 | Ga0501314_024195 | 3300049530 | Bacteria | 647 |
| 1374 | Ga0501315_022278 | 3300049531 | Bacteria | 863 |
| 1375 | Ga0501315_037778 | 3300049531 | Bacteria | 720 |
| 1376 | Ga0501316_013762 | 3300049532 | Bacteria | 959 |
| 1377 | Ga0501318_020502 | 3300049534 | Bacteria | 833 |
| 1378 | Ga0501322_024908 | 3300049538 | Bacteria | 543 |
| 1379 | Ga0501323_054399 | 3300049539 | Bacteria | 614 |
| 1380 | Ga0501230_002780 | 3300049667 | Bacteria | 2255 |
| 1381 | Ga0501238_008754 | 3300049671 | Bacteria | 1335 |
| 1382 | Ga0501249_002892 | 3300049679 | Bacteria | 3455 |
| 1383 | Ga0501234_055166 | 3300049707 | Bacteria | 667 |
| 1384 | Ga0501263_027310 | 3300049760 | Bacteria | 793 |
| 1385 | Ga0501265_102468 | 3300049762 | Bacteria | 525 |
| 1386 | Ga0501269_000099 | 3300049766 | Bacteria | 27098 |
| 1387 | Ga0501279_002296 | 3300049775 | Bacteria | 2512 |
| 1388 | Ga0501279_017123 | 3300049775 | Bacteria | 1013 |
| 1389 | Ga0501035_0000965 | 3300049822 | Bacteria | 30391 |
| 1390 | Ga0501220_04705 | 3300049852 | Bacteria | 638 |
| 1391 | nmdc:mga03683_52564_c1 | 3300050489 | Bacteria | 1703 |
| 1392 | nmdc:mga0qj67_80226_c1 | 3300050509 | Bacteria | 2614 |
| 1393 | nmdc:mga08y16_312463_c1 | 3300050511 | Unclassified | 1618 |
| 1394 | nmdc:mga0n895_1047098_c1 | 3300050512 | Unclassified | 795 |
| 1395 | nmdc:mga0n895_197141_c1 | 3300050512 | Bacteria | 2045 |
| 1396 | nmdc:mga0rr50_1700061_c1 | 3300050513 | Unclassified | 532 |
| 1397 | nmdc:mga08x19_320078_c1 | 3300050514 | Bacteria | 1079 |
| 1398 | nmdc:mga08x19_8569_c1 | 3300050514 | Bacteria | 4583 |
| 1399 | nmdc:mga0a205_759673_c1 | 3300050515 | Unclassified | 818 |
| 1400 | Ga0500647_0364579 | 3300053091 | Bacteria | 597 |
| 1401 | Ga0500594_0024669 | 3300053118 | Bacteria | 1534 |
| 1402 | Ga0500618_000358 | 3300053125 | Bacteria | 31730 |
| 1403 | Ga0500618_035890 | 3300053125 | Bacteria | 1150 |
| 1404 | Ga0500586_027112 | 3300053145 | Bacteria | 1860 |
| 1405 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 1406 | Ga0587093_037672 | 3300059478 | Bacteria | 722 |
| 1407 | Ga0587066_061325 | 3300059490 | Bacteria | 768 |
| 1408 | Ga0587073_0052305 | 3300059492 | Bacteria | 930 |
| 1409 | Ga0587077_036677 | 3300059493 | Bacteria | 964 |
| 1410 | Ga0587080_003170 | 3300059503 | Bacteria | 2020 |
| 1411 | Ga0587080_031135 | 3300059503 | Bacteria | 930 |
| 1412 | Ga0587088_048226 | 3300059508 | Bacteria | 826 |
| 1413 | Ga0587090_041300 | 3300059510 | Bacteria | 813 |
| 1414 | Ga0587091_088410 | 3300059511 | Bacteria | 707 |
| 1415 | Ga0587094_056969 | 3300059513 | Bacteria | 675 |
| 1416 | Ga0587098_052710 | 3300059604 | Bacteria | 621 |
| 1417 | Ga0587106_023638 | 3300059605 | Bacteria | 933 |
| 1418 | Ga0587129_024236 | 3300059608 | Bacteria | 555 |
| 1419 | Ga0587099_051983 | 3300059622 | Bacteria | 549 |
| 1420 | Ga0587101_024610 | 3300059623 | Bacteria | 895 |
| 1421 | Ga0587115_053305 | 3300059626 | Bacteria | 662 |
| 1422 | Ga0587117_035241 | 3300059627 | Bacteria | 774 |
| 1423 | Ga0587062_061390 | 3300059639 | Bacteria | 660 |
| 1424 | Ga0587062_068412 | 3300059639 | Bacteria | 638 |
| 1425 | Ga0587068_003385 | 3300059641 | Bacteria | 2033 |
| 1426 | Ga0587068_138221 | 3300059641 | Bacteria | 542 |
| 1427 | Ga0587069_004663 | 3300059642 | Bacteria | 1557 |
| 1428 | Ga0587075_024541 | 3300059644 | Bacteria | 921 |
| 1429 | Ga0587076_036335 | 3300059645 | Bacteria | 900 |
| 1430 | Ga0587079_042086 | 3300059647 | Bacteria | 927 |
| 1431 | Ga0587102_045335 | 3300059649 | Bacteria | 579 |
| 1432 | Ga0587105_007802 | 3300059651 | Bacteria | 765 |
| 1433 | Ga0587107_073157 | 3300059652 | Bacteria | 630 |
| 1434 | Ga0587124_019618 | 3300059660 | Bacteria | 682 |
| 1435 | Ga0587071_061264 | 3300060344 | Bacteria | 800 |
| 1436 | Ga0587111_0057014 | 3300060346 | Bacteria | 878 |
| 1437 | Ga0587111_0084966 | 3300060346 | Bacteria | 763 |
| 1438 | Ga0466962_0083668 | 3300061719 | Bacteria | 1526 |
| 1439 | Ga0466962_0114442 | 3300061719 | Bacteria | 1299 |
| 1440 | 2643786992 | 2643221554 | Bacteria | 6603920 |
| 1441 | 2643802316 | 2643221556 | Bacteria | 7251154 |
| 1442 | 2644215914 | 2643221638 | Bacteria | 6579467 |
| 1443 | 2644254384 | 2643221645 | Bacteria | 7207331 |
| 1444 | 2644357949 | 2643221664 | Bacteria | 7272945 |
| 1445 | 2644475824 | 2643221684 | Bacteria | 7145183 |
| 1446 | 2738741196 | 2738541280 | Bacteria | 6630198 |
| 1447 | 2738829264 | 2738541297 | Bacteria | 6549566 |
| 1448 | 2738845662 | 2738541300 | Bacteria | 6675882 |
| 1449 | 2739153060 | 2738541357 | Bacteria | 6549408 |
| 1450 | 2739194980 | 2738543003 | Bacteria | 6549560 |
| 1451 | 2739277470 | 2738543018 | Bacteria | 6718814 |
| 1452 | 2739321456 | 2738543026 | Bacteria | 6549408 |
| 1453 | 2739339988 | 2738543029 | Bacteria | 6549249 |
| 1454 | 2739346607 | 2738543030 | Bacteria | 6719714 |
| 1455 | 2809145361 | 2808606418 | Bacteria | 6724496 |
| 1456 | 2821131543 | 2821131069 | Bacteria | 6108407 |
| 1457 | 2842718111 | 2842711865 | Bacteria | 7155354 |
| 1458 | 2857554423 | 2857553236 | Bacteria | 6166726 |
| 1459 | 2857563850 | 2857558681 | Bacteria | 6617694 |
| 1460 | 2857564791 | 2857564685 | Bacteria | 6290584 |
| 1461 | 2904426082 | 2904424332 | Bacteria | 7633521 |
| 1462 | 2919478473 | 2919476304 | Bacteria | 5888696 |
| 1463 | 8047673826 | 8047673197 | Bacteria | 7395230 |
| 1464 | Ga0207665_10281142 | |||
| 1465 | MRS1b_contig_3883174 | |||
| 1466 | CNXas_1000109 | |||
| 1467 | JGI25154J39366_1001666 | |||
| 1468 | JGI25158J39367_1016024 | |||
| 1469 | JGI25158J39367_1026400 | |||
| 1470 | JGI25152J39213_1000395 | |||
| 1471 | JGI25152J39213_1021195 | |||
| 1472 | JGI25150J39212_1001869 | |||
| 1473 | JGI25150J39212_1003324 | |||
| 1474 | JGI25159J45721_1004182 | |||
| 1475 | JGI25159J45721_1007879 | |||
| 1476 | JGI25159J45721_1008010 | |||
| 1477 | Ga0006759J45824_1074564 | |||
| 1478 | JGI25151J46595_10143722 | |||
| 1479 | JGI25406J46586_10000011 | |||
| 1480 | JGI25153J46596_10016332 | |||
| 1481 | Ga0006770J48903_1038274 | |||
| 1482 | rootL2_10109828 | |||
| 1483 | JGI25160J50197_1012431 | |||
| 1484 | JGI25161J50226_1004160 | |||
| 1485 | JGI25161J50226_1006147 | |||
| 1486 | JGI25161J50226_1008312 | |||
| 1487 | Ga0007417J51691_1055251 | |||
| 1488 | Ga0007409J51694_1016091 | |||
| 1489 | Ga0055525_1000001 | |||
| 1490 | Ga0055529_1000146 | |||
| 1491 | Ga0055526_1000074 | |||
| 1492 | Ga0055526_1000299 | |||
| 1493 | Ga0055526_1004222 | |||
| 1494 | Ga0055526_1015299 | |||
| 1495 | Ga0055526_1030873 | |||
| 1496 | Ga0055537_1000154 | |||
| 1497 | Ga0055537_1020048 | |||
| 1498 | Ga0055524_1000021 | |||
| 1499 | Ga0055524_1000099 | |||
| 1500 | Ga0055524_1009788 | |||
| 1501 | Ga0055524_1020989 | |||
| 1502 | Ga0055534_1000513 | |||
| 1503 | Ga0055534_1037235 | |||
| 1504 | Ga0055534_1046031 | |||
| 1505 | Ga0055528_1007230 | |||
| 1506 | Ga0055528_1027547 | |||
| 1507 | Ga0055530_10101324 | |||
| 1508 | Ga0055530_10104705 | |||
| 1509 | Ga0055531_10003560 | |||
| 1510 | Ga0055543_1002596 | |||
| 1511 | Ga0055543_1005900 | |||
| 1512 | Ga0055543_1026489 | |||
| 1513 | Ga0065165_1000055 | |||
| 1514 | Ga0065165_1003015 | |||
| 1515 | Ga0065165_1013829 | |||
| 1516 | Ga0065165_1031771 | |||
| 1517 | Ga0065165_1044818 | |||
| 1518 | Ga0065704_10301195 | |||
| 1519 | Ga0065712_10098684 | |||
| 1520 | Ga0065712_10381451 | |||
| 1521 | Ga0070676_10006530 | |||
| 1522 | Ga0070676_10027936 | |||
| 1523 | Ga0070676_10100217 | |||
| 1524 | Ga0070690_100159858 | |||
| 1525 | Ga0070690_100533002 | |||
| 1526 | Ga0070690_101299440 | |||
| 1527 | Ga0070670_100002302 | |||
| 1528 | Ga0070670_100006241 | |||
| 1529 | Ga0070670_100890794 | |||
| 1530 | Ga0070666_10041425 | |||
| 1531 | Ga0070666_11129305 | |||
| 1532 | Ga0070680_100113297 | |||
| 1533 | Ga0068868_100039996 | |||
| 1534 | Ga0070660_100045119 | |||
| 1535 | Ga0070689_100045940 | |||
| 1536 | Ga0070689_100209478 | |||
| 1537 | Ga0070661_100199014 | |||
| 1538 | Ga0070661_100571449 | |||
| 1539 | Ga0070661_100887244 | |||
| 1540 | Ga0070668_100012213 | |||
| 1541 | Ga0070668_101247694 | |||
| 1542 | Ga0070669_100014990 | |||
| 1543 | Ga0070669_100050766 | |||
| 1544 | Ga0070675_100033029 | |||
| 1545 | Ga0070675_100327014 | |||
| 1546 | Ga0070671_100015082 | |||
| 1547 | Ga0070671_100022258 | |||
| 1548 | Ga0070671_100750893 | |||
| 1549 | Ga0070671_101048816 | |||
| 1550 | Ga0070674_100316035 | |||
| 1551 | Ga0070688_100001382 | |||
| 1552 | Ga0070688_100393804 | |||
| 1553 | Ga0070659_100016372 | |||
| 1554 | Ga0070659_101646324 | |||
| 1555 | Ga0070667_100001152 | |||
| 1556 | Ga0070667_100037387 | |||
| 1557 | Ga0070667_100130998 | |||
| 1558 | Ga0070710_11084711 | |||
| 1559 | Ga0070711_100309067 | |||
| 1560 | Ga0070708_100069853 | |||
| 1561 | Ga0070708_100095985 | |||
| 1562 | Ga0070708_100151113 | |||
| 1563 | Ga0070708_100678736 | |||
| 1564 | Ga0070708_100993817 | |||
| 1565 | Ga0070663_100487664 | |||
| 1566 | Ga0070663_100750009 | |||
| 1567 | Ga0070678_100032818 | |||
| 1568 | Ga0070678_101004950 | |||
| 1569 | Ga0070678_101026758 | |||
| 1570 | Ga0070662_100166473 | |||
| 1571 | Ga0070662_100309108 | |||
| 1572 | Ga0068867_100830696 | |||
| 1573 | Ga0068867_101237614 | |||
| 1574 | Ga0070706_100000116 | |||
| 1575 | Ga0070706_100018698 | |||
| 1576 | Ga0070706_100030413 | |||
| 1577 | Ga0070706_100035119 | |||
| 1578 | Ga0070706_100394020 | |||
| 1579 | Ga0070706_101359080 | |||
| 1580 | Ga0070706_101692047 | |||
| 1581 | Ga0070707_100002729 | |||
| 1582 | Ga0070707_100024521 | |||
| 1583 | Ga0070707_100025365 | |||
| 1584 | Ga0070707_100025898 | |||
| 1585 | Ga0070707_100036840 | |||
| 1586 | Ga0070707_100040136 | |||
| 1587 | Ga0070707_100172499 | |||
| 1588 | Ga0070707_100174613 | |||
| 1589 | Ga0070707_100430691 | |||
| 1590 | Ga0070707_100634912 | |||
| 1591 | Ga0070707_101153467 | |||
| 1592 | Ga0070698_100003134 | |||
| 1593 | Ga0070698_100010744 | |||
| 1594 | Ga0070698_100097143 | |||
| 1595 | Ga0070698_100521070 | |||
| 1596 | Ga0070698_101424514 | |||
| 1597 | Ga0070699_100073974 | |||
| 1598 | Ga0070699_100121464 | |||
| 1599 | Ga0070699_100970298 | |||
| 1600 | Ga0070679_101207007 | |||
| 1601 | Ga0070697_100003060 | |||
| 1602 | Ga0070697_100004215 | |||
| 1603 | Ga0070697_100014381 | |||
| 1604 | Ga0070697_100045646 | |||
| 1605 | Ga0070697_100070956 | |||
| 1606 | Ga0070697_100171703 | |||
| 1607 | Ga0070697_100184858 | |||
| 1608 | Ga0070697_100362220 | |||
| 1609 | Ga0070697_101366158 | |||
| 1610 | Ga0070672_100003958 | |||
| 1611 | Ga0070672_100311686 | |||
| 1612 | Ga0070672_100552408 | |||
| 1613 | Ga0070672_101073981 | |||
| 1614 | Ga0070695_100045457 | |||
| 1615 | Ga0070693_100285770 | |||
| 1616 | Ga0070665_100046012 | |||
| 1617 | Ga0070665_100159514 | |||
| 1618 | Ga0070704_100924943 | |||
| 1619 | Ga0070704_100937297 | |||
| 1620 | Ga0068855_100044300 | |||
| 1621 | Ga0070664_100257608 | |||
| 1622 | Ga0070664_100271830 | |||
| 1623 | Ga0070664_100792839 | |||
| 1624 | Ga0070664_101708942 | |||
| 1625 | Ga0068857_100381724 | |||
| 1626 | Ga0068856_100937236 | |||
| 1627 | Ga0068856_101631923 | |||
| 1628 | Ga0070702_100522835 | |||
| 1629 | Ga0070702_101523037 | |||
| 1630 | Ga0068852_100132069 | |||
| 1631 | Ga0068866_10030064 | |||
| 1632 | Ga0068866_10155285 | |||
| 1633 | Ga0068851_10140563 | |||
| 1634 | Ga0068860_100603401 | |||
| 1635 | Ga0081540_1195395 | |||
| 1636 | Ga0081539_10000139 | |||
| 1637 | Ga0081539_10002232 | |||
| 1638 | Ga0081539_10012174 | |||
| 1639 | Ga0081539_10052402 | |||
| 1640 | Ga0081539_10052887 | |||
| 1641 | Ga0070717_10002406 | |||
| 1642 | Ga0070717_10006132 | |||
| 1643 | Ga0070717_10148449 | |||
| 1644 | Ga0075364_10477428 | |||
| 1645 | Ga0070716_100306864 | |||
| 1646 | Ga0070716_100311420 | |||
| 1647 | Ga0070716_100350730 | |||
| 1648 | Ga0070716_100643389 | |||
| 1649 | Ga0075362_10055685 | |||
| 1650 | Ga0097621_100004370 | |||
| 1651 | Ga0097621_100004743 | |||
| 1652 | Ga0097621_101288069 | |||
| 1653 | Ga0068871_100017920 | |||
| 1654 | Ga0068871_100040568 | |||
| 1655 | Ga0068871_100127459 | |||
| 1656 | Ga0068871_100263499 | |||
| 1657 | Ga0075433_10655378 | |||
| 1658 | Ga0075434_100073372 | |||
| 1659 | Ga0075434_101182136 | |||
| 1660 | Ga0068865_100083101 | |||
| 1661 | Ga0068865_100183875 | |||
| 1662 | Ga0075436_100021119 | |||
| 1663 | Ga0079104_1020522 | |||
| 1664 | Ga0099826_10000002 | |||
| 1665 | Ga0099794_10138050 | |||
| 1666 | Ga0105244_10001358 | |||
| 1667 | Ga0105244_10001435 | |||
| 1668 | Ga0105244_10066484 | |||
| 1669 | Ga0105244_10526848 | |||
| 1670 | Ga0105250_10242911 | |||
| 1671 | Ga0105240_10686415 | |||
| 1672 | Ga0105240_10813296 | |||
| 1673 | Ga0105240_11305553 | |||
| 1674 | Ga0111539_10260786 | |||
| 1675 | Ga0105245_10084318 | |||
| 1676 | Ga0105245_10119936 | |||
| 1677 | Ga0105245_10167216 | |||
| 1678 | Ga0105245_10651147 | |||
| 1679 | Ga0105245_13006666 | |||
| 1680 | Ga0105243_10234788 | |||
| 1681 | Ga0105243_11841945 | |||
| 1682 | Ga0105241_10193522 | |||
| 1683 | Ga0105242_10021980 | |||
| 1684 | Ga0105242_10974916 | |||
| 1685 | Ga0105248_11780232 | |||
| 1686 | Ga0105237_10302030 | |||
| 1687 | Ga0105237_10856390 | |||
| 1688 | Ga0105238_10362340 | |||
| 1689 | Ga0105239_10068393 | |||
| 1690 | Ga0105239_10492732 | |||
| 1691 | Ga0105239_12258985 | |||
| 1692 | Ga0157327_1013057 | |||
| 1693 | Ga0157373_10078322 | |||
| 1694 | Ga0157373_10634948 | |||
| 1695 | Ga0157373_11009385 | |||
| 1696 | Ga0157371_10000078 | |||
| 1697 | Ga0157370_10796901 | |||
| 1698 | Ga0157374_10020633 | |||
| 1699 | Ga0157374_10099139 | |||
| 1700 | Ga0157374_10116843 | |||
| 1701 | Ga0157374_10255295 | |||
| 1702 | Ga0157374_10610886 | |||
| 1703 | Ga0157378_10022702 | |||
| 1704 | Ga0157378_10023772 | |||
| 1705 | Ga0157378_10093439 | |||
| 1706 | Ga0157378_10093654 | |||
| 1707 | Ga0157378_10156781 | |||
| 1708 | Ga0157378_10258166 | |||
| 1709 | Ga0157378_10271158 | |||
| 1710 | Ga0157378_10297016 | |||
| 1711 | Ga0157378_10486787 | |||
| 1712 | Ga0157378_10626109 | |||
| 1713 | Ga0157378_10897282 | |||
| 1714 | Ga0157378_12407997 | |||
| 1715 | Ga0163162_10004766 | |||
| 1716 | Ga0163162_10112128 | |||
| 1717 | Ga0163162_10262665 | |||
| 1718 | Ga0157372_10224982 | |||
| 1719 | Ga0157372_10877763 | |||
| 1720 | Ga0157375_10000847 | |||
| 1721 | Ga0157375_10016097 | |||
| 1722 | Ga0157375_10168179 | |||
| 1723 | Ga0157375_10387053 | |||
| 1724 | Ga0157375_13139799 | |||
| 1725 | Ga0182008_10021358 | |||
| 1726 | Ga0157377_11272339 | |||
| 1727 | Ga0157376_10002921 | |||
| 1728 | Ga0157376_10486261 | |||
| 1729 | Ga0157376_10568546 | |||
| 1730 | Ga0182006_1000026 | |||
| 1731 | Ga0182006_1037798 | |||
| 1732 | Ga0182006_1097963 | |||
| 1733 | Ga0182006_1195413 | |||
| 1734 | Ga0182007_10086611 | |||
| 1735 | Ga0182007_10276411 | |||
| 1736 | Ga0182005_1000007 | |||
| 1737 | Ga0182005_1081840 | |||
| 1738 | Ga0163161_10040505 | |||
| 1739 | Ga0163161_10262967 | |||
| 1740 | Ga0206351_10247105 | |||
| 1741 | Ga0206353_10452765 | |||
| 1742 | Ga0154015_1381368 | |||
| 1743 | Ga0213872_10000028 | |||
| 1744 | Ga0213872_10006879 | |||
| 1745 | Ga0213872_10033421 | |||
| 1746 | Ga0209436_100351 | |||
| 1747 | Ga0209436_103199 | |||
| 1748 | Ga0209563_100007 | |||
| 1749 | Ga0209437_108742 | |||
| 1750 | Ga0209437_114140 | |||
| 1751 | Ga0207425_1000001 | |||
| 1752 | Ga0207425_1000327 | |||
| 1753 | Ga0207425_1000339 | |||
| 1754 | Ga0207425_1064128 | |||
| 1755 | Ga0209646_1000010 | |||
| 1756 | Ga0209677_104764 | |||
| 1757 | Ga0209148_1000360 | |||
| 1758 | Ga0209129_1000001 | |||
| 1759 | Ga0209129_1011719 | |||
| 1760 | Ga0209565_1000057 | |||
| 1761 | Ga0209565_1003411 | |||
| 1762 | Ga0209565_1003951 | |||
| 1763 | Ga0209565_1087400 | |||
| 1764 | Ga0209455_1000037 | |||
| 1765 | Ga0209673_1000051 | |||
| 1766 | Ga0209673_1007915 | |||
| 1767 | Ga0209130_1000091 | |||
| 1768 | Ga0209130_1002422 | |||
| 1769 | Ga0209130_1002705 | |||
| 1770 | Ga0209675_1000027 | |||
| 1771 | Ga0209675_1001211 | |||
| 1772 | Ga0209675_1005738 | |||
| 1773 | Ga0209675_1024807 | |||
| 1774 | Ga0209025_1005014 | |||
| 1775 | Ga0209564_1000009 | |||
| 1776 | Ga0209564_1000068 | |||
| 1777 | Ga0209564_1000094 | |||
| 1778 | Ga0209564_1001487 | |||
| 1779 | Ga0209564_1007956 | |||
| 1780 | Ga0209564_1010315 | |||
| 1781 | Ga0209564_1038751 | |||
| 1782 | Ga0209758_1000073 | |||
| 1783 | Ga0209758_1000227 | |||
| 1784 | Ga0209050_1000046 | |||
| 1785 | Ga0209050_1000442 | |||
| 1786 | Ga0209256_1000044 | |||
| 1787 | Ga0209256_1000116 | |||
| 1788 | Ga0209256_1000145 | |||
| 1789 | Ga0209256_1000988 | |||
| 1790 | Ga0209256_1007853 | |||
| 1791 | Ga0207426_1003827 | |||
| 1792 | Ga0209051_1045983 | |||
| 1793 | Ga0209257_1000068 | |||
| 1794 | Ga0207697_10000230 | |||
| 1795 | Ga0207656_10147600 | |||
| 1796 | Ga0207655_1015761 | |||
| 1797 | Ga0207642_10018395 | |||
| 1798 | Ga0207642_10133315 | |||
| 1799 | Ga0207642_11051782 | |||
| 1800 | Ga0207688_10028875 | |||
| 1801 | Ga0207680_10022988 | |||
| 1802 | Ga0207699_10353593 | |||
| 1803 | Ga0207705_10001972 | |||
| 1804 | Ga0207705_10526539 | |||
| 1805 | Ga0207684_10000190 | |||
| 1806 | Ga0207684_10030054 | |||
| 1807 | Ga0207684_10031627 | |||
| 1808 | Ga0207684_10059588 | |||
| 1809 | Ga0207684_10070092 | |||
| 1810 | Ga0207684_10539954 | |||
| 1811 | Ga0207684_10779762 | |||
| 1812 | Ga0207654_10008161 | |||
| 1813 | Ga0207671_10204875 | |||
| 1814 | Ga0207671_10830194 | |||
| 1815 | Ga0207660_10057168 | |||
| 1816 | Ga0207657_10871977 | |||
| 1817 | Ga0207649_10228473 | |||
| 1818 | Ga0207652_10809247 | |||
| 1819 | Ga0207646_10003785 | |||
| 1820 | Ga0207646_10009717 | |||
| 1821 | Ga0207646_10015435 | |||
| 1822 | Ga0207646_10047841 | |||
| 1823 | Ga0207646_10114655 | |||
| 1824 | Ga0207646_10120029 | |||
| 1825 | Ga0207646_11511300 | |||
| 1826 | Ga0207646_11862424 | |||
| 1827 | Ga0207681_10069268 | |||
| 1828 | Ga0207681_10666174 | |||
| 1829 | Ga0207694_10368309 | |||
| 1830 | Ga0207650_10015523 | |||
| 1831 | Ga0207650_11819441 | |||
| 1832 | Ga0207659_10049775 | |||
| 1833 | Ga0207659_10203549 | |||
| 1834 | Ga0207687_10518458 | |||
| 1835 | Ga0207644_10543189 | |||
| 1836 | Ga0207644_11170587 | |||
| 1837 | Ga0207690_10010877 | |||
| 1838 | Ga0207690_10152984 | |||
| 1839 | Ga0207690_11221363 | |||
| 1840 | Ga0207706_10120143 | |||
| 1841 | Ga0207706_10127098 | |||
| 1842 | Ga0207706_10365512 | |||
| 1843 | Ga0207686_10028891 | |||
| 1844 | Ga0207686_10399664 | |||
| 1845 | Ga0207709_10683063 | |||
| 1846 | Ga0207670_10026701 | |||
| 1847 | Ga0207670_10267760 | |||
| 1848 | Ga0207669_10125945 | |||
| 1849 | Ga0207669_11362432 | |||
| 1850 | Ga0207704_10225664 | |||
| 1851 | Ga0207704_10339819 | |||
| 1852 | Ga0207665_10019448 | |||
| 1853 | Ga0207665_10082276 | |||
| 1854 | Ga0207691_10001130 | |||
| 1855 | Ga0207691_10227193 | |||
| 1856 | Ga0207691_10312466 | |||
| 1857 | Ga0207691_11053828 | |||
| 1858 | Ga0207691_11186069 | |||
| 1859 | Ga0207679_10083312 | |||
| 1860 | Ga0207679_10088846 | |||
| 1861 | Ga0207667_10027566 | |||
| 1862 | Ga0207651_10987501 | |||
| 1863 | Ga0207668_10236886 | |||
| 1864 | Ga0207668_10542504 | |||
| 1865 | Ga0207640_10715427 | |||
| 1866 | Ga0207658_10010500 | |||
| 1867 | Ga0207677_10063774 | |||
| 1868 | Ga0207677_12103007 | |||
| 1869 | Ga0207678_10063189 | |||
| 1870 | Ga0207678_10295105 | |||
| 1871 | Ga0207702_10880136 | |||
| 1872 | Ga0207702_11275697 | |||
| 1873 | Ga0207648_10098010 | |||
| 1874 | Ga0207648_10225463 | |||
| 1875 | Ga0207648_11146711 | |||
| 1876 | Ga0207674_11315610 | |||
| 1877 | Ga0207683_10006813 | |||
| 1878 | Ga0207683_10336655 | |||
| 1879 | Ga0207698_10222334 | |||
| 1880 | Ga0209281_1005666 | |||
| 1881 | Ga0209282_1000001 | |||
| 1882 | Ga0268266_10013072 | |||
| 1883 | Ga0316180_1109616 | |||
| 1884 | Ga0316183_1134260 | |||
| 1885 | Ga0316181_1070955 | |||
| 1886 | Ga0316181_1263623 | |||
| 1887 | Ga0316182_1023982 | |||
| 1888 | Ga0265316_10067224 | |||
| 1889 | Ga0265316_11107695 | |||
| 1890 | Ga0307513_10136437 | |||
| 1891 | Ga0307408_100000981 | |||
| 1892 | Ga0307408_100001472 | |||
| 1893 | Ga0307408_100002767 | |||
| 1894 | Ga0307408_101680490 | |||
| 1895 | Ga0307508_10139506 | |||
| 1896 | Ga0307518_10137449 | |||
| 1897 | Ga0307406_12051234 | |||
| 1898 | Ga0307412_10476873 | |||
| 1899 | Ga0307412_10502414 | |||
| 1900 | Ga0307412_12064263 | |||
| 1901 | Ga0307416_100011426 | |||
| 1902 | Ga0307416_101432393 | |||
| 1903 | Ga0307416_102723184 | |||
| 1904 | Ga0307414_10020067 | |||
| 1905 | Ga0307414_10541653 | |||
| 1906 | Ga0307411_10968862 | |||
| 1907 | Ga0307415_102043720 | |||
| 1908 | Ga0373943_0048876 | |||
| 1909 | Ga0373943_0947714 | |||
| 1910 | Ga0373947_0040081 | |||
| 1911 | Ga0373947_0126165 | |||
| 1912 | Ga0373937_0168600 | |||
| 1913 | Ga0373925_0080283 | |||
| 1914 | Ga0373925_0771979 | |||
| 1915 | Ga0395899_0000082 | |||
| 1916 | Ga0395899_0016969 | |||
| 1917 | Ga0395899_0024287 | |||
| 1918 | Ga0395899_0210055 | |||
| 1919 | Ga0395900_0000393 | |||
| 1920 | Ga0395900_0019995 | |||
| 1921 | Ga0395900_0046773 | |||
| 1922 | Ga0395900_0092327 | |||
| 1923 | Ga0395900_0113588 | |||
| 1924 | Ga0395900_0184192 | |||
| 1925 | Ga0395900_1822254 | |||
| 1926 | Ga0395898_0106973 | |||
| 1927 | Ga0395898_0152641 | |||
| 1928 | Ga0395898_1003428 | |||
| 1929 | Ga0395898_1377172 | |||
| 1930 | Ga0395905_0009206 | |||
| 1931 | Ga0395905_0047340 | |||
| 1932 | Ga0395905_0549185 | |||
| 1933 | Ga0395905_0569842 | |||
| 1934 | Ga0395905_0701342 | |||
| 1935 | Ga0395905_1823413 | |||
| 1936 | Ga0395905_1847022 | |||
| 1937 | Ga0436364_0101037 | |||
| 1938 | Ga0395901_0000054 | |||
| 1939 | Ga0395901_0010533 | |||
| 1940 | Ga0395901_0163525 | |||
| 1941 | Ga0395901_0334325 | |||
| 1942 | Ga0395901_0359500 | |||
| 1943 | Ga0395901_1163544 | |||
| 1944 | Ga0436361_0605732 | |||
| 1945 | Ga0436361_0616428 | |||
| 1946 | Ga0436361_1222516 | |||
| 1947 | Ga0439436_0045720 | |||
| 1948 | Ga0451807_2769524 | |||
| 1949 | Ga0451835_0242121 | |||
| 1950 | Ga0451853_2377098 | |||
| 1951 | Ga0451853_2842729 | |||
| 1952 | Ga0451853_3225716 | |||
| 1953 | Ga0439448_0316470 | |||
| 1954 | Ga0439449_0028091 | |||
| 1955 | Ga0439450_156315 | |||
| 1956 | Ga0439454_004952 | |||
| 1957 | Ga0439455_0105379 | |||
| 1958 | Ga0450911_020566 | |||
| 1959 | Ga0450920_092727 | |||
| 1960 | Ga0450898_106442 | |||
| 1961 | Ga0450904_000438 | |||
| 1962 | Ga0439446_0134383 | |||
| 1963 | Ga0450893_0090164 | |||
| 1964 | Ga0451577_0107899 | |||
| 1965 | Ga0451577_1143792 | |||
| 1966 | Ga0466969_0062179 | |||
| 1967 | Ga0466969_0205223 | |||
| 1968 | Ga0466972_0000042 | |||
| 1969 | Ga0466972_0127184 | |||
| 1970 | Ga0466972_0130545 | |||
| 1971 | Ga0466982_0387196 | |||
| 1972 | Ga0466965_0123291 | |||
| 1973 | Ga0466965_0159673 | |||
| 1974 | Ga0466965_0182269 | |||
| 1975 | Ga0466966_0034358 | |||
| 1976 | Ga0466966_0180341 | |||
| 1977 | Ga0466963_0184915 | |||
| 1978 | Ga0466964_0000091 | |||
| 1979 | Ga0466964_0052645 | |||
| 1980 | Ga0466964_0429360 | |||
| 1981 | Ga0453684_0000917 | |||
| 1982 | Ga0453684_1277106 | |||
| 1983 | Ga0466971_0210479 | |||
| 1984 | Ga0466971_0242506 | |||
| 1985 | Ga0466968_0000777 | |||
| 1986 | Ga0466957_0166814 | |||
| 1987 | Ga0466957_0218946 | |||
| 1988 | Ga0466960_0144687 | |||
| 1989 | Ga0466960_0312230 | |||
| 1990 | Ga0466960_0574434 | |||
| 1991 | Ga0466959_0028509 | |||
| 1992 | Ga0466959_0220493 | |||
| 1993 | Ga0451576_0365370 | |||
| 1994 | Ga0466958_0208527 | |||
| 1995 | Ga0466967_0015997 | |||
| 1996 | Ga0466967_0118372 | |||
| 1997 | Ga0466967_0181032 | |||
| 1998 | Ga0495617_000041 | |||
| 1999 | Ga0495617_000057 | |||
| 2000 | Ga0495617_001102 | |||
| 2001 | Ga0495617_026400 | |||
| 2002 | Ga0495617_033783 | |||
| 2003 | Ga0495617_234914 | |||
| 2004 | Ga0495627_000007 | |||
| 2005 | Ga0495627_001004 | |||
| 2006 | Ga0495627_014641 | |||
| 2007 | Ga0495603_0057009 | |||
| 2008 | Ga0495603_0183470 | |||
| 2009 | Ga0495603_0327998 | |||
| 2010 | Ga0495603_0394385 | |||
| 2011 | Ga0495590_0000001 | |||
| 2012 | Ga0495590_0000018 | |||
| 2013 | Ga0495590_0000251 | |||
| 2014 | Ga0495590_0003051 | |||
| 2015 | Ga0495590_0016843 | |||
| 2016 | Ga0495590_0122654 | |||
| 2017 | Ga0495590_0186459 | |||
| 2018 | Ga0495591_004295 | |||
| 2019 | Ga0495591_020659 | |||
| 2020 | Ga0495629_0008847 | |||
| 2021 | Ga0495629_0041207 | |||
| 2022 | Ga0495629_0093578 | |||
| 2023 | Ga0495629_0171494 | |||
| 2024 | Ga0495629_0377308 | |||
| 2025 | Ga0495638_0000423 | |||
| 2026 | Ga0495638_0001950 | |||
| 2027 | Ga0495638_0002366 | |||
| 2028 | Ga0495638_0025941 | |||
| 2029 | Ga0495638_0097743 | |||
| 2030 | Ga0495638_0125695 | |||
| 2031 | Ga0495638_0148394 | |||
| 2032 | Ga0495638_0287897 | |||
| 2033 | Ga0495653_0000002 | |||
| 2034 | Ga0495653_0005312 | |||
| 2035 | Ga0495653_0123169 | |||
| 2036 | Ga0495653_0126365 | |||
| 2037 | Ga0495653_0242459 | |||
| 2038 | Ga0495650_0000108 | |||
| 2039 | Ga0495650_0000118 | |||
| 2040 | Ga0495650_0000156 | |||
| 2041 | Ga0495650_0000166 | |||
| 2042 | Ga0495650_0001417 | |||
| 2043 | Ga0495650_0004758 | |||
| 2044 | Ga0495650_0033948 | |||
| 2045 | Ga0495650_0056190 | |||
| 2046 | Ga0495650_0129330 | |||
| 2047 | Ga0495580_0029634 | |||
| 2048 | Ga0495580_0685629 | |||
| 2049 | Ga0495582_0007542 | |||
| 2050 | Ga0495582_0096997 | |||
| 2051 | Ga0495582_0149706 | |||
| 2052 | Ga0495582_0378240 | |||
| 2053 | Ga0495582_0717439 | |||
| 2054 | Ga0495605_0000059 | |||
| 2055 | Ga0495605_0000260 | |||
| 2056 | Ga0495605_0000598 | |||
| 2057 | Ga0495605_0001111 | |||
| 2058 | Ga0495605_0003011 | |||
| 2059 | Ga0495605_0008745 | |||
| 2060 | Ga0495605_0029751 | |||
| 2061 | Ga0495605_0030368 | |||
| 2062 | Ga0495605_0037060 | |||
| 2063 | Ga0495605_0041669 | |||
| 2064 | Ga0495605_0062056 | |||
| 2065 | Ga0495605_0069744 | |||
| 2066 | Ga0495605_0089022 | |||
| 2067 | Ga0495605_0278526 | |||
| 2068 | Ga0495605_0361635 | |||
| 2069 | Ga0495605_0378819 | |||
| 2070 | Ga0495639_0250894 | |||
| 2071 | Ga0495664_0703930 | |||
| 2072 | Ga0495584_0000006 | |||
| 2073 | Ga0495584_0001835 | |||
| 2074 | Ga0495584_0001841 | |||
| 2075 | Ga0495584_0002247 | |||
| 2076 | Ga0495584_0004974 | |||
| 2077 | Ga0495584_0007211 | |||
| 2078 | Ga0495584_0011682 | |||
| 2079 | Ga0495584_0013361 | |||
| 2080 | Ga0495584_0013827 | |||
| 2081 | Ga0495584_0036310 | |||
| 2082 | Ga0495584_0036816 | |||
| 2083 | Ga0495584_0041304 | |||
| 2084 | Ga0495584_0047001 | |||
| 2085 | Ga0495584_0058346 | |||
| 2086 | Ga0495584_0089372 | |||
| 2087 | Ga0495584_0091051 | |||
| 2088 | Ga0495584_0237158 | |||
| 2089 | Ga0495584_0666068 | |||
| 2090 | Ga0495585_0000282 | |||
| 2091 | Ga0495585_0003548 | |||
| 2092 | Ga0495585_0004128 | |||
| 2093 | Ga0495585_0004783 | |||
| 2094 | Ga0495585_0007364 | |||
| 2095 | Ga0495585_0008922 | |||
| 2096 | Ga0495585_0011838 | |||
| 2097 | Ga0495585_0014509 | |||
| 2098 | Ga0495585_0016543 | |||
| 2099 | Ga0495585_0023658 | |||
| 2100 | Ga0495585_0042612 | |||
| 2101 | Ga0495585_0047888 | |||
| 2102 | Ga0495585_0097886 | |||
| 2103 | Ga0495585_0101232 | |||
| 2104 | Ga0495585_0120605 | |||
| 2105 | Ga0495585_0134348 | |||
| 2106 | Ga0495585_0144154 | |||
| 2107 | Ga0495585_0146493 | |||
| 2108 | Ga0495585_0181351 | |||
| 2109 | Ga0495585_0208936 | |||
| 2110 | Ga0495585_0635359 | |||
| 2111 | Ga0495594_0006060 | |||
| 2112 | Ga0495594_0022540 | |||
| 2113 | Ga0495594_0056774 | |||
| 2114 | Ga0495594_0063287 | |||
| 2115 | Ga0495594_0088303 | |||
| 2116 | Ga0495594_0100196 | |||
| 2117 | Ga0495594_0103494 | |||
| 2118 | Ga0495594_0228512 | |||
| 2119 | Ga0495594_0471986 | |||
| 2120 | Ga0495596_0000236 | |||
| 2121 | Ga0495596_0003733 | |||
| 2122 | Ga0495596_0003880 | |||
| 2123 | Ga0495596_0010298 | |||
| 2124 | Ga0495596_0016755 | |||
| 2125 | Ga0495596_0020946 | |||
| 2126 | Ga0495596_0032093 | |||
| 2127 | Ga0495596_0039830 | |||
| 2128 | Ga0495596_0066495 | |||
| 2129 | Ga0495596_0072165 | |||
| 2130 | Ga0495596_0112662 | |||
| 2131 | Ga0495596_0225634 | |||
| 2132 | Ga0495607_0002467 | |||
| 2133 | Ga0495607_0003144 | |||
| 2134 | Ga0495607_0003634 | |||
| 2135 | Ga0495607_0008457 | |||
| 2136 | Ga0495607_0014610 | |||
| 2137 | Ga0495607_0014950 | |||
| 2138 | Ga0495607_0027861 | |||
| 2139 | Ga0495607_0038208 | |||
| 2140 | Ga0495607_0040944 | |||
| 2141 | Ga0495607_0051300 | |||
| 2142 | Ga0495607_0147306 | |||
| 2143 | Ga0495607_0226812 | |||
| 2144 | Ga0495607_0336100 | |||
| 2145 | Ga0495607_0419653 | |||
| 2146 | Ga0495583_0000035 | |||
| 2147 | Ga0495583_0000525 | |||
| 2148 | Ga0495583_0000533 | |||
| 2149 | Ga0495583_0000608 | |||
| 2150 | Ga0495583_0001445 | |||
| 2151 | Ga0495583_0002759 | |||
| 2152 | Ga0495583_0004051 | |||
| 2153 | Ga0495583_0004816 | |||
| 2154 | Ga0495583_0011794 | |||
| 2155 | Ga0495583_0014446 | |||
| 2156 | Ga0495583_0020340 | |||
| 2157 | Ga0495583_0027832 | |||
| 2158 | Ga0495583_0063913 | |||
| 2159 | Ga0495583_0087871 | |||
| 2160 | Ga0495583_0138545 | |||
| 2161 | Ga0495606_0000011 | |||
| 2162 | Ga0495606_0000064 | |||
| 2163 | Ga0495606_0001147 | |||
| 2164 | Ga0495606_0001181 | |||
| 2165 | Ga0495606_0006161 | |||
| 2166 | Ga0495606_0009081 | |||
| 2167 | Ga0495606_0013368 | |||
| 2168 | Ga0495606_0014662 | |||
| 2169 | Ga0495606_0014803 | |||
| 2170 | Ga0495606_0026334 | |||
| 2171 | Ga0495606_0036164 | |||
| 2172 | Ga0495606_0037676 | |||
| 2173 | Ga0495606_0038517 | |||
| 2174 | Ga0495606_0084712 | |||
| 2175 | Ga0495606_0145115 | |||
| 2176 | Ga0495606_0151684 | |||
| 2177 | Ga0495606_0200207 | |||
| 2178 | Ga0495610_0000003 | |||
| 2179 | Ga0495610_0000873 | |||
| 2180 | Ga0495610_0001162 | |||
| 2181 | Ga0495610_0008688 | |||
| 2182 | Ga0495616_0000272 | |||
| 2183 | Ga0495616_0000343 | |||
| 2184 | Ga0495616_0000680 | |||
| 2185 | Ga0495616_0001661 | |||
| 2186 | Ga0495616_0003238 | |||
| 2187 | Ga0495616_0009292 | |||
| 2188 | Ga0495616_0009654 | |||
| 2189 | Ga0495616_0012631 | |||
| 2190 | Ga0495616_0013294 | |||
| 2191 | Ga0495616_0028258 | |||
| 2192 | Ga0495616_0031645 | |||
| 2193 | Ga0495616_0045896 | |||
| 2194 | Ga0495616_0056668 | |||
| 2195 | Ga0495616_0064979 | |||
| 2196 | Ga0495616_0125523 | |||
| 2197 | Ga0495616_0139171 | |||
| 2198 | Ga0495620_0003145 | |||
| 2199 | Ga0495630_0017831 | |||
| 2200 | Ga0495631_0000983 | |||
| 2201 | Ga0495631_0002105 | |||
| 2202 | Ga0495631_0003385 | |||
| 2203 | Ga0495631_0005046 | |||
| 2204 | Ga0495631_0006876 | |||
| 2205 | Ga0495631_0007988 | |||
| 2206 | Ga0495631_0016269 | |||
| 2207 | Ga0495631_0039469 | |||
| 2208 | Ga0495631_0044435 | |||
| 2209 | Ga0495631_0072699 | |||
| 2210 | Ga0495631_0141351 | |||
| 2211 | Ga0495632_0000062 | |||
| 2212 | Ga0495632_0000235 | |||
| 2213 | Ga0495632_0000901 | |||
| 2214 | Ga0495632_0002631 | |||
| 2215 | Ga0495632_0007247 | |||
| 2216 | Ga0495632_0009591 | |||
| 2217 | Ga0495632_0019389 | |||
| 2218 | Ga0495637_0000004 | |||
| 2219 | Ga0495637_0000482 | |||
| 2220 | Ga0495637_0005727 | |||
| 2221 | Ga0495637_0022968 | |||
| 2222 | Ga0495637_0058812 | |||
| 2223 | Ga0495637_0085828 | |||
| 2224 | Ga0495637_0132682 | |||
| 2225 | Ga0495643_0000123 | |||
| 2226 | Ga0495643_0000170 | |||
| 2227 | Ga0495643_0000969 | |||
| 2228 | Ga0495643_0001637 | |||
| 2229 | Ga0495643_0004001 | |||
| 2230 | Ga0495643_0007137 | |||
| 2231 | Ga0495643_0011059 | |||
| 2232 | Ga0495643_0014320 | |||
| 2233 | Ga0495643_0173562 | |||
| 2234 | Ga0495643_0195476 | |||
| 2235 | Ga0495644_0003684 | |||
| 2236 | Ga0495644_0003719 | |||
| 2237 | Ga0495644_0006986 | |||
| 2238 | Ga0495644_0008087 | |||
| 2239 | Ga0495644_0008241 | |||
| 2240 | Ga0495644_0010379 | |||
| 2241 | Ga0495644_0021058 | |||
| 2242 | Ga0495644_0022081 | |||
| 2243 | Ga0495644_0022349 | |||
| 2244 | Ga0495644_0044530 | |||
| 2245 | Ga0495644_0144985 | |||
| 2246 | Ga0495644_0164084 | |||
| 2247 | Ga0495648_0000001 | |||
| 2248 | Ga0495648_0000109 | |||
| 2249 | Ga0495648_0000541 | |||
| 2250 | Ga0495648_0002349 | |||
| 2251 | Ga0495648_0013051 | |||
| 2252 | Ga0495648_0018771 | |||
| 2253 | Ga0495648_0027536 | |||
| 2254 | Ga0495648_0033572 | |||
| 2255 | Ga0495648_0041132 | |||
| 2256 | Ga0495648_0088906 | |||
| 2257 | Ga0495648_0130402 | |||
| 2258 | Ga0495648_0132888 | |||
| 2259 | Ga0495648_0164941 | |||
| 2260 | Ga0495648_0174124 | |||
| 2261 | Ga0495648_0175834 | |||
| 2262 | Ga0495663_0004570 | |||
| 2263 | Ga0495663_0043379 | |||
| 2264 | Ga0495663_0073136 | |||
| 2265 | Ga0495663_0311424 | |||
| 2266 | Ga0495666_0000975 | |||
| 2267 | Ga0495666_0001244 | |||
| 2268 | Ga0495666_0022762 | |||
| 2269 | Ga0495666_0024822 | |||
| 2270 | Ga0495666_0088051 | |||
| 2271 | Ga0495642_0000196 | |||
| 2272 | Ga0495642_0002912 | |||
| 2273 | Ga0495642_0003623 | |||
| 2274 | Ga0495642_0006116 | |||
| 2275 | Ga0495642_0008553 | |||
| 2276 | Ga0495642_0008675 | |||
| 2277 | Ga0495642_0008881 | |||
| 2278 | Ga0495642_0018690 | |||
| 2279 | Ga0495642_0020087 | |||
| 2280 | Ga0495642_0021451 | |||
| 2281 | Ga0495642_0027433 | |||
| 2282 | Ga0495642_0032728 | |||
| 2283 | Ga0495642_0077602 | |||
| 2284 | Ga0495642_0088316 | |||
| 2285 | Ga0495642_0101537 | |||
| 2286 | Ga0495642_0116714 | |||
| 2287 | Ga0495642_0205702 | |||
| 2288 | Ga0495642_0232419 | |||
| 2289 | Ga0495652_0020052 | |||
| 2290 | Ga0495654_0000038 | |||
| 2291 | Ga0495654_0002038 | |||
| 2292 | Ga0495654_0011618 | |||
| 2293 | Ga0495654_0019835 | |||
| 2294 | Ga0495654_0049466 | |||
| 2295 | Ga0495654_0052082 | |||
| 2296 | Ga0495654_0062661 | |||
| 2297 | Ga0495654_0084811 | |||
| 2298 | Ga0495665_0004075 | |||
| 2299 | Ga0495665_0018192 | |||
| 2300 | Ga0495665_0022051 | |||
| 2301 | Ga0495665_0030374 | |||
| 2302 | Ga0495665_0136960 | |||
| 2303 | Ga0495665_0237927 | |||
| 2304 | Ga0495665_0621341 | |||
| 2305 | Ga0495640_0096951 | |||
| 2306 | Ga0495586_0010365 | |||
| 2307 | Ga0495586_0014931 | |||
| 2308 | Ga0495586_0197549 | |||
| 2309 | Ga0495586_0427977 | |||
| 2310 | Ga0495587_0094550 | |||
| 2311 | Ga0495587_0241029 | |||
| 2312 | Ga0495587_0331613 | |||
| 2313 | Ga0495598_0012534 | |||
| 2314 | Ga0495609_0000009 | |||
| 2315 | Ga0495609_0000636 | |||
| 2316 | Ga0495609_0003073 | |||
| 2317 | Ga0495609_0003510 | |||
| 2318 | Ga0495609_0003925 | |||
| 2319 | Ga0495609_0006181 | |||
| 2320 | Ga0495609_0010588 | |||
| 2321 | Ga0495609_0012139 | |||
| 2322 | Ga0495609_0018688 | |||
| 2323 | Ga0495609_0021303 | |||
| 2324 | Ga0495609_0023305 | |||
| 2325 | Ga0495609_0104995 | |||
| 2326 | Ga0495609_0107807 | |||
| 2327 | Ga0495609_0110710 | |||
| 2328 | Ga0495609_0194205 | |||
| 2329 | Ga0495609_0216406 | |||
| 2330 | Ga0495621_0207430 | |||
| 2331 | Ga0495597_0001393 | |||
| 2332 | Ga0495597_0001520 | |||
| 2333 | Ga0495597_0001796 | |||
| 2334 | Ga0495597_0002277 | |||
| 2335 | Ga0495597_0004290 | |||
| 2336 | Ga0495597_0005992 | |||
| 2337 | Ga0495597_0007074 | |||
| 2338 | Ga0495597_0011554 | |||
| 2339 | Ga0495597_0013569 | |||
| 2340 | Ga0495597_0028551 | |||
| 2341 | Ga0495597_0035996 | |||
| 2342 | Ga0495597_0062840 | |||
| 2343 | Ga0495597_0067467 | |||
| 2344 | Ga0495597_0091483 | |||
| 2345 | Ga0495597_0197927 | |||
| 2346 | Ga0495645_0125435 | |||
| 2347 | Ga0495645_0176359 | |||
| 2348 | Ga0495622_0000028 | |||
| 2349 | Ga0495622_0000398 | |||
| 2350 | Ga0495622_0028161 | |||
| 2351 | Ga0495622_0091127 | |||
| 2352 | Ga0495622_0108925 | |||
| 2353 | Ga0495622_0226951 | |||
| 2354 | Ga0495622_0292540 | |||
| 2355 | Ga0495622_0411964 | |||
| 2356 | Ga0495633_0002074 | |||
| 2357 | Ga0495633_0002390 | |||
| 2358 | Ga0495633_0004129 | |||
| 2359 | Ga0495633_0007239 | |||
| 2360 | Ga0495633_0008374 | |||
| 2361 | Ga0495633_0015513 | |||
| 2362 | Ga0495633_0016604 | |||
| 2363 | Ga0495633_0016656 | |||
| 2364 | Ga0495633_0018775 | |||
| 2365 | Ga0495633_0028145 | |||
| 2366 | Ga0495633_0034928 | |||
| 2367 | Ga0495633_0036808 | |||
| 2368 | Ga0495633_0069418 | |||
| 2369 | Ga0495633_0077381 | |||
| 2370 | Ga0495633_0107297 | |||
| 2371 | Ga0495633_0132449 | |||
| 2372 | Ga0495633_0182335 | |||
| 2373 | Ga0495633_0334694 | |||
| 2374 | Ga0495633_0540313 | |||
| 2375 | Ga0495667_0301968 | |||
| 2376 | Ga0495656_0003737 | |||
| 2377 | Ga0495656_0015862 | |||
| 2378 | Ga0495656_0043073 | |||
| 2379 | Ga0495656_0048042 | |||
| 2380 | Ga0495656_0120080 | |||
| 2381 | Ga0495668_0000048 | |||
| 2382 | Ga0495668_0001362 | |||
| 2383 | Ga0495668_0002401 | |||
| 2384 | Ga0495668_0002455 | |||
| 2385 | Ga0495668_0004786 | |||
| 2386 | Ga0495668_0005220 | |||
| 2387 | Ga0495668_0007462 | |||
| 2388 | Ga0495668_0010370 | |||
| 2389 | Ga0495668_0013225 | |||
| 2390 | Ga0495668_0013802 | |||
| 2391 | Ga0495668_0022879 | |||
| 2392 | Ga0495668_0025705 | |||
| 2393 | Ga0495668_0026212 | |||
| 2394 | Ga0495668_0027856 | |||
| 2395 | Ga0495668_0031057 | |||
| 2396 | Ga0495668_0045217 | |||
| 2397 | Ga0495668_0069580 | |||
| 2398 | Ga0495668_0151893 | |||
| 2399 | Ga0495668_0184006 | |||
| 2400 | Ga0495668_0531138 | |||
| 2401 | Ga0495634_0003145 | |||
| 2402 | Ga0495634_0052778 | |||
| 2403 | Ga0495611_0003052 | |||
| 2404 | Ga0495611_0004232 | |||
| 2405 | Ga0495611_0005048 | |||
| 2406 | Ga0495611_0007604 | |||
| 2407 | Ga0495611_0034181 | |||
| 2408 | Ga0495611_0048649 | |||
| 2409 | Ga0495611_0052940 | |||
| 2410 | Ga0495611_0062572 | |||
| 2411 | Ga0495611_0098119 | |||
| 2412 | Ga0495611_0124226 | |||
| 2413 | Ga0495611_0185804 | |||
| 2414 | Ga0495611_0269588 | |||
| 2415 | Ga0495611_0328188 | |||
| 2416 | Ga0495611_0357724 | |||
| 2417 | Ga0495611_0448255 | |||
| 2418 | Ga0495625_0000164 | |||
| 2419 | Ga0495625_0005794 | |||
| 2420 | Ga0495625_0009364 | |||
| 2421 | Ga0495625_0009819 | |||
| 2422 | Ga0495625_0015487 | |||
| 2423 | Ga0495625_0018254 | |||
| 2424 | Ga0495625_0021196 | |||
| 2425 | Ga0495625_0029832 | |||
| 2426 | Ga0495625_0038200 | |||
| 2427 | Ga0495625_0046986 | |||
| 2428 | Ga0495625_0069612 | |||
| 2429 | Ga0495625_0100232 | |||
| 2430 | Ga0495625_0245382 | |||
| 2431 | Ga0495625_0453458 | |||
| 2432 | Ga0495625_0566492 | |||
| 2433 | Ga0495635_0006579 | |||
| 2434 | Ga0495635_0619974 | |||
| 2435 | Ga0495659_0000289 | |||
| 2436 | Ga0495659_0001247 | |||
| 2437 | Ga0495659_0009392 | |||
| 2438 | Ga0495659_0069126 | |||
| 2439 | Ga0495659_0123825 | |||
| 2440 | Ga0495661_0000368 | |||
| 2441 | Ga0495661_0001167 | |||
| 2442 | Ga0495661_0002363 | |||
| 2443 | Ga0495661_0006427 | |||
| 2444 | Ga0495661_0012089 | |||
| 2445 | Ga0495661_0015517 | |||
| 2446 | Ga0495661_0019494 | |||
| 2447 | Ga0495661_0023664 | |||
| 2448 | Ga0495661_0029376 | |||
| 2449 | Ga0495661_0037274 | |||
| 2450 | Ga0495661_0040171 | |||
| 2451 | Ga0495661_0052747 | |||
| 2452 | Ga0495661_0067409 | |||
| 2453 | Ga0495661_0072941 | |||
| 2454 | Ga0495661_0083536 | |||
| 2455 | Ga0495661_0103370 | |||
| 2456 | Ga0495661_0104872 | |||
| 2457 | Ga0495661_0124413 | |||
| 2458 | Ga0495661_0141254 | |||
| 2459 | Ga0495661_0147861 | |||
| 2460 | Ga0495661_0235293 | |||
| 2461 | Ga0495661_0256340 | |||
| 2462 | Ga0495661_0267876 | |||
| 2463 | Ga0495588_0000077 | |||
| 2464 | Ga0495588_0035172 | |||
| 2465 | Ga0495588_0045378 | |||
| 2466 | Ga0495588_0064739 | |||
| 2467 | Ga0495588_0065381 | |||
| 2468 | Ga0495588_0071146 | |||
| 2469 | Ga0495588_0080651 | |||
| 2470 | Ga0495588_0109500 | |||
| 2471 | Ga0495588_0121903 | |||
| 2472 | Ga0495588_0123522 | |||
| 2473 | Ga0495588_0164135 | |||
| 2474 | Ga0495588_0173649 | |||
| 2475 | Ga0495588_0708148 | |||
| 2476 | Ga0495599_0266621 | |||
| 2477 | Ga0495623_0007712 | |||
| 2478 | Ga0495623_0027846 | |||
| 2479 | Ga0495623_0091002 | |||
| 2480 | Ga0495623_0220094 | |||
| 2481 | Ga0495646_0190750 | |||
| 2482 | Ga0495669_0000217 | |||
| 2483 | Ga0495669_0001851 | |||
| 2484 | Ga0495669_0010502 | |||
| 2485 | Ga0495669_0017194 | |||
| 2486 | Ga0495669_0033212 | |||
| 2487 | Ga0495669_0036868 | |||
| 2488 | Ga0495669_0053078 | |||
| 2489 | Ga0495669_0538708 | |||
| 2490 | Ga0495613_0069142 | |||
| 2491 | Ga0495613_0793672 | |||
| 2492 | Ga0495624_0007752 | |||
| 2493 | Ga0495624_0340855 | |||
| 2494 | Ga0495670_0009961 | |||
| 2495 | Ga0495670_0021082 | |||
| 2496 | Ga0495670_0021157 | |||
| 2497 | Ga0495670_0022494 | |||
| 2498 | Ga0495670_0031986 | |||
| 2499 | Ga0495670_0034737 | |||
| 2500 | Ga0495670_0039198 | |||
| 2501 | Ga0495670_0195811 | |||
| 2502 | Ga0495670_0199854 | |||
| 2503 | Ga0495670_0274896 | |||
| 2504 | Ga0495670_0391270 | |||
| 2505 | Ga0495670_0408214 | |||
| 2506 | Ga0495670_0421933 | |||
| 2507 | Ga0495670_0464390 | |||
| 2508 | Ga0495670_0523431 | |||
| 2509 | Ga0495671_0000001 | |||
| 2510 | Ga0495671_0000744 | |||
| 2511 | Ga0495671_0000848 | |||
| 2512 | Ga0495671_0022004 | |||
| 2513 | Ga0495671_0023568 | |||
| 2514 | Ga0495671_0027348 | |||
| 2515 | Ga0495671_0028223 | |||
| 2516 | Ga0495671_0079765 | |||
| 2517 | Ga0495671_0112690 | |||
| 2518 | Ga0495671_0180502 | |||
| 2519 | Ga0495671_0397099 | |||
| 2520 | Ga0495649_0002149 | |||
| 2521 | Ga0495649_0007989 | |||
| 2522 | Ga0495649_0019739 | |||
| 2523 | Ga0495649_0031292 | |||
| 2524 | Ga0495649_0051556 | |||
| 2525 | Ga0495649_0133357 | |||
| 2526 | Ga0495649_0159202 | |||
| 2527 | Ga0495649_0206303 | |||
| 2528 | Ga0495649_0218901 | |||
| 2529 | Ga0495589_0000037 | |||
| 2530 | Ga0495589_0001177 | |||
| 2531 | Ga0495589_0001260 | |||
| 2532 | Ga0495589_0010118 | |||
| 2533 | Ga0495589_0014498 | |||
| 2534 | Ga0495589_0017796 | |||
| 2535 | Ga0495589_0026334 | |||
| 2536 | Ga0495589_0038794 | |||
| 2537 | Ga0495589_0042313 | |||
| 2538 | Ga0495589_0085592 | |||
| 2539 | Ga0495589_0163846 | |||
| 2540 | Ga0495589_0180011 | |||
| 2541 | Ga0495589_0241467 | |||
| 2542 | Ga0495600_0002155 | |||
| 2543 | Ga0495600_0104154 | |||
| 2544 | Ga0495660_0000178 | |||
| 2545 | Ga0495660_0001476 | |||
| 2546 | Ga0495660_0003120 | |||
| 2547 | Ga0495660_0003323 | |||
| 2548 | Ga0495660_0017672 | |||
| 2549 | Ga0495660_0022155 | |||
| 2550 | Ga0495660_0043740 | |||
| 2551 | Ga0495660_0044082 | |||
| 2552 | Ga0495660_0059138 | |||
| 2553 | Ga0495660_0095189 | |||
| 2554 | Ga0495660_0118619 | |||
| 2555 | Ga0495660_0124887 | |||
| 2556 | Ga0495660_0128231 | |||
| 2557 | Ga0495581_0008712 | |||
| 2558 | Ga0495581_0066676 | |||
| 2559 | Ga0495581_0078795 | |||
| 2560 | Ga0495581_0287595 | |||
| 2561 | Ga0495604_0036530 | |||
| 2562 | Ga0495604_0085661 | |||
| 2563 | Ga0495604_0148305 | |||
| 2564 | Ga0495604_0192669 | |||
| 2565 | Ga0495604_0223117 | |||
| 2566 | Ga0495604_0262021 | |||
| 2567 | Ga0495636_0006148 | |||
| 2568 | Ga0495636_0012768 | |||
| 2569 | Ga0495636_0017608 | |||
| 2570 | Ga0495636_0069736 | |||
| 2571 | Ga0495636_0087023 | |||
| 2572 | Ga0495636_0094728 | |||
| 2573 | Ga0495636_0104862 | |||
| 2574 | Ga0495636_0180386 | |||
| 2575 | Ga0495636_0367497 | |||
| 2576 | Ga0495636_0445788 | |||
| 2577 | Ga0495674_0003394 | |||
| 2578 | Ga0495674_0784125 | |||
| 2579 | Ga0495672_0000097 | |||
| 2580 | Ga0495672_0000424 | |||
| 2581 | Ga0495672_0000590 | |||
| 2582 | Ga0495672_0000758 | |||
| 2583 | Ga0495672_0001440 | |||
| 2584 | Ga0495672_0001672 | |||
| 2585 | Ga0495672_0002152 | |||
| 2586 | Ga0495672_0011872 | |||
| 2587 | Ga0495672_0098796 | |||
| 2588 | Ga0495672_0108065 | |||
| 2589 | Ga0495676_0000342 | |||
| 2590 | Ga0495676_0014902 | |||
| 2591 | Ga0495676_0077540 | |||
| 2592 | Ga0495676_0108382 | |||
| 2593 | Ga0495676_0123990 | |||
| 2594 | Ga0495676_0169465 | |||
| 2595 | Ga0495676_0202693 | |||
| 2596 | Ga0495680_0005344 | |||
| 2597 | Ga0495680_0086272 | |||
| 2598 | Ga0495680_0909474 | |||
| 2599 | Ga0495683_0000144 | |||
| 2600 | Ga0495683_0000952 | |||
| 2601 | Ga0495683_0001039 | |||
| 2602 | Ga0495683_0016641 | |||
| 2603 | Ga0495683_0017608 | |||
| 2604 | Ga0495683_0029959 | |||
| 2605 | Ga0495683_0035711 | |||
| 2606 | Ga0495683_0087662 | |||
| 2607 | Ga0495683_0095436 | |||
| 2608 | Ga0495683_0169338 | |||
| 2609 | Ga0495687_000002 | |||
| 2610 | Ga0495687_000017 | |||
| 2611 | Ga0495687_000024 | |||
| 2612 | Ga0495687_000148 | |||
| 2613 | Ga0495687_001539 | |||
| 2614 | Ga0495687_005580 | |||
| 2615 | Ga0495687_005608 | |||
| 2616 | Ga0495687_010840 | |||
| 2617 | Ga0495687_015538 | |||
| 2618 | Ga0495687_029001 | |||
| 2619 | Ga0495687_076171 | |||
| 2620 | Ga0495675_0002413 | |||
| 2621 | Ga0495675_0004400 | |||
| 2622 | Ga0495675_0147236 | |||
| 2623 | Ga0495677_0000011 | |||
| 2624 | Ga0495677_0000979 | |||
| 2625 | Ga0495677_0001358 | |||
| 2626 | Ga0495677_0003050 | |||
| 2627 | Ga0495677_0004099 | |||
| 2628 | Ga0495677_0006130 | |||
| 2629 | Ga0495677_0007985 | |||
| 2630 | Ga0495677_0011203 | |||
| 2631 | Ga0495677_0016146 | |||
| 2632 | Ga0495677_0074320 | |||
| 2633 | Ga0495677_0139302 | |||
| 2634 | Ga0495677_0141551 | |||
| 2635 | Ga0495677_0149027 | |||
| 2636 | Ga0495677_0165097 | |||
| 2637 | Ga0495679_003113 | |||
| 2638 | Ga0495679_003957 | |||
| 2639 | Ga0495679_009988 | |||
| 2640 | Ga0495679_016017 | |||
| 2641 | Ga0495679_017414 | |||
| 2642 | Ga0495679_050542 | |||
| 2643 | Ga0495685_000077 | |||
| 2644 | Ga0495685_006760 | |||
| 2645 | Ga0495685_010360 | |||
| 2646 | Ga0495685_024841 | |||
| 2647 | Ga0495685_034772 | |||
| 2648 | Ga0495685_095119 | |||
| 2649 | Ga0495685_175374 | |||
| 2650 | Ga0495673_0000003 | |||
| 2651 | Ga0495673_0000097 | |||
| 2652 | Ga0495673_0000100 | |||
| 2653 | Ga0495673_0002730 | |||
| 2654 | Ga0495673_0010183 | |||
| 2655 | Ga0495681_0002294 | |||
| 2656 | Ga0495681_0002968 | |||
| 2657 | Ga0495681_0007086 | |||
| 2658 | Ga0495681_0009449 | |||
| 2659 | Ga0495681_0011139 | |||
| 2660 | Ga0495681_0011368 | |||
| 2661 | Ga0495681_0011590 | |||
| 2662 | Ga0495681_0014249 | |||
| 2663 | Ga0495681_0020183 | |||
| 2664 | Ga0495681_0020331 | |||
| 2665 | Ga0495681_0048194 | |||
| 2666 | Ga0495681_0155420 | |||
| 2667 | Ga0495686_0000428 | |||
| 2668 | Ga0495686_0001462 | |||
| 2669 | Ga0495686_0001479 | |||
| 2670 | Ga0495686_0003365 | |||
| 2671 | Ga0495686_0008053 | |||
| 2672 | Ga0495686_0049892 | |||
| 2673 | Ga0495686_0121758 | |||
| 2674 | Ga0495686_0184539 | |||
| 2675 | Ga0495686_0189731 | |||
| 2676 | Ga0495686_0228281 | |||
| 2677 | Ga0495686_0293147 | |||
| 2678 | Ga0495686_0377640 | |||
| 2679 | Ga0495593_0002473 | |||
| 2680 | Ga0495593_0021073 | |||
| 2681 | Ga0495593_0128819 | |||
| 2682 | Ga0495602_0086299 | |||
| 2683 | Ga0495602_0128484 | |||
| 2684 | Ga0495602_0459422 | |||
| 2685 | Ga0495614_0002563 | |||
| 2686 | Ga0495614_0162459 | |||
| 2687 | Ga0495614_0181823 | |||
| 2688 | Ga0495614_0205280 | |||
| 2689 | Ga0495614_0251407 | |||
| 2690 | Ga0495615_0000530 | |||
| 2691 | Ga0495615_0080961 | |||
| 2692 | Ga0495626_0000004 | |||
| 2693 | Ga0495626_0000016 | |||
| 2694 | Ga0495626_0000569 | |||
| 2695 | Ga0495626_0005849 | |||
| 2696 | Ga0495626_0008239 | |||
| 2697 | Ga0495626_0009582 | |||
| 2698 | Ga0495626_0027385 | |||
| 2699 | Ga0495626_0033635 | |||
| 2700 | Ga0495626_0040645 | |||
| 2701 | Ga0495626_0054570 | |||
| 2702 | Ga0495626_0069092 | |||
| 2703 | Ga0495626_0091745 | |||
| 2704 | Ga0495626_0092145 | |||
| 2705 | Ga0495626_0118149 | |||
| 2706 | Ga0495626_0176147 | |||
| 2707 | Ga0496100_0004475 | |||
| 2708 | Ga0496100_0266561 | |||
| 2709 | Ga0496100_0332721 | |||
| 2710 | Ga0496100_0380203 | |||
| 2711 | Ga0496101_0106911 | |||
| 2712 | Ga0496101_0108970 | |||
| 2713 | Ga0496101_0702507 | |||
| 2714 | Ga0496101_0820075 | |||
| 2715 | Ga0496102_0000461 | |||
| 2716 | Ga0496102_0016630 | |||
| 2717 | Ga0496102_0020653 | |||
| 2718 | Ga0496102_0023210 | |||
| 2719 | Ga0496102_0040178 | |||
| 2720 | Ga0496102_0069033 | |||
| 2721 | Ga0496102_0076786 | |||
| 2722 | Ga0496102_0178602 | |||
| 2723 | Ga0496102_0205505 | |||
| 2724 | Ga0496102_0760861 | |||
| 2725 | Ga0496102_0941197 | |||
| 2726 | Ga0496102_1447319 | |||
| 2727 | Ga0496103_0001321 | |||
| 2728 | Ga0496103_0002752 | |||
| 2729 | Ga0496103_0006660 | |||
| 2730 | Ga0496103_0007974 | |||
| 2731 | Ga0496103_0045259 | |||
| 2732 | Ga0496103_0143904 | |||
| 2733 | Ga0496104_0616755 | |||
| 2734 | Ga0496104_0668275 | |||
| 2735 | Ga0496104_1316698 | |||
| 2736 | Ga0496105_0077123 | |||
| 2737 | Ga0496105_0113339 | |||
| 2738 | Ga0496105_0747240 | |||
| 2739 | Ga0496106_0230450 | |||
| 2740 | Ga0496106_0268693 | |||
| 2741 | Ga0496107_0021795 | |||
| 2742 | Ga0496108_0010622 | |||
| 2743 | Ga0496108_0023299 | |||
| 2744 | Ga0496108_0394878 | |||
| 2745 | Ga0496108_0483826 | |||
| 2746 | Ga0496109_0081610 | |||
| 2747 | Ga0496109_0149594 | |||
| 2748 | Ga0496109_0321254 | |||
| 2749 | Ga0496109_0656844 | |||
| 2750 | Ga0496109_1427618 | |||
| 2751 | Ga0496110_0000019 | |||
| 2752 | Ga0496110_0003499 | |||
| 2753 | Ga0496110_0807477 | |||
| 2754 | Ga0496111_0031224 | |||
| 2755 | Ga0496111_0246770 | |||
| 2756 | Ga0496112_0032351 | |||
| 2757 | Ga0496112_0037388 | |||
| 2758 | Ga0496112_0037948 | |||
| 2759 | Ga0496112_0246092 | |||
| 2760 | Ga0496112_0252691 | |||
| 2761 | Ga0496112_1095950 | |||
| 2762 | Ga0496113_0037686 | |||
| 2763 | Ga0496113_0123029 | |||
| 2764 | Ga0496113_0328300 | |||
| 2765 | Ga0496113_0421049 | |||
| 2766 | Ga0496113_0738842 | |||
| 2767 | Ga0496113_0782382 | |||
| 2768 | Ga0496114_0436287 | |||
| 2769 | Ga0496114_0475759 | |||
| 2770 | Ga0496114_0532190 | |||
| 2771 | Ga0496115_0011854 | |||
| 2772 | Ga0496115_0034428 | |||
| 2773 | Ga0496115_0060772 | |||
| 2774 | Ga0496115_0251481 | |||
| 2775 | Ga0496115_0282915 | |||
| 2776 | Ga0496115_0712674 | |||
| 2777 | Ga0496116_0039030 | |||
| 2778 | Ga0496116_0080004 | |||
| 2779 | Ga0496117_0000132 | |||
| 2780 | Ga0496118_0000099 | |||
| 2781 | Ga0496119_0321679 | |||
| 2782 | Ga0496120_0105101 | |||
| 2783 | Ga0496121_0080423 | |||
| 2784 | Ga0496121_0127464 | |||
| 2785 | Ga0496121_0210954 | |||
| 2786 | Ga0496121_0236303 | |||
| 2787 | Ga0496121_0615776 | |||
| 2788 | Ga0496122_0000835 | |||
| 2789 | Ga0496122_0001402 | |||
| 2790 | Ga0496122_0036243 | |||
| 2791 | Ga0496122_0477397 | |||
| 2792 | Ga0496123_0001003 | |||
| 2793 | Ga0496123_0004574 | |||
| 2794 | Ga0496123_0051903 | |||
| 2795 | Ga0496123_0053089 | |||
| 2796 | Ga0496123_0299454 | |||
| 2797 | Ga0496124_0008384 | |||
| 2798 | Ga0496124_0017479 | |||
| 2799 | Ga0496124_0041651 | |||
| 2800 | Ga0496124_0061626 | |||
| 2801 | Ga0496124_0118308 | |||
| 2802 | Ga0496124_0143321 | |||
| 2803 | Ga0496124_0173038 | |||
| 2804 | Ga0496124_0218266 | |||
| 2805 | Ga0496124_0295788 | |||
| 2806 | Ga0496124_0731909 | |||
| 2807 | Ga0496125_0001280 | |||
| 2808 | Ga0496125_0023719 | |||
| 2809 | Ga0496125_0381725 | |||
| 2810 | Ga0496126_0015539 | |||
| 2811 | Ga0501308_001629 | |||
| 2812 | Ga0501309_047482 | |||
| 2813 | Ga0501310_022591 | |||
| 2814 | Ga0501310_073953 | |||
| 2815 | Ga0501304_002381 | |||
| 2816 | Ga0501305_098766 | |||
| 2817 | Ga0501307_014325 | |||
| 2818 | Ga0501307_033547 | |||
| 2819 | Ga0495678_000004 | |||
| 2820 | Ga0495678_000384 | |||
| 2821 | Ga0495678_000515 | |||
| 2822 | Ga0495678_000866 | |||
| 2823 | Ga0495678_001499 | |||
| 2824 | Ga0495678_017736 | |||
| 2825 | Ga0495678_024378 | |||
| 2826 | Ga0495678_040952 | |||
| 2827 | Ga0495678_043619 | |||
| 2828 | Ga0495678_045351 | |||
| 2829 | Ga0495678_156665 | |||
| 2830 | Ga0495678_209202 | |||
| 2831 | Ga0495682_0000869 | |||
| 2832 | Ga0495682_0001115 | |||
| 2833 | Ga0495682_0006435 | |||
| 2834 | Ga0495682_0031927 | |||
| 2835 | Ga0501312_034371 | |||
| 2836 | Ga0501314_024195 | |||
| 2837 | Ga0501315_022278 | |||
| 2838 | Ga0501315_037778 | |||
| 2839 | Ga0501316_013762 | |||
| 2840 | Ga0501318_020502 | |||
| 2841 | Ga0501322_024908 | |||
| 2842 | Ga0501323_054399 | |||
| 2843 | Ga0501230_002780 | |||
| 2844 | Ga0501238_008754 | |||
| 2845 | Ga0501249_002892 | |||
| 2846 | Ga0501234_055166 | |||
| 2847 | Ga0501263_027310 | |||
| 2848 | Ga0501265_102468 | |||
| 2849 | Ga0501269_000099 | |||
| 2850 | Ga0501279_002296 | |||
| 2851 | Ga0501279_017123 | |||
| 2852 | Ga0501035_0000965 | |||
| 2853 | Ga0501220_04705 | |||
| 2854 | nmdc:mga03683_52564_c1 | |||
| 2855 | nmdc:mga0qj67_80226_c1 | |||
| 2856 | nmdc:mga08y16_312463_c1 | |||
| 2857 | nmdc:mga0n895_1047098_c1 | |||
| 2858 | nmdc:mga0n895_197141_c1 | |||
| 2859 | nmdc:mga0rr50_1700061_c1 | |||
| 2860 | nmdc:mga08x19_320078_c1 | |||
| 2861 | nmdc:mga08x19_8569_c1 | |||
| 2862 | nmdc:mga0a205_759673_c1 | |||
| 2863 | Ga0500647_0364579 | |||
| 2864 | Ga0500594_0024669 | |||
| 2865 | Ga0500618_000358 | |||
| 2866 | Ga0500618_035890 | |||
| 2867 | Ga0500586_027112 | |||
| 2868 | Ga0500622_0000001 | |||
| 2869 | Ga0587093_037672 | |||
| 2870 | Ga0587066_061325 | |||
| 2871 | Ga0587073_0052305 | |||
| 2872 | Ga0587077_036677 | |||
| 2873 | Ga0587080_003170 | |||
| 2874 | Ga0587080_031135 | |||
| 2875 | Ga0587088_048226 | |||
| 2876 | Ga0587090_041300 | |||
| 2877 | Ga0587091_088410 | |||
| 2878 | Ga0587094_056969 | |||
| 2879 | Ga0587098_052710 | |||
| 2880 | Ga0587106_023638 | |||
| 2881 | Ga0587129_024236 | |||
| 2882 | Ga0587099_051983 | |||
| 2883 | Ga0587101_024610 | |||
| 2884 | Ga0587115_053305 | |||
| 2885 | Ga0587117_035241 | |||
| 2886 | Ga0587062_061390 | |||
| 2887 | Ga0587062_068412 | |||
| 2888 | Ga0587068_003385 | |||
| 2889 | Ga0587068_138221 | |||
| 2890 | Ga0587069_004663 | |||
| 2891 | Ga0587075_024541 | |||
| 2892 | Ga0587076_036335 | |||
| 2893 | Ga0587079_042086 | |||
| 2894 | Ga0587102_045335 | |||
| 2895 | Ga0587105_007802 | |||
| 2896 | Ga0587107_073157 | |||
| 2897 | Ga0587124_019618 | |||
| 2898 | Ga0587071_061264 | |||
| 2899 | Ga0587111_0057014 | |||
| 2900 | Ga0587111_0084966 | |||
| 2901 | Ga0466962_0083668 | |||
| 2902 | Ga0466962_0114442 | |||
| 2903 | 2643786992 | |||
| 2904 | 2643802316 | |||
| 2905 | 2644215914 | |||
| 2906 | 2644254384 | |||
| 2907 | 2644357949 | |||
| 2908 | 2644475824 | |||
| 2909 | 2738741196 | |||
| 2910 | 2738829264 | |||
| 2911 | 2738845662 | |||
| 2912 | 2739153060 | |||
| 2913 | 2739194980 | |||
| 2914 | 2739277470 | |||
| 2915 | 2739321456 | |||
| 2916 | 2739339988 | |||
| 2917 | 2739346607 | |||
| 2918 | 2809145361 | |||
| 2919 | 2821131543 | |||
| 2920 | 2842718111 | |||
| 2921 | 2857554423 | |||
| 2922 | 2857563850 | |||
| 2923 | 2857564791 | |||
| 2924 | 2904426082 | |||
| 2925 | 2919478473 | |||
| 2926 | 8047673826 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kny-assembly1.cif.gz_A | crystal structure of the response regulator kdpe complexed to dna in an active-like conformation | 0.954 | 8 | 126 |
| 2qzj-assembly5.cif.gz_E | crystal structure of a two-component response regulator from clostridium difficile | 0.9516 | 9 | 126 |
| 3dzd-assembly1.cif.gz_B | crystal structure of sigma54 activator ntrc4 in the inactive state | 0.9508 | 10 | 128 |
| 5m7n-assembly1.cif.gz_B | crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology | 0.9502 | 8 | 137 |
| 5m7o-assembly1.cif.gz_B | crystal structure of ntrx from brucella abortus processed with the crystaldirect automated mounting and cryo-cooling technology | 0.9501 | 8 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVQ9_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.952 | 10 | 85 | 3.40.50.2300 |
| 3dzdB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9513 | 10 | 129 | 3.40.50.2300 |
| 5m7oA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9483 | 8 | 137 | 3.40.50.2300 |
| 3nhzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.947 | 9 | 122 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9465 | 9 | 87 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6M0H3-F1-model_v4 | DNA-binding response regulator | 0.9691 | 7 | 118 |
GO:0000160
GO:0003677 |
| AF-A0A832MF14-F1-model_v4 | Response regulator | 0.9654 | 8 | 126 |
GO:0000160
|
| AF-A0A679HR12-F1-model_v4 | Response regulator | 0.965 | 9 | 127 |
GO:0000160
|
| AF-A0A2V5MZM0-F1-model_v4 | Response regulatory domain-containing protein | 0.9636 | 8 | 125 |
GO:0000160
|
| AF-A0A2D6G530-F1-model_v4 | Response regulator | 0.9625 | 8 | 125 |
GO:0000160
|