F494142

General Info

Members Datasets Scaffolds Average Seq Length
1463 454 2926 133

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10281142|Ga0207665_102811422
Length 145
Sequence MADPKMRFLVVDDFSTMRRIVRNLLKELGYANVDEAEDGVMALAKLRSESFDFVVSDWNMPNMDGLTMLQNIRADPALAKLPVLMVTAEAKKENIIAAAQAGANGYVSKNLPIEQLYCVLARILATCQQRKRGVPNSEPVLAGAA

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
188 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
191 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
192 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
193 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
223 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
224 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
225 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
228 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
229 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
230 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
267 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
268 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
269 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
270 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
292 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
325 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
329 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
330 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
331 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
332 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
333 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
334 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
335 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
336 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
337 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
343 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
344 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
345 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
346 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
347 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
348 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
349 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
355 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
356 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
357 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
358 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
361 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
362 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
363 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
364 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
365 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
372 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
373 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
381 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
382 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
383 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
384 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
385 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
386 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
387 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
388 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
396 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
397 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
398 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
399 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
400 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
401 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
402 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
431 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
432 2643221556 Massilia sp. Root1485 Isolate Unclassified
433 2643221638 Duganella sp. Root336D2 Isolate Unclassified
434 2643221645 Massilia sp. Root351 Isolate Unclassified
435 2643221664 Massilia sp. Root418 Isolate Unclassified
436 2643221684 Massilia sp. Root133 Isolate Unclassified
437 2738541280 Massilia sp. GV090 Isolate Unclassified
438 2738541297 Duganella sp. GV083 Isolate Unclassified
439 2738541300 Massilia sp. GV016 Isolate Unclassified
440 2738541357 Duganella sp. GV053 Isolate Unclassified
441 2738543003 Duganella sp. GV066 Isolate Unclassified
442 2738543018 Massilia sp. GV045 Isolate Unclassified
443 2738543026 Duganella sp. GV089 Isolate Unclassified
444 2738543029 Duganella sp. GV039 Isolate Unclassified
445 2738543030 Massilia sp. GV097 Isolate Unclassified
446 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
447 2821131069 Duganella sp. 1224 Isolate Unclassified
448 2842711865 Duganella sp. R-73148 Isolate Unclassified
449 2857553236 Duganella sp. R-74557 Isolate Unclassified
450 2857558681 Duganella sp. R-74565 Isolate Unclassified
451 2857564685 Duganella sp. R-74599 Isolate Unclassified
452 2904424332 Duganella sp. 1411 Isolate Rhizosphere
453 2919476304 Duganella sp. 3397 Isolate Unclassified
454 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.6
Metatranscriptomes 3.76
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.84
Nodule 0.27
Rhizoplane 4.85
Rhizosphere 83.46
Stem 0
Stem Tuber 0
Unclassified 5.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10281142 3300025939 Bacteria 1238
2 MRS1b_contig_3883174 2162886011 Bacteria 873
3 CNXas_1000109 3300000545 Bacteria 15185
4 JGI25154J39366_1001666 3300002738 Bacteria 7369
5 JGI25158J39367_1016024 3300002739 Bacteria 950
6 JGI25158J39367_1026400 3300002739 Bacteria 678
7 JGI25152J39213_1000395 3300002773 Bacteria 26530
8 JGI25152J39213_1021195 3300002773 Bacteria 1144
9 JGI25150J39212_1001869 3300002774 Bacteria 5551
10 JGI25150J39212_1003324 3300002774 Bacteria 3787
11 JGI25159J45721_1004182 3300002987 Bacteria 4878
12 JGI25159J45721_1007879 3300002987 Bacteria 2996
13 JGI25159J45721_1008010 3300002987 Bacteria 2955
14 Ga0006759J45824_1074564 3300003163 Bacteria 691
15 JGI25151J46595_10143722 3300003187 Bacteria 578
16 JGI25406J46586_10000011 3300003203 Bacteria 104720
17 JGI25153J46596_10016332 3300003215 Bacteria 2979
18 Ga0006770J48903_1038274 3300003305 Bacteria 562
19 rootL2_10109828 3300003322 Bacteria 4438
20 JGI25160J50197_1012431 3300003354 Bacteria 2955
21 JGI25161J50226_1004160 3300003374 Bacteria 3096
22 JGI25161J50226_1006147 3300003374 Bacteria 2216
23 JGI25161J50226_1008312 3300003374 Bacteria 1612
24 Ga0007417J51691_1055251 3300003544 Bacteria 824
25 Ga0007409J51694_1016091 3300003575 Bacteria 1464
26 Ga0055525_1000001 3300003759 Bacteria 1016948
27 Ga0055529_1000146 3300003763 Bacteria 100947
28 Ga0055526_1000074 3300003771 Bacteria 92854
29 Ga0055526_1000299 3300003771 Bacteria 41248
30 Ga0055526_1004222 3300003771 Bacteria 8724
31 Ga0055526_1015299 3300003771 Bacteria 3088
32 Ga0055526_1030873 3300003771 Bacteria 1552
33 Ga0055537_1000154 3300003773 Bacteria 51753
34 Ga0055537_1020048 3300003773 Bacteria 1024
35 Ga0055524_1000021 3300003775 Bacteria 227578
36 Ga0055524_1000099 3300003775 Bacteria 107171
37 Ga0055524_1009788 3300003775 Bacteria 3867
38 Ga0055524_1020989 3300003775 Bacteria 2181
39 Ga0055534_1000513 3300003784 Bacteria 20944
40 Ga0055534_1037235 3300003784 Bacteria 728
41 Ga0055534_1046031 3300003784 Bacteria 630
42 Ga0055528_1007230 3300003790 Bacteria 4933
43 Ga0055528_1027547 3300003790 Bacteria 1595
44 Ga0055530_10101324 3300003791 Bacteria 578
45 Ga0055530_10104705 3300003791 Bacteria 564
46 Ga0055531_10003560 3300003794 Bacteria 9889
47 Ga0055543_1002596 3300004625 Bacteria 5842
48 Ga0055543_1005900 3300004625 Bacteria 3053
49 Ga0055543_1026489 3300004625 Bacteria 1030
50 Ga0065165_1000055 3300005262 Bacteria 187003
51 Ga0065165_1003015 3300005262 Bacteria 12716
52 Ga0065165_1013829 3300005262 Bacteria 3175
53 Ga0065165_1031771 3300005262 Bacteria 1664
54 Ga0065165_1044818 3300005262 Bacteria 1292
55 Ga0065704_10301195 3300005289 Unclassified 885
56 Ga0065712_10098684 3300005290 Unclassified 2108
57 Ga0065712_10381451 3300005290 Bacteria 752
58 Ga0070676_10006530 3300005328 Bacteria 6232
59 Ga0070676_10027936 3300005328 Bacteria 3203
60 Ga0070676_10100217 3300005328 Bacteria 1788
61 Ga0070690_100159858 3300005330 Bacteria 1543
62 Ga0070690_100533002 3300005330 Unclassified 883
63 Ga0070690_101299440 3300005330 Unclassified 583
64 Ga0070670_100002302 3300005331 Bacteria 15736
65 Ga0070670_100006241 3300005331 Bacteria 10083
66 Ga0070670_100890794 3300005331 Unclassified 806
67 Ga0070666_10041425 3300005335 Bacteria 3078
68 Ga0070666_11129305 3300005335 Unclassified 583
69 Ga0070680_100113297 3300005336 Bacteria 2259
70 Ga0068868_100039996 3300005338 Bacteria 3647
71 Ga0070660_100045119 3300005339 Bacteria 3373
72 Ga0070689_100045940 3300005340 Bacteria 3364
73 Ga0070689_100209478 3300005340 Bacteria 1595
74 Ga0070661_100199014 3300005344 Bacteria 1530
75 Ga0070661_100571449 3300005344 Bacteria 912
76 Ga0070661_100887244 3300005344 Bacteria 735
77 Ga0070668_100012213 3300005347 Bacteria 6398
78 Ga0070668_101247694 3300005347 Unclassified 674
79 Ga0070669_100014990 3300005353 Bacteria 5525
80 Ga0070669_100050766 3300005353 Bacteria 3030
81 Ga0070675_100033029 3300005354 Bacteria 4192
82 Ga0070675_100327014 3300005354 Bacteria 1355
83 Ga0070671_100015082 3300005355 Bacteria 6241
84 Ga0070671_100022258 3300005355 Bacteria 5177
85 Ga0070671_100750893 3300005355 Unclassified 848
86 Ga0070671_101048816 3300005355 Unclassified 715
87 Ga0070674_100316035 3300005356 Unclassified 1250
88 Ga0070688_100001382 3300005365 Bacteria 12060
89 Ga0070688_100393804 3300005365 Bacteria 1024
90 Ga0070659_100016372 3300005366 Bacteria 5566
91 Ga0070659_101646324 3300005366 Bacteria 573
92 Ga0070667_100001152 3300005367 Bacteria 23990
93 Ga0070667_100037387 3300005367 Unclassified 4070
94 Ga0070667_100130998 3300005367 Bacteria 2189
95 Ga0070710_11084711 3300005437 Bacteria 587
96 Ga0070711_100309067 3300005439 Bacteria 1260
97 Ga0070708_100069853 3300005445 Bacteria 3159
98 Ga0070708_100095985 3300005445 Bacteria 2707
99 Ga0070708_100151113 3300005445 Bacteria 2159
100 Ga0070708_100678736 3300005445 Unclassified 970
101 Ga0070708_100993817 3300005445 Unclassified 787
102 Ga0070663_100487664 3300005455 Bacteria 1021
103 Ga0070663_100750009 3300005455 Unclassified 833
104 Ga0070678_100032818 3300005456 Bacteria 3597
105 Ga0070678_101004950 3300005456 Bacteria 767
106 Ga0070678_101026758 3300005456 Bacteria 759
107 Ga0070662_100166473 3300005457 Unclassified 1728
108 Ga0070662_100309108 3300005457 Bacteria 1286
109 Ga0068867_100830696 3300005459 Unclassified 826
110 Ga0068867_101237614 3300005459 Bacteria 687
111 Ga0070706_100000116 3300005467 Bacteria 97606
112 Ga0070706_100018698 3300005467 Bacteria 6389
113 Ga0070706_100030413 3300005467 Bacteria 4976
114 Ga0070706_100035119 3300005467 Bacteria 4629
115 Ga0070706_100394020 3300005467 Bacteria 1289
116 Ga0070706_101359080 3300005467 Bacteria 651
117 Ga0070706_101692047 3300005467 Unclassified 576
118 Ga0070707_100002729 3300005468 Bacteria 16791
119 Ga0070707_100024521 3300005468 Bacteria 5713
120 Ga0070707_100025365 3300005468 Bacteria 5623
121 Ga0070707_100025898 3300005468 Bacteria 5567
122 Ga0070707_100036840 3300005468 Bacteria 4669
123 Ga0070707_100040136 3300005468 Bacteria 4477
124 Ga0070707_100172499 3300005468 Bacteria 2107
125 Ga0070707_100174613 3300005468 Bacteria 2094
126 Ga0070707_100430691 3300005468 Bacteria 1279
127 Ga0070707_100634912 3300005468 Bacteria 1030
128 Ga0070707_101153467 3300005468 Bacteria 741
129 Ga0070698_100003134 3300005471 Bacteria 18214
130 Ga0070698_100010744 3300005471 Bacteria 9742
131 Ga0070698_100097143 3300005471 Unclassified 2922
132 Ga0070698_100521070 3300005471 Unclassified 1127
133 Ga0070698_101424514 3300005471 Unclassified 644
134 Ga0070699_100073974 3300005518 Bacteria 2964
135 Ga0070699_100121464 3300005518 Unclassified 2297
136 Ga0070699_100970298 3300005518 Bacteria 779
137 Ga0070679_101207007 3300005530 Bacteria 702
138 Ga0070697_100003060 3300005536 Bacteria 12826
139 Ga0070697_100004215 3300005536 Bacteria 11014
140 Ga0070697_100014381 3300005536 Bacteria 6216
141 Ga0070697_100045646 3300005536 Bacteria 3551
142 Ga0070697_100070956 3300005536 Unclassified 2856
143 Ga0070697_100171703 3300005536 Unclassified 1835
144 Ga0070697_100184858 3300005536 Unclassified 1767
145 Ga0070697_100362220 3300005536 Bacteria 1253
146 Ga0070697_101366158 3300005536 Bacteria 632
147 Ga0070672_100003958 3300005543 Bacteria 9661
148 Ga0070672_100311686 3300005543 Bacteria 1336
149 Ga0070672_100552408 3300005543 Unclassified 1000
150 Ga0070672_101073981 3300005543 Bacteria 715
151 Ga0070695_100045457 3300005545 Bacteria 2798
152 Ga0070693_100285770 3300005547 Unclassified 1106
153 Ga0070665_100046012 3300005548 Bacteria 4383
154 Ga0070665_100159514 3300005548 Unclassified 2257
155 Ga0070704_100924943 3300005549 Unclassified 785
156 Ga0070704_100937297 3300005549 Bacteria 780
157 Ga0068855_100044300 3300005563 Bacteria 5266
158 Ga0070664_100257608 3300005564 Unclassified 1569
159 Ga0070664_100271830 3300005564 Bacteria 1527
160 Ga0070664_100792839 3300005564 Bacteria 885
161 Ga0070664_101708942 3300005564 Bacteria 596
162 Ga0068857_100381724 3300005577 Bacteria 1308
163 Ga0068856_100937236 3300005614 Bacteria 885
164 Ga0068856_101631923 3300005614 Bacteria 658
165 Ga0070702_100522835 3300005615 Unclassified 875
166 Ga0070702_101523037 3300005615 Bacteria 551
167 Ga0068852_100132069 3300005616 Bacteria 2300
168 Ga0068866_10030064 3300005718 Unclassified 2603
169 Ga0068866_10155285 3300005718 Unclassified 1329
170 Ga0068851_10140563 3300005834 Bacteria 1313
171 Ga0068860_100603401 3300005843 Bacteria 1103
172 Ga0081540_1195395 3300005983 Unclassified 741
173 Ga0081539_10000139 3300005985 Bacteria 170623
174 Ga0081539_10002232 3300005985 Bacteria 28218
175 Ga0081539_10012174 3300005985 Bacteria 6675
176 Ga0081539_10052402 3300005985 Bacteria 2291
177 Ga0081539_10052887 3300005985 Bacteria 2277
178 Ga0070717_10002406 3300006028 Bacteria 13200
179 Ga0070717_10006132 3300006028 Bacteria 8828
180 Ga0070717_10148449 3300006028 Bacteria 2027
181 Ga0075364_10477428 3300006051 Bacteria 852
182 Ga0070716_100306864 3300006173 Unclassified 1106
183 Ga0070716_100311420 3300006173 Unclassified 1099
184 Ga0070716_100350730 3300006173 Bacteria 1044
185 Ga0070716_100643389 3300006173 Bacteria 803
186 Ga0075362_10055685 3300006177 Bacteria 1779
187 Ga0097621_100004370 3300006237 Bacteria 9828
188 Ga0097621_100004743 3300006237 Bacteria 9503
189 Ga0097621_101288069 3300006237 Unclassified 690
190 Ga0068871_100017920 3300006358 Bacteria 5370
191 Ga0068871_100040568 3300006358 Bacteria 3729
192 Ga0068871_100127459 3300006358 Bacteria 2155
193 Ga0068871_100263499 3300006358 Bacteria 1504
194 Ga0075433_10655378 3300006852 Unclassified 920
195 Ga0075434_100073372 3300006871 Bacteria 3415
196 Ga0075434_101182136 3300006871 Unclassified 777
197 Ga0068865_100083101 3300006881 Unclassified 2304
198 Ga0068865_100183875 3300006881 Bacteria 1611
199 Ga0075436_100021119 3300006914 Bacteria 4467
200 Ga0079104_1020522 3300006946 Bacteria 1818
201 Ga0099826_10000002 3300006948 Bacteria 1125830
202 Ga0099794_10138050 3300007265 Bacteria 1234
203 Ga0105244_10001358 3300009036 Bacteria 19911
204 Ga0105244_10001435 3300009036 Bacteria 19281
205 Ga0105244_10066484 3300009036 Bacteria 1804
206 Ga0105244_10526848 3300009036 Bacteria 544
207 Ga0105250_10242911 3300009092 Bacteria 768
208 Ga0105240_10686415 3300009093 Bacteria 1119
209 Ga0105240_10813296 3300009093 Unclassified 1011
210 Ga0105240_11305553 3300009093 Bacteria 765
211 Ga0111539_10260786 3300009094 Unclassified 2017
212 Ga0105245_10084318 3300009098 Bacteria 2911
213 Ga0105245_10119936 3300009098 Bacteria 2456
214 Ga0105245_10167216 3300009098 Bacteria 2091
215 Ga0105245_10651147 3300009098 Unclassified 1084
216 Ga0105245_13006666 3300009098 Bacteria 523
217 Ga0105243_10234788 3300009148 Bacteria 1629
218 Ga0105243_11841945 3300009148 Bacteria 637
219 Ga0105241_10193522 3300009174 Bacteria 1694
220 Ga0105242_10021980 3300009176 Bacteria 5014
221 Ga0105242_10974916 3300009176 Bacteria 854
222 Ga0105248_11780232 3300009177 Bacteria 698
223 Ga0105237_10302030 3300009545 Unclassified 1604
224 Ga0105237_10856390 3300009545 Bacteria 916
225 Ga0105238_10362340 3300009551 Bacteria 1439
226 Ga0105239_10068393 3300010375 Bacteria 3903
227 Ga0105239_10492732 3300010375 Bacteria 1393
228 Ga0105239_12258985 3300010375 Unclassified 633
229 Ga0157327_1013057 3300012512 Bacteria 829
230 Ga0157373_10078322 3300013100 Bacteria 2331
231 Ga0157373_10634948 3300013100 Bacteria 779
232 Ga0157373_11009385 3300013100 Bacteria 621
233 Ga0157371_10000078 3300013102 Bacteria 154095
234 Ga0157370_10796901 3300013104 Bacteria 860
235 Ga0157374_10020633 3300013296 Bacteria 5851
236 Ga0157374_10099139 3300013296 Unclassified 2790
237 Ga0157374_10116843 3300013296 Unclassified 2571
238 Ga0157374_10255295 3300013296 Bacteria 1726
239 Ga0157374_10610886 3300013296 Bacteria 1101
240 Ga0157378_10022702 3300013297 Bacteria 5523
241 Ga0157378_10023772 3300013297 Bacteria 5391
242 Ga0157378_10093439 3300013297 Bacteria 2738
243 Ga0157378_10093654 3300013297 Bacteria 2735
244 Ga0157378_10156781 3300013297 Bacteria 2126
245 Ga0157378_10258166 3300013297 Bacteria 1671
246 Ga0157378_10271158 3300013297 Bacteria 1632
247 Ga0157378_10297016 3300013297 Unclassified 1562
248 Ga0157378_10486787 3300013297 Bacteria 1230
249 Ga0157378_10626109 3300013297 Unclassified 1090
250 Ga0157378_10897282 3300013297 Unclassified 917
251 Ga0157378_12407997 3300013297 Bacteria 578
252 Ga0163162_10004766 3300013306 Bacteria 13090
253 Ga0163162_10112128 3300013306 Bacteria 2826
254 Ga0163162_10262665 3300013306 Bacteria 1858
255 Ga0157372_10224982 3300013307 Unclassified 2175
256 Ga0157372_10877763 3300013307 Bacteria 1041
257 Ga0157375_10000847 3300013308 Bacteria 26687
258 Ga0157375_10016097 3300013308 Bacteria 6709
259 Ga0157375_10168179 3300013308 Bacteria 2338
260 Ga0157375_10387053 3300013308 Bacteria 1565
261 Ga0157375_13139799 3300013308 Bacteria 551
262 Ga0182008_10021358 3300014497 Bacteria 3324
263 Ga0157377_11272339 3300014745 Bacteria 573
264 Ga0157376_10002921 3300014969 Bacteria 11722
265 Ga0157376_10486261 3300014969 Bacteria 1210
266 Ga0157376_10568546 3300014969 Bacteria 1124
267 Ga0182006_1000026 3300015261 Bacteria 253543
268 Ga0182006_1037798 3300015261 Bacteria 1912
269 Ga0182006_1097963 3300015261 Bacteria 1045
270 Ga0182006_1195413 3300015261 Bacteria 671
271 Ga0182007_10086611 3300015262 Bacteria 1030
272 Ga0182007_10276411 3300015262 Bacteria 610
273 Ga0182005_1000007 3300015265 Bacteria 490994
274 Ga0182005_1081840 3300015265 Bacteria 892
275 Ga0163161_10040505 3300017792 Bacteria 3346
276 Ga0163161_10262967 3300017792 Bacteria 1348
277 Ga0206351_10247105 3300020077 Bacteria 1290
278 Ga0206353_10452765 3300020082 Bacteria 590
279 Ga0154015_1381368 3300020610 Bacteria 982
280 Ga0213872_10000028 3300021361 Bacteria 148766
281 Ga0213872_10006879 3300021361 Bacteria 5659
282 Ga0213872_10033421 3300021361 Bacteria 2356
283 Ga0209436_100351 3300025208 Bacteria 20779
284 Ga0209436_103199 3300025208 Bacteria 4460
285 Ga0209563_100007 3300025230 Bacteria 1579402
286 Ga0209437_108742 3300025233 Bacteria 1608
287 Ga0209437_114140 3300025233 Bacteria 1121
288 Ga0207425_1000001 3300025245 Bacteria 2525432
289 Ga0207425_1000327 3300025245 Bacteria 33618
290 Ga0207425_1000339 3300025245 Bacteria 32468
291 Ga0207425_1064128 3300025245 Bacteria 642
292 Ga0209646_1000010 3300025246 Bacteria 573803
293 Ga0209677_104764 3300025253 Bacteria 3783
294 Ga0209148_1000360 3300025254 Bacteria 57908
295 Ga0209129_1000001 3300025258 Bacteria 1452436
296 Ga0209129_1011719 3300025258 Bacteria 2071
297 Ga0209565_1000057 3300025263 Bacteria 196908
298 Ga0209565_1003411 3300025263 Bacteria 5154
299 Ga0209565_1003951 3300025263 Bacteria 4642
300 Ga0209565_1087400 3300025263 Bacteria 506
301 Ga0209455_1000037 3300025272 Bacteria 464097
302 Ga0209673_1000051 3300025273 Bacteria 282161
303 Ga0209673_1007915 3300025273 Bacteria 4803
304 Ga0209130_1000091 3300025284 Bacteria 149502
305 Ga0209130_1002422 3300025284 Bacteria 9393
306 Ga0209130_1002705 3300025284 Bacteria 8437
307 Ga0209675_1000027 3300025291 Bacteria 282175
308 Ga0209675_1001211 3300025291 Bacteria 15650
309 Ga0209675_1005738 3300025291 Bacteria 5124
310 Ga0209675_1024807 3300025291 Bacteria 1524
311 Ga0209025_1005014 3300025294 Bacteria 11056
312 Ga0209564_1000009 3300025295 Bacteria 950196
313 Ga0209564_1000068 3300025295 Bacteria 311171
314 Ga0209564_1000094 3300025295 Bacteria 243176
315 Ga0209564_1001487 3300025295 Bacteria 23618
316 Ga0209564_1007956 3300025295 Bacteria 5334
317 Ga0209564_1010315 3300025295 Bacteria 4323
318 Ga0209564_1038751 3300025295 Bacteria 1321
319 Ga0209758_1000073 3300025297 Bacteria 276262
320 Ga0209758_1000227 3300025297 Bacteria 120073
321 Ga0209050_1000046 3300025298 Bacteria 386466
322 Ga0209050_1000442 3300025298 Bacteria 75310
323 Ga0209256_1000044 3300025299 Bacteria 337264
324 Ga0209256_1000116 3300025299 Bacteria 169876
325 Ga0209256_1000145 3300025299 Bacteria 150609
326 Ga0209256_1000988 3300025299 Bacteria 34026
327 Ga0209256_1007853 3300025299 Bacteria 5124
328 Ga0207426_1003827 3300025302 Bacteria 7778
329 Ga0209051_1045983 3300025303 Bacteria 1505
330 Ga0209257_1000068 3300025304 Bacteria 341291
331 Ga0207697_10000230 3300025315 Bacteria 30289
332 Ga0207656_10147600 3300025321 Bacteria 1112
333 Ga0207655_1015761 3300025728 Bacteria 4179
334 Ga0207642_10018395 3300025899 Bacteria 2681
335 Ga0207642_10133315 3300025899 Bacteria 1300
336 Ga0207642_11051782 3300025899 Bacteria 525
337 Ga0207688_10028875 3300025901 Bacteria 3051
338 Ga0207680_10022988 3300025903 Bacteria 3398
339 Ga0207699_10353593 3300025906 Bacteria 1037
340 Ga0207705_10001972 3300025909 Bacteria 15970
341 Ga0207705_10526539 3300025909 Bacteria 919
342 Ga0207684_10000190 3300025910 Bacteria 97762
343 Ga0207684_10030054 3300025910 Bacteria 4626
344 Ga0207684_10031627 3300025910 Bacteria 4501
345 Ga0207684_10059588 3300025910 Bacteria 3242
346 Ga0207684_10070092 3300025910 Bacteria 2979
347 Ga0207684_10539954 3300025910 Bacteria 998
348 Ga0207684_10779762 3300025910 Bacteria 809
349 Ga0207654_10008161 3300025911 Bacteria 5281
350 Ga0207671_10204875 3300025914 Unclassified 1541
351 Ga0207671_10830194 3300025914 Bacteria 732
352 Ga0207660_10057168 3300025917 Bacteria 2794
353 Ga0207657_10871977 3300025919 Bacteria 694
354 Ga0207649_10228473 3300025920 Bacteria 1329
355 Ga0207652_10809247 3300025921 Bacteria 832
356 Ga0207646_10003785 3300025922 Bacteria 16837
357 Ga0207646_10009717 3300025922 Bacteria 9483
358 Ga0207646_10015435 3300025922 Bacteria 7213
359 Ga0207646_10047841 3300025922 Bacteria 3835
360 Ga0207646_10114655 3300025922 Bacteria 2420
361 Ga0207646_10120029 3300025922 Bacteria 2362
362 Ga0207646_11511300 3300025922 Unclassified 581
363 Ga0207646_11862424 3300025922 Bacteria 513
364 Ga0207681_10069268 3300025923 Unclassified 2453
365 Ga0207681_10666174 3300025923 Unclassified 863
366 Ga0207694_10368309 3300025924 Bacteria 1191
367 Ga0207650_10015523 3300025925 Bacteria 5305
368 Ga0207650_11819441 3300025925 Bacteria 515
369 Ga0207659_10049775 3300025926 Bacteria 2973
370 Ga0207659_10203549 3300025926 Bacteria 1582
371 Ga0207687_10518458 3300025927 Bacteria 997
372 Ga0207644_10543189 3300025931 Unclassified 961
373 Ga0207644_11170587 3300025931 Unclassified 646
374 Ga0207690_10010877 3300025932 Bacteria 5422
375 Ga0207690_10152984 3300025932 Bacteria 1712
376 Ga0207690_11221363 3300025932 Bacteria 628
377 Ga0207706_10120143 3300025933 Unclassified 2310
378 Ga0207706_10127098 3300025933 Bacteria 2241
379 Ga0207706_10365512 3300025933 Bacteria 1253
380 Ga0207686_10028891 3300025934 Bacteria 3265
381 Ga0207686_10399664 3300025934 Unclassified 1046
382 Ga0207709_10683063 3300025935 Bacteria 820
383 Ga0207670_10026701 3300025936 Bacteria 3642
384 Ga0207670_10267760 3300025936 Unclassified 1327
385 Ga0207669_10125945 3300025937 Bacteria 1750
386 Ga0207669_11362432 3300025937 Unclassified 603
387 Ga0207704_10225664 3300025938 Bacteria 1389
388 Ga0207704_10339819 3300025938 Bacteria 1165
389 Ga0207665_10019448 3300025939 Bacteria 4465
390 Ga0207665_10082276 3300025939 Unclassified 2218
391 Ga0207691_10001130 3300025940 Bacteria 26498
392 Ga0207691_10227193 3300025940 Bacteria 1617
393 Ga0207691_10312466 3300025940 Bacteria 1348
394 Ga0207691_11053828 3300025940 Bacteria 677
395 Ga0207691_11186069 3300025940 Unclassified 633
396 Ga0207679_10083312 3300025945 Bacteria 2451
397 Ga0207679_10088846 3300025945 Bacteria 2384
398 Ga0207667_10027566 3300025949 Bacteria 6180
399 Ga0207651_10987501 3300025960 Bacteria 752
400 Ga0207668_10236886 3300025972 Unclassified 1474
401 Ga0207668_10542504 3300025972 Bacteria 1006
402 Ga0207640_10715427 3300025981 Bacteria 860
403 Ga0207658_10010500 3300025986 Bacteria 6289
404 Ga0207677_10063774 3300026023 Bacteria 2563
405 Ga0207677_12103007 3300026023 Unclassified 525
406 Ga0207678_10063189 3300026067 Bacteria 3181
407 Ga0207678_10295105 3300026067 Unclassified 1392
408 Ga0207702_10880136 3300026078 Bacteria 887
409 Ga0207702_11275697 3300026078 Bacteria 729
410 Ga0207648_10098010 3300026089 Bacteria 2566
411 Ga0207648_10225463 3300026089 Bacteria 1666
412 Ga0207648_11146711 3300026089 Bacteria 729
413 Ga0207674_11315610 3300026116 Bacteria 692
414 Ga0207683_10006813 3300026121 Bacteria 9784
415 Ga0207683_10336655 3300026121 Bacteria 1384
416 Ga0207698_10222334 3300026142 Bacteria 1707
417 Ga0209281_1005666 3300027111 Bacteria 3412
418 Ga0209282_1000001 3300027666 Bacteria 2450367
419 Ga0268266_10013072 3300028379 Bacteria 7159
420 Ga0316180_1109616 3300030736 Bacteria 3644
421 Ga0316183_1134260 3300030742 Bacteria 893
422 Ga0316181_1070955 3300030744 Bacteria 1466
423 Ga0316181_1263623 3300030744 Bacteria 1678
424 Ga0316182_1023982 3300030745 Bacteria 3939
425 Ga0265316_10067224 3300031344 Bacteria 2772
426 Ga0265316_11107695 3300031344 Bacteria 549
427 Ga0307513_10136437 3300031456 Bacteria 2388
428 Ga0307408_100000981 3300031548 Bacteria 22068
429 Ga0307408_100001472 3300031548 Bacteria 17464
430 Ga0307408_100002767 3300031548 Bacteria 12179
431 Ga0307408_101680490 3300031548 Bacteria 604
432 Ga0307508_10139506 3300031616 Bacteria 2027
433 Ga0307518_10137449 3300031838 Bacteria 1709
434 Ga0307406_12051234 3300031901 Bacteria 512
435 Ga0307412_10476873 3300031911 Bacteria 1034
436 Ga0307412_10502414 3300031911 Bacteria 1010
437 Ga0307412_12064263 3300031911 Bacteria 529
438 Ga0307416_100011426 3300032002 Bacteria 5921
439 Ga0307416_101432393 3300032002 Bacteria 797
440 Ga0307416_102723184 3300032002 Bacteria 591
441 Ga0307414_10020067 3300032004 Bacteria 4156
442 Ga0307414_10541653 3300032004 Bacteria 1036
443 Ga0307411_10968862 3300032005 Bacteria 760
444 Ga0307415_102043720 3300032126 Bacteria 559
445 Ga0373943_0048876 3300035170 Bacteria 2074
446 Ga0373943_0947714 3300035170 Unclassified 515
447 Ga0373947_0040081 3300035725 Bacteria 2789
448 Ga0373947_0126165 3300035725 Bacteria 1630
449 Ga0373937_0168600 3300036401 Bacteria 2054
450 Ga0373925_0080283 3300037068 Bacteria 2479
451 Ga0373925_0771979 3300037068 Unclassified 792
452 Ga0395899_0000082 3300037312 Bacteria 168513
453 Ga0395899_0016969 3300037312 Bacteria 5549
454 Ga0395899_0024287 3300037312 Bacteria 4584
455 Ga0395899_0210055 3300037312 Bacteria 1353
456 Ga0395900_0000393 3300037418 Bacteria 63296
457 Ga0395900_0019995 3300037418 Bacteria 6826
458 Ga0395900_0046773 3300037418 Bacteria 4455
459 Ga0395900_0092327 3300037418 Bacteria 3110
460 Ga0395900_0113588 3300037418 Bacteria 2779
461 Ga0395900_0184192 3300037418 Bacteria 2120
462 Ga0395900_1822254 3300037418 Bacteria 519
463 Ga0395898_0106973 3300037466 Bacteria 2682
464 Ga0395898_0152641 3300037466 Bacteria 2209
465 Ga0395898_1003428 3300037466 Bacteria 770
466 Ga0395898_1377172 3300037466 Bacteria 633
467 Ga0395905_0009206 3300037471 Bacteria 9668
468 Ga0395905_0047340 3300037471 Bacteria 4030
469 Ga0395905_0549185 3300037471 Bacteria 1056
470 Ga0395905_0569842 3300037471 Bacteria 1034
471 Ga0395905_0701342 3300037471 Bacteria 914
472 Ga0395905_1823413 3300037471 Bacteria 514
473 Ga0395905_1847022 3300037471 Bacteria 510
474 Ga0436364_0101037 3300037853 Bacteria 585
475 Ga0395901_0000054 3300038443 Bacteria 160505
476 Ga0395901_0010533 3300038443 Bacteria 9365
477 Ga0395901_0163525 3300038443 Bacteria 2337
478 Ga0395901_0334325 3300038443 Bacteria 1565
479 Ga0395901_0359500 3300038443 Bacteria 1501
480 Ga0395901_1163544 3300038443 Bacteria 739
481 Ga0436361_0605732 3300039447 Bacteria 3541
482 Ga0436361_0616428 3300039447 Bacteria 15855
483 Ga0436361_1222516 3300039447 Bacteria 588
484 Ga0439436_0045720 3300041404 Bacteria 1245
485 Ga0451807_2769524 3300041486 Unclassified 669
486 Ga0451835_0242121 3300041492 Unclassified 506
487 Ga0451853_2377098 3300041512 Bacteria 678
488 Ga0451853_2842729 3300041512 Unclassified 854
489 Ga0451853_3225716 3300041512 Bacteria 855
490 Ga0439448_0316470 3300042005 Bacteria 555
491 Ga0439449_0028091 3300042007 Bacteria 2097
492 Ga0439450_156315 3300042008 Bacteria 599
493 Ga0439454_004952 3300042011 Bacteria 1567
494 Ga0439455_0105379 3300042012 Bacteria 781
495 Ga0450911_020566 3300042115 Bacteria 862
496 Ga0450920_092727 3300042122 Bacteria 624
497 Ga0450898_106442 3300042134 Bacteria 590
498 Ga0450904_000438 3300042139 Bacteria 8300
499 Ga0439446_0134383 3300042156 Bacteria 804
500 Ga0450893_0090164 3300042532 Bacteria 615
501 Ga0451577_0107899 3300042876 Bacteria 2489
502 Ga0451577_1143792 3300042876 Bacteria 695
503 Ga0466969_0062179 3300044656 Bacteria 1812
504 Ga0466969_0205223 3300044656 Bacteria 898
505 Ga0466972_0000042 3300044658 Bacteria 131971
506 Ga0466972_0127184 3300044658 Bacteria 1200
507 Ga0466972_0130545 3300044658 Bacteria 1183
508 Ga0466982_0387196 3300044672 Bacteria 762
509 Ga0466965_0123291 3300044683 Bacteria 1339
510 Ga0466965_0159673 3300044683 Bacteria 1181
511 Ga0466965_0182269 3300044683 Bacteria 1108
512 Ga0466966_0034358 3300044684 Bacteria 3278
513 Ga0466966_0180341 3300044684 Bacteria 1281
514 Ga0466963_0184915 3300044694 Bacteria 1455
515 Ga0466964_0000091 3300044706 Bacteria 21332
516 Ga0466964_0052645 3300044706 Bacteria 1673
517 Ga0466964_0429360 3300044706 Bacteria 696
518 Ga0453684_0000917 3300044712 Bacteria 97990
519 Ga0453684_1277106 3300044712 Bacteria 767
520 Ga0466971_0210479 3300044719 Bacteria 919
521 Ga0466971_0242506 3300044719 Bacteria 857
522 Ga0466968_0000777 3300044735 Bacteria 11090
523 Ga0466957_0166814 3300044842 Bacteria 1432
524 Ga0466957_0218946 3300044842 Bacteria 1256
525 Ga0466960_0144687 3300044901 Bacteria 1265
526 Ga0466960_0312230 3300044901 Bacteria 888
527 Ga0466960_0574434 3300044901 Bacteria 667
528 Ga0466959_0028509 3300045049 Bacteria 4140
529 Ga0466959_0220493 3300045049 Bacteria 1315
530 Ga0451576_0365370 3300045051 Bacteria 1512
531 Ga0466958_0208527 3300045836 Bacteria 1244
532 Ga0466967_0015997 3300045976 Bacteria 5900
533 Ga0466967_0118372 3300045976 Bacteria 2443
534 Ga0466967_0181032 3300045976 Bacteria 1988
535 Ga0495617_000041 3300046452 Bacteria 124027
536 Ga0495617_000057 3300046452 Bacteria 100673
537 Ga0495617_001102 3300046452 Bacteria 12291
538 Ga0495617_026400 3300046452 Bacteria 1955
539 Ga0495617_033783 3300046452 Bacteria 1716
540 Ga0495617_234914 3300046452 Bacteria 567
541 Ga0495627_000007 3300046453 Bacteria 575915
542 Ga0495627_001004 3300046453 Bacteria 18981
543 Ga0495627_014641 3300046453 Bacteria 2730
544 Ga0495603_0057009 3300046455 Bacteria 2312
545 Ga0495603_0183470 3300046455 Bacteria 1210
546 Ga0495603_0327998 3300046455 Bacteria 878
547 Ga0495603_0394385 3300046455 Bacteria 793
548 Ga0495590_0000001 3300046457 Bacteria 762984
549 Ga0495590_0000018 3300046457 Bacteria 216375
550 Ga0495590_0000251 3300046457 Bacteria 29217
551 Ga0495590_0003051 3300046457 Bacteria 6864
552 Ga0495590_0016843 3300046457 Bacteria 2637
553 Ga0495590_0122654 3300046457 Bacteria 931
554 Ga0495590_0186459 3300046457 Bacteria 759
555 Ga0495591_004295 3300046458 Bacteria 7030
556 Ga0495591_020659 3300046458 Bacteria 2169
557 Ga0495629_0008847 3300046459 Bacteria 7403
558 Ga0495629_0041207 3300046459 Bacteria 3249
559 Ga0495629_0093578 3300046459 Bacteria 2097
560 Ga0495629_0171494 3300046459 Bacteria 1505
561 Ga0495629_0377308 3300046459 Unclassified 965
562 Ga0495638_0000423 3300046460 Bacteria 51134
563 Ga0495638_0001950 3300046460 Bacteria 17693
564 Ga0495638_0002366 3300046460 Bacteria 15443
565 Ga0495638_0025941 3300046460 Bacteria 3804
566 Ga0495638_0097743 3300046460 Bacteria 1760
567 Ga0495638_0125695 3300046460 Bacteria 1511
568 Ga0495638_0148394 3300046460 Bacteria 1362
569 Ga0495638_0287897 3300046460 Bacteria 890
570 Ga0495653_0000002 3300046463 Bacteria 507262
571 Ga0495653_0005312 3300046463 Bacteria 10477
572 Ga0495653_0123169 3300046463 Bacteria 1844
573 Ga0495653_0126365 3300046463 Bacteria 1815
574 Ga0495653_0242459 3300046463 Bacteria 1200
575 Ga0495650_0000108 3300046471 Bacteria 200369
576 Ga0495650_0000118 3300046471 Bacteria 187358
577 Ga0495650_0000156 3300046471 Bacteria 155338
578 Ga0495650_0000166 3300046471 Bacteria 146047
579 Ga0495650_0001417 3300046471 Bacteria 23322
580 Ga0495650_0004758 3300046471 Bacteria 9125
581 Ga0495650_0033948 3300046471 Bacteria 2264
582 Ga0495650_0056190 3300046471 Bacteria 1598
583 Ga0495650_0129330 3300046471 Bacteria 922
584 Ga0495580_0029634 3300046472 Bacteria 3970
585 Ga0495580_0685629 3300046472 Bacteria 672
586 Ga0495582_0007542 3300046473 Bacteria 6017
587 Ga0495582_0096997 3300046473 Bacteria 1648
588 Ga0495582_0149706 3300046473 Bacteria 1325
589 Ga0495582_0378240 3300046473 Bacteria 816
590 Ga0495582_0717439 3300046473 Bacteria 578
591 Ga0495605_0000059 3300046474 Bacteria 146371
592 Ga0495605_0000260 3300046474 Bacteria 61729
593 Ga0495605_0000598 3300046474 Bacteria 28458
594 Ga0495605_0001111 3300046474 Bacteria 17923
595 Ga0495605_0003011 3300046474 Bacteria 10174
596 Ga0495605_0008745 3300046474 Bacteria 5716
597 Ga0495605_0029751 3300046474 Bacteria 2806
598 Ga0495605_0030368 3300046474 Bacteria 2772
599 Ga0495605_0037060 3300046474 Bacteria 2455
600 Ga0495605_0041669 3300046474 Bacteria 2286
601 Ga0495605_0062056 3300046474 Bacteria 1786
602 Ga0495605_0069744 3300046474 Bacteria 1663
603 Ga0495605_0089022 3300046474 Bacteria 1433
604 Ga0495605_0278526 3300046474 Bacteria 711
605 Ga0495605_0361635 3300046474 Bacteria 607
606 Ga0495605_0378819 3300046474 Bacteria 590
607 Ga0495639_0250894 3300046475 Bacteria 875
608 Ga0495664_0703930 3300046477 Bacteria 597
609 Ga0495584_0000006 3300046491 Bacteria 301775
610 Ga0495584_0001835 3300046491 Bacteria 12335
611 Ga0495584_0001841 3300046491 Bacteria 12302
612 Ga0495584_0002247 3300046491 Bacteria 11024
613 Ga0495584_0004974 3300046491 Bacteria 7082
614 Ga0495584_0007211 3300046491 Bacteria 5802
615 Ga0495584_0011682 3300046491 Bacteria 4493
616 Ga0495584_0013361 3300046491 Bacteria 4192
617 Ga0495584_0013827 3300046491 Bacteria 4114
618 Ga0495584_0036310 3300046491 Bacteria 2490
619 Ga0495584_0036816 3300046491 Bacteria 2471
620 Ga0495584_0041304 3300046491 Bacteria 2328
621 Ga0495584_0047001 3300046491 Bacteria 2176
622 Ga0495584_0058346 3300046491 Bacteria 1941
623 Ga0495584_0089372 3300046491 Bacteria 1553
624 Ga0495584_0091051 3300046491 Bacteria 1538
625 Ga0495584_0237158 3300046491 Bacteria 927
626 Ga0495584_0666068 3300046491 Bacteria 530
627 Ga0495585_0000282 3300046492 Bacteria 50936
628 Ga0495585_0003548 3300046492 Bacteria 10477
629 Ga0495585_0004128 3300046492 Bacteria 9503
630 Ga0495585_0004783 3300046492 Bacteria 8711
631 Ga0495585_0007364 3300046492 Bacteria 6745
632 Ga0495585_0008922 3300046492 Bacteria 6048
633 Ga0495585_0011838 3300046492 Bacteria 5153
634 Ga0495585_0014509 3300046492 Bacteria 4587
635 Ga0495585_0016543 3300046492 Bacteria 4273
636 Ga0495585_0023658 3300046492 Bacteria 3525
637 Ga0495585_0042612 3300046492 Bacteria 2541
638 Ga0495585_0047888 3300046492 Bacteria 2378
639 Ga0495585_0097886 3300046492 Bacteria 1572
640 Ga0495585_0101232 3300046492 Bacteria 1540
641 Ga0495585_0120605 3300046492 Bacteria 1387
642 Ga0495585_0134348 3300046492 Bacteria 1299
643 Ga0495585_0144154 3300046492 Bacteria 1245
644 Ga0495585_0146493 3300046492 Bacteria 1233
645 Ga0495585_0181351 3300046492 Bacteria 1082
646 Ga0495585_0208936 3300046492 Bacteria 990
647 Ga0495585_0635359 3300046492 Bacteria 500
648 Ga0495594_0006060 3300046499 Bacteria 6213
649 Ga0495594_0022540 3300046499 Bacteria 3368
650 Ga0495594_0056774 3300046499 Bacteria 2161
651 Ga0495594_0063287 3300046499 Bacteria 2049
652 Ga0495594_0088303 3300046499 Bacteria 1735
653 Ga0495594_0100196 3300046499 Bacteria 1629
654 Ga0495594_0103494 3300046499 Bacteria 1602
655 Ga0495594_0228512 3300046499 Bacteria 1061
656 Ga0495594_0471986 3300046499 Bacteria 713
657 Ga0495596_0000236 3300046500 Bacteria 37630
658 Ga0495596_0003733 3300046500 Bacteria 7608
659 Ga0495596_0003880 3300046500 Bacteria 7419
660 Ga0495596_0010298 3300046500 Bacteria 4076
661 Ga0495596_0016755 3300046500 Bacteria 3041
662 Ga0495596_0020946 3300046500 Bacteria 2672
663 Ga0495596_0032093 3300046500 Bacteria 2095
664 Ga0495596_0039830 3300046500 Bacteria 1855
665 Ga0495596_0066495 3300046500 Bacteria 1401
666 Ga0495596_0072165 3300046500 Bacteria 1340
667 Ga0495596_0112662 3300046500 Bacteria 1056
668 Ga0495596_0225634 3300046500 Bacteria 727
669 Ga0495607_0002467 3300046501 Bacteria 15021
670 Ga0495607_0003144 3300046501 Bacteria 12800
671 Ga0495607_0003634 3300046501 Bacteria 11712
672 Ga0495607_0008457 3300046501 Bacteria 7032
673 Ga0495607_0014610 3300046501 Bacteria 5105
674 Ga0495607_0014950 3300046501 Bacteria 5046
675 Ga0495607_0027861 3300046501 Bacteria 3488
676 Ga0495607_0038208 3300046501 Bacteria 2877
677 Ga0495607_0040944 3300046501 Bacteria 2754
678 Ga0495607_0051300 3300046501 Bacteria 2396
679 Ga0495607_0147306 3300046501 Bacteria 1208
680 Ga0495607_0226812 3300046501 Bacteria 910
681 Ga0495607_0336100 3300046501 Bacteria 700
682 Ga0495607_0419653 3300046501 Bacteria 605
683 Ga0495583_0000035 3300046506 Bacteria 246849
684 Ga0495583_0000525 3300046506 Bacteria 54370
685 Ga0495583_0000533 3300046506 Bacteria 53778
686 Ga0495583_0000608 3300046506 Bacteria 48449
687 Ga0495583_0001445 3300046506 Bacteria 24126
688 Ga0495583_0002759 3300046506 Bacteria 14503
689 Ga0495583_0004051 3300046506 Bacteria 10773
690 Ga0495583_0004816 3300046506 Bacteria 9459
691 Ga0495583_0011794 3300046506 Bacteria 4998
692 Ga0495583_0014446 3300046506 Bacteria 4356
693 Ga0495583_0020340 3300046506 Bacteria 3441
694 Ga0495583_0027832 3300046506 Bacteria 2785
695 Ga0495583_0063913 3300046506 Bacteria 1634
696 Ga0495583_0087871 3300046506 Bacteria 1342
697 Ga0495583_0138545 3300046506 Bacteria 1014
698 Ga0495606_0000011 3300046507 Bacteria 296816
699 Ga0495606_0000064 3300046507 Bacteria 183631
700 Ga0495606_0001147 3300046507 Bacteria 37572
701 Ga0495606_0001181 3300046507 Bacteria 36855
702 Ga0495606_0006161 3300046507 Bacteria 11164
703 Ga0495606_0009081 3300046507 Bacteria 8472
704 Ga0495606_0013368 3300046507 Bacteria 6489
705 Ga0495606_0014662 3300046507 Bacteria 6097
706 Ga0495606_0014803 3300046507 Bacteria 6059
707 Ga0495606_0026334 3300046507 Bacteria 4146
708 Ga0495606_0036164 3300046507 Bacteria 3367
709 Ga0495606_0037676 3300046507 Bacteria 3281
710 Ga0495606_0038517 3300046507 Bacteria 3233
711 Ga0495606_0084712 3300046507 Bacteria 1962
712 Ga0495606_0145115 3300046507 Bacteria 1398
713 Ga0495606_0151684 3300046507 Bacteria 1359
714 Ga0495606_0200207 3300046507 Bacteria 1138
715 Ga0495610_0000003 3300046512 Bacteria 1203910
716 Ga0495610_0000873 3300046512 Bacteria 28152
717 Ga0495610_0001162 3300046512 Bacteria 23954
718 Ga0495610_0008688 3300046512 Bacteria 6540
719 Ga0495616_0000272 3300046513 Bacteria 41986
720 Ga0495616_0000343 3300046513 Bacteria 36983
721 Ga0495616_0000680 3300046513 Bacteria 25142
722 Ga0495616_0001661 3300046513 Bacteria 15228
723 Ga0495616_0003238 3300046513 Bacteria 10474
724 Ga0495616_0009292 3300046513 Bacteria 5762
725 Ga0495616_0009654 3300046513 Bacteria 5625
726 Ga0495616_0012631 3300046513 Bacteria 4787
727 Ga0495616_0013294 3300046513 Bacteria 4649
728 Ga0495616_0028258 3300046513 Bacteria 2969
729 Ga0495616_0031645 3300046513 Bacteria 2768
730 Ga0495616_0045896 3300046513 Bacteria 2209
731 Ga0495616_0056668 3300046513 Bacteria 1934
732 Ga0495616_0064979 3300046513 Bacteria 1779
733 Ga0495616_0125523 3300046513 Bacteria 1180
734 Ga0495616_0139171 3300046513 Bacteria 1106
735 Ga0495620_0003145 3300046515 Bacteria 9470
736 Ga0495630_0017831 3300046517 Bacteria 5207
737 Ga0495631_0000983 3300046518 Bacteria 17719
738 Ga0495631_0002105 3300046518 Bacteria 11552
739 Ga0495631_0003385 3300046518 Bacteria 8732
740 Ga0495631_0005046 3300046518 Bacteria 6953
741 Ga0495631_0006876 3300046518 Bacteria 5836
742 Ga0495631_0007988 3300046518 Bacteria 5350
743 Ga0495631_0016269 3300046518 Bacteria 3551
744 Ga0495631_0039469 3300046518 Bacteria 2094
745 Ga0495631_0044435 3300046518 Bacteria 1957
746 Ga0495631_0072699 3300046518 Bacteria 1485
747 Ga0495631_0141351 3300046518 Bacteria 1033
748 Ga0495632_0000062 3300046519 Bacteria 118205
749 Ga0495632_0000235 3300046519 Bacteria 55317
750 Ga0495632_0000901 3300046519 Bacteria 26017
751 Ga0495632_0002631 3300046519 Bacteria 13521
752 Ga0495632_0007247 3300046519 Bacteria 6999
753 Ga0495632_0009591 3300046519 Bacteria 5820
754 Ga0495632_0019389 3300046519 Bacteria 3707
755 Ga0495637_0000004 3300046520 Bacteria 589740
756 Ga0495637_0000482 3300046520 Bacteria 29077
757 Ga0495637_0005727 3300046520 Bacteria 6296
758 Ga0495637_0022968 3300046520 Bacteria 2839
759 Ga0495637_0058812 3300046520 Bacteria 1583
760 Ga0495637_0085828 3300046520 Bacteria 1248
761 Ga0495637_0132682 3300046520 Bacteria 950
762 Ga0495643_0000123 3300046522 Bacteria 124936
763 Ga0495643_0000170 3300046522 Bacteria 103438
764 Ga0495643_0000969 3300046522 Bacteria 29411
765 Ga0495643_0001637 3300046522 Bacteria 19768
766 Ga0495643_0004001 3300046522 Bacteria 10529
767 Ga0495643_0007137 3300046522 Bacteria 7249
768 Ga0495643_0011059 3300046522 Bacteria 5518
769 Ga0495643_0014320 3300046522 Bacteria 4721
770 Ga0495643_0173562 3300046522 Bacteria 1052
771 Ga0495643_0195476 3300046522 Bacteria 974
772 Ga0495644_0003684 3300046523 Bacteria 6029
773 Ga0495644_0003719 3300046523 Bacteria 6004
774 Ga0495644_0006986 3300046523 Bacteria 4369
775 Ga0495644_0008087 3300046523 Bacteria 4045
776 Ga0495644_0008241 3300046523 Bacteria 4011
777 Ga0495644_0010379 3300046523 Bacteria 3590
778 Ga0495644_0021058 3300046523 Bacteria 2487
779 Ga0495644_0022081 3300046523 Bacteria 2426
780 Ga0495644_0022349 3300046523 Bacteria 2410
781 Ga0495644_0044530 3300046523 Bacteria 1669
782 Ga0495644_0144985 3300046523 Bacteria 907
783 Ga0495644_0164084 3300046523 Bacteria 852
784 Ga0495648_0000001 3300046524 Bacteria 696872
785 Ga0495648_0000109 3300046524 Bacteria 101519
786 Ga0495648_0000541 3300046524 Bacteria 40809
787 Ga0495648_0002349 3300046524 Bacteria 17563
788 Ga0495648_0013051 3300046524 Bacteria 6163
789 Ga0495648_0018771 3300046524 Bacteria 4881
790 Ga0495648_0027536 3300046524 Bacteria 3802
791 Ga0495648_0033572 3300046524 Bacteria 3349
792 Ga0495648_0041132 3300046524 Bacteria 2922
793 Ga0495648_0088906 3300046524 Bacteria 1735
794 Ga0495648_0130402 3300046524 Bacteria 1337
795 Ga0495648_0132888 3300046524 Bacteria 1321
796 Ga0495648_0164941 3300046524 Bacteria 1141
797 Ga0495648_0174124 3300046524 Bacteria 1100
798 Ga0495648_0175834 3300046524 Bacteria 1093
799 Ga0495663_0004570 3300046525 Bacteria 3881
800 Ga0495663_0043379 3300046525 Bacteria 1373
801 Ga0495663_0073136 3300046525 Bacteria 1094
802 Ga0495663_0311424 3300046525 Bacteria 568
803 Ga0495666_0000975 3300046526 Bacteria 13502
804 Ga0495666_0001244 3300046526 Bacteria 12329
805 Ga0495666_0022762 3300046526 Bacteria 3101
806 Ga0495666_0024822 3300046526 Bacteria 2961
807 Ga0495666_0088051 3300046526 Bacteria 1466
808 Ga0495642_0000196 3300046528 Bacteria 35510
809 Ga0495642_0002912 3300046528 Bacteria 6821
810 Ga0495642_0003623 3300046528 Bacteria 6064
811 Ga0495642_0006116 3300046528 Bacteria 4623
812 Ga0495642_0008553 3300046528 Bacteria 3916
813 Ga0495642_0008675 3300046528 Bacteria 3884
814 Ga0495642_0008881 3300046528 Bacteria 3845
815 Ga0495642_0018690 3300046528 Bacteria 2713
816 Ga0495642_0020087 3300046528 Bacteria 2620
817 Ga0495642_0021451 3300046528 Bacteria 2540
818 Ga0495642_0027433 3300046528 Bacteria 2266
819 Ga0495642_0032728 3300046528 Bacteria 2087
820 Ga0495642_0077602 3300046528 Bacteria 1395
821 Ga0495642_0088316 3300046528 Bacteria 1310
822 Ga0495642_0101537 3300046528 Bacteria 1224
823 Ga0495642_0116714 3300046528 Bacteria 1144
824 Ga0495642_0205702 3300046528 Bacteria 858
825 Ga0495642_0232419 3300046528 Bacteria 805
826 Ga0495652_0020052 3300046529 Bacteria 5947
827 Ga0495654_0000038 3300046530 Bacteria 185693
828 Ga0495654_0002038 3300046530 Bacteria 13252
829 Ga0495654_0011618 3300046530 Bacteria 4758
830 Ga0495654_0019835 3300046530 Bacteria 3511
831 Ga0495654_0049466 3300046530 Bacteria 2059
832 Ga0495654_0052082 3300046530 Bacteria 1995
833 Ga0495654_0062661 3300046530 Bacteria 1782
834 Ga0495654_0084811 3300046530 Bacteria 1479
835 Ga0495665_0004075 3300046531 Bacteria 7881
836 Ga0495665_0018192 3300046531 Bacteria 3776
837 Ga0495665_0022051 3300046531 Bacteria 3424
838 Ga0495665_0030374 3300046531 Bacteria 2891
839 Ga0495665_0136960 3300046531 Bacteria 1280
840 Ga0495665_0237927 3300046531 Bacteria 939
841 Ga0495665_0621341 3300046531 Bacteria 539
842 Ga0495640_0096951 3300046533 Bacteria 1939
843 Ga0495586_0010365 3300046535 Bacteria 4955
844 Ga0495586_0014931 3300046535 Bacteria 4126
845 Ga0495586_0197549 3300046535 Bacteria 1140
846 Ga0495586_0427977 3300046535 Bacteria 762
847 Ga0495587_0094550 3300046536 Bacteria 1725
848 Ga0495587_0241029 3300046536 Bacteria 1017
849 Ga0495587_0331613 3300046536 Bacteria 849
850 Ga0495598_0012534 3300046537 Bacteria 2084
851 Ga0495609_0000009 3300046538 Bacteria 354860
852 Ga0495609_0000636 3300046538 Bacteria 27314
853 Ga0495609_0003073 3300046538 Bacteria 9786
854 Ga0495609_0003510 3300046538 Bacteria 8955
855 Ga0495609_0003925 3300046538 Bacteria 8335
856 Ga0495609_0006181 3300046538 Bacteria 6158
857 Ga0495609_0010588 3300046538 Bacteria 4419
858 Ga0495609_0012139 3300046538 Bacteria 4088
859 Ga0495609_0018688 3300046538 Bacteria 3211
860 Ga0495609_0021303 3300046538 Bacteria 2990
861 Ga0495609_0023305 3300046538 Bacteria 2846
862 Ga0495609_0104995 3300046538 Bacteria 1222
863 Ga0495609_0107807 3300046538 Bacteria 1203
864 Ga0495609_0110710 3300046538 Bacteria 1185
865 Ga0495609_0194205 3300046538 Bacteria 850
866 Ga0495609_0216406 3300046538 Bacteria 796
867 Ga0495621_0207430 3300046539 Bacteria 790
868 Ga0495597_0001393 3300046542 Bacteria 17466
869 Ga0495597_0001520 3300046542 Bacteria 16508
870 Ga0495597_0001796 3300046542 Bacteria 14723
871 Ga0495597_0002277 3300046542 Bacteria 12472
872 Ga0495597_0004290 3300046542 Bacteria 7877
873 Ga0495597_0005992 3300046542 Bacteria 6340
874 Ga0495597_0007074 3300046542 Bacteria 5743
875 Ga0495597_0011554 3300046542 Bacteria 4278
876 Ga0495597_0013569 3300046542 Bacteria 3898
877 Ga0495597_0028551 3300046542 Bacteria 2553
878 Ga0495597_0035996 3300046542 Bacteria 2230
879 Ga0495597_0062840 3300046542 Bacteria 1614
880 Ga0495597_0067467 3300046542 Bacteria 1547
881 Ga0495597_0091483 3300046542 Bacteria 1291
882 Ga0495597_0197927 3300046542 Bacteria 806
883 Ga0495645_0125435 3300046543 Bacteria 1804
884 Ga0495645_0176359 3300046543 Bacteria 1468
885 Ga0495622_0000028 3300046557 Bacteria 133197
886 Ga0495622_0000398 3300046557 Bacteria 29440
887 Ga0495622_0028161 3300046557 Bacteria 2623
888 Ga0495622_0091127 3300046557 Bacteria 1400
889 Ga0495622_0108925 3300046557 Bacteria 1268
890 Ga0495622_0226951 3300046557 Bacteria 826
891 Ga0495622_0292540 3300046557 Bacteria 710
892 Ga0495622_0411964 3300046557 Bacteria 581
893 Ga0495633_0002074 3300046558 Bacteria 14420
894 Ga0495633_0002390 3300046558 Bacteria 13287
895 Ga0495633_0004129 3300046558 Bacteria 9350
896 Ga0495633_0007239 3300046558 Bacteria 6420
897 Ga0495633_0008374 3300046558 Bacteria 5834
898 Ga0495633_0015513 3300046558 Bacteria 3950
899 Ga0495633_0016604 3300046558 Bacteria 3789
900 Ga0495633_0016656 3300046558 Bacteria 3782
901 Ga0495633_0018775 3300046558 Bacteria 3506
902 Ga0495633_0028145 3300046558 Bacteria 2741
903 Ga0495633_0034928 3300046558 Bacteria 2416
904 Ga0495633_0036808 3300046558 Bacteria 2343
905 Ga0495633_0069418 3300046558 Bacteria 1645
906 Ga0495633_0077381 3300046558 Bacteria 1549
907 Ga0495633_0107297 3300046558 Bacteria 1295
908 Ga0495633_0132449 3300046558 Bacteria 1154
909 Ga0495633_0182335 3300046558 Bacteria 966
910 Ga0495633_0334694 3300046558 Bacteria 686
911 Ga0495633_0540313 3300046558 Bacteria 525
912 Ga0495667_0301968 3300046559 Bacteria 1014
913 Ga0495656_0003737 3300046615 Bacteria 5168
914 Ga0495656_0015862 3300046615 Bacteria 2851
915 Ga0495656_0043073 3300046615 Bacteria 1893
916 Ga0495656_0048042 3300046615 Bacteria 1812
917 Ga0495656_0120080 3300046615 Bacteria 1239
918 Ga0495668_0000048 3300046616 Bacteria 217867
919 Ga0495668_0001362 3300046616 Bacteria 23977
920 Ga0495668_0002401 3300046616 Bacteria 15518
921 Ga0495668_0002455 3300046616 Bacteria 15251
922 Ga0495668_0004786 3300046616 Bacteria 9440
923 Ga0495668_0005220 3300046616 Bacteria 8908
924 Ga0495668_0007462 3300046616 Bacteria 6987
925 Ga0495668_0010370 3300046616 Bacteria 5639
926 Ga0495668_0013225 3300046616 Bacteria 4878
927 Ga0495668_0013802 3300046616 Bacteria 4752
928 Ga0495668_0022879 3300046616 Bacteria 3569
929 Ga0495668_0025705 3300046616 Bacteria 3344
930 Ga0495668_0026212 3300046616 Bacteria 3308
931 Ga0495668_0027856 3300046616 Bacteria 3200
932 Ga0495668_0031057 3300046616 Bacteria 3010
933 Ga0495668_0045217 3300046616 Bacteria 2447
934 Ga0495668_0069580 3300046616 Bacteria 1935
935 Ga0495668_0151893 3300046616 Bacteria 1268
936 Ga0495668_0184006 3300046616 Bacteria 1144
937 Ga0495668_0531138 3300046616 Bacteria 649
938 Ga0495634_0003145 3300046642 Bacteria 13386
939 Ga0495634_0052778 3300046642 Bacteria 2725
940 Ga0495611_0003052 3300046648 Bacteria 7456
941 Ga0495611_0004232 3300046648 Bacteria 6247
942 Ga0495611_0005048 3300046648 Bacteria 5657
943 Ga0495611_0007604 3300046648 Bacteria 4597
944 Ga0495611_0034181 3300046648 Bacteria 2246
945 Ga0495611_0048649 3300046648 Bacteria 1906
946 Ga0495611_0052940 3300046648 Bacteria 1831
947 Ga0495611_0062572 3300046648 Bacteria 1693
948 Ga0495611_0098119 3300046648 Bacteria 1358
949 Ga0495611_0124226 3300046648 Bacteria 1203
950 Ga0495611_0185804 3300046648 Bacteria 970
951 Ga0495611_0269588 3300046648 Bacteria 787
952 Ga0495611_0328188 3300046648 Bacteria 703
953 Ga0495611_0357724 3300046648 Bacteria 669
954 Ga0495611_0448255 3300046648 Bacteria 588
955 Ga0495625_0000164 3300046660 Bacteria 103037
956 Ga0495625_0005794 3300046660 Bacteria 11161
957 Ga0495625_0009364 3300046660 Bacteria 8201
958 Ga0495625_0009819 3300046660 Bacteria 7965
959 Ga0495625_0015487 3300046660 Bacteria 6038
960 Ga0495625_0018254 3300046660 Bacteria 5482
961 Ga0495625_0021196 3300046660 Bacteria 5006
962 Ga0495625_0029832 3300046660 Bacteria 4074
963 Ga0495625_0038200 3300046660 Bacteria 3516
964 Ga0495625_0046986 3300046660 Bacteria 3113
965 Ga0495625_0069612 3300046660 Bacteria 2472
966 Ga0495625_0100232 3300046660 Bacteria 1991
967 Ga0495625_0245382 3300046660 Bacteria 1164
968 Ga0495625_0453458 3300046660 Bacteria 792
969 Ga0495625_0566492 3300046660 Bacteria 686
970 Ga0495635_0006579 3300046663 Bacteria 8109
971 Ga0495635_0619974 3300046663 Bacteria 705
972 Ga0495659_0000289 3300046664 Bacteria 20134
973 Ga0495659_0001247 3300046664 Bacteria 8795
974 Ga0495659_0009392 3300046664 Bacteria 3120
975 Ga0495659_0069126 3300046664 Bacteria 1320
976 Ga0495659_0123825 3300046664 Bacteria 1020
977 Ga0495661_0000368 3300046665 Bacteria 48926
978 Ga0495661_0001167 3300046665 Bacteria 22911
979 Ga0495661_0002363 3300046665 Bacteria 14562
980 Ga0495661_0006427 3300046665 Bacteria 8262
981 Ga0495661_0012089 3300046665 Bacteria 5837
982 Ga0495661_0015517 3300046665 Bacteria 5083
983 Ga0495661_0019494 3300046665 Bacteria 4444
984 Ga0495661_0023664 3300046665 Bacteria 3983
985 Ga0495661_0029376 3300046665 Bacteria 3509
986 Ga0495661_0037274 3300046665 Bacteria 3036
987 Ga0495661_0040171 3300046665 Bacteria 2903
988 Ga0495661_0052747 3300046665 Bacteria 2448
989 Ga0495661_0067409 3300046665 Bacteria 2102
990 Ga0495661_0072941 3300046665 Bacteria 2001
991 Ga0495661_0083536 3300046665 Bacteria 1835
992 Ga0495661_0103370 3300046665 Bacteria 1599
993 Ga0495661_0104872 3300046665 Bacteria 1584
994 Ga0495661_0124413 3300046665 Bacteria 1420
995 Ga0495661_0141254 3300046665 Bacteria 1309
996 Ga0495661_0147861 3300046665 Bacteria 1271
997 Ga0495661_0235293 3300046665 Bacteria 942
998 Ga0495661_0256340 3300046665 Bacteria 890
999 Ga0495661_0267876 3300046665 Bacteria 865
1000 Ga0495588_0000077 3300046674 Bacteria 215338
1001 Ga0495588_0035172 3300046674 Bacteria 2537
1002 Ga0495588_0045378 3300046674 Bacteria 2252
1003 Ga0495588_0064739 3300046674 Bacteria 1896
1004 Ga0495588_0065381 3300046674 Bacteria 1886
1005 Ga0495588_0071146 3300046674 Bacteria 1808
1006 Ga0495588_0080651 3300046674 Bacteria 1698
1007 Ga0495588_0109500 3300046674 Bacteria 1454
1008 Ga0495588_0121903 3300046674 Bacteria 1374
1009 Ga0495588_0123522 3300046674 Unclassified 1365
1010 Ga0495588_0164135 3300046674 Bacteria 1174
1011 Ga0495588_0173649 3300046674 Bacteria 1139
1012 Ga0495588_0708148 3300046674 Bacteria 526
1013 Ga0495599_0266621 3300046678 Bacteria 1040
1014 Ga0495623_0007712 3300046679 Bacteria 6995
1015 Ga0495623_0027846 3300046679 Bacteria 3638
1016 Ga0495623_0091002 3300046679 Bacteria 1872
1017 Ga0495623_0220094 3300046679 Bacteria 1082
1018 Ga0495646_0190750 3300046680 Bacteria 1120
1019 Ga0495669_0000217 3300046684 Bacteria 34603
1020 Ga0495669_0001851 3300046684 Bacteria 8677
1021 Ga0495669_0010502 3300046684 Bacteria 3914
1022 Ga0495669_0017194 3300046684 Bacteria 3101
1023 Ga0495669_0033212 3300046684 Bacteria 2270
1024 Ga0495669_0036868 3300046684 Bacteria 2162
1025 Ga0495669_0053078 3300046684 Bacteria 1822
1026 Ga0495669_0538708 3300046684 Unclassified 568
1027 Ga0495613_0069142 3300046689 Bacteria 2575
1028 Ga0495613_0793672 3300046689 Bacteria 618
1029 Ga0495624_0007752 3300046690 Bacteria 7532
1030 Ga0495624_0340855 3300046690 Bacteria 902
1031 Ga0495670_0009961 3300046691 Bacteria 4671
1032 Ga0495670_0021082 3300046691 Bacteria 3213
1033 Ga0495670_0021157 3300046691 Bacteria 3208
1034 Ga0495670_0022494 3300046691 Bacteria 3112
1035 Ga0495670_0031986 3300046691 Bacteria 2615
1036 Ga0495670_0034737 3300046691 Bacteria 2512
1037 Ga0495670_0039198 3300046691 Bacteria 2362
1038 Ga0495670_0195811 3300046691 Bacteria 1069
1039 Ga0495670_0199854 3300046691 Bacteria 1058
1040 Ga0495670_0274896 3300046691 Bacteria 900
1041 Ga0495670_0391270 3300046691 Bacteria 750
1042 Ga0495670_0408214 3300046691 Bacteria 734
1043 Ga0495670_0421933 3300046691 Bacteria 721
1044 Ga0495670_0464390 3300046691 Bacteria 686
1045 Ga0495670_0523431 3300046691 Bacteria 645
1046 Ga0495671_0000001 3300046692 Bacteria 1169494
1047 Ga0495671_0000744 3300046692 Bacteria 23455
1048 Ga0495671_0000848 3300046692 Bacteria 21841
1049 Ga0495671_0022004 3300046692 Bacteria 3344
1050 Ga0495671_0023568 3300046692 Bacteria 3214
1051 Ga0495671_0027348 3300046692 Bacteria 2947
1052 Ga0495671_0028223 3300046692 Bacteria 2893
1053 Ga0495671_0079765 3300046692 Bacteria 1604
1054 Ga0495671_0112690 3300046692 Bacteria 1328
1055 Ga0495671_0180502 3300046692 Bacteria 1025
1056 Ga0495671_0397099 3300046692 Bacteria 660
1057 Ga0495649_0002149 3300046694 Bacteria 14104
1058 Ga0495649_0007989 3300046694 Bacteria 6396
1059 Ga0495649_0019739 3300046694 Bacteria 3784
1060 Ga0495649_0031292 3300046694 Bacteria 2935
1061 Ga0495649_0051556 3300046694 Bacteria 2231
1062 Ga0495649_0133357 3300046694 Bacteria 1310
1063 Ga0495649_0159202 3300046694 Bacteria 1184
1064 Ga0495649_0206303 3300046694 Bacteria 1019
1065 Ga0495649_0218901 3300046694 Bacteria 985
1066 Ga0495589_0000037 3300046794 Bacteria 150603
1067 Ga0495589_0001177 3300046794 Bacteria 15597
1068 Ga0495589_0001260 3300046794 Bacteria 14998
1069 Ga0495589_0010118 3300046794 Bacteria 4900
1070 Ga0495589_0014498 3300046794 Bacteria 4056
1071 Ga0495589_0017796 3300046794 Bacteria 3645
1072 Ga0495589_0026334 3300046794 Bacteria 2947
1073 Ga0495589_0038794 3300046794 Bacteria 2382
1074 Ga0495589_0042313 3300046794 Bacteria 2270
1075 Ga0495589_0085592 3300046794 Bacteria 1531
1076 Ga0495589_0163846 3300046794 Bacteria 1058
1077 Ga0495589_0180011 3300046794 Bacteria 1003
1078 Ga0495589_0241467 3300046794 Bacteria 845
1079 Ga0495600_0002155 3300046809 Bacteria 11161
1080 Ga0495600_0104154 3300046809 Bacteria 1849
1081 Ga0495660_0000178 3300046810 Bacteria 68956
1082 Ga0495660_0001476 3300046810 Bacteria 15998
1083 Ga0495660_0003120 3300046810 Bacteria 10328
1084 Ga0495660_0003323 3300046810 Bacteria 9978
1085 Ga0495660_0017672 3300046810 Bacteria 4103
1086 Ga0495660_0022155 3300046810 Bacteria 3630
1087 Ga0495660_0043740 3300046810 Bacteria 2467
1088 Ga0495660_0044082 3300046810 Bacteria 2456
1089 Ga0495660_0059138 3300046810 Bacteria 2062
1090 Ga0495660_0095189 3300046810 Bacteria 1541
1091 Ga0495660_0118619 3300046810 Bacteria 1341
1092 Ga0495660_0124887 3300046810 Bacteria 1297
1093 Ga0495660_0128231 3300046810 Bacteria 1275
1094 Ga0495581_0008712 3300047315 Bacteria 5876
1095 Ga0495581_0066676 3300047315 Bacteria 2081
1096 Ga0495581_0078795 3300047315 Bacteria 1906
1097 Ga0495581_0287595 3300047315 Bacteria 961
1098 Ga0495604_0036530 3300047317 Bacteria 3873
1099 Ga0495604_0085661 3300047317 Bacteria 2351
1100 Ga0495604_0148305 3300047317 Bacteria 1669
1101 Ga0495604_0192669 3300047317 Bacteria 1419
1102 Ga0495604_0223117 3300047317 Bacteria 1296
1103 Ga0495604_0262021 3300047317 Bacteria 1174
1104 Ga0495636_0006148 3300047318 Bacteria 4715
1105 Ga0495636_0012768 3300047318 Bacteria 3327
1106 Ga0495636_0017608 3300047318 Bacteria 2860
1107 Ga0495636_0069736 3300047318 Bacteria 1498
1108 Ga0495636_0087023 3300047318 Bacteria 1352
1109 Ga0495636_0094728 3300047318 Bacteria 1299
1110 Ga0495636_0104862 3300047318 Bacteria 1239
1111 Ga0495636_0180386 3300047318 Bacteria 958
1112 Ga0495636_0367497 3300047318 Bacteria 681
1113 Ga0495636_0445788 3300047318 Bacteria 621
1114 Ga0495674_0003394 3300047319 Bacteria 15471
1115 Ga0495674_0784125 3300047319 Bacteria 742
1116 Ga0495672_0000097 3300047320 Bacteria 141608
1117 Ga0495672_0000424 3300047320 Bacteria 50607
1118 Ga0495672_0000590 3300047320 Bacteria 41027
1119 Ga0495672_0000758 3300047320 Bacteria 35256
1120 Ga0495672_0001440 3300047320 Bacteria 23361
1121 Ga0495672_0001672 3300047320 Bacteria 21505
1122 Ga0495672_0002152 3300047320 Bacteria 18417
1123 Ga0495672_0011872 3300047320 Bacteria 6114
1124 Ga0495672_0098796 3300047320 Bacteria 1587
1125 Ga0495672_0108065 3300047320 Bacteria 1497
1126 Ga0495676_0000342 3300047321 Bacteria 38031
1127 Ga0495676_0014902 3300047321 Bacteria 6942
1128 Ga0495676_0077540 3300047321 Bacteria 2534
1129 Ga0495676_0108382 3300047321 Bacteria 2043
1130 Ga0495676_0123990 3300047321 Bacteria 1875
1131 Ga0495676_0169465 3300047321 Bacteria 1538
1132 Ga0495676_0202693 3300047321 Bacteria 1378
1133 Ga0495680_0005344 3300047322 Bacteria 12118
1134 Ga0495680_0086272 3300047322 Bacteria 2362
1135 Ga0495680_0909474 3300047322 Bacteria 568
1136 Ga0495683_0000144 3300047323 Bacteria 69959
1137 Ga0495683_0000952 3300047323 Bacteria 20358
1138 Ga0495683_0001039 3300047323 Bacteria 19287
1139 Ga0495683_0016641 3300047323 Bacteria 3816
1140 Ga0495683_0017608 3300047323 Bacteria 3701
1141 Ga0495683_0029959 3300047323 Bacteria 2779
1142 Ga0495683_0035711 3300047323 Bacteria 2526
1143 Ga0495683_0087662 3300047323 Bacteria 1511
1144 Ga0495683_0095436 3300047323 Bacteria 1436
1145 Ga0495683_0169338 3300047323 Bacteria 1005
1146 Ga0495687_000002 3300047443 Bacteria 1085770
1147 Ga0495687_000017 3300047443 Bacteria 350429
1148 Ga0495687_000024 3300047443 Bacteria 316676
1149 Ga0495687_000148 3300047443 Bacteria 106947
1150 Ga0495687_001539 3300047443 Bacteria 20979
1151 Ga0495687_005580 3300047443 Bacteria 7970
1152 Ga0495687_005608 3300047443 Bacteria 7936
1153 Ga0495687_010840 3300047443 Bacteria 4952
1154 Ga0495687_015538 3300047443 Bacteria 3867
1155 Ga0495687_029001 3300047443 Bacteria 2566
1156 Ga0495687_076171 3300047443 Bacteria 1328
1157 Ga0495675_0002413 3300047444 Bacteria 11164
1158 Ga0495675_0004400 3300047444 Bacteria 8527
1159 Ga0495675_0147236 3300047444 Bacteria 1456
1160 Ga0495677_0000011 3300047445 Bacteria 149837
1161 Ga0495677_0000979 3300047445 Bacteria 11487
1162 Ga0495677_0001358 3300047445 Bacteria 9771
1163 Ga0495677_0003050 3300047445 Bacteria 6513
1164 Ga0495677_0004099 3300047445 Bacteria 5626
1165 Ga0495677_0006130 3300047445 Bacteria 4549
1166 Ga0495677_0007985 3300047445 Bacteria 3932
1167 Ga0495677_0011203 3300047445 Bacteria 3282
1168 Ga0495677_0016146 3300047445 Bacteria 2709
1169 Ga0495677_0074320 3300047445 Bacteria 1268
1170 Ga0495677_0139302 3300047445 Bacteria 931
1171 Ga0495677_0141551 3300047445 Bacteria 924
1172 Ga0495677_0149027 3300047445 Bacteria 900
1173 Ga0495677_0165097 3300047445 Bacteria 855
1174 Ga0495679_003113 3300047446 Bacteria 8123
1175 Ga0495679_003957 3300047446 Bacteria 6981
1176 Ga0495679_009988 3300047446 Bacteria 3760
1177 Ga0495679_016017 3300047446 Bacteria 2723
1178 Ga0495679_017414 3300047446 Bacteria 2572
1179 Ga0495679_050542 3300047446 Bacteria 1249
1180 Ga0495685_000077 3300047447 Bacteria 37238
1181 Ga0495685_006760 3300047447 Bacteria 3769
1182 Ga0495685_010360 3300047447 Bacteria 3124
1183 Ga0495685_024841 3300047447 Bacteria 2062
1184 Ga0495685_034772 3300047447 Bacteria 1731
1185 Ga0495685_095119 3300047447 Bacteria 985
1186 Ga0495685_175374 3300047447 Bacteria 692
1187 Ga0495673_0000003 3300047469 Bacteria 1491337
1188 Ga0495673_0000097 3300047469 Bacteria 182247
1189 Ga0495673_0000100 3300047469 Bacteria 173962
1190 Ga0495673_0002730 3300047469 Bacteria 12103
1191 Ga0495673_0010183 3300047469 Bacteria 5136
1192 Ga0495681_0002294 3300047470 Bacteria 13753
1193 Ga0495681_0002968 3300047470 Bacteria 11956
1194 Ga0495681_0007086 3300047470 Bacteria 7235
1195 Ga0495681_0009449 3300047470 Bacteria 6007
1196 Ga0495681_0011139 3300047470 Bacteria 5385
1197 Ga0495681_0011368 3300047470 Bacteria 5304
1198 Ga0495681_0011590 3300047470 Bacteria 5236
1199 Ga0495681_0014249 3300047470 Bacteria 4569
1200 Ga0495681_0020183 3300047470 Bacteria 3620
1201 Ga0495681_0020331 3300047470 Bacteria 3605
1202 Ga0495681_0048194 3300047470 Bacteria 2021
1203 Ga0495681_0155420 3300047470 Bacteria 956
1204 Ga0495686_0000428 3300047472 Bacteria 65588
1205 Ga0495686_0001462 3300047472 Bacteria 25726
1206 Ga0495686_0001479 3300047472 Bacteria 25538
1207 Ga0495686_0003365 3300047472 Bacteria 13932
1208 Ga0495686_0008053 3300047472 Bacteria 7807
1209 Ga0495686_0049892 3300047472 Bacteria 2631
1210 Ga0495686_0121758 3300047472 Bacteria 1554
1211 Ga0495686_0184539 3300047472 Bacteria 1206
1212 Ga0495686_0189731 3300047472 Bacteria 1185
1213 Ga0495686_0228281 3300047472 Bacteria 1055
1214 Ga0495686_0293147 3300047472 Bacteria 900
1215 Ga0495686_0377640 3300047472 Bacteria 765
1216 Ga0495593_0002473 3300047673 Bacteria 11113
1217 Ga0495593_0021073 3300047673 Bacteria 3644
1218 Ga0495593_0128819 3300047673 Bacteria 1285
1219 Ga0495602_0086299 3300048088 Bacteria 2620
1220 Ga0495602_0128484 3300048088 Bacteria 2025
1221 Ga0495602_0459422 3300048088 Bacteria 897
1222 Ga0495614_0002563 3300048089 Bacteria 8081
1223 Ga0495614_0162459 3300048089 Bacteria 1000
1224 Ga0495614_0181823 3300048089 Bacteria 946
1225 Ga0495614_0205280 3300048089 Bacteria 893
1226 Ga0495614_0251407 3300048089 Bacteria 808
1227 Ga0495615_0000530 3300048090 Bacteria 5448
1228 Ga0495615_0080961 3300048090 Bacteria 890
1229 Ga0495626_0000004 3300048091 Bacteria 356599
1230 Ga0495626_0000016 3300048091 Bacteria 232214
1231 Ga0495626_0000569 3300048091 Bacteria 36626
1232 Ga0495626_0005849 3300048091 Bacteria 7094
1233 Ga0495626_0008239 3300048091 Bacteria 5734
1234 Ga0495626_0009582 3300048091 Bacteria 5226
1235 Ga0495626_0027385 3300048091 Bacteria 2772
1236 Ga0495626_0033635 3300048091 Bacteria 2455
1237 Ga0495626_0040645 3300048091 Bacteria 2195
1238 Ga0495626_0054570 3300048091 Bacteria 1834
1239 Ga0495626_0069092 3300048091 Bacteria 1591
1240 Ga0495626_0091745 3300048091 Bacteria 1335
1241 Ga0495626_0092145 3300048091 Bacteria 1331
1242 Ga0495626_0118149 3300048091 Bacteria 1142
1243 Ga0495626_0176147 3300048091 Bacteria 889
1244 Ga0496100_0004475 3300048903 Bacteria 7416
1245 Ga0496100_0266561 3300048903 Bacteria 1272
1246 Ga0496100_0332721 3300048903 Bacteria 1143
1247 Ga0496100_0380203 3300048903 Bacteria 1072
1248 Ga0496101_0106911 3300048904 Bacteria 2101
1249 Ga0496101_0108970 3300048904 Bacteria 2083
1250 Ga0496101_0702507 3300048904 Bacteria 798
1251 Ga0496101_0820075 3300048904 Bacteria 733
1252 Ga0496102_0000461 3300048905 Bacteria 45293
1253 Ga0496102_0016630 3300048905 Bacteria 6431
1254 Ga0496102_0020653 3300048905 Bacteria 5820
1255 Ga0496102_0023210 3300048905 Bacteria 5506
1256 Ga0496102_0040178 3300048905 Bacteria 4230
1257 Ga0496102_0069033 3300048905 Bacteria 3244
1258 Ga0496102_0076786 3300048905 Bacteria 3073
1259 Ga0496102_0178602 3300048905 Bacteria 1999
1260 Ga0496102_0205505 3300048905 Bacteria 1857
1261 Ga0496102_0760861 3300048905 Bacteria 891
1262 Ga0496102_0941197 3300048905 Bacteria 785
1263 Ga0496102_1447319 3300048905 Bacteria 606
1264 Ga0496103_0001321 3300048906 Bacteria 16822
1265 Ga0496103_0002752 3300048906 Bacteria 10969
1266 Ga0496103_0006660 3300048906 Bacteria 6896
1267 Ga0496103_0007974 3300048906 Bacteria 6290
1268 Ga0496103_0045259 3300048906 Bacteria 2716
1269 Ga0496103_0143904 3300048906 Bacteria 1525
1270 Ga0496104_0616755 3300048907 Bacteria 995
1271 Ga0496104_0668275 3300048907 Bacteria 947
1272 Ga0496104_1316698 3300048907 Bacteria 625
1273 Ga0496105_0077123 3300048908 Bacteria 2752
1274 Ga0496105_0113339 3300048908 Bacteria 2238
1275 Ga0496105_0747240 3300048908 Bacteria 747
1276 Ga0496106_0230450 3300048909 Bacteria 1479
1277 Ga0496106_0268693 3300048909 Bacteria 1365
1278 Ga0496107_0021795 3300048910 Bacteria 4527
1279 Ga0496108_0010622 3300048911 Bacteria 7469
1280 Ga0496108_0023299 3300048911 Bacteria 5093
1281 Ga0496108_0394878 3300048911 Unclassified 1208
1282 Ga0496108_0483826 3300048911 Bacteria 1081
1283 Ga0496109_0081610 3300048912 Unclassified 2980
1284 Ga0496109_0149594 3300048912 Bacteria 2186
1285 Ga0496109_0321254 3300048912 Bacteria 1461
1286 Ga0496109_0656844 3300048912 Bacteria 985
1287 Ga0496109_1427618 3300048912 Bacteria 627
1288 Ga0496110_0000019 3300048913 Bacteria 79137
1289 Ga0496110_0003499 3300048913 Bacteria 12050
1290 Ga0496110_0807477 3300048913 Bacteria 842
1291 Ga0496111_0031224 3300048914 Bacteria 3794
1292 Ga0496111_0246770 3300048914 Bacteria 1325
1293 Ga0496112_0032351 3300048915 Bacteria 5079
1294 Ga0496112_0037388 3300048915 Bacteria 4739
1295 Ga0496112_0037948 3300048915 Bacteria 4705
1296 Ga0496112_0246092 3300048915 Bacteria 1740
1297 Ga0496112_0252691 3300048915 Bacteria 1714
1298 Ga0496112_1095950 3300048915 Bacteria 715
1299 Ga0496113_0037686 3300048916 Bacteria 3550
1300 Ga0496113_0123029 3300048916 Bacteria 2030
1301 Ga0496113_0328300 3300048916 Bacteria 1227
1302 Ga0496113_0421049 3300048916 Bacteria 1073
1303 Ga0496113_0738842 3300048916 Bacteria 784
1304 Ga0496113_0782382 3300048916 Unclassified 759
1305 Ga0496114_0436287 3300048917 Bacteria 1160
1306 Ga0496114_0475759 3300048917 Bacteria 1105
1307 Ga0496114_0532190 3300048917 Unclassified 1039
1308 Ga0496115_0011854 3300048918 Bacteria 6548
1309 Ga0496115_0034428 3300048918 Bacteria 4003
1310 Ga0496115_0060772 3300048918 Bacteria 3045
1311 Ga0496115_0251481 3300048918 Bacteria 1455
1312 Ga0496115_0282915 3300048918 Bacteria 1361
1313 Ga0496115_0712674 3300048918 Bacteria 788
1314 Ga0496116_0039030 3300048919 Bacteria 3288
1315 Ga0496116_0080004 3300048919 Bacteria 2031
1316 Ga0496117_0000132 3300048920 Bacteria 162117
1317 Ga0496118_0000099 3300048921 Bacteria 160412
1318 Ga0496119_0321679 3300048922 Bacteria 757
1319 Ga0496120_0105101 3300048923 Bacteria 1485
1320 Ga0496121_0080423 3300048924 Bacteria 2583
1321 Ga0496121_0127464 3300048924 Bacteria 1911
1322 Ga0496121_0210954 3300048924 Bacteria 1376
1323 Ga0496121_0236303 3300048924 Bacteria 1276
1324 Ga0496121_0615776 3300048924 Bacteria 667
1325 Ga0496122_0000835 3300048925 Bacteria 58311
1326 Ga0496122_0001402 3300048925 Bacteria 39141
1327 Ga0496122_0036243 3300048925 Bacteria 3993
1328 Ga0496122_0477397 3300048925 Bacteria 611
1329 Ga0496123_0001003 3300048926 Bacteria 43216
1330 Ga0496123_0004574 3300048926 Bacteria 14422
1331 Ga0496123_0051903 3300048926 Bacteria 2726
1332 Ga0496123_0053089 3300048926 Bacteria 2682
1333 Ga0496123_0299454 3300048926 Bacteria 768
1334 Ga0496124_0008384 3300048927 Bacteria 10812
1335 Ga0496124_0017479 3300048927 Bacteria 6757
1336 Ga0496124_0041651 3300048927 Bacteria 3961
1337 Ga0496124_0061626 3300048927 Bacteria 3144
1338 Ga0496124_0118308 3300048927 Bacteria 2121
1339 Ga0496124_0143321 3300048927 Bacteria 1883
1340 Ga0496124_0173038 3300048927 Bacteria 1670
1341 Ga0496124_0218266 3300048927 Bacteria 1436
1342 Ga0496124_0295788 3300048927 Bacteria 1172
1343 Ga0496124_0731909 3300048927 Bacteria 622
1344 Ga0496125_0001280 3300048928 Bacteria 37321
1345 Ga0496125_0023719 3300048928 Bacteria 5656
1346 Ga0496125_0381725 3300048928 Bacteria 830
1347 Ga0496126_0015539 3300048929 Bacteria 7649
1348 Ga0501308_001629 3300049128 Bacteria 1839
1349 Ga0501309_047482 3300049129 Bacteria 668
1350 Ga0501310_022591 3300049130 Bacteria 795
1351 Ga0501310_073953 3300049130 Bacteria 526
1352 Ga0501304_002381 3300049160 Bacteria 1301
1353 Ga0501305_098766 3300049161 Bacteria 542
1354 Ga0501307_014325 3300049162 Bacteria 967
1355 Ga0501307_033547 3300049162 Bacteria 722
1356 Ga0495678_000004 3300049459 Bacteria 532920
1357 Ga0495678_000384 3300049459 Bacteria 44841
1358 Ga0495678_000515 3300049459 Bacteria 37716
1359 Ga0495678_000866 3300049459 Bacteria 26949
1360 Ga0495678_001499 3300049459 Bacteria 18192
1361 Ga0495678_017736 3300049459 Bacteria 3217
1362 Ga0495678_024378 3300049459 Bacteria 2612
1363 Ga0495678_040952 3300049459 Bacteria 1857
1364 Ga0495678_043619 3300049459 Bacteria 1779
1365 Ga0495678_045351 3300049459 Bacteria 1734
1366 Ga0495678_156665 3300049459 Bacteria 731
1367 Ga0495678_209202 3300049459 Bacteria 597
1368 Ga0495682_0000869 3300049460 Bacteria 18741
1369 Ga0495682_0001115 3300049460 Bacteria 15630
1370 Ga0495682_0006435 3300049460 Bacteria 4749
1371 Ga0495682_0031927 3300049460 Bacteria 1945
1372 Ga0501312_034371 3300049528 Bacteria 808
1373 Ga0501314_024195 3300049530 Bacteria 647
1374 Ga0501315_022278 3300049531 Bacteria 863
1375 Ga0501315_037778 3300049531 Bacteria 720
1376 Ga0501316_013762 3300049532 Bacteria 959
1377 Ga0501318_020502 3300049534 Bacteria 833
1378 Ga0501322_024908 3300049538 Bacteria 543
1379 Ga0501323_054399 3300049539 Bacteria 614
1380 Ga0501230_002780 3300049667 Bacteria 2255
1381 Ga0501238_008754 3300049671 Bacteria 1335
1382 Ga0501249_002892 3300049679 Bacteria 3455
1383 Ga0501234_055166 3300049707 Bacteria 667
1384 Ga0501263_027310 3300049760 Bacteria 793
1385 Ga0501265_102468 3300049762 Bacteria 525
1386 Ga0501269_000099 3300049766 Bacteria 27098
1387 Ga0501279_002296 3300049775 Bacteria 2512
1388 Ga0501279_017123 3300049775 Bacteria 1013
1389 Ga0501035_0000965 3300049822 Bacteria 30391
1390 Ga0501220_04705 3300049852 Bacteria 638
1391 nmdc:mga03683_52564_c1 3300050489 Bacteria 1703
1392 nmdc:mga0qj67_80226_c1 3300050509 Bacteria 2614
1393 nmdc:mga08y16_312463_c1 3300050511 Unclassified 1618
1394 nmdc:mga0n895_1047098_c1 3300050512 Unclassified 795
1395 nmdc:mga0n895_197141_c1 3300050512 Bacteria 2045
1396 nmdc:mga0rr50_1700061_c1 3300050513 Unclassified 532
1397 nmdc:mga08x19_320078_c1 3300050514 Bacteria 1079
1398 nmdc:mga08x19_8569_c1 3300050514 Bacteria 4583
1399 nmdc:mga0a205_759673_c1 3300050515 Unclassified 818
1400 Ga0500647_0364579 3300053091 Bacteria 597
1401 Ga0500594_0024669 3300053118 Bacteria 1534
1402 Ga0500618_000358 3300053125 Bacteria 31730
1403 Ga0500618_035890 3300053125 Bacteria 1150
1404 Ga0500586_027112 3300053145 Bacteria 1860
1405 Ga0500622_0000001 3300053156 Bacteria 657715
1406 Ga0587093_037672 3300059478 Bacteria 722
1407 Ga0587066_061325 3300059490 Bacteria 768
1408 Ga0587073_0052305 3300059492 Bacteria 930
1409 Ga0587077_036677 3300059493 Bacteria 964
1410 Ga0587080_003170 3300059503 Bacteria 2020
1411 Ga0587080_031135 3300059503 Bacteria 930
1412 Ga0587088_048226 3300059508 Bacteria 826
1413 Ga0587090_041300 3300059510 Bacteria 813
1414 Ga0587091_088410 3300059511 Bacteria 707
1415 Ga0587094_056969 3300059513 Bacteria 675
1416 Ga0587098_052710 3300059604 Bacteria 621
1417 Ga0587106_023638 3300059605 Bacteria 933
1418 Ga0587129_024236 3300059608 Bacteria 555
1419 Ga0587099_051983 3300059622 Bacteria 549
1420 Ga0587101_024610 3300059623 Bacteria 895
1421 Ga0587115_053305 3300059626 Bacteria 662
1422 Ga0587117_035241 3300059627 Bacteria 774
1423 Ga0587062_061390 3300059639 Bacteria 660
1424 Ga0587062_068412 3300059639 Bacteria 638
1425 Ga0587068_003385 3300059641 Bacteria 2033
1426 Ga0587068_138221 3300059641 Bacteria 542
1427 Ga0587069_004663 3300059642 Bacteria 1557
1428 Ga0587075_024541 3300059644 Bacteria 921
1429 Ga0587076_036335 3300059645 Bacteria 900
1430 Ga0587079_042086 3300059647 Bacteria 927
1431 Ga0587102_045335 3300059649 Bacteria 579
1432 Ga0587105_007802 3300059651 Bacteria 765
1433 Ga0587107_073157 3300059652 Bacteria 630
1434 Ga0587124_019618 3300059660 Bacteria 682
1435 Ga0587071_061264 3300060344 Bacteria 800
1436 Ga0587111_0057014 3300060346 Bacteria 878
1437 Ga0587111_0084966 3300060346 Bacteria 763
1438 Ga0466962_0083668 3300061719 Bacteria 1526
1439 Ga0466962_0114442 3300061719 Bacteria 1299
1440 2643786992 2643221554 Bacteria 6603920
1441 2643802316 2643221556 Bacteria 7251154
1442 2644215914 2643221638 Bacteria 6579467
1443 2644254384 2643221645 Bacteria 7207331
1444 2644357949 2643221664 Bacteria 7272945
1445 2644475824 2643221684 Bacteria 7145183
1446 2738741196 2738541280 Bacteria 6630198
1447 2738829264 2738541297 Bacteria 6549566
1448 2738845662 2738541300 Bacteria 6675882
1449 2739153060 2738541357 Bacteria 6549408
1450 2739194980 2738543003 Bacteria 6549560
1451 2739277470 2738543018 Bacteria 6718814
1452 2739321456 2738543026 Bacteria 6549408
1453 2739339988 2738543029 Bacteria 6549249
1454 2739346607 2738543030 Bacteria 6719714
1455 2809145361 2808606418 Bacteria 6724496
1456 2821131543 2821131069 Bacteria 6108407
1457 2842718111 2842711865 Bacteria 7155354
1458 2857554423 2857553236 Bacteria 6166726
1459 2857563850 2857558681 Bacteria 6617694
1460 2857564791 2857564685 Bacteria 6290584
1461 2904426082 2904424332 Bacteria 7633521
1462 2919478473 2919476304 Bacteria 5888696
1463 8047673826 8047673197 Bacteria 7395230
1464 Ga0207665_10281142
1465 MRS1b_contig_3883174
1466 CNXas_1000109
1467 JGI25154J39366_1001666
1468 JGI25158J39367_1016024
1469 JGI25158J39367_1026400
1470 JGI25152J39213_1000395
1471 JGI25152J39213_1021195
1472 JGI25150J39212_1001869
1473 JGI25150J39212_1003324
1474 JGI25159J45721_1004182
1475 JGI25159J45721_1007879
1476 JGI25159J45721_1008010
1477 Ga0006759J45824_1074564
1478 JGI25151J46595_10143722
1479 JGI25406J46586_10000011
1480 JGI25153J46596_10016332
1481 Ga0006770J48903_1038274
1482 rootL2_10109828
1483 JGI25160J50197_1012431
1484 JGI25161J50226_1004160
1485 JGI25161J50226_1006147
1486 JGI25161J50226_1008312
1487 Ga0007417J51691_1055251
1488 Ga0007409J51694_1016091
1489 Ga0055525_1000001
1490 Ga0055529_1000146
1491 Ga0055526_1000074
1492 Ga0055526_1000299
1493 Ga0055526_1004222
1494 Ga0055526_1015299
1495 Ga0055526_1030873
1496 Ga0055537_1000154
1497 Ga0055537_1020048
1498 Ga0055524_1000021
1499 Ga0055524_1000099
1500 Ga0055524_1009788
1501 Ga0055524_1020989
1502 Ga0055534_1000513
1503 Ga0055534_1037235
1504 Ga0055534_1046031
1505 Ga0055528_1007230
1506 Ga0055528_1027547
1507 Ga0055530_10101324
1508 Ga0055530_10104705
1509 Ga0055531_10003560
1510 Ga0055543_1002596
1511 Ga0055543_1005900
1512 Ga0055543_1026489
1513 Ga0065165_1000055
1514 Ga0065165_1003015
1515 Ga0065165_1013829
1516 Ga0065165_1031771
1517 Ga0065165_1044818
1518 Ga0065704_10301195
1519 Ga0065712_10098684
1520 Ga0065712_10381451
1521 Ga0070676_10006530
1522 Ga0070676_10027936
1523 Ga0070676_10100217
1524 Ga0070690_100159858
1525 Ga0070690_100533002
1526 Ga0070690_101299440
1527 Ga0070670_100002302
1528 Ga0070670_100006241
1529 Ga0070670_100890794
1530 Ga0070666_10041425
1531 Ga0070666_11129305
1532 Ga0070680_100113297
1533 Ga0068868_100039996
1534 Ga0070660_100045119
1535 Ga0070689_100045940
1536 Ga0070689_100209478
1537 Ga0070661_100199014
1538 Ga0070661_100571449
1539 Ga0070661_100887244
1540 Ga0070668_100012213
1541 Ga0070668_101247694
1542 Ga0070669_100014990
1543 Ga0070669_100050766
1544 Ga0070675_100033029
1545 Ga0070675_100327014
1546 Ga0070671_100015082
1547 Ga0070671_100022258
1548 Ga0070671_100750893
1549 Ga0070671_101048816
1550 Ga0070674_100316035
1551 Ga0070688_100001382
1552 Ga0070688_100393804
1553 Ga0070659_100016372
1554 Ga0070659_101646324
1555 Ga0070667_100001152
1556 Ga0070667_100037387
1557 Ga0070667_100130998
1558 Ga0070710_11084711
1559 Ga0070711_100309067
1560 Ga0070708_100069853
1561 Ga0070708_100095985
1562 Ga0070708_100151113
1563 Ga0070708_100678736
1564 Ga0070708_100993817
1565 Ga0070663_100487664
1566 Ga0070663_100750009
1567 Ga0070678_100032818
1568 Ga0070678_101004950
1569 Ga0070678_101026758
1570 Ga0070662_100166473
1571 Ga0070662_100309108
1572 Ga0068867_100830696
1573 Ga0068867_101237614
1574 Ga0070706_100000116
1575 Ga0070706_100018698
1576 Ga0070706_100030413
1577 Ga0070706_100035119
1578 Ga0070706_100394020
1579 Ga0070706_101359080
1580 Ga0070706_101692047
1581 Ga0070707_100002729
1582 Ga0070707_100024521
1583 Ga0070707_100025365
1584 Ga0070707_100025898
1585 Ga0070707_100036840
1586 Ga0070707_100040136
1587 Ga0070707_100172499
1588 Ga0070707_100174613
1589 Ga0070707_100430691
1590 Ga0070707_100634912
1591 Ga0070707_101153467
1592 Ga0070698_100003134
1593 Ga0070698_100010744
1594 Ga0070698_100097143
1595 Ga0070698_100521070
1596 Ga0070698_101424514
1597 Ga0070699_100073974
1598 Ga0070699_100121464
1599 Ga0070699_100970298
1600 Ga0070679_101207007
1601 Ga0070697_100003060
1602 Ga0070697_100004215
1603 Ga0070697_100014381
1604 Ga0070697_100045646
1605 Ga0070697_100070956
1606 Ga0070697_100171703
1607 Ga0070697_100184858
1608 Ga0070697_100362220
1609 Ga0070697_101366158
1610 Ga0070672_100003958
1611 Ga0070672_100311686
1612 Ga0070672_100552408
1613 Ga0070672_101073981
1614 Ga0070695_100045457
1615 Ga0070693_100285770
1616 Ga0070665_100046012
1617 Ga0070665_100159514
1618 Ga0070704_100924943
1619 Ga0070704_100937297
1620 Ga0068855_100044300
1621 Ga0070664_100257608
1622 Ga0070664_100271830
1623 Ga0070664_100792839
1624 Ga0070664_101708942
1625 Ga0068857_100381724
1626 Ga0068856_100937236
1627 Ga0068856_101631923
1628 Ga0070702_100522835
1629 Ga0070702_101523037
1630 Ga0068852_100132069
1631 Ga0068866_10030064
1632 Ga0068866_10155285
1633 Ga0068851_10140563
1634 Ga0068860_100603401
1635 Ga0081540_1195395
1636 Ga0081539_10000139
1637 Ga0081539_10002232
1638 Ga0081539_10012174
1639 Ga0081539_10052402
1640 Ga0081539_10052887
1641 Ga0070717_10002406
1642 Ga0070717_10006132
1643 Ga0070717_10148449
1644 Ga0075364_10477428
1645 Ga0070716_100306864
1646 Ga0070716_100311420
1647 Ga0070716_100350730
1648 Ga0070716_100643389
1649 Ga0075362_10055685
1650 Ga0097621_100004370
1651 Ga0097621_100004743
1652 Ga0097621_101288069
1653 Ga0068871_100017920
1654 Ga0068871_100040568
1655 Ga0068871_100127459
1656 Ga0068871_100263499
1657 Ga0075433_10655378
1658 Ga0075434_100073372
1659 Ga0075434_101182136
1660 Ga0068865_100083101
1661 Ga0068865_100183875
1662 Ga0075436_100021119
1663 Ga0079104_1020522
1664 Ga0099826_10000002
1665 Ga0099794_10138050
1666 Ga0105244_10001358
1667 Ga0105244_10001435
1668 Ga0105244_10066484
1669 Ga0105244_10526848
1670 Ga0105250_10242911
1671 Ga0105240_10686415
1672 Ga0105240_10813296
1673 Ga0105240_11305553
1674 Ga0111539_10260786
1675 Ga0105245_10084318
1676 Ga0105245_10119936
1677 Ga0105245_10167216
1678 Ga0105245_10651147
1679 Ga0105245_13006666
1680 Ga0105243_10234788
1681 Ga0105243_11841945
1682 Ga0105241_10193522
1683 Ga0105242_10021980
1684 Ga0105242_10974916
1685 Ga0105248_11780232
1686 Ga0105237_10302030
1687 Ga0105237_10856390
1688 Ga0105238_10362340
1689 Ga0105239_10068393
1690 Ga0105239_10492732
1691 Ga0105239_12258985
1692 Ga0157327_1013057
1693 Ga0157373_10078322
1694 Ga0157373_10634948
1695 Ga0157373_11009385
1696 Ga0157371_10000078
1697 Ga0157370_10796901
1698 Ga0157374_10020633
1699 Ga0157374_10099139
1700 Ga0157374_10116843
1701 Ga0157374_10255295
1702 Ga0157374_10610886
1703 Ga0157378_10022702
1704 Ga0157378_10023772
1705 Ga0157378_10093439
1706 Ga0157378_10093654
1707 Ga0157378_10156781
1708 Ga0157378_10258166
1709 Ga0157378_10271158
1710 Ga0157378_10297016
1711 Ga0157378_10486787
1712 Ga0157378_10626109
1713 Ga0157378_10897282
1714 Ga0157378_12407997
1715 Ga0163162_10004766
1716 Ga0163162_10112128
1717 Ga0163162_10262665
1718 Ga0157372_10224982
1719 Ga0157372_10877763
1720 Ga0157375_10000847
1721 Ga0157375_10016097
1722 Ga0157375_10168179
1723 Ga0157375_10387053
1724 Ga0157375_13139799
1725 Ga0182008_10021358
1726 Ga0157377_11272339
1727 Ga0157376_10002921
1728 Ga0157376_10486261
1729 Ga0157376_10568546
1730 Ga0182006_1000026
1731 Ga0182006_1037798
1732 Ga0182006_1097963
1733 Ga0182006_1195413
1734 Ga0182007_10086611
1735 Ga0182007_10276411
1736 Ga0182005_1000007
1737 Ga0182005_1081840
1738 Ga0163161_10040505
1739 Ga0163161_10262967
1740 Ga0206351_10247105
1741 Ga0206353_10452765
1742 Ga0154015_1381368
1743 Ga0213872_10000028
1744 Ga0213872_10006879
1745 Ga0213872_10033421
1746 Ga0209436_100351
1747 Ga0209436_103199
1748 Ga0209563_100007
1749 Ga0209437_108742
1750 Ga0209437_114140
1751 Ga0207425_1000001
1752 Ga0207425_1000327
1753 Ga0207425_1000339
1754 Ga0207425_1064128
1755 Ga0209646_1000010
1756 Ga0209677_104764
1757 Ga0209148_1000360
1758 Ga0209129_1000001
1759 Ga0209129_1011719
1760 Ga0209565_1000057
1761 Ga0209565_1003411
1762 Ga0209565_1003951
1763 Ga0209565_1087400
1764 Ga0209455_1000037
1765 Ga0209673_1000051
1766 Ga0209673_1007915
1767 Ga0209130_1000091
1768 Ga0209130_1002422
1769 Ga0209130_1002705
1770 Ga0209675_1000027
1771 Ga0209675_1001211
1772 Ga0209675_1005738
1773 Ga0209675_1024807
1774 Ga0209025_1005014
1775 Ga0209564_1000009
1776 Ga0209564_1000068
1777 Ga0209564_1000094
1778 Ga0209564_1001487
1779 Ga0209564_1007956
1780 Ga0209564_1010315
1781 Ga0209564_1038751
1782 Ga0209758_1000073
1783 Ga0209758_1000227
1784 Ga0209050_1000046
1785 Ga0209050_1000442
1786 Ga0209256_1000044
1787 Ga0209256_1000116
1788 Ga0209256_1000145
1789 Ga0209256_1000988
1790 Ga0209256_1007853
1791 Ga0207426_1003827
1792 Ga0209051_1045983
1793 Ga0209257_1000068
1794 Ga0207697_10000230
1795 Ga0207656_10147600
1796 Ga0207655_1015761
1797 Ga0207642_10018395
1798 Ga0207642_10133315
1799 Ga0207642_11051782
1800 Ga0207688_10028875
1801 Ga0207680_10022988
1802 Ga0207699_10353593
1803 Ga0207705_10001972
1804 Ga0207705_10526539
1805 Ga0207684_10000190
1806 Ga0207684_10030054
1807 Ga0207684_10031627
1808 Ga0207684_10059588
1809 Ga0207684_10070092
1810 Ga0207684_10539954
1811 Ga0207684_10779762
1812 Ga0207654_10008161
1813 Ga0207671_10204875
1814 Ga0207671_10830194
1815 Ga0207660_10057168
1816 Ga0207657_10871977
1817 Ga0207649_10228473
1818 Ga0207652_10809247
1819 Ga0207646_10003785
1820 Ga0207646_10009717
1821 Ga0207646_10015435
1822 Ga0207646_10047841
1823 Ga0207646_10114655
1824 Ga0207646_10120029
1825 Ga0207646_11511300
1826 Ga0207646_11862424
1827 Ga0207681_10069268
1828 Ga0207681_10666174
1829 Ga0207694_10368309
1830 Ga0207650_10015523
1831 Ga0207650_11819441
1832 Ga0207659_10049775
1833 Ga0207659_10203549
1834 Ga0207687_10518458
1835 Ga0207644_10543189
1836 Ga0207644_11170587
1837 Ga0207690_10010877
1838 Ga0207690_10152984
1839 Ga0207690_11221363
1840 Ga0207706_10120143
1841 Ga0207706_10127098
1842 Ga0207706_10365512
1843 Ga0207686_10028891
1844 Ga0207686_10399664
1845 Ga0207709_10683063
1846 Ga0207670_10026701
1847 Ga0207670_10267760
1848 Ga0207669_10125945
1849 Ga0207669_11362432
1850 Ga0207704_10225664
1851 Ga0207704_10339819
1852 Ga0207665_10019448
1853 Ga0207665_10082276
1854 Ga0207691_10001130
1855 Ga0207691_10227193
1856 Ga0207691_10312466
1857 Ga0207691_11053828
1858 Ga0207691_11186069
1859 Ga0207679_10083312
1860 Ga0207679_10088846
1861 Ga0207667_10027566
1862 Ga0207651_10987501
1863 Ga0207668_10236886
1864 Ga0207668_10542504
1865 Ga0207640_10715427
1866 Ga0207658_10010500
1867 Ga0207677_10063774
1868 Ga0207677_12103007
1869 Ga0207678_10063189
1870 Ga0207678_10295105
1871 Ga0207702_10880136
1872 Ga0207702_11275697
1873 Ga0207648_10098010
1874 Ga0207648_10225463
1875 Ga0207648_11146711
1876 Ga0207674_11315610
1877 Ga0207683_10006813
1878 Ga0207683_10336655
1879 Ga0207698_10222334
1880 Ga0209281_1005666
1881 Ga0209282_1000001
1882 Ga0268266_10013072
1883 Ga0316180_1109616
1884 Ga0316183_1134260
1885 Ga0316181_1070955
1886 Ga0316181_1263623
1887 Ga0316182_1023982
1888 Ga0265316_10067224
1889 Ga0265316_11107695
1890 Ga0307513_10136437
1891 Ga0307408_100000981
1892 Ga0307408_100001472
1893 Ga0307408_100002767
1894 Ga0307408_101680490
1895 Ga0307508_10139506
1896 Ga0307518_10137449
1897 Ga0307406_12051234
1898 Ga0307412_10476873
1899 Ga0307412_10502414
1900 Ga0307412_12064263
1901 Ga0307416_100011426
1902 Ga0307416_101432393
1903 Ga0307416_102723184
1904 Ga0307414_10020067
1905 Ga0307414_10541653
1906 Ga0307411_10968862
1907 Ga0307415_102043720
1908 Ga0373943_0048876
1909 Ga0373943_0947714
1910 Ga0373947_0040081
1911 Ga0373947_0126165
1912 Ga0373937_0168600
1913 Ga0373925_0080283
1914 Ga0373925_0771979
1915 Ga0395899_0000082
1916 Ga0395899_0016969
1917 Ga0395899_0024287
1918 Ga0395899_0210055
1919 Ga0395900_0000393
1920 Ga0395900_0019995
1921 Ga0395900_0046773
1922 Ga0395900_0092327
1923 Ga0395900_0113588
1924 Ga0395900_0184192
1925 Ga0395900_1822254
1926 Ga0395898_0106973
1927 Ga0395898_0152641
1928 Ga0395898_1003428
1929 Ga0395898_1377172
1930 Ga0395905_0009206
1931 Ga0395905_0047340
1932 Ga0395905_0549185
1933 Ga0395905_0569842
1934 Ga0395905_0701342
1935 Ga0395905_1823413
1936 Ga0395905_1847022
1937 Ga0436364_0101037
1938 Ga0395901_0000054
1939 Ga0395901_0010533
1940 Ga0395901_0163525
1941 Ga0395901_0334325
1942 Ga0395901_0359500
1943 Ga0395901_1163544
1944 Ga0436361_0605732
1945 Ga0436361_0616428
1946 Ga0436361_1222516
1947 Ga0439436_0045720
1948 Ga0451807_2769524
1949 Ga0451835_0242121
1950 Ga0451853_2377098
1951 Ga0451853_2842729
1952 Ga0451853_3225716
1953 Ga0439448_0316470
1954 Ga0439449_0028091
1955 Ga0439450_156315
1956 Ga0439454_004952
1957 Ga0439455_0105379
1958 Ga0450911_020566
1959 Ga0450920_092727
1960 Ga0450898_106442
1961 Ga0450904_000438
1962 Ga0439446_0134383
1963 Ga0450893_0090164
1964 Ga0451577_0107899
1965 Ga0451577_1143792
1966 Ga0466969_0062179
1967 Ga0466969_0205223
1968 Ga0466972_0000042
1969 Ga0466972_0127184
1970 Ga0466972_0130545
1971 Ga0466982_0387196
1972 Ga0466965_0123291
1973 Ga0466965_0159673
1974 Ga0466965_0182269
1975 Ga0466966_0034358
1976 Ga0466966_0180341
1977 Ga0466963_0184915
1978 Ga0466964_0000091
1979 Ga0466964_0052645
1980 Ga0466964_0429360
1981 Ga0453684_0000917
1982 Ga0453684_1277106
1983 Ga0466971_0210479
1984 Ga0466971_0242506
1985 Ga0466968_0000777
1986 Ga0466957_0166814
1987 Ga0466957_0218946
1988 Ga0466960_0144687
1989 Ga0466960_0312230
1990 Ga0466960_0574434
1991 Ga0466959_0028509
1992 Ga0466959_0220493
1993 Ga0451576_0365370
1994 Ga0466958_0208527
1995 Ga0466967_0015997
1996 Ga0466967_0118372
1997 Ga0466967_0181032
1998 Ga0495617_000041
1999 Ga0495617_000057
2000 Ga0495617_001102
2001 Ga0495617_026400
2002 Ga0495617_033783
2003 Ga0495617_234914
2004 Ga0495627_000007
2005 Ga0495627_001004
2006 Ga0495627_014641
2007 Ga0495603_0057009
2008 Ga0495603_0183470
2009 Ga0495603_0327998
2010 Ga0495603_0394385
2011 Ga0495590_0000001
2012 Ga0495590_0000018
2013 Ga0495590_0000251
2014 Ga0495590_0003051
2015 Ga0495590_0016843
2016 Ga0495590_0122654
2017 Ga0495590_0186459
2018 Ga0495591_004295
2019 Ga0495591_020659
2020 Ga0495629_0008847
2021 Ga0495629_0041207
2022 Ga0495629_0093578
2023 Ga0495629_0171494
2024 Ga0495629_0377308
2025 Ga0495638_0000423
2026 Ga0495638_0001950
2027 Ga0495638_0002366
2028 Ga0495638_0025941
2029 Ga0495638_0097743
2030 Ga0495638_0125695
2031 Ga0495638_0148394
2032 Ga0495638_0287897
2033 Ga0495653_0000002
2034 Ga0495653_0005312
2035 Ga0495653_0123169
2036 Ga0495653_0126365
2037 Ga0495653_0242459
2038 Ga0495650_0000108
2039 Ga0495650_0000118
2040 Ga0495650_0000156
2041 Ga0495650_0000166
2042 Ga0495650_0001417
2043 Ga0495650_0004758
2044 Ga0495650_0033948
2045 Ga0495650_0056190
2046 Ga0495650_0129330
2047 Ga0495580_0029634
2048 Ga0495580_0685629
2049 Ga0495582_0007542
2050 Ga0495582_0096997
2051 Ga0495582_0149706
2052 Ga0495582_0378240
2053 Ga0495582_0717439
2054 Ga0495605_0000059
2055 Ga0495605_0000260
2056 Ga0495605_0000598
2057 Ga0495605_0001111
2058 Ga0495605_0003011
2059 Ga0495605_0008745
2060 Ga0495605_0029751
2061 Ga0495605_0030368
2062 Ga0495605_0037060
2063 Ga0495605_0041669
2064 Ga0495605_0062056
2065 Ga0495605_0069744
2066 Ga0495605_0089022
2067 Ga0495605_0278526
2068 Ga0495605_0361635
2069 Ga0495605_0378819
2070 Ga0495639_0250894
2071 Ga0495664_0703930
2072 Ga0495584_0000006
2073 Ga0495584_0001835
2074 Ga0495584_0001841
2075 Ga0495584_0002247
2076 Ga0495584_0004974
2077 Ga0495584_0007211
2078 Ga0495584_0011682
2079 Ga0495584_0013361
2080 Ga0495584_0013827
2081 Ga0495584_0036310
2082 Ga0495584_0036816
2083 Ga0495584_0041304
2084 Ga0495584_0047001
2085 Ga0495584_0058346
2086 Ga0495584_0089372
2087 Ga0495584_0091051
2088 Ga0495584_0237158
2089 Ga0495584_0666068
2090 Ga0495585_0000282
2091 Ga0495585_0003548
2092 Ga0495585_0004128
2093 Ga0495585_0004783
2094 Ga0495585_0007364
2095 Ga0495585_0008922
2096 Ga0495585_0011838
2097 Ga0495585_0014509
2098 Ga0495585_0016543
2099 Ga0495585_0023658
2100 Ga0495585_0042612
2101 Ga0495585_0047888
2102 Ga0495585_0097886
2103 Ga0495585_0101232
2104 Ga0495585_0120605
2105 Ga0495585_0134348
2106 Ga0495585_0144154
2107 Ga0495585_0146493
2108 Ga0495585_0181351
2109 Ga0495585_0208936
2110 Ga0495585_0635359
2111 Ga0495594_0006060
2112 Ga0495594_0022540
2113 Ga0495594_0056774
2114 Ga0495594_0063287
2115 Ga0495594_0088303
2116 Ga0495594_0100196
2117 Ga0495594_0103494
2118 Ga0495594_0228512
2119 Ga0495594_0471986
2120 Ga0495596_0000236
2121 Ga0495596_0003733
2122 Ga0495596_0003880
2123 Ga0495596_0010298
2124 Ga0495596_0016755
2125 Ga0495596_0020946
2126 Ga0495596_0032093
2127 Ga0495596_0039830
2128 Ga0495596_0066495
2129 Ga0495596_0072165
2130 Ga0495596_0112662
2131 Ga0495596_0225634
2132 Ga0495607_0002467
2133 Ga0495607_0003144
2134 Ga0495607_0003634
2135 Ga0495607_0008457
2136 Ga0495607_0014610
2137 Ga0495607_0014950
2138 Ga0495607_0027861
2139 Ga0495607_0038208
2140 Ga0495607_0040944
2141 Ga0495607_0051300
2142 Ga0495607_0147306
2143 Ga0495607_0226812
2144 Ga0495607_0336100
2145 Ga0495607_0419653
2146 Ga0495583_0000035
2147 Ga0495583_0000525
2148 Ga0495583_0000533
2149 Ga0495583_0000608
2150 Ga0495583_0001445
2151 Ga0495583_0002759
2152 Ga0495583_0004051
2153 Ga0495583_0004816
2154 Ga0495583_0011794
2155 Ga0495583_0014446
2156 Ga0495583_0020340
2157 Ga0495583_0027832
2158 Ga0495583_0063913
2159 Ga0495583_0087871
2160 Ga0495583_0138545
2161 Ga0495606_0000011
2162 Ga0495606_0000064
2163 Ga0495606_0001147
2164 Ga0495606_0001181
2165 Ga0495606_0006161
2166 Ga0495606_0009081
2167 Ga0495606_0013368
2168 Ga0495606_0014662
2169 Ga0495606_0014803
2170 Ga0495606_0026334
2171 Ga0495606_0036164
2172 Ga0495606_0037676
2173 Ga0495606_0038517
2174 Ga0495606_0084712
2175 Ga0495606_0145115
2176 Ga0495606_0151684
2177 Ga0495606_0200207
2178 Ga0495610_0000003
2179 Ga0495610_0000873
2180 Ga0495610_0001162
2181 Ga0495610_0008688
2182 Ga0495616_0000272
2183 Ga0495616_0000343
2184 Ga0495616_0000680
2185 Ga0495616_0001661
2186 Ga0495616_0003238
2187 Ga0495616_0009292
2188 Ga0495616_0009654
2189 Ga0495616_0012631
2190 Ga0495616_0013294
2191 Ga0495616_0028258
2192 Ga0495616_0031645
2193 Ga0495616_0045896
2194 Ga0495616_0056668
2195 Ga0495616_0064979
2196 Ga0495616_0125523
2197 Ga0495616_0139171
2198 Ga0495620_0003145
2199 Ga0495630_0017831
2200 Ga0495631_0000983
2201 Ga0495631_0002105
2202 Ga0495631_0003385
2203 Ga0495631_0005046
2204 Ga0495631_0006876
2205 Ga0495631_0007988
2206 Ga0495631_0016269
2207 Ga0495631_0039469
2208 Ga0495631_0044435
2209 Ga0495631_0072699
2210 Ga0495631_0141351
2211 Ga0495632_0000062
2212 Ga0495632_0000235
2213 Ga0495632_0000901
2214 Ga0495632_0002631
2215 Ga0495632_0007247
2216 Ga0495632_0009591
2217 Ga0495632_0019389
2218 Ga0495637_0000004
2219 Ga0495637_0000482
2220 Ga0495637_0005727
2221 Ga0495637_0022968
2222 Ga0495637_0058812
2223 Ga0495637_0085828
2224 Ga0495637_0132682
2225 Ga0495643_0000123
2226 Ga0495643_0000170
2227 Ga0495643_0000969
2228 Ga0495643_0001637
2229 Ga0495643_0004001
2230 Ga0495643_0007137
2231 Ga0495643_0011059
2232 Ga0495643_0014320
2233 Ga0495643_0173562
2234 Ga0495643_0195476
2235 Ga0495644_0003684
2236 Ga0495644_0003719
2237 Ga0495644_0006986
2238 Ga0495644_0008087
2239 Ga0495644_0008241
2240 Ga0495644_0010379
2241 Ga0495644_0021058
2242 Ga0495644_0022081
2243 Ga0495644_0022349
2244 Ga0495644_0044530
2245 Ga0495644_0144985
2246 Ga0495644_0164084
2247 Ga0495648_0000001
2248 Ga0495648_0000109
2249 Ga0495648_0000541
2250 Ga0495648_0002349
2251 Ga0495648_0013051
2252 Ga0495648_0018771
2253 Ga0495648_0027536
2254 Ga0495648_0033572
2255 Ga0495648_0041132
2256 Ga0495648_0088906
2257 Ga0495648_0130402
2258 Ga0495648_0132888
2259 Ga0495648_0164941
2260 Ga0495648_0174124
2261 Ga0495648_0175834
2262 Ga0495663_0004570
2263 Ga0495663_0043379
2264 Ga0495663_0073136
2265 Ga0495663_0311424
2266 Ga0495666_0000975
2267 Ga0495666_0001244
2268 Ga0495666_0022762
2269 Ga0495666_0024822
2270 Ga0495666_0088051
2271 Ga0495642_0000196
2272 Ga0495642_0002912
2273 Ga0495642_0003623
2274 Ga0495642_0006116
2275 Ga0495642_0008553
2276 Ga0495642_0008675
2277 Ga0495642_0008881
2278 Ga0495642_0018690
2279 Ga0495642_0020087
2280 Ga0495642_0021451
2281 Ga0495642_0027433
2282 Ga0495642_0032728
2283 Ga0495642_0077602
2284 Ga0495642_0088316
2285 Ga0495642_0101537
2286 Ga0495642_0116714
2287 Ga0495642_0205702
2288 Ga0495642_0232419
2289 Ga0495652_0020052
2290 Ga0495654_0000038
2291 Ga0495654_0002038
2292 Ga0495654_0011618
2293 Ga0495654_0019835
2294 Ga0495654_0049466
2295 Ga0495654_0052082
2296 Ga0495654_0062661
2297 Ga0495654_0084811
2298 Ga0495665_0004075
2299 Ga0495665_0018192
2300 Ga0495665_0022051
2301 Ga0495665_0030374
2302 Ga0495665_0136960
2303 Ga0495665_0237927
2304 Ga0495665_0621341
2305 Ga0495640_0096951
2306 Ga0495586_0010365
2307 Ga0495586_0014931
2308 Ga0495586_0197549
2309 Ga0495586_0427977
2310 Ga0495587_0094550
2311 Ga0495587_0241029
2312 Ga0495587_0331613
2313 Ga0495598_0012534
2314 Ga0495609_0000009
2315 Ga0495609_0000636
2316 Ga0495609_0003073
2317 Ga0495609_0003510
2318 Ga0495609_0003925
2319 Ga0495609_0006181
2320 Ga0495609_0010588
2321 Ga0495609_0012139
2322 Ga0495609_0018688
2323 Ga0495609_0021303
2324 Ga0495609_0023305
2325 Ga0495609_0104995
2326 Ga0495609_0107807
2327 Ga0495609_0110710
2328 Ga0495609_0194205
2329 Ga0495609_0216406
2330 Ga0495621_0207430
2331 Ga0495597_0001393
2332 Ga0495597_0001520
2333 Ga0495597_0001796
2334 Ga0495597_0002277
2335 Ga0495597_0004290
2336 Ga0495597_0005992
2337 Ga0495597_0007074
2338 Ga0495597_0011554
2339 Ga0495597_0013569
2340 Ga0495597_0028551
2341 Ga0495597_0035996
2342 Ga0495597_0062840
2343 Ga0495597_0067467
2344 Ga0495597_0091483
2345 Ga0495597_0197927
2346 Ga0495645_0125435
2347 Ga0495645_0176359
2348 Ga0495622_0000028
2349 Ga0495622_0000398
2350 Ga0495622_0028161
2351 Ga0495622_0091127
2352 Ga0495622_0108925
2353 Ga0495622_0226951
2354 Ga0495622_0292540
2355 Ga0495622_0411964
2356 Ga0495633_0002074
2357 Ga0495633_0002390
2358 Ga0495633_0004129
2359 Ga0495633_0007239
2360 Ga0495633_0008374
2361 Ga0495633_0015513
2362 Ga0495633_0016604
2363 Ga0495633_0016656
2364 Ga0495633_0018775
2365 Ga0495633_0028145
2366 Ga0495633_0034928
2367 Ga0495633_0036808
2368 Ga0495633_0069418
2369 Ga0495633_0077381
2370 Ga0495633_0107297
2371 Ga0495633_0132449
2372 Ga0495633_0182335
2373 Ga0495633_0334694
2374 Ga0495633_0540313
2375 Ga0495667_0301968
2376 Ga0495656_0003737
2377 Ga0495656_0015862
2378 Ga0495656_0043073
2379 Ga0495656_0048042
2380 Ga0495656_0120080
2381 Ga0495668_0000048
2382 Ga0495668_0001362
2383 Ga0495668_0002401
2384 Ga0495668_0002455
2385 Ga0495668_0004786
2386 Ga0495668_0005220
2387 Ga0495668_0007462
2388 Ga0495668_0010370
2389 Ga0495668_0013225
2390 Ga0495668_0013802
2391 Ga0495668_0022879
2392 Ga0495668_0025705
2393 Ga0495668_0026212
2394 Ga0495668_0027856
2395 Ga0495668_0031057
2396 Ga0495668_0045217
2397 Ga0495668_0069580
2398 Ga0495668_0151893
2399 Ga0495668_0184006
2400 Ga0495668_0531138
2401 Ga0495634_0003145
2402 Ga0495634_0052778
2403 Ga0495611_0003052
2404 Ga0495611_0004232
2405 Ga0495611_0005048
2406 Ga0495611_0007604
2407 Ga0495611_0034181
2408 Ga0495611_0048649
2409 Ga0495611_0052940
2410 Ga0495611_0062572
2411 Ga0495611_0098119
2412 Ga0495611_0124226
2413 Ga0495611_0185804
2414 Ga0495611_0269588
2415 Ga0495611_0328188
2416 Ga0495611_0357724
2417 Ga0495611_0448255
2418 Ga0495625_0000164
2419 Ga0495625_0005794
2420 Ga0495625_0009364
2421 Ga0495625_0009819
2422 Ga0495625_0015487
2423 Ga0495625_0018254
2424 Ga0495625_0021196
2425 Ga0495625_0029832
2426 Ga0495625_0038200
2427 Ga0495625_0046986
2428 Ga0495625_0069612
2429 Ga0495625_0100232
2430 Ga0495625_0245382
2431 Ga0495625_0453458
2432 Ga0495625_0566492
2433 Ga0495635_0006579
2434 Ga0495635_0619974
2435 Ga0495659_0000289
2436 Ga0495659_0001247
2437 Ga0495659_0009392
2438 Ga0495659_0069126
2439 Ga0495659_0123825
2440 Ga0495661_0000368
2441 Ga0495661_0001167
2442 Ga0495661_0002363
2443 Ga0495661_0006427
2444 Ga0495661_0012089
2445 Ga0495661_0015517
2446 Ga0495661_0019494
2447 Ga0495661_0023664
2448 Ga0495661_0029376
2449 Ga0495661_0037274
2450 Ga0495661_0040171
2451 Ga0495661_0052747
2452 Ga0495661_0067409
2453 Ga0495661_0072941
2454 Ga0495661_0083536
2455 Ga0495661_0103370
2456 Ga0495661_0104872
2457 Ga0495661_0124413
2458 Ga0495661_0141254
2459 Ga0495661_0147861
2460 Ga0495661_0235293
2461 Ga0495661_0256340
2462 Ga0495661_0267876
2463 Ga0495588_0000077
2464 Ga0495588_0035172
2465 Ga0495588_0045378
2466 Ga0495588_0064739
2467 Ga0495588_0065381
2468 Ga0495588_0071146
2469 Ga0495588_0080651
2470 Ga0495588_0109500
2471 Ga0495588_0121903
2472 Ga0495588_0123522
2473 Ga0495588_0164135
2474 Ga0495588_0173649
2475 Ga0495588_0708148
2476 Ga0495599_0266621
2477 Ga0495623_0007712
2478 Ga0495623_0027846
2479 Ga0495623_0091002
2480 Ga0495623_0220094
2481 Ga0495646_0190750
2482 Ga0495669_0000217
2483 Ga0495669_0001851
2484 Ga0495669_0010502
2485 Ga0495669_0017194
2486 Ga0495669_0033212
2487 Ga0495669_0036868
2488 Ga0495669_0053078
2489 Ga0495669_0538708
2490 Ga0495613_0069142
2491 Ga0495613_0793672
2492 Ga0495624_0007752
2493 Ga0495624_0340855
2494 Ga0495670_0009961
2495 Ga0495670_0021082
2496 Ga0495670_0021157
2497 Ga0495670_0022494
2498 Ga0495670_0031986
2499 Ga0495670_0034737
2500 Ga0495670_0039198
2501 Ga0495670_0195811
2502 Ga0495670_0199854
2503 Ga0495670_0274896
2504 Ga0495670_0391270
2505 Ga0495670_0408214
2506 Ga0495670_0421933
2507 Ga0495670_0464390
2508 Ga0495670_0523431
2509 Ga0495671_0000001
2510 Ga0495671_0000744
2511 Ga0495671_0000848
2512 Ga0495671_0022004
2513 Ga0495671_0023568
2514 Ga0495671_0027348
2515 Ga0495671_0028223
2516 Ga0495671_0079765
2517 Ga0495671_0112690
2518 Ga0495671_0180502
2519 Ga0495671_0397099
2520 Ga0495649_0002149
2521 Ga0495649_0007989
2522 Ga0495649_0019739
2523 Ga0495649_0031292
2524 Ga0495649_0051556
2525 Ga0495649_0133357
2526 Ga0495649_0159202
2527 Ga0495649_0206303
2528 Ga0495649_0218901
2529 Ga0495589_0000037
2530 Ga0495589_0001177
2531 Ga0495589_0001260
2532 Ga0495589_0010118
2533 Ga0495589_0014498
2534 Ga0495589_0017796
2535 Ga0495589_0026334
2536 Ga0495589_0038794
2537 Ga0495589_0042313
2538 Ga0495589_0085592
2539 Ga0495589_0163846
2540 Ga0495589_0180011
2541 Ga0495589_0241467
2542 Ga0495600_0002155
2543 Ga0495600_0104154
2544 Ga0495660_0000178
2545 Ga0495660_0001476
2546 Ga0495660_0003120
2547 Ga0495660_0003323
2548 Ga0495660_0017672
2549 Ga0495660_0022155
2550 Ga0495660_0043740
2551 Ga0495660_0044082
2552 Ga0495660_0059138
2553 Ga0495660_0095189
2554 Ga0495660_0118619
2555 Ga0495660_0124887
2556 Ga0495660_0128231
2557 Ga0495581_0008712
2558 Ga0495581_0066676
2559 Ga0495581_0078795
2560 Ga0495581_0287595
2561 Ga0495604_0036530
2562 Ga0495604_0085661
2563 Ga0495604_0148305
2564 Ga0495604_0192669
2565 Ga0495604_0223117
2566 Ga0495604_0262021
2567 Ga0495636_0006148
2568 Ga0495636_0012768
2569 Ga0495636_0017608
2570 Ga0495636_0069736
2571 Ga0495636_0087023
2572 Ga0495636_0094728
2573 Ga0495636_0104862
2574 Ga0495636_0180386
2575 Ga0495636_0367497
2576 Ga0495636_0445788
2577 Ga0495674_0003394
2578 Ga0495674_0784125
2579 Ga0495672_0000097
2580 Ga0495672_0000424
2581 Ga0495672_0000590
2582 Ga0495672_0000758
2583 Ga0495672_0001440
2584 Ga0495672_0001672
2585 Ga0495672_0002152
2586 Ga0495672_0011872
2587 Ga0495672_0098796
2588 Ga0495672_0108065
2589 Ga0495676_0000342
2590 Ga0495676_0014902
2591 Ga0495676_0077540
2592 Ga0495676_0108382
2593 Ga0495676_0123990
2594 Ga0495676_0169465
2595 Ga0495676_0202693
2596 Ga0495680_0005344
2597 Ga0495680_0086272
2598 Ga0495680_0909474
2599 Ga0495683_0000144
2600 Ga0495683_0000952
2601 Ga0495683_0001039
2602 Ga0495683_0016641
2603 Ga0495683_0017608
2604 Ga0495683_0029959
2605 Ga0495683_0035711
2606 Ga0495683_0087662
2607 Ga0495683_0095436
2608 Ga0495683_0169338
2609 Ga0495687_000002
2610 Ga0495687_000017
2611 Ga0495687_000024
2612 Ga0495687_000148
2613 Ga0495687_001539
2614 Ga0495687_005580
2615 Ga0495687_005608
2616 Ga0495687_010840
2617 Ga0495687_015538
2618 Ga0495687_029001
2619 Ga0495687_076171
2620 Ga0495675_0002413
2621 Ga0495675_0004400
2622 Ga0495675_0147236
2623 Ga0495677_0000011
2624 Ga0495677_0000979
2625 Ga0495677_0001358
2626 Ga0495677_0003050
2627 Ga0495677_0004099
2628 Ga0495677_0006130
2629 Ga0495677_0007985
2630 Ga0495677_0011203
2631 Ga0495677_0016146
2632 Ga0495677_0074320
2633 Ga0495677_0139302
2634 Ga0495677_0141551
2635 Ga0495677_0149027
2636 Ga0495677_0165097
2637 Ga0495679_003113
2638 Ga0495679_003957
2639 Ga0495679_009988
2640 Ga0495679_016017
2641 Ga0495679_017414
2642 Ga0495679_050542
2643 Ga0495685_000077
2644 Ga0495685_006760
2645 Ga0495685_010360
2646 Ga0495685_024841
2647 Ga0495685_034772
2648 Ga0495685_095119
2649 Ga0495685_175374
2650 Ga0495673_0000003
2651 Ga0495673_0000097
2652 Ga0495673_0000100
2653 Ga0495673_0002730
2654 Ga0495673_0010183
2655 Ga0495681_0002294
2656 Ga0495681_0002968
2657 Ga0495681_0007086
2658 Ga0495681_0009449
2659 Ga0495681_0011139
2660 Ga0495681_0011368
2661 Ga0495681_0011590
2662 Ga0495681_0014249
2663 Ga0495681_0020183
2664 Ga0495681_0020331
2665 Ga0495681_0048194
2666 Ga0495681_0155420
2667 Ga0495686_0000428
2668 Ga0495686_0001462
2669 Ga0495686_0001479
2670 Ga0495686_0003365
2671 Ga0495686_0008053
2672 Ga0495686_0049892
2673 Ga0495686_0121758
2674 Ga0495686_0184539
2675 Ga0495686_0189731
2676 Ga0495686_0228281
2677 Ga0495686_0293147
2678 Ga0495686_0377640
2679 Ga0495593_0002473
2680 Ga0495593_0021073
2681 Ga0495593_0128819
2682 Ga0495602_0086299
2683 Ga0495602_0128484
2684 Ga0495602_0459422
2685 Ga0495614_0002563
2686 Ga0495614_0162459
2687 Ga0495614_0181823
2688 Ga0495614_0205280
2689 Ga0495614_0251407
2690 Ga0495615_0000530
2691 Ga0495615_0080961
2692 Ga0495626_0000004
2693 Ga0495626_0000016
2694 Ga0495626_0000569
2695 Ga0495626_0005849
2696 Ga0495626_0008239
2697 Ga0495626_0009582
2698 Ga0495626_0027385
2699 Ga0495626_0033635
2700 Ga0495626_0040645
2701 Ga0495626_0054570
2702 Ga0495626_0069092
2703 Ga0495626_0091745
2704 Ga0495626_0092145
2705 Ga0495626_0118149
2706 Ga0495626_0176147
2707 Ga0496100_0004475
2708 Ga0496100_0266561
2709 Ga0496100_0332721
2710 Ga0496100_0380203
2711 Ga0496101_0106911
2712 Ga0496101_0108970
2713 Ga0496101_0702507
2714 Ga0496101_0820075
2715 Ga0496102_0000461
2716 Ga0496102_0016630
2717 Ga0496102_0020653
2718 Ga0496102_0023210
2719 Ga0496102_0040178
2720 Ga0496102_0069033
2721 Ga0496102_0076786
2722 Ga0496102_0178602
2723 Ga0496102_0205505
2724 Ga0496102_0760861
2725 Ga0496102_0941197
2726 Ga0496102_1447319
2727 Ga0496103_0001321
2728 Ga0496103_0002752
2729 Ga0496103_0006660
2730 Ga0496103_0007974
2731 Ga0496103_0045259
2732 Ga0496103_0143904
2733 Ga0496104_0616755
2734 Ga0496104_0668275
2735 Ga0496104_1316698
2736 Ga0496105_0077123
2737 Ga0496105_0113339
2738 Ga0496105_0747240
2739 Ga0496106_0230450
2740 Ga0496106_0268693
2741 Ga0496107_0021795
2742 Ga0496108_0010622
2743 Ga0496108_0023299
2744 Ga0496108_0394878
2745 Ga0496108_0483826
2746 Ga0496109_0081610
2747 Ga0496109_0149594
2748 Ga0496109_0321254
2749 Ga0496109_0656844
2750 Ga0496109_1427618
2751 Ga0496110_0000019
2752 Ga0496110_0003499
2753 Ga0496110_0807477
2754 Ga0496111_0031224
2755 Ga0496111_0246770
2756 Ga0496112_0032351
2757 Ga0496112_0037388
2758 Ga0496112_0037948
2759 Ga0496112_0246092
2760 Ga0496112_0252691
2761 Ga0496112_1095950
2762 Ga0496113_0037686
2763 Ga0496113_0123029
2764 Ga0496113_0328300
2765 Ga0496113_0421049
2766 Ga0496113_0738842
2767 Ga0496113_0782382
2768 Ga0496114_0436287
2769 Ga0496114_0475759
2770 Ga0496114_0532190
2771 Ga0496115_0011854
2772 Ga0496115_0034428
2773 Ga0496115_0060772
2774 Ga0496115_0251481
2775 Ga0496115_0282915
2776 Ga0496115_0712674
2777 Ga0496116_0039030
2778 Ga0496116_0080004
2779 Ga0496117_0000132
2780 Ga0496118_0000099
2781 Ga0496119_0321679
2782 Ga0496120_0105101
2783 Ga0496121_0080423
2784 Ga0496121_0127464
2785 Ga0496121_0210954
2786 Ga0496121_0236303
2787 Ga0496121_0615776
2788 Ga0496122_0000835
2789 Ga0496122_0001402
2790 Ga0496122_0036243
2791 Ga0496122_0477397
2792 Ga0496123_0001003
2793 Ga0496123_0004574
2794 Ga0496123_0051903
2795 Ga0496123_0053089
2796 Ga0496123_0299454
2797 Ga0496124_0008384
2798 Ga0496124_0017479
2799 Ga0496124_0041651
2800 Ga0496124_0061626
2801 Ga0496124_0118308
2802 Ga0496124_0143321
2803 Ga0496124_0173038
2804 Ga0496124_0218266
2805 Ga0496124_0295788
2806 Ga0496124_0731909
2807 Ga0496125_0001280
2808 Ga0496125_0023719
2809 Ga0496125_0381725
2810 Ga0496126_0015539
2811 Ga0501308_001629
2812 Ga0501309_047482
2813 Ga0501310_022591
2814 Ga0501310_073953
2815 Ga0501304_002381
2816 Ga0501305_098766
2817 Ga0501307_014325
2818 Ga0501307_033547
2819 Ga0495678_000004
2820 Ga0495678_000384
2821 Ga0495678_000515
2822 Ga0495678_000866
2823 Ga0495678_001499
2824 Ga0495678_017736
2825 Ga0495678_024378
2826 Ga0495678_040952
2827 Ga0495678_043619
2828 Ga0495678_045351
2829 Ga0495678_156665
2830 Ga0495678_209202
2831 Ga0495682_0000869
2832 Ga0495682_0001115
2833 Ga0495682_0006435
2834 Ga0495682_0031927
2835 Ga0501312_034371
2836 Ga0501314_024195
2837 Ga0501315_022278
2838 Ga0501315_037778
2839 Ga0501316_013762
2840 Ga0501318_020502
2841 Ga0501322_024908
2842 Ga0501323_054399
2843 Ga0501230_002780
2844 Ga0501238_008754
2845 Ga0501249_002892
2846 Ga0501234_055166
2847 Ga0501263_027310
2848 Ga0501265_102468
2849 Ga0501269_000099
2850 Ga0501279_002296
2851 Ga0501279_017123
2852 Ga0501035_0000965
2853 Ga0501220_04705
2854 nmdc:mga03683_52564_c1
2855 nmdc:mga0qj67_80226_c1
2856 nmdc:mga08y16_312463_c1
2857 nmdc:mga0n895_1047098_c1
2858 nmdc:mga0n895_197141_c1
2859 nmdc:mga0rr50_1700061_c1
2860 nmdc:mga08x19_320078_c1
2861 nmdc:mga08x19_8569_c1
2862 nmdc:mga0a205_759673_c1
2863 Ga0500647_0364579
2864 Ga0500594_0024669
2865 Ga0500618_000358
2866 Ga0500618_035890
2867 Ga0500586_027112
2868 Ga0500622_0000001
2869 Ga0587093_037672
2870 Ga0587066_061325
2871 Ga0587073_0052305
2872 Ga0587077_036677
2873 Ga0587080_003170
2874 Ga0587080_031135
2875 Ga0587088_048226
2876 Ga0587090_041300
2877 Ga0587091_088410
2878 Ga0587094_056969
2879 Ga0587098_052710
2880 Ga0587106_023638
2881 Ga0587129_024236
2882 Ga0587099_051983
2883 Ga0587101_024610
2884 Ga0587115_053305
2885 Ga0587117_035241
2886 Ga0587062_061390
2887 Ga0587062_068412
2888 Ga0587068_003385
2889 Ga0587068_138221
2890 Ga0587069_004663
2891 Ga0587075_024541
2892 Ga0587076_036335
2893 Ga0587079_042086
2894 Ga0587102_045335
2895 Ga0587105_007802
2896 Ga0587107_073157
2897 Ga0587124_019618
2898 Ga0587071_061264
2899 Ga0587111_0057014
2900 Ga0587111_0084966
2901 Ga0466962_0083668
2902 Ga0466962_0114442
2903 2643786992
2904 2643802316
2905 2644215914
2906 2644254384
2907 2644357949
2908 2644475824
2909 2738741196
2910 2738829264
2911 2738845662
2912 2739153060
2913 2739194980
2914 2739277470
2915 2739321456
2916 2739339988
2917 2739346607
2918 2809145361
2919 2821131543
2920 2842718111
2921 2857554423
2922 2857563850
2923 2857564791
2924 2904426082
2925 2919478473
2926 8047673826

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

8

121

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kny-assembly1.cif.gz_A crystal structure of the response regulator kdpe complexed to dna in an active-like conformation 0.954 8 126
2qzj-assembly5.cif.gz_E crystal structure of a two-component response regulator from clostridium difficile 0.9516 9 126
3dzd-assembly1.cif.gz_B crystal structure of sigma54 activator ntrc4 in the inactive state 0.9508 10 128
5m7n-assembly1.cif.gz_B crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology 0.9502 8 137
5m7o-assembly1.cif.gz_B crystal structure of ntrx from brucella abortus processed with the crystaldirect automated mounting and cryo-cooling technology 0.9501 8 137
ID Description Score Start End Superfamily
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.952 10 85 3.40.50.2300
3dzdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9513 10 129 3.40.50.2300
5m7oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9483 8 137 3.40.50.2300
3nhzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.947 9 122 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9465 9 87 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V6M0H3-F1-model_v4 DNA-binding response regulator 0.9691 7 118 GO:0000160
GO:0003677
AF-A0A832MF14-F1-model_v4 Response regulator 0.9654 8 126 GO:0000160
AF-A0A679HR12-F1-model_v4 Response regulator 0.965 9 127 GO:0000160
AF-A0A2V5MZM0-F1-model_v4 Response regulatory domain-containing protein 0.9636 8 125 GO:0000160
AF-A0A2D6G530-F1-model_v4 Response regulator 0.9625 8 125 GO:0000160

Map