metagRoot

F494146

General Info

Members	Datasets	Scaffolds	Average Seq Length
1463	663	1314	329

Family's Representative Sequence

Representative Sequence	3300046660\|Ga0495625_0151306\|Ga0495625_0151306_360_1550
Length	396
Sequence	MYMQNTPTLRSTGSSGAGKNGGICREIGVFCRAPLQECGYLQDISDSTDHTKQQWDIEALRSGGTMQKRKLGKSGLEVSALGLGCMSMSSAYGPAADKGEMIKLIRAAHDRGVTLFDTAEAYGPFANEELVGEALQPIRDKVVIATKFGFDIDLETGKRSGGTNSRQEHIMRVAEASLKRLRTDHIDLFYQHRVDPDVPIEDVAGAVKELISQDKVKHLGLSEAGVQTIRRAHAVQPVTAVQSEYSRFWRGPEAELLPTLEELAVGFVPFSPLGAGFLTGKIDENTKFDPTDFRNIAPRFSPEARKANMVLVDLVKAVAVRKGATPAQVALAWLLAQKPWIVPIPGTTKLHRLEENLGAVNVGLTKNDLKQIDEAASRLKLEGARLPEAALKMTGR

Samples

	Sample ID	Description	Type	Environment
1	2510065045	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
2	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
3	2510917020	Caulobacter sp. AP07	Isolate	Rhizosphere
4	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
5	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
6	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
7	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
8	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
9	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
10	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
11	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
12	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
13	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
14	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
15	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
16	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
17	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
18	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
19	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
20	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
21	2582581280	Caulobacter henricii CF287	Isolate	Rhizosphere
22	2582581293	Caulobacter henricii YR570	Isolate	Rhizosphere
23	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
24	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
25	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
26	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
27	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
28	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
29	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
30	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
31	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
32	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
33	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
34	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
35	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
36	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
37	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
38	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
39	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
40	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
41	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
42	2643221584	Caulobacter sp. Root656	Isolate	Unclassified
43	2643221618	Ensifer sp. Root231	Isolate	Unclassified
44	2643221626	Ensifer sp. Root31	Isolate	Unclassified
45	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
46	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
47	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
48	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
49	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
50	2643221659	Ensifer sp. Root127	Isolate	Unclassified
51	2643221698	Ensifer sp. Root142	Isolate	Unclassified
52	2643221712	Ensifer sp. Root258	Isolate	Unclassified
53	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
54	2718217991	Paraburkholderia sprentiae WSM5005	Isolate	Nodule
55	2721755686	Mesorhizobium amorphae CCNWGS0123	Isolate	Nodule
56	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
57	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
58	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
59	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
60	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
61	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
62	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
63	2791355263	Rhizobium chutanense C5	Isolate	Nodule
64	2791355266	Rhizobium sp. L43	Isolate	Nodule
65	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
66	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
67	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
68	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
69	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
70	2818991461	Neorhizobium alkalisoli 1225	Isolate	Unclassified
71	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
72	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
73	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
74	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
75	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
76	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
77	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
78	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
79	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
80	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
81	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
82	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
83	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
84	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
85	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
86	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
87	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
88	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
89	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
90	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
91	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
92	2854911287	Brucella lupini LUP21	Isolate	Unclassified
93	2857442823	Stenotrophomonas sp. R-74235	Isolate	Unclassified
94	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
95	2857564685	Duganella sp. R-74599	Isolate	Unclassified
96	2874123672	Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1	Isolate	Nodule
97	2874168670	Mesorhizobium kowhaii Ach-343	Isolate	Nodule
98	2898329390	Caulobacter sp. 602-2	Isolate	Rhizosphere
99	2904479285	Comamonas sediminis 4487	Isolate	Rhizosphere
100	2919089067	Stenotrophomonas sp. 1337	Isolate	Rhizosphere
101	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
102	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
103	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
104	2922425934
105	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
106	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
107	2928496128	Stenotrophomonas indicatrix 1163	Isolate	Unclassified
108	2928531327	Caulobacter sp. 1776	Isolate	Rhizosphere
109	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
110	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
111	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
112	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
113	2939568625	Lelliottia sp. 489	Isolate	Rhizosphere
114	2939589442	Stenotrophomonas rhizophila 716	Isolate	Rhizosphere
115	2939607340	Leclercia sp. 1548	Isolate	Rhizosphere
116	2939622612	Stenotrophomonas sp. 2619	Isolate	Rhizosphere
117	2939626828	Stenotrophomonas sp. 2694	Isolate	Rhizosphere
118	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
119	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
120	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
121	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
122	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
123	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
124	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
125	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
126	2974307012	Stenotrophomonas sp. SORGH_AS_0282	Isolate	Unclassified
127	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
128	2984514374	Stenotrophomonas sp. SORGH_AS282	Isolate	Aerial Root
129	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
130	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
131	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
132	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
133	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
134	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
135	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
136	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
137	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
138	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
139	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
140	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
141	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
142	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
143	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
144	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
145	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
146	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
147	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
148	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
149	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
150	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
151	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
152	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
153	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
154	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
155	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
156	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
157	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
158	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
159	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
160	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
161	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
162	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
163	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
164	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
165	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
166	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
167	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
168	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
169	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
170	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
171	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
172	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
173	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
174	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
175	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
176	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
177	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
178	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
179	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
180	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
181	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
182	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
183	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
184	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
185	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
186	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
187	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
188	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
189	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
190	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
191	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
192	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
193	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
194	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
195	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
196	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
197	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
198	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
199	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
200	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
201	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
202	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
203	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
204	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
205	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
206	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
207	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
208	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
209	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
210	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
211	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
212	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
213	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
214	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
215	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
216	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
217	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
218	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
219	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
220	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
221	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
222	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
223	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
224	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
225	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
226	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
227	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
228	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
229	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
230	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
231	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
232	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
233	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
234	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
235	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
236	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
237	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
238	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
239	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
240	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
241	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
242	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
243	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
244	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
245	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
246	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
247	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
248	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
249	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
250	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
251	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
252	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
253	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
254	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
255	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
256	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
257	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
258	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
259	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
260	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
261	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
262	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
263	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
264	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
265	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
266	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
267	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
268	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
269	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
270	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
271	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
272	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
273	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
274	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
275	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
276	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
277	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
278	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
279	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
280	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
281	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
282	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
283	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
284	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
285	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
286	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
287	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
288	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
289	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
290	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
291	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
292	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
293	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
294	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
295	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
296	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
297	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
298	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
299	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
300	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
301	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
302	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
303	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
304	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
305	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
306	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
307	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
308	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
309	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
310	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
311	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
312	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
313	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
314	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
315	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
316	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
317	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
318	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
319	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
320	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
321	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
384	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
385	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
386	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
387	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
391	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
392	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
393	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
394	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
395	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
396	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
397	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
398	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
399	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
400	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
401	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
402	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
403	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
404	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
405	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
406	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
407	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
408	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
409	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
410	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
411	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
412	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
413	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
414	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
415	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
416	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
417	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
418	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
419	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
420	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
421	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
422	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
423	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
424	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
425	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
426	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
427	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
428	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
429	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
430	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
431	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
432	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
433	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
434	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
435	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
436	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
437	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
438	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
439	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
440	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
441	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
442	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
443	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
444	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
445	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
446	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
447	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
448	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
449	3300041503	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG	Metagenome	Unclassified
450	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
451	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
452	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
453	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
454	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
455	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
456	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
457	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
458	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
459	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
460	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
461	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
462	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
463	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
464	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
465	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
466	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
467	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
468	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
469	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
470	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
471	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
472	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
473	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
474	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
475	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
476	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
477	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
478	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
479	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
480	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
481	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
482	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
483	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
484	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
485	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
486	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
487	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
488	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
489	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
490	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
491	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
492	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
493	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
494	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
495	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
496	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
497	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
498	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
499	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
500	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
501	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
502	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
503	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
504	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
505	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
506	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
507	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
508	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
509	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
510	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
511	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
512	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
513	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
514	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
515	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
516	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
517	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
518	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
519	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
520	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
521	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
522	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
523	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
524	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
525	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
526	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
527	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
528	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
529	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
530	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
531	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
532	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
533	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
534	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
535	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
536	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
537	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
538	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
539	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
540	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
541	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
542	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
543	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
544	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
545	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
546	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
547	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
548	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
549	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
550	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
551	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
552	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
553	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
554	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
555	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
556	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
557	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
558	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
559	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
560	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
561	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
562	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
563	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
564	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
565	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
566	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
567	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
568	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
569	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
570	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
571	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
572	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
573	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
574	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
575	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
576	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
577	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
578	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
579	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
580	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
581	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
582	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
583	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
584	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
585	3300049674	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought	Metagenome	Rhizosphere
586	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
587	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
588	3300049688	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought	Metagenome	Rhizosphere
589	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
590	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
591	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
592	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
593	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
594	3300049850	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control	Metagenome	Rhizosphere
595	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
596	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
597	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
598	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
599	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
600	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
601	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
602	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
603	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
604	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
605	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
606	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
607	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
608	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
609	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
610	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
611	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
612	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
613	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
614	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
615	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
616	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
617	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
618	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
619	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
620	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
621	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
622	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
623	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
624	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
625	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
626	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
627	3300053124	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere	Metagenome	Endosphere
628	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
629	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
630	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
631	3300053135	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere	Metagenome	Endosphere
632	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
633	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
634	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
635	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
636	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
637	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
638	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
639	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
640	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
641	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
642	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
643	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
644	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
645	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
646	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
647	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
648	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
649	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
650	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
651	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
652	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule
653	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
654	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
655	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
656	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
657	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
658	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
659	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
660	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
661	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
662	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
663	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	90.08
Metatranscriptomes	0
Isolates	9.92

Biome Distribution

Category	Percentage (%)
Aerial Root	0.07
Bulb	0
Endosphere	14.35
Nodule	5.67
Rhizoplane	2.6
Rhizosphere	68.97
Stem	0
Stem Tuber	0
Unclassified	8.34

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25162J39368_1001022	3300002737	Bacteria	17340
2	JGI25162J39368_1001952	3300002737	Bacteria	9287
3	JGI25158J39367_1001102	3300002739	Bacteria	4904
4	JGI25157J39369_1002857	3300002741	Bacteria	3888
5	JGI25164J39214_1000447	3300002772	Bacteria	21548
6	JGI25164J39214_1000744	3300002772	Bacteria	12129
7	JGI25159J45721_1000012	3300002987	Bacteria	149808
8	JGI25151J46595_10001546	3300003187	Bacteria	15355
9	JGI25406J46586_10003401	3300003203	Bacteria	7487
10	JGI25165J46597_1000006	3300003214	Bacteria	529784
11	JGI25165J46597_1000276	3300003214	Bacteria	66076
12	JGI25165J46597_1000623	3300003214	Bacteria	29740
13	rootH1_10056871	3300003316	Bacteria	6286
14	JGI25160J50197_1000042	3300003354	Bacteria	149808
15	JGI25160J50197_1000165	3300003354	Bacteria	57403
16	JGI25160J50197_1014129	3300003354	Bacteria	2686
17	JGI25161J50226_1000164	3300003374	Bacteria	46091
18	JGI25161J50226_1000254	3300003374	Bacteria	31906
19	Ga0055539_1007848	3300003752	Bacteria	1343
20	Ga0055533_1008213	3300003756	Bacteria	1343
21	Ga0055527_1000037	3300003760	Bacteria	124590
22	Ga0055535_1000059	3300003761	Bacteria	124595
23	Ga0055542_1000086	3300003762	Bacteria	124594
24	Ga0055529_1000231	3300003763	Bacteria	70928
25	Ga0055526_1000599	3300003771	Bacteria	28366
26	Ga0055526_1003483	3300003771	Bacteria	9980
27	Ga0055526_1003967	3300003771	Bacteria	9118
28	Ga0055537_1000244	3300003773	Bacteria	39860
29	Ga0055537_1000470	3300003773	Bacteria	25445
30	Ga0055524_1000549	3300003775	Bacteria	28342
31	Ga0055524_1001372	3300003775	Bacteria	14142
32	Ga0055536_1007706	3300003781	Bacteria	4769
33	Ga0055534_1000030	3300003784	Bacteria	121396
34	Ga0055534_1015193	3300003784	Bacteria	1417
35	Ga0055528_1000269	3300003790	Bacteria	44061
36	Ga0055528_1000340	3300003790	Bacteria	38910
37	Ga0055528_1000801	3300003790	Bacteria	21717
38	Ga0055530_10001875	3300003791	Bacteria	14448
39	Ga0055530_10002168	3300003791	Bacteria	13009
40	Ga0055531_10010018	3300003794	Bacteria	4769
41	Ga0055531_10024152	3300003794	Bacteria	2253
42	Ga0055531_10051168	3300003794	Bacteria	1087
43	Ga0055543_1000153	3300004625	Bacteria	57441
44	Ga0055543_1001671	3300004625	Bacteria	8435
45	Ga0055543_1002317	3300004625	Bacteria	6387
46	Ga0065165_1000174	3300005262	Bacteria	113769
47	Ga0065165_1000682	3300005262	Bacteria	48662
48	Ga0065165_1004055	3300005262	Bacteria	9512
49	Ga0065712_10000846	3300005290	Bacteria	13151
50	Ga0065712_10094372	3300005290	Bacteria	2258
51	Ga0065715_10001921	3300005293	Bacteria	9410
52	Ga0065715_10019492	3300005293	Bacteria	2288
53	Ga0065715_10032990	3300005293	Bacteria	1861
54	Ga0065715_10152955	3300005293	Bacteria	1708
55	Ga0065707_10081942	3300005295	Bacteria	28468
56	Ga0070658_10001422	3300005327	Bacteria	20409
57	Ga0070658_10002477	3300005327	Bacteria	15435
58	Ga0070658_10012730	3300005327	Bacteria	6747
59	Ga0070658_10040377	3300005327	Bacteria	3764
60	Ga0070658_10079789	3300005327	Bacteria	2688
61	Ga0070658_10118101	3300005327	Bacteria	2202
62	Ga0070676_10009031	3300005328	Bacteria	5394
63	Ga0070676_10028635	3300005328	Bacteria	3164
64	Ga0070683_100048416	3300005329	Bacteria	3930
65	Ga0070683_100119419	3300005329	Bacteria	2490
66	Ga0070683_100248243	3300005329	Bacteria	1692
67	Ga0070690_100049188	3300005330	Bacteria	2686
68	Ga0070670_100006133	3300005331	Bacteria	10164
69	Ga0070670_100442557	3300005331	Bacteria	1151
70	Ga0068869_100023229	3300005334	Bacteria	4280
71	Ga0070666_10158373	3300005335	Bacteria	1582
72	Ga0070680_100001277	3300005336	Bacteria	18194
73	Ga0070682_100078399	3300005337	Bacteria	2131
74	Ga0068868_100010497	3300005338	Bacteria	6710
75	Ga0068868_100177431	3300005338	Bacteria	1766
76	Ga0070660_100031271	3300005339	Bacteria	3997
77	Ga0070660_100038619	3300005339	Bacteria	3625
78	Ga0070660_100041638	3300005339	Bacteria	3501
79	Ga0070660_100154911	3300005339	Bacteria	1844
80	Ga0070660_100190152	3300005339	Bacteria	1663
81	Ga0070691_10000183	3300005341	Bacteria	20760
82	Ga0070691_10041394	3300005341	Bacteria	2178
83	Ga0070687_100027058	3300005343	Bacteria	2766
84	Ga0070661_100048196	3300005344	Bacteria	3119
85	Ga0070661_100172919	3300005344	Bacteria	1641
86	Ga0070692_10191728	3300005345	Bacteria	1191
87	Ga0070668_100077282	3300005347	Bacteria	2602
88	Ga0070668_100174029	3300005347	Bacteria	1754
89	Ga0070669_100001026	3300005353	Bacteria	20337
90	Ga0070669_100054872	3300005353	Bacteria	2919
91	Ga0070675_100003940	3300005354	Bacteria	11251
92	Ga0070675_100006648	3300005354	Bacteria	8890
93	Ga0070675_100056036	3300005354	Bacteria	3247
94	Ga0070671_100001094	3300005355	Bacteria	20083
95	Ga0070671_100002455	3300005355	Bacteria	14331
96	Ga0070671_100138401	3300005355	Bacteria	2053
97	Ga0070671_100200496	3300005355	Bacteria	1692
98	Ga0070671_100373497	3300005355	Bacteria	1218
99	Ga0070674_100003982	3300005356	Bacteria	8370
100	Ga0070674_100014562	3300005356	Bacteria	4892
101	Ga0070674_100017906	3300005356	Bacteria	4466
102	Ga0070673_100034220	3300005364	Bacteria	3842
103	Ga0070673_100139240	3300005364	Bacteria	2045
104	Ga0070688_100014803	3300005365	Bacteria	4425
105	Ga0070688_100043714	3300005365	Bacteria	2761
106	Ga0070688_100145921	3300005365	Bacteria	1612
107	Ga0070688_100154674	3300005365	Bacteria	1570
108	Ga0070659_100001976	3300005366	Bacteria	14647
109	Ga0070659_100009795	3300005366	Bacteria	7042
110	Ga0070659_100024527	3300005366	Bacteria	4622
111	Ga0070659_100030580	3300005366	Bacteria	4167
112	Ga0070659_100034011	3300005366	Bacteria	3963
113	Ga0070659_100316942	3300005366	Bacteria	1303
114	Ga0070667_100024593	3300005367	Bacteria	5003
115	Ga0070703_10007854	3300005406	Bacteria	3000
116	Ga0070709_10122244	3300005434	Bacteria	1766
117	Ga0070709_10209748	3300005434	Bacteria	1384
118	Ga0070714_100000085	3300005435	Bacteria	79813
119	Ga0070713_100000703	3300005436	Bacteria	21478
120	Ga0070713_100100813	3300005436	Bacteria	2500
121	Ga0070713_100546481	3300005436	Bacteria	1096
122	Ga0070710_10057359	3300005437	Bacteria	2207
123	Ga0070701_10062442	3300005438	Bacteria	1968
124	Ga0070711_100001959	3300005439	Bacteria	11556
125	Ga0070711_100009519	3300005439	Bacteria	5991
126	Ga0070711_100011763	3300005439	Bacteria	5443
127	Ga0070708_100055901	3300005445	Bacteria	3510
128	Ga0070708_100166986	3300005445	Bacteria	2053
129	Ga0070708_100278506	3300005445	Bacteria	1574
130	Ga0070663_100014696	3300005455	Bacteria	5031
131	Ga0070663_100144387	3300005455	Bacteria	1820
132	Ga0070678_100268350	3300005456	Bacteria	1438
133	Ga0070662_100001254	3300005457	Bacteria	15584
134	Ga0070681_10004342	3300005458	Bacteria	13479
135	Ga0070681_10018144	3300005458	Bacteria	7036
136	Ga0070681_10041490	3300005458	Unclassified	4612
137	Ga0070681_10122164	3300005458	Bacteria	2538
138	Ga0070681_10136822	3300005458	Bacteria	2380
139	Ga0070681_10150204	3300005458	Bacteria	2256
140	Ga0070681_10172179	3300005458	Bacteria	2087
141	Ga0068867_100008025	3300005459	Bacteria	7461
142	Ga0068867_100305109	3300005459	Bacteria	1314
143	Ga0068867_100319973	3300005459	Bacteria	1285
144	Ga0070706_100030508	3300005467	Bacteria	4969
145	Ga0070706_100053627	3300005467	Bacteria	3721
146	Ga0070707_100032730	3300005468	Bacteria	4954
147	Ga0070707_100104794	3300005468	Bacteria	2742
148	Ga0070707_100224699	3300005468	Bacteria	1828
149	Ga0070698_100197491	3300005471	Bacteria	1948
150	Ga0070699_100085555	3300005518	Bacteria	2751
151	Ga0070699_100145892	3300005518	Bacteria	2091
152	Ga0070679_100003730	3300005530	Bacteria	13963
153	Ga0070679_100017613	3300005530	Bacteria	6916
154	Ga0070679_100034405	3300005530	Bacteria	5021
155	Ga0070679_100036190	3300005530	Bacteria	4898
156	Ga0070679_100050861	3300005530	Bacteria	4128
157	Ga0070679_100306190	3300005530	Bacteria	1539
158	Ga0070679_100310528	3300005530	Bacteria	1527
159	Ga0070684_100011986	3300005535	Bacteria	6927
160	Ga0070684_100059580	3300005535	Bacteria	3338
161	Ga0070684_100155133	3300005535	Bacteria	2076
162	Ga0070697_100002348	3300005536	Bacteria	14546
163	Ga0070697_100023026	3300005536	Bacteria	4954
164	Ga0070697_100094264	3300005536	Bacteria	2480
165	Ga0068853_100000108	3300005539	Bacteria	55985
166	Ga0068853_100034201	3300005539	Bacteria	4314
167	Ga0068853_100045273	3300005539	Bacteria	3768
168	Ga0070672_100006443	3300005543	Bacteria	7888
169	Ga0070672_100034657	3300005543	Bacteria	3832
170	Ga0070665_100000189	3300005548	Bacteria	109948
171	Ga0070665_100074470	3300005548	Bacteria	3401
172	Ga0070665_100091922	3300005548	Bacteria	3039
173	Ga0070665_100117053	3300005548	Bacteria	2667
174	Ga0070665_100165114	3300005548	Bacteria	2216
175	Ga0070665_100480818	3300005548	Bacteria	1253
176	Ga0068855_100092984	3300005563	Bacteria	3478
177	Ga0068855_100139997	3300005563	Bacteria	2759
178	Ga0068855_100141848	3300005563	Bacteria	2738
179	Ga0068855_100286023	3300005563	Bacteria	1829
180	Ga0070664_100005127	3300005564	Bacteria	10517
181	Ga0070664_100032832	3300005564	Bacteria	4343
182	Ga0070664_100069279	3300005564	Bacteria	3018
183	Ga0070664_100115708	3300005564	Bacteria	2344
184	Ga0070664_100118209	3300005564	Bacteria	2319
185	Ga0070664_100286049	3300005564	Bacteria	1487
186	Ga0068857_100010699	3300005577	Bacteria	7983
187	Ga0068854_100043547	3300005578	Bacteria	3182
188	Ga0068854_100254673	3300005578	Bacteria	1403
189	Ga0068856_100001530	3300005614	Bacteria	24235
190	Ga0068856_100016751	3300005614	Bacteria	7100
191	Ga0068856_100070897	3300005614	Bacteria	3448
192	Ga0068856_100282092	3300005614	Bacteria	1678
193	Ga0070702_100004988	3300005615	Bacteria	6128
194	Ga0068852_100124920	3300005616	Bacteria	2361
195	Ga0068852_100162666	3300005616	Bacteria	2085
196	Ga0068852_100284034	3300005616	Bacteria	1596
197	Ga0068852_100495632	3300005616	Bacteria	1216
198	Ga0068859_100006701	3300005617	Bacteria	11698
199	Ga0068859_100061105	3300005617	Bacteria	3796
200	Ga0068859_100152242	3300005617	Bacteria	2388
201	Ga0068859_100188335	3300005617	Bacteria	2147
202	Ga0068864_100000039	3300005618	Bacteria	176547
203	Ga0068864_100007366	3300005618	Bacteria	9056
204	Ga0068864_100009370	3300005618	Bacteria	8079
205	Ga0068864_100025329	3300005618	Bacteria	4995
206	Ga0068864_100081456	3300005618	Bacteria	2837
207	Ga0068864_100085984	3300005618	Bacteria	2766
208	Ga0068864_100103275	3300005618	Bacteria	2531
209	Ga0068864_100514845	3300005618	Bacteria	1153
210	Ga0068861_100033020	3300005719	Bacteria	3815
211	Ga0068861_100053495	3300005719	Bacteria	3072
212	Ga0068861_100166984	3300005719	Bacteria	1820
213	Ga0068851_10019830	3300005834	Bacteria	3250
214	Ga0068870_10020403	3300005840	Bacteria	3227
215	Ga0068863_100002506	3300005841	Bacteria	18253
216	Ga0068863_100151927	3300005841	Bacteria	2216
217	Ga0068858_100096483	3300005842	Bacteria	2755
218	Ga0068858_100211624	3300005842	Bacteria	1835
219	Ga0068858_100234562	3300005842	Bacteria	1740
220	Ga0068858_100403421	3300005842	Bacteria	1314
221	Ga0068860_100082893	3300005843	Bacteria	3049
222	Ga0068860_100141352	3300005843	Bacteria	2314
223	Ga0068860_100388499	3300005843	Bacteria	1379
224	Ga0068862_100089341	3300005844	Bacteria	2682
225	Ga0081455_10181904	3300005937	Bacteria	1590
226	Ga0081540_1006686	3300005983	Bacteria	8340
227	Ga0081540_1032749	3300005983	Bacteria	2832
228	Ga0081539_10000045	3300005985	Bacteria	277027
229	Ga0081539_10001296	3300005985	Bacteria	43866
230	Ga0081539_10006956	3300005985	Bacteria	10514
231	Ga0070717_10023490	3300006028	Bacteria	4886
232	Ga0070717_10025193	3300006028	Bacteria	4727
233	Ga0070717_10057717	3300006028	Bacteria	3209
234	Ga0070717_10111519	3300006028	Bacteria	2334
235	Ga0075365_10000340	3300006038	Bacteria	16674
236	Ga0075365_10002060	3300006038	Bacteria	9586
237	Ga0075365_10004414	3300006038	Bacteria	7450
238	Ga0075365_10176176	3300006038	Bacteria	1494
239	Ga0075368_10006019	3300006042	Bacteria	4210
240	Ga0075363_100025070	3300006048	Bacteria	3037
241	Ga0075363_100033538	3300006048	Bacteria	2674
242	Ga0075364_10002946	3300006051	Bacteria	9598
243	Ga0075364_10005201	3300006051	Bacteria	7550
244	Ga0075364_10211542	3300006051	Bacteria	1315
245	Ga0075432_10001973	3300006058	Bacteria	6821
246	Ga0070716_100009384	3300006173	Bacteria	4874
247	Ga0070712_100000250	3300006175	Bacteria	30272
248	Ga0070712_100011752	3300006175	Bacteria	5564
249	Ga0075362_10001544	3300006177	Bacteria	7426
250	Ga0075362_10006915	3300006177	Bacteria	4254
251	Ga0075362_10020833	3300006177	Bacteria	2743
252	Ga0075362_10053958	3300006177	Bacteria	1805
253	Ga0075362_10130118	3300006177	Bacteria	1196
254	Ga0075367_10004257	3300006178	Bacteria	6956
255	Ga0075367_10023667	3300006178	Bacteria	3458
256	Ga0075367_10037982	3300006178	Bacteria	2801
257	Ga0075369_10000332	3300006186	Bacteria	14056
258	Ga0075366_10005556	3300006195	Bacteria	6835
259	Ga0075366_10052697	3300006195	Bacteria	2417
260	Ga0097621_100053865	3300006237	Bacteria	3279
261	Ga0097621_100104583	3300006237	Bacteria	2386
262	Ga0097621_100240254	3300006237	Bacteria	1583
263	Ga0097621_100347097	3300006237	Bacteria	1319
264	Ga0075370_10001635	3300006353	Bacteria	9882
265	Ga0075370_10110190	3300006353	Bacteria	1598
266	Ga0068871_100016783	3300006358	Bacteria	5526
267	Ga0068871_100109978	3300006358	Bacteria	2317
268	Ga0075428_100013593	3300006844	Bacteria	9064
269	Ga0075428_100323821	3300006844	Bacteria	1656
270	Ga0075428_100394019	3300006844	Bacteria	1484
271	Ga0075428_100397354	3300006844	Bacteria	1477
272	Ga0075431_100156808	3300006847	Bacteria	2342
273	Ga0075431_100203143	3300006847	Bacteria	2027
274	Ga0075433_10013122	3300006852	Bacteria	6723
275	Ga0075433_10024365	3300006852	Bacteria	5106
276	Ga0075433_10091148	3300006852	Bacteria	2694
277	Ga0075433_10173039	3300006852	Bacteria	1921
278	Ga0075434_100118130	3300006871	Bacteria	2665
279	Ga0075434_100160251	3300006871	Bacteria	2270
280	Ga0075434_100186126	3300006871	Bacteria	2097
281	Ga0075434_100324663	3300006871	Bacteria	1559
282	Ga0075429_100012926	3300006880	Bacteria	7241
283	Ga0075429_100251377	3300006880	Bacteria	1548
284	Ga0068865_100141357	3300006881	Bacteria	1815
285	Ga0068865_100354455	3300006881	Bacteria	1190
286	Ga0075436_100025773	3300006914	Bacteria	4046
287	Ga0075436_100029897	3300006914	Bacteria	3748
288	Ga0075436_100046730	3300006914	Bacteria	2986
289	Ga0097620_100006701	3300006931	Bacteria	11698
290	Ga0097620_100061104	3300006931	Bacteria	3796
291	Ga0097620_100152251	3300006931	Bacteria	2388
292	Ga0097620_100188348	3300006931	Bacteria	2147
293	Ga0097620_100503283	3300006931	Bacteria	1306
294	Ga0079104_1000014	3300006946	Bacteria	337362
295	Ga0079104_1000480	3300006946	Bacteria	44433
296	Ga0079104_1006514	3300006946	Bacteria	4399
297	Ga0075435_100013725	3300007076	Bacteria	6035
298	Ga0075435_100039556	3300007076	Bacteria	3763
299	Ga0075435_100320429	3300007076	Bacteria	1327
300	Ga0105251_10001873	3300009011	Bacteria	17290
301	Ga0105251_10005219	3300009011	Bacteria	8562
302	Ga0105244_10004923	3300009036	Bacteria	9036
303	Ga0105250_10013970	3300009092	Bacteria	3306
304	Ga0105250_10047074	3300009092	Bacteria	1729
305	Ga0105240_10003365	3300009093	Bacteria	24874
306	Ga0105240_10010237	3300009093	Bacteria	13200
307	Ga0105240_10029221	3300009093	Bacteria	7188
308	Ga0105240_10068502	3300009093	Bacteria	4394
309	Ga0105240_10072839	3300009093	Bacteria	4245
310	Ga0105240_10120378	3300009093	Bacteria	3161
311	Ga0105240_10358836	3300009093	Bacteria	1651
312	Ga0105240_10375253	3300009093	Bacteria	1607
313	Ga0111539_10111270	3300009094	Bacteria	3214
314	Ga0105245_10139053	3300009098	Bacteria	2285
315	Ga0105247_10038872	3300009101	Bacteria	2906
316	Ga0105247_10070710	3300009101	Bacteria	2181
317	Ga0114129_10008337	3300009147	Bacteria	14781
318	Ga0114129_10110862	3300009147	Bacteria	3787
319	Ga0114129_10123146	3300009147	Bacteria	3567
320	Ga0114129_10139727	3300009147	Bacteria	3321
321	Ga0105243_10054865	3300009148	Bacteria	3165
322	Ga0105241_10076268	3300009174	Bacteria	2614
323	Ga0105241_10215047	3300009174	Bacteria	1612
324	Ga0105241_10260087	3300009174	Bacteria	1475
325	Ga0105242_10230225	3300009176	Bacteria	1661
326	Ga0105248_10003006	3300009177	Bacteria	18710
327	Ga0105248_10016781	3300009177	Bacteria	8063
328	Ga0105248_10328710	3300009177	Bacteria	1722
329	Ga0105248_10446383	3300009177	Bacteria	1457
330	Ga0105237_10003924	3300009545	Bacteria	17421
331	Ga0105238_10035051	3300009551	Bacteria	5104
332	Ga0105238_10143500	3300009551	Bacteria	2364
333	Ga0105238_10299474	3300009551	Bacteria	1591
334	Ga0105249_10010686	3300009553	Bacteria	8064
335	Ga0105249_10017914	3300009553	Bacteria	6294
336	Ga0105249_10023126	3300009553	Bacteria	5574
337	Ga0105249_10395821	3300009553	Bacteria	1411
338	Ga0105249_10466128	3300009553	Bacteria	1304
339	Ga0123341_1052966	3300009765	Bacteria	2221
340	Ga0123342_1015355	3300009766	Bacteria	6987
341	Ga0099796_10078916	3300010159	Bacteria	1203
342	Ga0105239_10023776	3300010375	Bacteria	6748
343	Ga0105239_10023954	3300010375	Bacteria	6723
344	Ga0105239_10024329	3300010375	Bacteria	6671
345	Ga0105239_10029706	3300010375	Bacteria	6010
346	Ga0105239_10325960	3300010375	Bacteria	1732
347	Ga0105246_10260557	3300011119	Bacteria	1381
348	Ga0157373_10035021	3300013100	Bacteria	3606
349	Ga0157373_10037639	3300013100	Bacteria	3467
350	Ga0157373_10088254	3300013100	Bacteria	2185
351	Ga0157371_10106200	3300013102	Bacteria	1992
352	Ga0157370_10012653	3300013104	Bacteria	8740
353	Ga0157370_10060625	3300013104	Bacteria	3592
354	Ga0157370_10134530	3300013104	Bacteria	2305
355	Ga0157370_10170638	3300013104	Bacteria	2022
356	Ga0157370_10217923	3300013104	Bacteria	1768
357	Ga0157370_10233675	3300013104	Bacteria	1701
358	Ga0157369_10004377	3300013105	Bacteria	16674
359	Ga0157369_10022567	3300013105	Bacteria	7020
360	Ga0157369_10050990	3300013105	Bacteria	4480
361	Ga0157369_10097405	3300013105	Bacteria	3138
362	Ga0157374_10011205	3300013296	Bacteria	7753
363	Ga0157374_10021307	3300013296	Bacteria	5765
364	Ga0157374_10073372	3300013296	Bacteria	3230
365	Ga0157374_10086258	3300013296	Bacteria	2986
366	Ga0157374_10402493	3300013296	Bacteria	1366
367	Ga0157378_10007140	3300013297	Bacteria	9756
368	Ga0157378_10072439	3300013297	Bacteria	3096
369	Ga0157378_10174355	3300013297	Bacteria	2019
370	Ga0157378_10277386	3300013297	Bacteria	1614
371	Ga0157378_10375249	3300013297	Bacteria	1395
372	Ga0163162_10013542	3300013306	Bacteria	7965
373	Ga0163162_10018081	3300013306	Bacteria	6899
374	Ga0163162_10113890	3300013306	Bacteria	2803
375	Ga0163162_10171897	3300013306	Bacteria	2292
376	Ga0157372_10001861	3300013307	Bacteria	22889
377	Ga0157372_10004265	3300013307	Bacteria	15289
378	Ga0157375_10008987	3300013308	Bacteria	8744
379	Ga0157375_10139236	3300013308	Bacteria	2553
380	Ga0157375_10202648	3300013308	Bacteria	2140
381	Ga0157375_10462466	3300013308	Bacteria	1434
382	Ga0163163_10004790	3300014325	Bacteria	11616
383	Ga0163163_10010492	3300014325	Bacteria	8335
384	Ga0163163_10014605	3300014325	Bacteria	7224
385	Ga0163163_10055841	3300014325	Bacteria	3903
386	Ga0163163_10093282	3300014325	Bacteria	3027
387	Ga0163163_10093324	3300014325	Bacteria	3026
388	Ga0163163_10115546	3300014325	Bacteria	2715
389	Ga0163163_10134921	3300014325	Bacteria	2509
390	Ga0157380_10012041	3300014326	Bacteria	6261
391	Ga0157380_10038532	3300014326	Bacteria	3712
392	Ga0182008_10017131	3300014497	Bacteria	3760
393	Ga0182008_10029515	3300014497	Bacteria	2771
394	Ga0157376_10061586	3300014969	Bacteria	3155
395	Ga0157376_10140692	3300014969	Bacteria	2164
396	Ga0182006_1003576	3300015261	Bacteria	7922
397	Ga0182007_10002153	3300015262	Bacteria	10019
398	Ga0182007_10005298	3300015262	Bacteria	5689
399	Ga0182005_1007744	3300015265	Bacteria	3205
400	Ga0163161_10010040	3300017792	Bacteria	6554
401	Ga0163161_10110900	3300017792	Bacteria	2051
402	Ga0213873_10012896	3300021358	Bacteria	1822
403	Ga0213876_10000206	3300021384	Bacteria	59646
404	Ga0228711_1010103	3300022739	Bacteria	12525
405	Ga0228710_1010335	3300022740	Bacteria	12523
406	Ga0209436_100648	3300025208	Bacteria	14818
407	Ga0209674_100816	3300025226	Bacteria	10389
408	Ga0209674_103735	3300025226	Bacteria	2699
409	Ga0209672_100074	3300025228	Bacteria	159792
410	Ga0207427_100044	3300025231	Bacteria	242623
411	Ga0207427_100088	3300025231	Bacteria	137220
412	Ga0207427_100191	3300025231	Bacteria	60860
413	Ga0209437_100005	3300025233	Bacteria	1071596
414	Ga0209437_100023	3300025233	Bacteria	614195
415	Ga0209437_100167	3300025233	Bacteria	144661
416	Ga0209258_100004	3300025242	Bacteria	1376422
417	Ga0209258_100008	3300025242	Bacteria	1009355
418	Ga0209258_107940	3300025242	Bacteria	1534
419	Ga0209026_1000051	3300025250	Bacteria	250792
420	Ga0209677_101073	3300025253	Bacteria	12920
421	Ga0209148_1000041	3300025254	Bacteria	469323
422	Ga0209759_1021998	3300025256	Bacteria	1436
423	Ga0209129_1014413	3300025258	Bacteria	1685
424	Ga0209233_1000010	3300025261	Bacteria	1194329
425	Ga0209233_1000011	3300025261	Bacteria	1071611
426	Ga0209233_1000046	3300025261	Bacteria	470971
427	Ga0209233_1000062	3300025261	Bacteria	399685
428	Ga0209233_1006618	3300025261	Bacteria	3720
429	Ga0209565_1000024	3300025263	Bacteria	379907
430	Ga0209565_1006649	3300025263	Bacteria	3216
431	Ga0209455_1000007	3300025272	Bacteria	1157983
432	Ga0209673_1000013	3300025273	Bacteria	571633
433	Ga0209673_1000237	3300025273	Bacteria	106342
434	Ga0209673_1000325	3300025273	Bacteria	87535
435	Ga0209673_1006678	3300025273	Bacteria	5507
436	Ga0209130_1000075	3300025284	Bacteria	171698
437	Ga0209130_1000310	3300025284	Bacteria	57599
438	Ga0209675_1000107	3300025291	Bacteria	119593
439	Ga0209675_1001321	3300025291	Bacteria	14705
440	Ga0209676_1001452	3300025292	Bacteria	22273
441	Ga0209676_1003114	3300025292	Bacteria	10656
442	Ga0209676_1024523	3300025292	Bacteria	1952
443	Ga0209025_1000747	3300025294	Bacteria	54721
444	Ga0209564_1000264	3300025295	Bacteria	111404
445	Ga0209564_1000422	3300025295	Bacteria	74531
446	Ga0209564_1000834	3300025295	Bacteria	41660
447	Ga0209564_1001458	3300025295	Bacteria	24030
448	Ga0209758_1006281	3300025297	Bacteria	8637
449	Ga0209050_1000201	3300025298	Bacteria	134028
450	Ga0209050_1001448	3300025298	Bacteria	25493
451	Ga0209050_1005253	3300025298	Bacteria	8252
452	Ga0209050_1026796	3300025298	Bacteria	1919
453	Ga0209256_1000245	3300025299	Bacteria	96643
454	Ga0209256_1000369	3300025299	Bacteria	72557
455	Ga0209256_1000768	3300025299	Bacteria	41660
456	Ga0209256_1001381	3300025299	Bacteria	25407
457	Ga0209256_1003963	3300025299	Bacteria	9735
458	Ga0209256_1004988	3300025299	Bacteria	7943
459	Ga0209256_1007290	3300025299	Bacteria	5506
460	Ga0207426_1000039	3300025302	Bacteria	439937
461	Ga0207426_1000069	3300025302	Bacteria	334513
462	Ga0207426_1000163	3300025302	Bacteria	171698
463	Ga0209051_1001000	3300025303	Bacteria	27153
464	Ga0209051_1019262	3300025303	Bacteria	2985
465	Ga0209257_1000208	3300025304	Bacteria	141393
466	Ga0209257_1001401	3300025304	Bacteria	28810
467	Ga0209257_1008238	3300025304	Bacteria	6002
468	Ga0209257_1019193	3300025304	Bacteria	2587
469	Ga0207697_10015513	3300025315	Bacteria	3148
470	Ga0207696_1001046	3300025711	Bacteria	16401
471	Ga0207655_1001026	3300025728	Bacteria	28192
472	Ga0207655_1021264	3300025728	Bacteria	3298
473	Ga0207713_1002314	3300025735	Bacteria	13998
474	Ga0207713_1078235	3300025735	Bacteria	1198
475	Ga0207692_10002549	3300025898	Bacteria	7003
476	Ga0207692_10027527	3300025898	Bacteria	2679
477	Ga0207692_10068366	3300025898	Bacteria	1863
478	Ga0207642_10001917	3300025899	Bacteria	6413
479	Ga0207642_10027365	3300025899	Bacteria	2333
480	Ga0207642_10064718	3300025899	Bacteria	1715
481	Ga0207688_10013005	3300025901	Bacteria	4525
482	Ga0207688_10028540	3300025901	Bacteria	3070
483	Ga0207688_10154610	3300025901	Bacteria	1357
484	Ga0207699_10086114	3300025906	Bacteria	1962
485	Ga0207699_10238538	3300025906	Bacteria	1248
486	Ga0207645_10026706	3300025907	Bacteria	3730
487	Ga0207645_10028078	3300025907	Bacteria	3633
488	Ga0207643_10001041	3300025908	Bacteria	16470
489	Ga0207643_10016928	3300025908	Bacteria	3978
490	Ga0207705_10009047	3300025909	Bacteria	7257
491	Ga0207705_10011244	3300025909	Bacteria	6489
492	Ga0207705_10097010	3300025909	Bacteria	2164
493	Ga0207684_10016127	3300025910	Bacteria	6418
494	Ga0207684_10218664	3300025910	Bacteria	1644
495	Ga0207684_10423980	3300025910	Bacteria	1143
496	Ga0207654_10000458	3300025911	Bacteria	23295
497	Ga0207707_10002463	3300025912	Bacteria	16660
498	Ga0207707_10013761	3300025912	Bacteria	7055
499	Ga0207707_10017833	3300025912	Bacteria	6192
500	Ga0207707_10083627	3300025912	Bacteria	2787
501	Ga0207707_10219699	3300025912	Bacteria	1654
502	Ga0207707_10220156	3300025912	Bacteria	1652
503	Ga0207707_10246107	3300025912	Bacteria	1554
504	Ga0207695_10003786	3300025913	Bacteria	20991
505	Ga0207695_10005481	3300025913	Bacteria	16806
506	Ga0207695_10039157	3300025913	Bacteria	5097
507	Ga0207695_10050552	3300025913	Bacteria	4371
508	Ga0207695_10093194	3300025913	Bacteria	3022
509	Ga0207695_10213725	3300025913	Bacteria	1838
510	Ga0207671_10002406	3300025914	Bacteria	20068
511	Ga0207671_10369129	3300025914	Bacteria	1139
512	Ga0207693_10000015	3300025915	Bacteria	147464
513	Ga0207693_10000223	3300025915	Bacteria	51785
514	Ga0207693_10068868	3300025915	Bacteria	2770
515	Ga0207663_10001639	3300025916	Bacteria	10542
516	Ga0207663_10011183	3300025916	Bacteria	4809
517	Ga0207663_10023654	3300025916	Bacteria	3529
518	Ga0207663_10058631	3300025916	Bacteria	2431
519	Ga0207660_10000265	3300025917	Bacteria	34314
520	Ga0207662_10052041	3300025918	Bacteria	2437
521	Ga0207662_10103306	3300025918	Bacteria	1768
522	Ga0207662_10106424	3300025918	Bacteria	1744
523	Ga0207657_10007142	3300025919	Bacteria	11470
524	Ga0207657_10027172	3300025919	Bacteria	5245
525	Ga0207657_10029092	3300025919	Bacteria	5034
526	Ga0207657_10043878	3300025919	Bacteria	3935
527	Ga0207657_10048414	3300025919	Bacteria	3711
528	Ga0207657_10107843	3300025919	Bacteria	2303
529	Ga0207657_10109865	3300025919	Bacteria	2278
530	Ga0207649_10032637	3300025920	Bacteria	3106
531	Ga0207649_10100783	3300025920	Bacteria	1911
532	Ga0207652_10003444	3300025921	Bacteria	13054
533	Ga0207652_10012273	3300025921	Bacteria	6919
534	Ga0207652_10074882	3300025921	Bacteria	2949
535	Ga0207652_10324028	3300025921	Bacteria	1391
536	Ga0207646_10007690	3300025922	Bacteria	10910
537	Ga0207646_10023357	3300025922	Bacteria	5680
538	Ga0207646_10088748	3300025922	Bacteria	2767
539	Ga0207681_10025544	3300025923	Bacteria	3800
540	Ga0207694_10044666	3300025924	Bacteria	3421
541	Ga0207694_10266878	3300025924	Bacteria	1403
542	Ga0207650_10008887	3300025925	Bacteria	6863
543	Ga0207650_10042618	3300025925	Bacteria	3329
544	Ga0207650_10427942	3300025925	Bacteria	1099
545	Ga0207659_10000011	3300025926	Bacteria	275661
546	Ga0207659_10007427	3300025926	Bacteria	6736
547	Ga0207659_10085046	3300025926	Bacteria	2349
548	Ga0207659_10096542	3300025926	Bacteria	2219
549	Ga0207659_10138536	3300025926	Bacteria	1886
550	Ga0207700_10000095	3300025928	Bacteria	54191
551	Ga0207700_10003302	3300025928	Bacteria	9345
552	Ga0207700_10081433	3300025928	Bacteria	2528
553	Ga0207700_10459988	3300025928	Bacteria	1122
554	Ga0207664_10000164	3300025929	Bacteria	53052
555	Ga0207664_10128175	3300025929	Bacteria	2132
556	Ga0207664_10242886	3300025929	Bacteria	1569
557	Ga0207644_10141802	3300025931	Bacteria	1851
558	Ga0207690_10006181	3300025932	Bacteria	7091
559	Ga0207690_10009965	3300025932	Bacteria	5643
560	Ga0207690_10030063	3300025932	Bacteria	3460
561	Ga0207690_10107021	3300025932	Bacteria	2008
562	Ga0207690_10152956	3300025932	Bacteria	1712
563	Ga0207706_10000293	3300025933	Bacteria	54228
564	Ga0207686_10035304	3300025934	Bacteria	3000
565	Ga0207686_10035368	3300025934	Bacteria	2998
566	Ga0207709_10003858	3300025935	Bacteria	8783
567	Ga0207709_10158982	3300025935	Bacteria	1574
568	Ga0207670_10345811	3300025936	Bacteria	1176
569	Ga0207669_10003444	3300025937	Bacteria	6841
570	Ga0207704_10011636	3300025938	Bacteria	4340
571	Ga0207691_10003193	3300025940	Bacteria	16012
572	Ga0207691_10033270	3300025940	Bacteria	4799
573	Ga0207711_10100352	3300025941	Bacteria	2560
574	Ga0207711_10130020	3300025941	Bacteria	2257
575	Ga0207711_10141629	3300025941	Bacteria	2164
576	Ga0207689_10003862	3300025942	Bacteria	13656
577	Ga0207689_10021985	3300025942	Bacteria	5363
578	Ga0207689_10247246	3300025942	Bacteria	1475
579	Ga0207661_10038445	3300025944	Bacteria	3750
580	Ga0207661_10237828	3300025944	Bacteria	1615
581	Ga0207661_10300052	3300025944	Bacteria	1440
582	Ga0207679_10063300	3300025945	Bacteria	2760
583	Ga0207679_10068942	3300025945	Bacteria	2659
584	Ga0207679_10193489	3300025945	Bacteria	1693
585	Ga0207667_10246348	3300025949	Bacteria	1828
586	Ga0207651_10014779	3300025960	Bacteria	4518
587	Ga0207651_10035405	3300025960	Bacteria	3245
588	Ga0207651_10111571	3300025960	Bacteria	2054
589	Ga0207712_10001780	3300025961	Bacteria	14326
590	Ga0207712_10014570	3300025961	Bacteria	5062
591	Ga0207712_10100581	3300025961	Bacteria	2148
592	Ga0207712_10151630	3300025961	Bacteria	1791
593	Ga0207668_10009998	3300025972	Bacteria	5709
594	Ga0207668_10058327	3300025972	Bacteria	2698
595	Ga0207640_10127800	3300025981	Bacteria	1832
596	Ga0207640_10192935	3300025981	Bacteria	1537
597	Ga0207640_10217133	3300025981	Bacteria	1461
598	Ga0207640_10245145	3300025981	Bacteria	1387
599	Ga0207658_10319020	3300025986	Bacteria	1344
600	Ga0207677_10006541	3300026023	Bacteria	6398
601	Ga0207677_10076037	3300026023	Bacteria	2389
602	Ga0207703_10204932	3300026035	Bacteria	1755
603	Ga0207639_10000127	3300026041	Bacteria	56027
604	Ga0207639_10036949	3300026041	Bacteria	3624
605	Ga0207639_10117369	3300026041	Bacteria	2180
606	Ga0207639_10216317	3300026041	Bacteria	1652
607	Ga0207678_10010050	3300026067	Bacteria	8305
608	Ga0207678_10017167	3300026067	Bacteria	6353
609	Ga0207708_10018263	3300026075	Bacteria	5279
610	Ga0207702_10001070	3300026078	Bacteria	28050
611	Ga0207702_10012962	3300026078	Bacteria	6935
612	Ga0207702_10099176	3300026078	Bacteria	2567
613	Ga0207702_10110439	3300026078	Bacteria	2443
614	Ga0207702_10419976	3300026078	Bacteria	1293
615	Ga0207641_10018222	3300026088	Bacteria	5755
616	Ga0207641_10022087	3300026088	Bacteria	5235
617	Ga0207641_10036177	3300026088	Bacteria	4120
618	Ga0207641_10051387	3300026088	Bacteria	3491
619	Ga0207648_10028429	3300026089	Bacteria	4957
620	Ga0207648_10056675	3300026089	Bacteria	3419
621	Ga0207676_10000008	3300026095	Bacteria	588913
622	Ga0207676_10007421	3300026095	Bacteria	7776
623	Ga0207676_10032518	3300026095	Bacteria	3932
624	Ga0207676_10051558	3300026095	Bacteria	3213
625	Ga0207676_10150610	3300026095	Bacteria	2003
626	Ga0207674_10002015	3300026116	Bacteria	25797
627	Ga0207674_10112580	3300026116	Bacteria	2695
628	Ga0207674_10197882	3300026116	Bacteria	1959
629	Ga0207675_100025344	3300026118	Bacteria	5518
630	Ga0207675_100060823	3300026118	Bacteria	3526
631	Ga0207675_100174869	3300026118	Bacteria	2054
632	Ga0207675_100388717	3300026118	Bacteria	1373
633	Ga0207683_10001725	3300026121	Bacteria	19490
634	Ga0207683_10036702	3300026121	Bacteria	4269
635	Ga0207683_10213855	3300026121	Bacteria	1755
636	Ga0207683_10244892	3300026121	Bacteria	1635
637	Ga0207698_10054491	3300026142	Bacteria	3077
638	Ga0207698_10075775	3300026142	Bacteria	2690
639	Ga0207698_10135706	3300026142	Bacteria	2111
640	Ga0207698_10565426	3300026142	Bacteria	1117
641	Ga0209281_1000004	3300027111	Bacteria	1253949
642	Ga0209281_1000032	3300027111	Bacteria	401727
643	Ga0209389_1000103	3300027296	Bacteria	75590
644	Ga0209813_10002280	3300027866	Bacteria	4384
645	Ga0207428_10013174	3300027907	Bacteria	7239
646	Ga0207428_10069489	3300027907	Bacteria	2769
647	Ga0268266_10000180	3300028379	Bacteria	112295
648	Ga0268266_10015730	3300028379	Bacteria	6479
649	Ga0268266_10053097	3300028379	Bacteria	3481
650	Ga0268266_10143384	3300028379	Bacteria	2145
651	Ga0268266_10206215	3300028379	Bacteria	1801
652	Ga0268266_10210245	3300028379	Bacteria	1784
653	Ga0268266_10282022	3300028379	Bacteria	1545
654	Ga0268265_10233890	3300028380	Bacteria	1617
655	Ga0268264_10106779	3300028381	Bacteria	2445
656	Ga0265334_10000413	3300028573	Bacteria	22389
657	Ga0265336_10002094	3300028666	Bacteria	8476
658	Ga0307517_10090532	3300028786	Bacteria	2509
659	Ga0307515_10000109	3300028794	Bacteria	195895
660	Ga0307515_10001259	3300028794	Bacteria	57802
661	Ga0307515_10008042	3300028794	Bacteria	20665
662	Ga0307515_10121215	3300028794	Bacteria	2960
663	Ga0265338_10001001	3300028800	Bacteria	47438
664	Ga0265338_10001869	3300028800	Bacteria	33054
665	Ga0265338_10012656	3300028800	Bacteria	9603
666	Ga0265338_10048393	3300028800	Bacteria	3868
667	Ga0265338_10151481	3300028800	Bacteria	1801
668	Ga0307512_10050486	3300030522	Bacteria	3340
669	Ga0265332_10020144	3300031238	Bacteria	2945
670	Ga0265328_10008226	3300031239	Bacteria	4312
671	Ga0265328_10015756	3300031239	Bacteria	2956
672	Ga0265320_10028438	3300031240	Bacteria	2903
673	Ga0265325_10007021	3300031241	Bacteria	6788
674	Ga0265325_10025630	3300031241	Bacteria	3200
675	Ga0265325_10060186	3300031241	Bacteria	1930
676	Ga0265325_10079283	3300031241	Bacteria	1634
677	Ga0265340_10121671	3300031247	Bacteria	1201
678	Ga0265339_10000017	3300031249	Bacteria	185084
679	Ga0265339_10009489	3300031249	Bacteria	6116
680	Ga0265327_10001337	3300031251	Bacteria	31965
681	Ga0265316_10003240	3300031344	Bacteria	16535
682	Ga0265316_10031939	3300031344	Bacteria	4302
683	Ga0265316_10079707	3300031344	Bacteria	2512
684	Ga0307513_10012800	3300031456	Bacteria	10329
685	Ga0307513_10019854	3300031456	Bacteria	7986
686	Ga0307513_10100115	3300031456	Bacteria	2925
687	Ga0307509_10000004	3300031507	Bacteria	535507
688	Ga0307509_10003494	3300031507	Bacteria	23739
689	Ga0307509_10225311	3300031507	Bacteria	1683
690	Ga0307408_100008987	3300031548	Bacteria	6600
691	Ga0265313_10039997	3300031595	Bacteria	2322
692	Ga0307508_10000166	3300031616	Bacteria	79602
693	Ga0307508_10026258	3300031616	Bacteria	5279
694	Ga0307508_10080456	3300031616	Bacteria	2840
695	Ga0316579_10010492	3300031691	Bacteria	3918
696	Ga0265314_10012766	3300031711	Bacteria	6828
697	Ga0265342_10004192	3300031712	Bacteria	11471
698	Ga0265342_10007899	3300031712	Bacteria	7713
699	Ga0307516_10013100	3300031730	Bacteria	8866
700	Ga0307516_10107977	3300031730	Bacteria	2591
701	Ga0307516_10380971	3300031730	Bacteria	1072
702	Ga0307405_10314769	3300031731	Bacteria	1193
703	Ga0316577_10005506	3300031733	Bacteria	6642
704	Ga0307413_10010666	3300031824	Bacteria	4472
705	Ga0307410_10009755	3300031852	Bacteria	5403
706	Ga0307410_10009966	3300031852	Bacteria	5359
707	Ga0307410_10041567	3300031852	Bacteria	3033
708	Ga0307412_10000073	3300031911	Bacteria	105453
709	Ga0307412_10047716	3300031911	Bacteria	2814
710	Ga0307409_100022159	3300031995	Bacteria	4373
711	Ga0307416_100042585	3300032002	Bacteria	3546
712	Ga0307416_100233740	3300032002	Bacteria	1774
713	Ga0307414_10000521	3300032004	Bacteria	19988
714	Ga0307411_10159911	3300032005	Bacteria	1685
715	Ga0307507_10090245	3300033179	Bacteria	2631
716	Ga0307507_10102221	3300033179	Bacteria	2392
717	Ga0307507_10255223	3300033179	Bacteria	1127
718	Ga0373934_0073585	3300035086	Bacteria	1368
719	Ga0373951_0009188	3300035091	Bacteria	2227
720	Ga0373932_0000847	3300035112	Bacteria	9012
721	Ga0373936_0003143	3300035113	Bacteria	6180
722	Ga0373936_0014042	3300035113	Bacteria	3059
723	Ga0373939_0066423	3300035114	Bacteria	1163
724	Ga0373953_0016847	3300035117	Bacteria	2676
725	Ga0373943_0054539	3300035170	Bacteria	1977
726	Ga0373955_0012412	3300035172	Bacteria	4095
727	Ga0373955_0036029	3300035172	Bacteria	2624
728	Ga0373955_0052344	3300035172	Bacteria	2227
729	Ga0373955_0089868	3300035172	Bacteria	1749
730	Ga0373942_0006271	3300035207	Bacteria	2744
731	Ga0373942_0017356	3300035207	Bacteria	1774
732	Ga0373931_0014304	3300035691	Bacteria	3876
733	Ga0373931_0057387	3300035691	Bacteria	2088
734	Ga0373927_0001173	3300035695	Bacteria	19846
735	Ga0373927_0020679	3300035695	Bacteria	4316
736	Ga0373933_0015935	3300035724	Bacteria	4196
737	Ga0373933_0058334	3300035724	Bacteria	2322
738	Ga0373937_0038118	3300036401	Bacteria	4381
739	Ga0373937_0063688	3300036401	Bacteria	3392
740	Ga0373937_0176427	3300036401	Bacteria	2006
741	Ga0373937_0201814	3300036401	Bacteria	1869
742	Ga0373937_0207784	3300036401	Bacteria	1841
743	Ga0373937_0356392	3300036401	Bacteria	1386
744	Ga0316584_0003543	3300036712	Bacteria	10182
745	Ga0316584_0179680	3300036712	Bacteria	1567
746	Ga0373925_0001435	3300037068	Bacteria	20631
747	Ga0373925_0411067	3300037068	Bacteria	1104
748	Ga0395900_0128604	3300037418	Bacteria	2596
749	Ga0395900_0331314	3300037418	Bacteria	1500
750	Ga0395898_0229569	3300037466	Unclassified	1770
751	Ga0395905_0003971	3300037471	Bacteria	15563
752	Ga0395905_0108086	3300037471	Bacteria	2611
753	Ga0395905_0315405	3300037471	Bacteria	1452
754	Ga0395905_0334742	3300037471	Bacteria	1404
755	Ga0395905_0381297	3300037471	Bacteria	1304
756	Ga0395905_0388311	3300037471	Bacteria	1290
757	Ga0395901_0016819	3300038443	Bacteria	7454
758	Ga0395901_0078847	3300038443	Bacteria	3439
759	Ga0395901_0103888	3300038443	Bacteria	2981
760	Ga0436365_0880687	3300039437	Bacteria	59690
761	Ga0451833_0452954	3300041491	Bacteria	1193
762	Ga0451835_0639535	3300041492	Bacteria	4610
763	Ga0451837_0518878	3300041494	Bacteria	2132
764	Ga0451839_1038663	3300041496	Bacteria	3713
765	Ga0451841_0840586	3300041498	Bacteria	1220
766	Ga0451845_0125421	3300041501	Bacteria	4719
767	Ga0451847_0385431	3300041503	Bacteria	2390
768	Ga0451851_0082242	3300041507	Bacteria	4165
769	Ga0451851_0254372	3300041507	Bacteria	10404
770	Ga0451843_0051522	3300041509	Bacteria	2814
771	Ga0451855_1207873	3300041511	Bacteria	2346
772	Ga0451855_1245641	3300041511	Bacteria	2331
773	Ga0451853_2815247	3300041512	Bacteria	2892
774	Ga0439432_020827	3300042006	Bacteria	2177
775	Ga0451577_0000029	3300042876	Bacteria	395301
776	Ga0451577_0002390	3300042876	Bacteria	22478
777	Ga0451577_0006551	3300042876	Bacteria	11585
778	Ga0451577_0011763	3300042876	Bacteria	8259
779	Ga0451577_0213228	3300042876	Bacteria	1744
780	Ga0453683_0000277	3300044673	Bacteria	67425
781	Ga0453683_0000304	3300044673	Bacteria	61772
782	Ga0453683_0001087	3300044673	Bacteria	25012
783	Ga0466963_0004997	3300044694	Bacteria	7742
784	Ga0453684_0000088	3300044712	Bacteria	395200
785	Ga0453684_0002540	3300044712	Bacteria	43933
786	Ga0453684_0002678	3300044712	Bacteria	42425
787	Ga0453684_0005232	3300044712	Bacteria	25986
788	Ga0453684_0011873	3300044712	Bacteria	14504
789	Ga0453684_0014205	3300044712	Bacteria	12783
790	Ga0453684_0062625	3300044712	Bacteria	4763
791	Ga0453684_0116546	3300044712	Bacteria	3234
792	Ga0453684_0142480	3300044712	Bacteria	2860
793	Ga0453684_0547489	3300044712	Bacteria	1275
794	Ga0451576_0000967	3300045051	Bacteria	53617
795	Ga0451576_0010145	3300045051	Bacteria	10841
796	Ga0451576_0010705	3300045051	Bacteria	10501
797	Ga0451576_0011104	3300045051	Bacteria	10273
798	Ga0451576_0028725	3300045051	Bacteria	5955
799	Ga0451576_0178845	3300045051	Bacteria	2215
800	Ga0451576_0184786	3300045051	Bacteria	2177
801	Ga0451576_0359635	3300045051	Bacteria	1524
802	Ga0451576_0425934	3300045051	Bacteria	1392
803	Ga0466967_0006850	3300045976	Bacteria	8130
804	Ga0495617_000166	3300046452	Bacteria	42074
805	Ga0495617_032055	3300046452	Bacteria	1764
806	Ga0495627_000062	3300046453	Bacteria	138772
807	Ga0495627_001924	3300046453	Bacteria	10832
808	Ga0495627_059893	3300046453	Bacteria	1129
809	Ga0495603_0000025	3300046455	Bacteria	62985
810	Ga0495590_0003620	3300046457	Bacteria	6293
811	Ga0495591_000002	3300046458	Bacteria	455013
812	Ga0495591_000003	3300046458	Bacteria	449825
813	Ga0495591_000009	3300046458	Bacteria	331626
814	Ga0495591_010385	3300046458	Bacteria	3614
815	Ga0495629_0005209	3300046459	Bacteria	9737
816	Ga0495638_0000147	3300046460	Bacteria	110817
817	Ga0495638_0000373	3300046460	Bacteria	55670
818	Ga0495638_0005596	3300046460	Bacteria	9286
819	Ga0495638_0008465	3300046460	Bacteria	7292
820	Ga0495638_0014238	3300046460	Bacteria	5383
821	Ga0495638_0046711	3300046460	Bacteria	2719
822	Ga0495638_0115149	3300046460	Bacteria	1594
823	Ga0495638_0157978	3300046460	Bacteria	1310
824	Ga0495638_0178137	3300046460	Bacteria	1215
825	Ga0495651_0025414	3300046462	Bacteria	4610
826	Ga0495651_0111174	3300046462	Bacteria	2025
827	Ga0495651_0238000	3300046462	Bacteria	1250
828	Ga0495653_0044424	3300046463	Bacteria	3447
829	Ga0495653_0171407	3300046463	Bacteria	1498
830	Ga0495650_0000484	3300046471	Bacteria	60820
831	Ga0495650_0082565	3300046471	Bacteria	1236
832	Ga0495580_0014469	3300046472	Bacteria	5985
833	Ga0495580_0105031	3300046472	Bacteria	1963
834	Ga0495605_0000517	3300046474	Bacteria	32881
835	Ga0495605_0000731	3300046474	Bacteria	24213
836	Ga0495605_0024517	3300046474	Bacteria	3155
837	Ga0495605_0062376	3300046474	Bacteria	1781
838	Ga0495664_0163437	3300046477	Bacteria	1351
839	Ga0495584_0004896	3300046491	Bacteria	7150
840	Ga0495585_0001928	3300046492	Bacteria	15514
841	Ga0495585_0003186	3300046492	Bacteria	11231
842	Ga0495585_0034770	3300046492	Bacteria	2849
843	Ga0495594_0000383	3300046499	Bacteria	22193
844	Ga0495594_0000849	3300046499	Bacteria	15735
845	Ga0495594_0002139	3300046499	Bacteria	10285
846	Ga0495594_0132515	3300046499	Bacteria	1412
847	Ga0495596_0000034	3300046500	Bacteria	100596
848	Ga0495596_0041675	3300046500	Bacteria	1810
849	Ga0495607_0000045	3300046501	Bacteria	125217
850	Ga0495607_0000136	3300046501	Bacteria	77992
851	Ga0495607_0000323	3300046501	Bacteria	49494
852	Ga0495607_0000664	3300046501	Bacteria	33361
853	Ga0495607_0003007	3300046501	Bacteria	13165
854	Ga0495607_0030430	3300046501	Bacteria	3314
855	Ga0495607_0031272	3300046501	Bacteria	3259
856	Ga0495607_0046990	3300046501	Bacteria	2531
857	Ga0495607_0059138	3300046501	Bacteria	2187
858	Ga0495607_0093117	3300046501	Bacteria	1628
859	Ga0495583_0000037	3300046506	Bacteria	244437
860	Ga0495583_0003754	3300046506	Bacteria	11296
861	Ga0495583_0009208	3300046506	Bacteria	5926
862	Ga0495583_0086361	3300046506	Bacteria	1357
863	Ga0495606_0001186	3300046507	Bacteria	36728
864	Ga0495606_0003254	3300046507	Bacteria	17424
865	Ga0495606_0004151	3300046507	Bacteria	14686
866	Ga0495606_0005518	3300046507	Bacteria	12080
867	Ga0495606_0018848	3300046507	Bacteria	5161
868	Ga0495606_0046227	3300046507	Bacteria	2879
869	Ga0495606_0087013	3300046507	Bacteria	1930
870	Ga0495606_0199574	3300046507	Bacteria	1141
871	Ga0495610_0001573	3300046512	Bacteria	20100
872	Ga0495610_0001982	3300046512	Bacteria	17467
873	Ga0495610_0009411	3300046512	Bacteria	6183
874	Ga0495610_0029421	3300046512	Bacteria	2893
875	Ga0495610_0059577	3300046512	Bacteria	1821
876	Ga0495616_0000165	3300046513	Bacteria	57822
877	Ga0495616_0007637	3300046513	Bacteria	6469
878	Ga0495616_0010384	3300046513	Bacteria	5392
879	Ga0495616_0018236	3300046513	Bacteria	3856
880	Ga0495616_0021630	3300046513	Bacteria	3479
881	Ga0495616_0023716	3300046513	Bacteria	3298
882	Ga0495616_0043088	3300046513	Bacteria	2294
883	Ga0495616_0047868	3300046513	Bacteria	2151
884	Ga0495616_0081326	3300046513	Bacteria	1550
885	Ga0495620_0012713	3300046515	Bacteria	4332
886	Ga0495620_0092615	3300046515	Bacteria	1211
887	Ga0495630_0003428	3300046517	Bacteria	11038
888	Ga0495631_0000076	3300046518	Bacteria	63613
889	Ga0495631_0000303	3300046518	Bacteria	34166
890	Ga0495631_0001470	3300046518	Bacteria	14298
891	Ga0495631_0007732	3300046518	Bacteria	5454
892	Ga0495632_0003297	3300046519	Bacteria	11522
893	Ga0495632_0005254	3300046519	Bacteria	8611
894	Ga0495632_0005746	3300046519	Bacteria	8141
895	Ga0495632_0012028	3300046519	Bacteria	5012
896	Ga0495632_0020778	3300046519	Bacteria	3548
897	Ga0495632_0045411	3300046519	Bacteria	2188
898	Ga0495632_0053055	3300046519	Bacteria	1992
899	Ga0495632_0061000	3300046519	Bacteria	1831
900	Ga0495637_0000334	3300046520	Bacteria	36438
901	Ga0495637_0000716	3300046520	Bacteria	22706
902	Ga0495637_0003264	3300046520	Bacteria	8627
903	Ga0495637_0012651	3300046520	Bacteria	4028
904	Ga0495637_0017699	3300046520	Bacteria	3315
905	Ga0495643_0000284	3300046522	Bacteria	72435
906	Ga0495643_0000653	3300046522	Bacteria	41007
907	Ga0495643_0005280	3300046522	Bacteria	8775
908	Ga0495643_0099381	3300046522	Bacteria	1493
909	Ga0495643_0145154	3300046522	Bacteria	1179
910	Ga0495644_0000012	3300046523	Bacteria	94927
911	Ga0495644_0000105	3300046523	Bacteria	39842
912	Ga0495644_0000421	3300046523	Bacteria	18888
913	Ga0495644_0000934	3300046523	Bacteria	12141
914	Ga0495648_0000068	3300046524	Bacteria	138518
915	Ga0495648_0000636	3300046524	Bacteria	37436
916	Ga0495648_0005126	3300046524	Bacteria	10973
917	Ga0495648_0055796	3300046524	Bacteria	2380
918	Ga0495648_0127090	3300046524	Bacteria	1360
919	Ga0495663_0000757	3300046525	Bacteria	11087
920	Ga0495663_0000830	3300046525	Bacteria	10577
921	Ga0495663_0050632	3300046525	Bacteria	1285
922	Ga0495666_0053296	3300046526	Bacteria	1941
923	Ga0495654_0000045	3300046530	Bacteria	150593
924	Ga0495654_0000415	3300046530	Bacteria	36392
925	Ga0495654_0000769	3300046530	Bacteria	24760
926	Ga0495654_0005443	3300046530	Bacteria	7393
927	Ga0495654_0012708	3300046530	Bacteria	4520
928	Ga0495654_0021836	3300046530	Bacteria	3329
929	Ga0495654_0025735	3300046530	Bacteria	3030
930	Ga0495654_0061059	3300046530	Bacteria	1811
931	Ga0495654_0106744	3300046530	Bacteria	1282
932	Ga0495640_0028430	3300046533	Bacteria	4026
933	Ga0495598_0041552	3300046537	Bacteria	1346
934	Ga0495609_0000020	3300046538	Bacteria	294662
935	Ga0495609_0011523	3300046538	Bacteria	4208
936	Ga0495609_0038113	3300046538	Bacteria	2168
937	Ga0495609_0048454	3300046538	Bacteria	1899
938	Ga0495621_0005242	3300046539	Bacteria	3712
939	Ga0495621_0055957	3300046539	Bacteria	1421
940	Ga0495597_0000023	3300046542	Bacteria	149302
941	Ga0495597_0028618	3300046542	Bacteria	2549
942	Ga0495645_0007209	3300046543	Bacteria	7737
943	Ga0495645_0017619	3300046543	Bacteria	5118
944	Ga0495622_0001980	3300046557	Bacteria	10037
945	Ga0495633_0002695	3300046558	Bacteria	12329
946	Ga0495633_0003416	3300046558	Bacteria	10577
947	Ga0495633_0013512	3300046558	Bacteria	4300
948	Ga0495633_0059847	3300046558	Bacteria	1785
949	Ga0495667_0043856	3300046559	Bacteria	2963
950	Ga0495667_0140943	3300046559	Bacteria	1553
951	Ga0495656_0083201	3300046615	Bacteria	1449
952	Ga0495668_0000776	3300046616	Bacteria	37248
953	Ga0495668_0006629	3300046616	Bacteria	7547
954	Ga0495668_0007922	3300046616	Bacteria	6704
955	Ga0495668_0008246	3300046616	Bacteria	6532
956	Ga0495668_0020574	3300046616	Bacteria	3793
957	Ga0495668_0047693	3300046616	Bacteria	2378
958	Ga0495668_0070845	3300046616	Bacteria	1916
959	Ga0495668_0199983	3300046616	Bacteria	1094
960	Ga0495634_0000347	3300046642	Bacteria	44864
961	Ga0495634_0083463	3300046642	Bacteria	2085
962	Ga0495611_0001754	3300046648	Bacteria	10495
963	Ga0495611_0028540	3300046648	Bacteria	2444
964	Ga0495625_0000036	3300046660	Bacteria	221680
965	Ga0495625_0000966	3300046660	Bacteria	38161
966	Ga0495625_0001325	3300046660	Bacteria	30782
967	Ga0495625_0001742	3300046660	Bacteria	25169
968	Ga0495625_0003377	3300046660	Bacteria	16005
969	Ga0495625_0004397	3300046660	Bacteria	13361
970	Ga0495625_0005317	3300046660	Bacteria	11795
971	Ga0495625_0005641	3300046660	Bacteria	11340
972	Ga0495625_0027398	3300046660	Bacteria	4291
973	Ga0495625_0090243	3300046660	Bacteria	2120
974	Ga0495625_0151306	3300046660	Bacteria	1560
975	Ga0495635_0000210	3300046663	Bacteria	37002
976	Ga0495635_0119264	3300046663	Bacteria	1800
977	Ga0495635_0159173	3300046663	Bacteria	1537
978	Ga0495661_0006902	3300046665	Bacteria	7938
979	Ga0495661_0018334	3300046665	Bacteria	4606
980	Ga0495661_0033542	3300046665	Bacteria	3238
981	Ga0495588_0001410	3300046674	Bacteria	10267
982	Ga0495588_0016794	3300046674	Bacteria	3542
983	Ga0495588_0094181	3300046674	Bacteria	1570
984	Ga0495623_0002958	3300046679	Bacteria	11177
985	Ga0495623_0016451	3300046679	Bacteria	4778
986	Ga0495623_0047111	3300046679	Bacteria	2736
987	Ga0495646_0046615	3300046680	Bacteria	2641
988	Ga0495646_0063678	3300046680	Bacteria	2188
989	Ga0495658_0011198	3300046683	Bacteria	4503
990	Ga0495658_0098037	3300046683	Bacteria	1746
991	Ga0495669_0002111	3300046684	Bacteria	8157
992	Ga0495669_0036187	3300046684	Bacteria	2182
993	Ga0495613_0019346	3300046689	Bacteria	5077
994	Ga0495613_0028188	3300046689	Bacteria	4177
995	Ga0495670_0000591	3300046691	Bacteria	17276
996	Ga0495670_0004799	3300046691	Bacteria	6640
997	Ga0495670_0037019	3300046691	Bacteria	2432
998	Ga0495671_0000685	3300046692	Bacteria	24518
999	Ga0495671_0001319	3300046692	Bacteria	16846
1000	Ga0495671_0094660	3300046692	Bacteria	1461
1001	Ga0495671_0108760	3300046692	Bacteria	1354
1002	Ga0495649_0000017	3300046694	Bacteria	221685
1003	Ga0495649_0000154	3300046694	Bacteria	60553
1004	Ga0495649_0008742	3300046694	Bacteria	6077
1005	Ga0495649_0037397	3300046694	Bacteria	2664
1006	Ga0495649_0074890	3300046694	Bacteria	1813
1007	Ga0495649_0097661	3300046694	Bacteria	1563
1008	Ga0495589_0004141	3300046794	Bacteria	7758
1009	Ga0495589_0016509	3300046794	Bacteria	3796
1010	Ga0495600_0149491	3300046809	Bacteria	1513
1011	Ga0495660_0000053	3300046810	Bacteria	137479
1012	Ga0495660_0000072	3300046810	Bacteria	109692
1013	Ga0495660_0000439	3300046810	Bacteria	34751
1014	Ga0495660_0002045	3300046810	Bacteria	13114
1015	Ga0495660_0002788	3300046810	Bacteria	11013
1016	Ga0495660_0004038	3300046810	Bacteria	8958
1017	Ga0495660_0108584	3300046810	Bacteria	1418
1018	Ga0495604_0005952	3300047317	Bacteria	9677
1019	Ga0495604_0049788	3300047317	Bacteria	3253
1020	Ga0495604_0334848	3300047317	Bacteria	1009
1021	Ga0495636_0002324	3300047318	Bacteria	7303
1022	Ga0495636_0018531	3300047318	Bacteria	2794
1023	Ga0495636_0056562	3300047318	Bacteria	1652
1024	Ga0495674_0006547	3300047319	Bacteria	11176
1025	Ga0495674_0017477	3300047319	Bacteria	6674
1026	Ga0495674_0034418	3300047319	Bacteria	4582
1027	Ga0495674_0068315	3300047319	Bacteria	3076
1028	Ga0495674_0091874	3300047319	Bacteria	2592
1029	Ga0495674_0139894	3300047319	Bacteria	2035
1030	Ga0495672_0000587	3300047320	Bacteria	41091
1031	Ga0495672_0000994	3300047320	Bacteria	29280
1032	Ga0495672_0002052	3300047320	Bacteria	18929
1033	Ga0495672_0009608	3300047320	Bacteria	6984
1034	Ga0495672_0012243	3300047320	Bacteria	5998
1035	Ga0495672_0021250	3300047320	Bacteria	4236
1036	Ga0495672_0100568	3300047320	Bacteria	1569
1037	Ga0495680_0006234	3300047322	Bacteria	11121
1038	Ga0495680_0010968	3300047322	Bacteria	8052
1039	Ga0495683_0072296	3300047323	Bacteria	1692
1040	Ga0495683_0088700	3300047323	Bacteria	1501
1041	Ga0495687_025454	3300047443	Bacteria	2797
1042	Ga0495675_0040638	3300047444	Bacteria	2964
1043	Ga0495679_054250	3300047446	Bacteria	1194
1044	Ga0495685_079206	3300047447	Bacteria	1095
1045	Ga0495673_0000078	3300047469	Bacteria	203066
1046	Ga0495673_0000191	3300047469	Bacteria	96817
1047	Ga0495673_0000446	3300047469	Bacteria	45494
1048	Ga0495673_0000624	3300047469	Bacteria	34803
1049	Ga0495673_0000885	3300047469	Bacteria	27564
1050	Ga0495673_0013171	3300047469	Bacteria	4354
1051	Ga0495673_0033786	3300047469	Bacteria	2370
1052	Ga0495681_0007225	3300047470	Bacteria	7138
1053	Ga0495681_0009252	3300047470	Bacteria	6091
1054	Ga0495681_0033133	3300047470	Bacteria	2592
1055	Ga0495681_0041247	3300047470	Bacteria	2241
1056	Ga0495681_0128054	3300047470	Bacteria	1083
1057	Ga0495684_0024417	3300047471	Bacteria	4653
1058	Ga0495684_0060516	3300047471	Bacteria	2883
1059	Ga0495684_0063470	3300047471	Bacteria	2808
1060	Ga0495686_0002819	3300047472	Bacteria	15756
1061	Ga0495686_0003424	3300047472	Bacteria	13765
1062	Ga0495686_0006407	3300047472	Bacteria	9019
1063	Ga0495686_0020430	3300047472	Bacteria	4416
1064	Ga0495686_0020460	3300047472	Bacteria	4413
1065	Ga0495686_0024587	3300047472	Bacteria	3955
1066	Ga0495686_0029221	3300047472	Bacteria	3587
1067	Ga0495686_0117846	3300047472	Bacteria	1586
1068	Ga0495602_0202128	3300048088	Bacteria	1515
1069	Ga0495626_0007314	3300048091	Bacteria	6156
1070	Ga0495626_0017801	3300048091	Bacteria	3582
1071	Ga0495626_0034074	3300048091	Bacteria	2438
1072	Ga0495626_0061767	3300048091	Bacteria	1703
1073	Ga0496101_0138233	3300048904	Bacteria	1855
1074	Ga0496102_0000444	3300048905	Bacteria	47025
1075	Ga0496102_0748883	3300048905	Bacteria	900
1076	Ga0496103_0000290	3300048906	Bacteria	47006
1077	Ga0496104_0014718	3300048907	Bacteria	7069
1078	Ga0496104_0017415	3300048907	Bacteria	6541
1079	Ga0496104_0034145	3300048907	Bacteria	4740
1080	Ga0496104_0081095	3300048907	Bacteria	3094
1081	Ga0496104_0323961	3300048907	Bacteria	1454
1082	Ga0496105_0188591	3300048908	Bacteria	1687
1083	Ga0496106_0000374	3300048909	Bacteria	31782
1084	Ga0496106_0001689	3300048909	Bacteria	16500
1085	Ga0496108_0058260	3300048911	Bacteria	3246
1086	Ga0496108_0067701	3300048911	Bacteria	3012
1087	Ga0496109_0010084	3300048912	Bacteria	8062
1088	Ga0496109_0182928	3300048912	Bacteria	1969
1089	Ga0496110_0029498	3300048913	Bacteria	4722
1090	Ga0496110_0079758	3300048913	Bacteria	2915
1091	Ga0496111_0000302	3300048914	Bacteria	24160
1092	Ga0496112_0022761	3300048915	Bacteria	5978
1093	Ga0496112_0047332	3300048915	Bacteria	4219
1094	Ga0496112_0097322	3300048915	Bacteria	2913
1095	Ga0496113_0004936	3300048916	Bacteria	8261
1096	Ga0496113_0014936	3300048916	Bacteria	5315
1097	Ga0496113_0017306	3300048916	Bacteria	5000
1098	Ga0496113_0053931	3300048916	Bacteria	3007
1099	Ga0496114_0011054	3300048917	Bacteria	7201
1100	Ga0496114_0052739	3300048917	Bacteria	3388
1101	Ga0496114_0069483	3300048917	Bacteria	2958
1102	Ga0496114_0244831	3300048917	Bacteria	1577
1103	Ga0496114_0436724	3300048917	Bacteria	1159
1104	Ga0496115_0021986	3300048918	Bacteria	4933
1105	Ga0496115_0060376	3300048918	Bacteria	3055
1106	Ga0496115_0086072	3300048918	Bacteria	2564
1107	Ga0496115_0136579	3300048918	Bacteria	2022
1108	Ga0496116_0000201	3300048919	Bacteria	115647
1109	Ga0496116_0001025	3300048919	Bacteria	34122
1110	Ga0496116_0008628	3300048919	Bacteria	8817
1111	Ga0496116_0015807	3300048919	Bacteria	5944
1112	Ga0496116_0025899	3300048919	Bacteria	4301
1113	Ga0496117_0000437	3300048920	Bacteria	69398
1114	Ga0496117_0002386	3300048920	Bacteria	23895
1115	Ga0496117_0018996	3300048920	Bacteria	5665
1116	Ga0496117_0065846	3300048920	Bacteria	2461
1117	Ga0496118_0000430	3300048921	Bacteria	69608
1118	Ga0496118_0003745	3300048921	Bacteria	18802
1119	Ga0496118_0005120	3300048921	Bacteria	15061
1120	Ga0496118_0006887	3300048921	Bacteria	12305
1121	Ga0496118_0014231	3300048921	Bacteria	7460
1122	Ga0496118_0016244	3300048921	Bacteria	6836
1123	Ga0496119_0000505	3300048922	Bacteria	53192
1124	Ga0496119_0076184	3300048922	Bacteria	1946
1125	Ga0496119_0125061	3300048922	Bacteria	1408
1126	Ga0496120_0001008	3300048923	Bacteria	37851
1127	Ga0496121_0000685	3300048924	Bacteria	63117
1128	Ga0496121_0005880	3300048924	Bacteria	15532
1129	Ga0496121_0012935	3300048924	Bacteria	9021
1130	Ga0496121_0015440	3300048924	Bacteria	8003
1131	Ga0496121_0025282	3300048924	Bacteria	5641
1132	Ga0496121_0164621	3300048924	Bacteria	1618
1133	Ga0496121_0275095	3300048924	Bacteria	1155
1134	Ga0496122_0000005	3300048925	Bacteria	630659
1135	Ga0496122_0000533	3300048925	Bacteria	78884
1136	Ga0496122_0012873	3300048925	Bacteria	8268
1137	Ga0496122_0031169	3300048925	Bacteria	4445
1138	Ga0496122_0038935	3300048925	Bacteria	3799
1139	Ga0496122_0063210	3300048925	Bacteria	2703
1140	Ga0496123_0000008	3300048926	Bacteria	630628
1141	Ga0496123_0000406	3300048926	Bacteria	78882
1142	Ga0496123_0031480	3300048926	Bacteria	3858
1143	Ga0496124_0000390	3300048927	Bacteria	79997
1144	Ga0496124_0000974	3300048927	Bacteria	45559
1145	Ga0496124_0003213	3300048927	Bacteria	20183
1146	Ga0496124_0023815	3300048927	Bacteria	5580
1147	Ga0496124_0031787	3300048927	Bacteria	4668
1148	Ga0496125_0013099	3300048928	Bacteria	8176
1149	Ga0496125_0026773	3300048928	Bacteria	5240
1150	Ga0496125_0066506	3300048928	Bacteria	2847
1151	Ga0496125_0072180	3300048928	Bacteria	2692
1152	Ga0496126_0000298	3300048929	Bacteria	105872
1153	Ga0496126_0003665	3300048929	Bacteria	19182
1154	Ga0496126_0092205	3300048929	Bacteria	2662
1155	Ga0495678_000796	3300049459	Bacteria	28272
1156	Ga0495678_019065	3300049459	Bacteria	3071
1157	Ga0495678_020225	3300049459	Bacteria	2952
1158	Ga0495682_0000152	3300049460	Bacteria	59145
1159	Ga0495682_0000232	3300049460	Bacteria	43870
1160	Ga0495682_0004996	3300049460	Bacteria	5575
1161	Ga0495682_0018079	3300049460	Bacteria	2655
1162	Ga0495682_0025606	3300049460	Bacteria	2195
1163	Ga0495682_0033954	3300049460	Bacteria	1882
1164	Ga0501031_0038133	3300049568	Bacteria	3136
1165	Ga0501032_0003423	3300049569	Bacteria	12149
1166	Ga0501032_0020016	3300049569	Bacteria	4668
1167	Ga0501033_0018888	3300049570	Bacteria	5211
1168	Ga0501033_0085579	3300049570	Bacteria	2309
1169	Ga0501033_0250040	3300049570	Bacteria	1257
1170	Ga0501034_0038212	3300049571	Bacteria	4861
1171	Ga0501036_0000513	3300049572	Bacteria	27816
1172	Ga0501037_0003440	3300049573	Bacteria	11508
1173	Ga0501037_0035918	3300049573	Bacteria	3652
1174	Ga0501038_0018277	3300049574	Bacteria	6328
1175	Ga0501038_0104649	3300049574	Bacteria	2352
1176	Ga0501038_0407347	3300049574	Bacteria	1051
1177	Ga0501039_0007905	3300049575	Bacteria	8105
1178	Ga0501043_0006107	3300049579	Bacteria	9675
1179	Ga0501043_0009997	3300049579	Bacteria	7442
1180	Ga0501043_0076012	3300049579	Bacteria	2638
1181	Ga0501046_0001799	3300049580	Bacteria	20444
1182	Ga0501046_0028750	3300049580	Bacteria	4525
1183	Ga0501046_0073740	3300049580	Bacteria	2648
1184	Ga0501047_0009807	3300049581	Bacteria	9048
1185	Ga0501047_0019197	3300049581	Bacteria	6557
1186	Ga0501048_0012407	3300049582	Bacteria	6339
1187	Ga0501067_0050765	3300049583	Bacteria	2298
1188	Ga0501068_0003993	3300049584	Bacteria	8028
1189	Ga0501069_0000859	3300049585	Bacteria	14407
1190	Ga0501070_0025439	3300049586	Bacteria	4964
1191	Ga0501072_0022374	3300049588	Bacteria	4903
1192	Ga0501073_0001104	3300049589	Bacteria	19571
1193	Ga0501074_0019971	3300049590	Bacteria	4868
1194	Ga0501077_0003979	3300049593	Bacteria	8915
1195	Ga0501242_004236	3300049674	Bacteria	1587
1196	Ga0501249_000322	3300049679	Bacteria	13251
1197	Ga0501253_014314	3300049683	Bacteria	1282
1198	Ga0501259_003725	3300049688	Bacteria	2423
1199	Ga0501079_0000123	3300049741	Bacteria	41037
1200	Ga0501080_0000370	3300049742	Bacteria	34770
1201	Ga0501083_0003200	3300049744	Bacteria	11403
1202	Ga0501035_0000217	3300049822	Bacteria	68667
1203	Ga0501035_0004964	3300049822	Bacteria	12615
1204	Ga0501035_0018618	3300049822	Bacteria	6395
1205	Ga0501044_0001824	3300049823	Bacteria	24811
1206	Ga0501044_0026470	3300049823	Bacteria	6138
1207	Ga0501204_000981	3300049850	Bacteria	2674
1208	nmdc:mga03683_14250_c1	3300050489	Bacteria	2939
1209	nmdc:mga03683_6515_c1	3300050489	Bacteria	4002
1210	nmdc:mga03n38_25168_c1	3300050490	Bacteria	2441
1211	nmdc:mga00v17_2616_c1	3300050491	Bacteria	9236
1212	nmdc:mga00v17_50197_c1	3300050491	Bacteria	2534
1213	nmdc:mga0yw44_42157_c1	3300050492	Bacteria	2721
1214	nmdc:mga0yw44_850_c1	3300050492	Bacteria	11442
1215	nmdc:mga0k408_3147_c1	3300050493	Bacteria	8747
1216	nmdc:mga0k408_47630_c1	3300050493	Bacteria	2478
1217	nmdc:mga06z11_234_c1	3300050494	Bacteria	21580
1218	nmdc:mga04h51_2709_c1	3300050495	Bacteria	4217
1219	nmdc:mga07m45_49940_c1	3300050496	Bacteria	1652
1220	nmdc:mga07m45_9082_c1	3300050496	Bacteria	5138
1221	nmdc:mga05p37_16656_c1	3300050507	Bacteria	8855
1222	nmdc:mga05p37_196924_c1	3300050507	Bacteria	2443
1223	nmdc:mga05p37_23422_c1	3300050507	Bacteria	7492
1224	nmdc:mga09592_3503_c1	3300050508	Bacteria	12672
1225	nmdc:mga0qj67_18446_c1	3300050509	Bacteria	5317
1226	nmdc:mga06r32_124483_c1	3300050510	Bacteria	2545
1227	nmdc:mga06r32_34938_c1	3300050510	Bacteria	3491
1228	nmdc:mga08y16_329328_c1	3300050511	Bacteria	1571
1229	nmdc:mga08y16_352008_c1	3300050511	Bacteria	1513
1230	nmdc:mga08y16_3970_c1	3300050511	Bacteria	15413
1231	nmdc:mga0n895_28533_c1	3300050512	Bacteria	5309
1232	nmdc:mga0rr50_252643_c1	3300050513	Bacteria	1465
1233	nmdc:mga0rr50_3976_c1	3300050513	Bacteria	8607
1234	nmdc:mga08x19_18200_c1	3300050514	Bacteria	4304
1235	nmdc:mga08x19_236865_c1	3300050514	Bacteria	1257
1236	nmdc:mga08x19_68425_c1	3300050514	Bacteria	2311
1237	nmdc:mga0a205_145987_c1	3300050515	Bacteria	2266
1238	nmdc:mga0a205_158350_c1	3300050515	Bacteria	2162
1239	nmdc:mga0a205_35620_c1	3300050515	Bacteria	4779
1240	nmdc:mga0a205_44905_c1	3300050515	Bacteria	4261
1241	nmdc:mga0a205_73303_c1	3300050515	Bacteria	3308
1242	nmdc:mga0a205_7359_c1	3300050515	Bacteria	9969
1243	Ga0495601_0009042	3300053077	Bacteria	5883
1244	Ga0495612_0097108	3300053078	Bacteria	1252
1245	Ga0495619_0081998	3300053085	Bacteria	2173
1246	Ga0500578_0122290	3300053086	Bacteria	1636
1247	Ga0500578_0168211	3300053086	Bacteria	1357
1248	Ga0500643_000004	3300053087	Bacteria	857484
1249	Ga0500643_000024	3300053087	Bacteria	265935
1250	Ga0500643_011992	3300053087	Bacteria	3127
1251	Ga0500644_0000126	3300053088	Bacteria	47091
1252	Ga0500583_0100634	3300053092	Bacteria	1415
1253	Ga0500651_0000009	3300053093	Bacteria	270362
1254	Ga0500651_0001730	3300053093	Bacteria	11188
1255	Ga0500651_0005569	3300053093	Bacteria	7204
1256	Ga0500651_0043727	3300053093	Bacteria	2821
1257	Ga0500555_002604	3300053103	Bacteria	5194
1258	Ga0500556_0000005	3300053104	Bacteria	581135
1259	Ga0500557_039403	3300053105	Bacteria	1475
1260	Ga0500569_026385	3300053109	Bacteria	1591
1261	Ga0500572_000454	3300053111	Bacteria	14246
1262	Ga0500594_0000563	3300053118	Bacteria	8009
1263	Ga0500614_031737	3300053123	Bacteria	1296
1264	Ga0500617_074176	3300053124	Bacteria	1485
1265	Ga0500618_000025	3300053125	Bacteria	150583
1266	Ga0500618_000035	3300053125	Bacteria	120187
1267	Ga0500618_000116	3300053125	Bacteria	64971
1268	Ga0500618_000344	3300053125	Bacteria	33227
1269	Ga0500618_000405	3300053125	Bacteria	29227
1270	Ga0500618_004837	3300053125	Bacteria	4208
1271	Ga0500618_041767	3300053125	Bacteria	1052
1272	Ga0500652_084156	3300053131	Bacteria	1326
1273	Ga0500658_0009392	3300053134	Bacteria	3607
1274	Ga0500659_0004513	3300053135	Bacteria	7941
1275	Ga0500559_0000048	3300053136	Bacteria	93755
1276	Ga0500559_0000315	3300053136	Bacteria	36760
1277	Ga0500559_0020365	3300053136	Bacteria	2805
1278	Ga0500564_000018	3300053138	Bacteria	52235
1279	Ga0500564_055018	3300053138	Bacteria	1814
1280	Ga0500568_0000168	3300053139	Bacteria	56752
1281	Ga0500568_0000328	3300053139	Bacteria	37312
1282	Ga0500568_0005320	3300053139	Bacteria	6680
1283	Ga0500568_0005369	3300053139	Bacteria	6638
1284	Ga0500573_0000021	3300053140	Bacteria	159093
1285	Ga0500573_0000174	3300053140	Bacteria	26069
1286	Ga0500573_0000355	3300053140	Bacteria	19450
1287	Ga0500588_0012559	3300053146	Bacteria	2103
1288	Ga0500590_016349	3300053148	Bacteria	3836
1289	Ga0500604_0006366	3300053151	Bacteria	3121
1290	Ga0500604_0023312	3300053151	Bacteria	1765
1291	Ga0500616_0000075	3300053153	Bacteria	221455
1292	Ga0500616_0001366	3300053153	Bacteria	23717
1293	Ga0500616_0007137	3300053153	Bacteria	7150
1294	Ga0500616_0017374	3300053153	Bacteria	4080
1295	Ga0500616_0023622	3300053153	Bacteria	3422
1296	Ga0500616_0029219	3300053153	Bacteria	3035
1297	Ga0500622_0120376	3300053156	Bacteria	1273
1298	Ga0500624_000086	3300053157	Bacteria	47685
1299	Ga0500624_000165	3300053157	Bacteria	26716
1300	Ga0500630_058058	3300053159	Bacteria	1854
1301	Ga0500634_0000115	3300053161	Bacteria	30142
1302	Ga0500634_0007159	3300053161	Bacteria	5471
1303	Ga0500634_0014620	3300053161	Bacteria	4144
1304	Ga0500639_034262	3300053163	Bacteria	2684
1305	Ga0500636_0004803	3300053177	Bacteria	7669
1306	Ga0500636_0009650	3300053177	Bacteria	5616
1307	Ga0500636_0040354	3300053177	Bacteria	2760
1308	Ga0500636_0041222	3300053177	Bacteria	2731
1309	Ga0500637_0086765	3300053178	Bacteria	1809
1310	Ga0500625_000006	3300053729	Bacteria	206258
1311	Ga0500645_001044	3300053730	Bacteria	15423
1312	Ga0500587_001312	3300053739	Bacteria	3488
1313	Ga0501084_0001649	3300054114	Bacteria	17752
1314	Ga0501082_0004881	3300060353	Bacteria	11698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300047317	Ga0495604_0334848	Ga0495604_0334848_23_886	269
2	3300048905	Ga0496102_0748883	Ga0496102_0748883_19_876	284
3	3300045051	Ga0451576_0359635	Ga0451576_0359635_24_908	293
4	3300005614	Ga0068856_100070897	Ga0068856_1000708973	295
5	3300006237	Ga0097621_100104583	Ga0097621_1001045832	295
6	3300025916	Ga0207663_10058631	Ga0207663_100586312	295
7	3300025919	Ga0207657_10109865	Ga0207657_101098652	295
8	3300025920	Ga0207649_10032637	Ga0207649_100326372	295
9	3300026041	Ga0207639_10036949	Ga0207639_100369493	295
10	3300026078	Ga0207702_10012962	Ga0207702_100129624	295
11	3300026121	Ga0207683_10213855	Ga0207683_102138552	295
12	3300044694	Ga0466963_0004997	Ga0466963_0004997_456_1445	296
13	3300045976	Ga0466967_0006850	Ga0466967_0006850_3037_4026	296
14	3300047319	Ga0495674_0068315	Ga0495674_0068315_1878_2810	298
15	3300037471	Ga0395905_0108086	Ga0395905_0108086_182_1117	299
16	3300038443	Ga0395901_0078847	Ga0395901_0078847_865_1800	299
17	3300006914	Ga0075436_100046730	Ga0075436_1000467302	304
18	3300007076	Ga0075435_100013725	Ga0075435_1000137254	304
19	3300050513	nmdc:mga0rr50_3976_c1	nmdc:mga0rr50_3976_c1_5791_6783	304
20	3300050514	nmdc:mga08x19_18200_c1	nmdc:mga08x19_18200_c1_1672_2664	304
21	3300006871	Ga0075434_100324663	Ga0075434_1003246632	306
22	3300050514	nmdc:mga08x19_236865_c1	nmdc:mga08x19_236865_c1_221_1144	306
23	3300006871	Ga0075434_100186126	Ga0075434_1001861262	309
24	3300025945	Ga0207679_10068942	Ga0207679_100689422	309
25	3300031548	Ga0307408_100008987	Ga0307408_1000089874	309
26	3300031731	Ga0307405_10314769	Ga0307405_103147692	309
27	3300032002	Ga0307416_100233740	Ga0307416_1002337402	309
28	3300049568	Ga0501031_0038133	Ga0501031_0038133_2018_2950	309
29	3300049569	Ga0501032_0003423	Ga0501032_0003423_10151_11083	309
30	3300049570	Ga0501033_0018888	Ga0501033_0018888_3212_4144	309
31	3300049571	Ga0501034_0038212	Ga0501034_0038212_1068_2000	309
32	3300049572	Ga0501036_0000513	Ga0501036_0000513_25817_26749	309
33	3300049573	Ga0501037_0003440	Ga0501037_0003440_10112_11044	309
34	3300049574	Ga0501038_0018277	Ga0501038_0018277_802_1734	309
35	3300049575	Ga0501039_0007905	Ga0501039_0007905_912_1844	309
36	3300049579	Ga0501043_0006107	Ga0501043_0006107_2629_3561	309
37	3300049580	Ga0501046_0001799	Ga0501046_0001799_3773_4705	309
38	3300049581	Ga0501047_0019197	Ga0501047_0019197_3057_3989	309
39	3300049582	Ga0501048_0012407	Ga0501048_0012407_4722_5654	309
40	3300049583	Ga0501067_0050765	Ga0501067_0050765_1068_2000	309
41	3300049584	Ga0501068_0003993	Ga0501068_0003993_3056_3988	309
42	3300049585	Ga0501069_0000859	Ga0501069_0000859_9167_10099	309
43	3300049586	Ga0501070_0025439	Ga0501070_0025439_1068_2000	309
44	3300049588	Ga0501072_0022374	Ga0501072_0022374_888_1820	309
45	3300049589	Ga0501073_0001104	Ga0501073_0001104_5459_6391	309
46	3300049590	Ga0501074_0019971	Ga0501074_0019971_703_1635	309
47	3300049593	Ga0501077_0003979	Ga0501077_0003979_7163_8095	309
48	3300049741	Ga0501079_0000123	Ga0501079_0000123_19978_20910	309
49	3300049742	Ga0501080_0000370	Ga0501080_0000370_26166_27098	309
50	3300049744	Ga0501083_0003200	Ga0501083_0003200_1068_2000	309
51	3300049822	Ga0501035_0004964	Ga0501035_0004964_1068_2000	309
52	3300049823	Ga0501044_0026470	Ga0501044_0026470_1995_2927	309
53	3300054114	Ga0501084_0001649	Ga0501084_0001649_363_1295	309
54	3300060353	Ga0501082_0004881	Ga0501082_0004881_9699_10631	309
55	3300005337	Ga0070682_100078399	Ga0070682_1000783992	310
56	3300005985	Ga0081539_10001296	Ga0081539_1000129645	310
57	3300037471	Ga0395905_0334742	Ga0395905_0334742_424_1362	310
58	3300046506	Ga0495583_0003754	Ga0495583_0003754_3612_4547	310
59	3300009176	Ga0105242_10230225	Ga0105242_102302252	311
60	3300005530	Ga0070679_100036190	Ga0070679_1000361901	312
61	3300005336	Ga0070680_100001277	Ga0070680_10000127714	313
62	3300005344	Ga0070661_100172919	Ga0070661_1001729192	313
63	3300005458	Ga0070681_10041490	Ga0070681_100414903	313
64	3300005530	Ga0070679_100003730	Ga0070679_10000373012	313
65	3300005539	Ga0068853_100045273	Ga0068853_1000452733	313
66	3300005564	Ga0070664_100115708	Ga0070664_1001157083	313
67	3300006051	Ga0075364_10211542	Ga0075364_102115421	313
68	3300009174	Ga0105241_10260087	Ga0105241_102600871	313
69	3300009177	Ga0105248_10446383	Ga0105248_104463832	313
70	3300013100	Ga0157373_10088254	Ga0157373_100882542	313
71	3300013105	Ga0157369_10004377	Ga0157369_100043776	313
72	3300014969	Ga0157376_10061586	Ga0157376_100615862	313
73	3300025912	Ga0207707_10017833	Ga0207707_100178333	313
74	3300025914	Ga0207671_10369129	Ga0207671_103691291	313
75	3300025917	Ga0207660_10000265	Ga0207660_1000026512	313
76	3300025921	Ga0207652_10003444	Ga0207652_1000344412	313
77	3300048907	Ga0496104_0323961	Ga0496104_0323961_396_1388	313
78	3300005327	Ga0070658_10001422	Ga0070658_1000142216	314
79	3300005530	Ga0070679_100310528	Ga0070679_1003105282	314
80	3300036401	Ga0373937_0356392	Ga0373937_0356392_37_1041	314
81	3300037466	Ga0395898_0229569	Ga0395898_0229569_234_1301	314
82	3300046559	Ga0495667_0043856	Ga0495667_0043856_1771_2775	314
83	3300046679	Ga0495623_0047111	Ga0495623_0047111_598_1602	314
84	3300047444	Ga0495675_0040638	Ga0495675_0040638_1015_2019	314
85	3300048088	Ga0495602_0202128	Ga0495602_0202128_360_1364	314
86	3300050510	nmdc:mga06r32_124483_c1	nmdc:mga06r32_124483_c1_494_1441	314
87	3300053092	Ga0500583_0100634	Ga0500583_0100634_434_1381	314
88	3300005335	Ga0070666_10158373	Ga0070666_101583732	315
89	3300005458	Ga0070681_10150204	Ga0070681_101502042	315
90	3300048924	Ga0496121_0164621	Ga0496121_0164621_317_1306	315
91	3300006844	Ga0075428_100013593	Ga0075428_1000135935	316
92	3300009147	Ga0114129_10008337	Ga0114129_100083378	316
93	3300021358	Ga0213873_10012896	Ga0213873_100128962	316
94	3300027907	Ga0207428_10013174	Ga0207428_100131742	316
95	3300028800	Ga0265338_10001001	Ga0265338_1000100132	316
96	3300028800	Ga0265338_10001869	Ga0265338_1000186915	316
97	3300028800	Ga0265338_10012656	Ga0265338_100126565	316
98	3300044712	Ga0453684_0142480	Ga0453684_0142480_1634_2629	316
99	3300046453	Ga0495627_000062	Ga0495627_000062_101877_102869	316
100	3300046501	Ga0495607_0000664	Ga0495607_0000664_18467_19459	316
101	3300046519	Ga0495632_0012028	Ga0495632_0012028_819_1811	316
102	3300046530	Ga0495654_0000415	Ga0495654_0000415_31313_32305	316
103	3300046810	Ga0495660_0000072	Ga0495660_0000072_53658_54650	316
104	3300047320	Ga0495672_0012243	Ga0495672_0012243_2596_3588	316
105	3300050507	nmdc:mga05p37_16656_c1	nmdc:mga05p37_16656_c1_4178_5170	316
106	3300050508	nmdc:mga09592_3503_c1	nmdc:mga09592_3503_c1_8206_9198	316
107	3300050509	nmdc:mga0qj67_18446_c1	nmdc:mga0qj67_18446_c1_67_1059	316
108	3300050510	nmdc:mga06r32_34938_c1	nmdc:mga06r32_34938_c1_472_1464	316
109	3300050511	nmdc:mga08y16_3970_c1	nmdc:mga08y16_3970_c1_9119_10111	316
110	3300053085	Ga0495619_0081998	Ga0495619_0081998_1091_2044	316
111	3300005548	Ga0070665_100480818	Ga0070665_1004808181	317
112	3300006028	Ga0070717_10111519	Ga0070717_101115192	317
113	3300009093	Ga0105240_10072839	Ga0105240_100728393	317
114	3300025898	Ga0207692_10027527	Ga0207692_100275271	317
115	3300025916	Ga0207663_10011183	Ga0207663_100111832	317
116	3300028379	Ga0268266_10282022	Ga0268266_102820222	317
117	3300046524	Ga0495648_0055796	Ga0495648_0055796_456_1451	317
118	3300047322	Ga0495680_0010968	Ga0495680_0010968_1714_2676	317
119	3300053125	Ga0500618_004837	Ga0500618_004837_550_1545	317
120	iso_pu_bacteria	2874168670	2874169321	317
121	3300046462	Ga0495651_0025414	Ga0495651_0025414_1767_2759	318
122	3300046501	Ga0495607_0093117	Ga0495607_0093117_392_1384	318
123	3300046518	Ga0495631_0000303	Ga0495631_0000303_4557_5549	318
124	3300046679	Ga0495623_0016451	Ga0495623_0016451_1519_2511	318
125	3300047320	Ga0495672_0002052	Ga0495672_0002052_4188_5180	318
126	3300032002	Ga0307416_100042585	Ga0307416_1000425854	319
127	3300046472	Ga0495580_0105031	Ga0495580_0105031_487_1452	319
128	3300046522	Ga0495643_0000284	Ga0495643_0000284_36451_37443	319
129	3300046692	Ga0495671_0001319	Ga0495671_0001319_10147_11139	319
130	3300053161	Ga0500634_0014620	Ga0500634_0014620_2835_3845	319
131	3300005339	Ga0070660_100154911	Ga0070660_1001549113	320
132	3300005530	Ga0070679_100306190	Ga0070679_1003061901	320
133	3300005564	Ga0070664_100005127	Ga0070664_10000512711	320
134	3300005618	Ga0068864_100103275	Ga0068864_1001032751	320
135	3300009093	Ga0105240_10358836	Ga0105240_103588362	320
136	3300025912	Ga0207707_10219699	Ga0207707_102196991	320
137	3300026095	Ga0207676_10032518	Ga0207676_100325184	320
138	3300031344	Ga0265316_10003240	Ga0265316_1000324012	320
139	3300031711	Ga0265314_10012766	Ga0265314_100127662	320
140	3300053151	Ga0500604_0006366	Ga0500604_0006366_80_1051	320
141	iso_pu_bacteria	2939568625	2939569284	320
142	iso_pu_bacteria	2939607340	2939611176	320
143	3300009011	Ga0105251_10005219	Ga0105251_100052195	321
144	3300025735	Ga0207713_1002314	Ga0207713_10023146	321
145	iso_pu_bacteria	2643221628	2644159887	321
146	3300015265	Ga0182005_1007744	Ga0182005_10077441	322
147	3300046457	Ga0495590_0003620	Ga0495590_0003620_3608_4600	322
148	3300046460	Ga0495638_0008465	Ga0495638_0008465_4312_5304	322
149	3300046471	Ga0495650_0000484	Ga0495650_0000484_57089_58081	322
150	3300046500	Ga0495596_0000034	Ga0495596_0000034_26335_27327	322
151	3300046507	Ga0495606_0001186	Ga0495606_0001186_24924_25916	322
152	3300046519	Ga0495632_0005254	Ga0495632_0005254_4151_5143	322
153	3300046519	Ga0495632_0005746	Ga0495632_0005746_6369_7361	322
154	3300046520	Ga0495637_0000334	Ga0495637_0000334_10379_11371	322
155	3300046520	Ga0495637_0000716	Ga0495637_0000716_16411_17403	322
156	3300046523	Ga0495644_0000105	Ga0495644_0000105_13909_14901	322
157	3300046524	Ga0495648_0000636	Ga0495648_0000636_24831_25823	322
158	3300046530	Ga0495654_0000769	Ga0495654_0000769_4048_5040	322
159	3300046616	Ga0495668_0000776	Ga0495668_0000776_25084_26076	322
160	3300046692	Ga0495671_0000685	Ga0495671_0000685_11238_12230	322
161	3300046694	Ga0495649_0000154	Ga0495649_0000154_39456_40448	322
162	3300046810	Ga0495660_0000439	Ga0495660_0000439_25059_26051	322
163	3300047323	Ga0495683_0088700	Ga0495683_0088700_195_1187	322
164	3300047469	Ga0495673_0000624	Ga0495673_0000624_25072_26064	322
165	3300047472	Ga0495686_0006407	Ga0495686_0006407_4155_5147	322
166	3300048091	Ga0495626_0007314	Ga0495626_0007314_1869_2861	322
167	3300049459	Ga0495678_000796	Ga0495678_000796_18203_19195	322
168	3300005518	Ga0070699_100145892	Ga0070699_1001458922	323
169	3300053135	Ga0500659_0004513	Ga0500659_0004513_3023_4015	323
170	3300005406	Ga0070703_10007854	Ga0070703_100078541	324
171	3300005564	Ga0070664_100069279	Ga0070664_1000692791	324
172	3300006051	Ga0075364_10005201	Ga0075364_100052016	324
173	3300006852	Ga0075433_10024365	Ga0075433_100243655	324
174	3300006946	Ga0079104_1000480	Ga0079104_100048025	324
175	3300025901	Ga0207688_10154610	Ga0207688_101546102	324
176	3300027111	Ga0209281_1000004	Ga0209281_1000004938	324
177	3300036712	Ga0316584_0179680	Ga0316584_0179680_410_1396	324
178	3300046458	Ga0495591_000003	Ga0495591_000003_180031_181014	324
179	3300046522	Ga0495643_0099381	Ga0495643_0099381_356_1339	324
180	3300048904	Ga0496101_0138233	Ga0496101_0138233_705_1688	324
181	3300048919	Ga0496116_0008628	Ga0496116_0008628_6576_7559	324
182	3300048921	Ga0496118_0016244	Ga0496118_0016244_2310_3293	324
183	3300048922	Ga0496119_0076184	Ga0496119_0076184_214_1197	324
184	3300048924	Ga0496121_0012935	Ga0496121_0012935_6970_7953	324
185	3300048925	Ga0496122_0000005	Ga0496122_0000005_454584_455567	324
186	3300048926	Ga0496123_0000008	Ga0496123_0000008_175062_176045	324
187	3300048928	Ga0496125_0013099	Ga0496125_0013099_387_1370	324
188	3300050491	nmdc:mga00v17_2616_c1	nmdc:mga00v17_2616_c1_832_1815	324
189	3300003316	rootH1_10056871	rootH1_100568712	325
190	3300005327	Ga0070658_10118101	Ga0070658_101181013	325
191	3300005331	Ga0070670_100006133	Ga0070670_1000061339	325
192	3300005536	Ga0070697_100002348	Ga0070697_1000023488	325
193	3300005539	Ga0068853_100000108	Ga0068853_10000010828	325
194	3300005548	Ga0070665_100000189	Ga0070665_10000018917	325
195	3300005618	Ga0068864_100000039	Ga0068864_100000039103	325
196	3300005842	Ga0068858_100096483	Ga0068858_1000964833	325
197	3300006038	Ga0075365_10002060	Ga0075365_100020609	325
198	3300006048	Ga0075363_100033538	Ga0075363_1000335382	325
199	3300006051	Ga0075364_10002946	Ga0075364_100029462	325
200	3300006058	Ga0075432_10001973	Ga0075432_100019736	325
201	3300006177	Ga0075362_10001544	Ga0075362_100015442	325
202	3300006195	Ga0075366_10052697	Ga0075366_100526973	325
203	3300009147	Ga0114129_10139727	Ga0114129_101397272	325
204	3300010159	Ga0099796_10078916	Ga0099796_100789161	325
205	3300013297	Ga0157378_10007140	Ga0157378_100071405	325
206	3300026041	Ga0207639_10000127	Ga0207639_1000012714	325
207	3300026095	Ga0207676_10000008	Ga0207676_10000008106	325
208	3300027907	Ga0207428_10069489	Ga0207428_100694893	325
209	3300028379	Ga0268266_10000180	Ga0268266_1000018078	325
210	3300035691	Ga0373931_0057387	Ga0373931_0057387_237_1376	325
211	3300046506	Ga0495583_0086361	Ga0495583_0086361_304_1287	325
212	3300046507	Ga0495606_0018848	Ga0495606_0018848_2701_3684	325
213	3300046512	Ga0495610_0001573	Ga0495610_0001573_14845_15828	325
214	3300046513	Ga0495616_0010384	Ga0495616_0010384_4189_5172	325
215	3300046558	Ga0495633_0013512	Ga0495633_0013512_63_1046	325
216	3300046660	Ga0495625_0000036	Ga0495625_0000036_102569_103552	325
217	3300046665	Ga0495661_0006902	Ga0495661_0006902_5098_6081	325
218	3300046665	Ga0495661_0018334	Ga0495661_0018334_1161_2144	325
219	3300046692	Ga0495671_0094660	Ga0495671_0094660_320_1303	325
220	3300046694	Ga0495649_0000017	Ga0495649_0000017_118164_119147	325
221	3300046810	Ga0495660_0000053	Ga0495660_0000053_98774_99757	325
222	3300047472	Ga0495686_0020430	Ga0495686_0020430_309_1298	325
223	3300049570	Ga0501033_0085579	Ga0501033_0085579_1224_2207	325
224	3300049573	Ga0501037_0035918	Ga0501037_0035918_1633_2616	325
225	3300049574	Ga0501038_0104649	Ga0501038_0104649_667_1650	325
226	3300049579	Ga0501043_0009997	Ga0501043_0009997_2590_3573	325
227	3300049580	Ga0501046_0028750	Ga0501046_0028750_1878_2861	325
228	3300049581	Ga0501047_0009807	Ga0501047_0009807_6262_7245	325
229	3300049674	Ga0501242_004236	Ga0501242_004236_98_1102	325
230	3300049683	Ga0501253_014314	Ga0501253_014314_43_1047	325
231	3300049688	Ga0501259_003725	Ga0501259_003725_951_1955	325
232	3300049822	Ga0501035_0000217	Ga0501035_0000217_49_1026	325
233	3300049822	Ga0501035_0018618	Ga0501035_0018618_2627_3610	325
234	3300049823	Ga0501044_0001824	Ga0501044_0001824_23007_23990	325
235	3300050489	nmdc:mga03683_14250_c1	nmdc:mga03683_14250_c1_1054_2037	325
236	3300050490	nmdc:mga03n38_25168_c1	nmdc:mga03n38_25168_c1_1054_2037	325
237	3300050491	nmdc:mga00v17_50197_c1	nmdc:mga00v17_50197_c1_405_1388	325
238	3300050492	nmdc:mga0yw44_42157_c1	nmdc:mga0yw44_42157_c1_1228_2211	325
239	3300050493	nmdc:mga0k408_47630_c1	nmdc:mga0k408_47630_c1_724_1707	325
240	3300053093	Ga0500651_0005569	Ga0500651_0005569_6194_7180	325
241	3300053125	Ga0500618_000405	Ga0500618_000405_26903_27880	325
242	3300053139	Ga0500568_0005369	Ga0500568_0005369_2842_3825	325
243	3300053140	Ga0500573_0000174	Ga0500573_0000174_5288_6265	325
244	iso_pu_bacteria	2510065045	2510249593	325
245	iso_pu_bacteria	2510461076	2510894984	325
246	iso_pu_bacteria	2510917020	2511124643	325
247	iso_pu_bacteria	2510917022	2511134561	325
248	iso_pu_bacteria	2510917028	2511181750	325
249	iso_pu_bacteria	2510917030	2511195571	325
250	iso_pu_bacteria	2510917030	2511198933	325
251	iso_pu_bacteria	2511231031	2511413032	325
252	iso_pu_bacteria	2511231156	2511825120	325
253	iso_pu_bacteria	2513237085	2513577551	325
254	iso_pu_bacteria	2513237093	2513629803	325
255	iso_pu_bacteria	2513237138	2513869022	325
256	iso_pu_bacteria	2513237162	2514022108	325
257	iso_pu_bacteria	2515154113	2515632922	325
258	iso_pu_bacteria	2515154114	2515640065	325
259	iso_pu_bacteria	2515154116	2515655737	325
260	iso_pu_bacteria	2515154134	2515740191	325
261	iso_pu_bacteria	2516653046	2516898460	325
262	iso_pu_bacteria	2516653085	2517076667	325
263	iso_pu_bacteria	2517093000	2517095440	325
264	iso_pu_bacteria	2529292951	2530645758	325
265	iso_pu_bacteria	2582581280	2585154326	325
266	iso_pu_bacteria	2582581293	2585197213	325
267	iso_pu_bacteria	2582581298	2585220823	325
268	iso_pu_bacteria	2582581299	2585233724	325
269	iso_pu_bacteria	2582581306	2585266485	325
270	iso_pu_bacteria	2582581307	2585275683	325
271	iso_pu_bacteria	2582581866	2585397342	325
272	iso_pu_bacteria	2585427526	2585527061	325
273	iso_pu_bacteria	2585427528	2585537816	325
274	iso_pu_bacteria	2585427529	2585548625	325
275	iso_pu_bacteria	2585427530	2585555197	325
276	iso_pu_bacteria	2585427531	2585562462	325
277	iso_pu_bacteria	2585427590	2585820533	325
278	iso_pu_bacteria	2585427593	2585835766	325
279	iso_pu_bacteria	2585427608	2585901794	325
280	iso_pu_bacteria	2585427609	2585906372	325
281	iso_pu_bacteria	2585428125	2587981794	325
282	iso_pu_bacteria	2599185236	2599720817	325
283	iso_pu_bacteria	2599185352	2600194492	325
284	iso_pu_bacteria	2617270742	2617385188	325
285	iso_pu_bacteria	2643221582	2643917005	325
286	iso_pu_bacteria	2643221584	2643929268	325
287	iso_pu_bacteria	2643221618	2644105975	325
288	iso_pu_bacteria	2643221626	2644147060	325
289	iso_pu_bacteria	2643221634	2644192355	325
290	iso_pu_bacteria	2643221643	2644238933	325
291	iso_pu_bacteria	2643221644	2644246944	325
292	iso_pu_bacteria	2643221655	2644310587	325
293	iso_pu_bacteria	2643221659	2644334628	325
294	iso_pu_bacteria	2643221698	2644545176	325
295	iso_pu_bacteria	2643221712	2644612689	325
296	iso_pu_bacteria	2690316117	2692314944	325
297	iso_pu_bacteria	2718217991	2719642000	325
298	iso_pu_bacteria	2721755686	2723576809	325
299	iso_pu_bacteria	2724679232	2725950544	325
300	iso_pu_bacteria	2738541333	2739032474	325
301	iso_pu_bacteria	2756170246	2756672139	325
302	iso_pu_bacteria	2765235942	2766066856	325
303	iso_pu_bacteria	2775506901	2776262467	325
304	iso_pu_bacteria	2791355094	2792643233	325
305	iso_pu_bacteria	2791355263	2793344889	325
306	iso_pu_bacteria	2791355266	2793360695	325
307	iso_pu_bacteria	2802429633	2806043450	325
308	iso_pu_bacteria	2802429634	2806050617	325
309	iso_pu_bacteria	2802429635	2806057434	325
310	iso_pu_bacteria	2802429636	2806064814	325
311	iso_pu_bacteria	2802429637	2806072081	325
312	iso_pu_bacteria	2818991461	2819682654	325
313	iso_pu_bacteria	2838686498	2838692054	325
314	iso_pu_bacteria	2838729681	2838732800	325
315	iso_pu_bacteria	2838736955	2838741478	325
316	iso_pu_bacteria	2838742623	2838745678	325
317	iso_pu_bacteria	2841840854	2841845336	325
318	iso_pu_bacteria	2841851746	2841855864	325
319	iso_pu_bacteria	2842110456	2842114126	325
320	iso_pu_bacteria	2842140634	2842145039	325
321	iso_pu_bacteria	2842156927	2842157144	325
322	iso_pu_bacteria	2842163707	2842167804	325
323	iso_pu_bacteria	2842180545	2842181272	325
324	iso_pu_bacteria	2842229732	2842230677	325
325	iso_pu_bacteria	2842243621	2842245223	325
326	iso_pu_bacteria	2842257432	2842259036	325
327	iso_pu_bacteria	2842271015	2842276294	325
328	iso_pu_bacteria	2842304105	2842304563	325
329	iso_pu_bacteria	2842832357	2842835984	325
330	iso_pu_bacteria	2844163670	2844165678	325
331	iso_pu_bacteria	2844454524	2844458891	325
332	iso_pu_bacteria	2847417321	2847419999	325
333	iso_pu_bacteria	2852387548	2852393778	325
334	iso_pu_bacteria	2854911287	2854911689	325
335	iso_pu_bacteria	2857442823	2857443364	325
336	iso_pu_bacteria	2857516855	2857519984	325
337	iso_pu_bacteria	2857564685	2857567805	325
338	iso_pu_bacteria	2874123672	2874126402	325
339	iso_pu_bacteria	2898329390	2898332039	325
340	iso_pu_bacteria	2904479285	2904483583	325
341	iso_pu_bacteria	2919089067	2919089632	325
342	iso_pu_bacteria	2919456309	2919461243	325
343	iso_pu_bacteria	2921237296	2921243809	325
344	iso_pu_bacteria	2921250672	2921254317	325
345	iso_pu_bacteria	2922425934	2922430710	325
346	iso_pu_bacteria	2923556063	2923562639	325
347	iso_pu_bacteria	2924193448	2924195491	325
348	iso_pu_bacteria	2928496128	2928499084	325
349	iso_pu_bacteria	2928531327	2928531571	325
350	iso_pu_bacteria	2933570622	2933571835	325
351	iso_pu_bacteria	2933586486	2933590222	325
352	iso_pu_bacteria	2935901341	2935905414	325
353	iso_pu_bacteria	2936381700	2936387587	325
354	iso_pu_bacteria	2939589442	2939591655	325
355	iso_pu_bacteria	2939622612	2939625564	325
356	iso_pu_bacteria	2939626828	2939627250	325
357	iso_pu_bacteria	2945961074	2945962904	325
358	iso_pu_bacteria	2957408893	2957414453	325
359	iso_pu_bacteria	2957437181	2957440193	325
360	iso_pu_bacteria	2957450854	2957454958	325
361	iso_pu_bacteria	2960591022	2960591698	325
362	iso_pu_bacteria	2960667422	2960668149	325
363	iso_pu_bacteria	2967671571	2967674671	325
364	iso_pu_bacteria	2970026789	2970032839	325
365	iso_pu_bacteria	2974307012	2974308813	325
366	iso_pu_bacteria	2977864932	2977869434	325
367	iso_pu_bacteria	2984514374	2984515979	325
368	iso_pu_bacteria	2989349275	2989352642	325
369	iso_pu_bacteria	2996310559	2996315947	325
370	iso_pu_bacteria	3004167301	3004168364	325
371	iso_pu_bacteria	3004334049	3004335359	325
372	iso_pu_bacteria	643348564	643603761	325
373	iso_pu_bacteria	8005307578	8005312436	325
374	iso_pu_bacteria	8005556819	8005557430	325
375	iso_pu_bacteria	8005563573	8005568609	325
376	iso_pu_bacteria	8005570704	8005574531	325
377	iso_pu_bacteria	8018163183	8018166518	325
378	iso_pu_bacteria	8019555841	8019556133	325
379	iso_pu_bacteria	8019565922	8019569176	325
380	iso_pu_bacteria	8023680758	8023685113	325
381	iso_pu_bacteria	8024479707	8024483267	325
382	iso_pu_bacteria	8055266321	8055268483	325
383	iso_pu_bacteria	8055266321	8055273731	325
384	iso_pu_bacteria	8057874678	8057874765	325
385	3300005343	Ga0070687_100027058	Ga0070687_1000270582	326
386	3300005353	Ga0070669_100001026	Ga0070669_10000102616	326
387	3300005354	Ga0070675_100003940	Ga0070675_1000039401	326
388	3300005364	Ga0070673_100139240	Ga0070673_1001392401	326
389	3300005365	Ga0070688_100014803	Ga0070688_1000148033	326
390	3300005365	Ga0070688_100154674	Ga0070688_1001546742	326
391	3300005366	Ga0070659_100316942	Ga0070659_1003169421	326
392	3300005543	Ga0070672_100006443	Ga0070672_1000064438	326
393	3300005564	Ga0070664_100032832	Ga0070664_1000328323	326
394	3300005564	Ga0070664_100286049	Ga0070664_1002860491	326
395	3300005617	Ga0068859_100006701	Ga0068859_1000067012	326
396	3300005843	Ga0068860_100141352	Ga0068860_1001413521	326
397	3300006931	Ga0097620_100006701	Ga0097620_1000067012	326
398	3300009094	Ga0111539_10111270	Ga0111539_101112702	326
399	3300011119	Ga0105246_10260557	Ga0105246_102605571	326
400	3300025908	Ga0207643_10016928	Ga0207643_100169283	326
401	3300025918	Ga0207662_10052041	Ga0207662_100520412	326
402	3300025926	Ga0207659_10085046	Ga0207659_100850462	326
403	3300025936	Ga0207670_10345811	Ga0207670_103458111	326
404	3300025940	Ga0207691_10003193	Ga0207691_100031933	326
405	3300025945	Ga0207679_10193489	Ga0207679_101934892	326
406	3300025960	Ga0207651_10035405	Ga0207651_100354053	326
407	3300028800	Ga0265338_10151481	Ga0265338_101514812	326
408	3300042876	Ga0451577_0006551	Ga0451577_0006551_4340_5329	326
409	3300044712	Ga0453684_0014205	Ga0453684_0014205_5011_6000	326
410	3300050511	nmdc:mga08y16_329328_c1	nmdc:mga08y16_329328_c1_105_1094	326
411	3300005327	Ga0070658_10012730	Ga0070658_100127303	327
412	3300005327	Ga0070658_10040377	Ga0070658_100403773	327
413	3300005328	Ga0070676_10009031	Ga0070676_100090312	327
414	3300005328	Ga0070676_10028635	Ga0070676_100286352	327
415	3300005329	Ga0070683_100048416	Ga0070683_1000484162	327
416	3300005329	Ga0070683_100119419	Ga0070683_1001194192	327
417	3300005330	Ga0070690_100049188	Ga0070690_1000491882	327
418	3300005334	Ga0068869_100023229	Ga0068869_1000232295	327
419	3300005338	Ga0068868_100010497	Ga0068868_1000104975	327
420	3300005339	Ga0070660_100031271	Ga0070660_1000312712	327
421	3300005339	Ga0070660_100038619	Ga0070660_1000386193	327
422	3300005339	Ga0070660_100041638	Ga0070660_1000416382	327
423	3300005339	Ga0070660_100190152	Ga0070660_1001901522	327
424	3300005344	Ga0070661_100048196	Ga0070661_1000481964	327
425	3300005355	Ga0070671_100138401	Ga0070671_1001384012	327
426	3300005355	Ga0070671_100200496	Ga0070671_1002004962	327
427	3300005356	Ga0070674_100003982	Ga0070674_1000039826	327
428	3300005356	Ga0070674_100014562	Ga0070674_1000145621	327
429	3300005364	Ga0070673_100034220	Ga0070673_1000342204	327
430	3300005366	Ga0070659_100009795	Ga0070659_1000097953	327
431	3300005366	Ga0070659_100024527	Ga0070659_1000245274	327
432	3300005366	Ga0070659_100030580	Ga0070659_1000305805	327
433	3300005366	Ga0070659_100034011	Ga0070659_1000340112	327
434	3300005367	Ga0070667_100024593	Ga0070667_1000245932	327
435	3300005434	Ga0070709_10209748	Ga0070709_102097481	327
436	3300005436	Ga0070713_100546481	Ga0070713_1005464811	327
437	3300005437	Ga0070710_10057359	Ga0070710_100573592	327
438	3300005439	Ga0070711_100011763	Ga0070711_1000117634	327
439	3300005445	Ga0070708_100166986	Ga0070708_1001669861	327
440	3300005455	Ga0070663_100014696	Ga0070663_1000146964	327
441	3300005457	Ga0070662_100001254	Ga0070662_1000012545	327
442	3300005458	Ga0070681_10122164	Ga0070681_101221643	327
443	3300005458	Ga0070681_10172179	Ga0070681_101721791	327
444	3300005459	Ga0068867_100008025	Ga0068867_1000080254	327
445	3300005468	Ga0070707_100104794	Ga0070707_1001047941	327
446	3300005518	Ga0070699_100085555	Ga0070699_1000855553	327
447	3300005530	Ga0070679_100034405	Ga0070679_1000344054	327
448	3300005535	Ga0070684_100011986	Ga0070684_1000119862	327
449	3300005535	Ga0070684_100059580	Ga0070684_1000595805	327
450	3300005535	Ga0070684_100155133	Ga0070684_1001551332	327
451	3300005536	Ga0070697_100094264	Ga0070697_1000942641	327
452	3300005539	Ga0068853_100034201	Ga0068853_1000342012	327
453	3300005543	Ga0070672_100034657	Ga0070672_1000346575	327
454	3300005563	Ga0068855_100286023	Ga0068855_1002860232	327
455	3300005564	Ga0070664_100118209	Ga0070664_1001182091	327
456	3300005577	Ga0068857_100010699	Ga0068857_1000106996	327
457	3300005614	Ga0068856_100282092	Ga0068856_1002820922	327
458	3300005616	Ga0068852_100162666	Ga0068852_1001626662	327
459	3300005618	Ga0068864_100085984	Ga0068864_1000859842	327
460	3300005834	Ga0068851_10019830	Ga0068851_100198302	327
461	3300005842	Ga0068858_100403421	Ga0068858_1004034212	327
462	3300005985	Ga0081539_10000045	Ga0081539_1000004512	327
463	3300006038	Ga0075365_10004414	Ga0075365_100044142	327
464	3300006173	Ga0070716_100009384	Ga0070716_1000093844	327
465	3300006175	Ga0070712_100011752	Ga0070712_1000117523	327
466	3300006237	Ga0097621_100347097	Ga0097621_1003470971	327
467	3300006358	Ga0068871_100016783	Ga0068871_1000167833	327
468	3300006844	Ga0075428_100323821	Ga0075428_1003238211	327
469	3300006844	Ga0075428_100394019	Ga0075428_1003940191	327
470	3300006847	Ga0075431_100156808	Ga0075431_1001568082	327
471	3300006847	Ga0075431_100203143	Ga0075431_1002031432	327
472	3300006871	Ga0075434_100160251	Ga0075434_1001602513	327
473	3300006881	Ga0068865_100141357	Ga0068865_1001413572	327
474	3300006914	Ga0075436_100025773	Ga0075436_1000257735	327
475	3300007076	Ga0075435_100039556	Ga0075435_1000395565	327
476	3300009098	Ga0105245_10139053	Ga0105245_101390531	327
477	3300009147	Ga0114129_10123146	Ga0114129_101231461	327
478	3300009174	Ga0105241_10076268	Ga0105241_100762682	327
479	3300009551	Ga0105238_10299474	Ga0105238_102994741	327
480	3300009553	Ga0105249_10017914	Ga0105249_100179143	327
481	3300010375	Ga0105239_10024329	Ga0105239_100243295	327
482	3300013100	Ga0157373_10037639	Ga0157373_100376392	327
483	3300013104	Ga0157370_10170638	Ga0157370_101706382	327
484	3300013104	Ga0157370_10233675	Ga0157370_102336752	327
485	3300013105	Ga0157369_10097405	Ga0157369_100974053	327
486	3300013296	Ga0157374_10086258	Ga0157374_100862584	327
487	3300013296	Ga0157374_10402493	Ga0157374_104024931	327
488	3300013297	Ga0157378_10072439	Ga0157378_100724394	327
489	3300013297	Ga0157378_10277386	Ga0157378_102773862	327
490	3300013297	Ga0157378_10375249	Ga0157378_103752492	327
491	3300013307	Ga0157372_10004265	Ga0157372_100042653	327
492	3300013308	Ga0157375_10202648	Ga0157375_102026482	327
493	3300014969	Ga0157376_10140692	Ga0157376_101406922	327
494	3300025898	Ga0207692_10068366	Ga0207692_100683662	327
495	3300025899	Ga0207642_10001917	Ga0207642_1000191710	327
496	3300025899	Ga0207642_10064718	Ga0207642_100647182	327
497	3300025901	Ga0207688_10013005	Ga0207688_100130051	327
498	3300025906	Ga0207699_10238538	Ga0207699_102385381	327
499	3300025907	Ga0207645_10026706	Ga0207645_100267064	327
500	3300025907	Ga0207645_10028078	Ga0207645_100280782	327
501	3300025909	Ga0207705_10097010	Ga0207705_100970102	327
502	3300025912	Ga0207707_10220156	Ga0207707_102201562	327
503	3300025915	Ga0207693_10000223	Ga0207693_100002233	327
504	3300025919	Ga0207657_10007142	Ga0207657_100071427	327
505	3300025919	Ga0207657_10027172	Ga0207657_100271722	327
506	3300025919	Ga0207657_10029092	Ga0207657_100290926	327
507	3300025919	Ga0207657_10048414	Ga0207657_100484143	327
508	3300025920	Ga0207649_10100783	Ga0207649_101007832	327
509	3300025921	Ga0207652_10074882	Ga0207652_100748822	327
510	3300025922	Ga0207646_10088748	Ga0207646_100887482	327
511	3300025926	Ga0207659_10000011	Ga0207659_10000011245	327
512	3300025926	Ga0207659_10096542	Ga0207659_100965422	327
513	3300025928	Ga0207700_10459988	Ga0207700_104599882	327
514	3300025929	Ga0207664_10242886	Ga0207664_102428861	327
515	3300025931	Ga0207644_10141802	Ga0207644_101418022	327
516	3300025932	Ga0207690_10006181	Ga0207690_100061818	327
517	3300025932	Ga0207690_10030063	Ga0207690_100300633	327
518	3300025932	Ga0207690_10107021	Ga0207690_101070211	327
519	3300025933	Ga0207706_10000293	Ga0207706_1000029321	327
520	3300025934	Ga0207686_10035368	Ga0207686_100353683	327
521	3300025937	Ga0207669_10003444	Ga0207669_100034441	327
522	3300025938	Ga0207704_10011636	Ga0207704_100116365	327
523	3300025940	Ga0207691_10033270	Ga0207691_100332703	327
524	3300025941	Ga0207711_10100352	Ga0207711_101003522	327
525	3300025942	Ga0207689_10021985	Ga0207689_100219853	327
526	3300025942	Ga0207689_10247246	Ga0207689_102472461	327
527	3300025944	Ga0207661_10038445	Ga0207661_100384453	327
528	3300025944	Ga0207661_10237828	Ga0207661_102378282	327
529	3300025945	Ga0207679_10063300	Ga0207679_100633003	327
530	3300025960	Ga0207651_10014779	Ga0207651_100147794	327
531	3300025960	Ga0207651_10111571	Ga0207651_101115711	327
532	3300025961	Ga0207712_10001780	Ga0207712_100017805	327
533	3300025981	Ga0207640_10127800	Ga0207640_101278002	327
534	3300025986	Ga0207658_10319020	Ga0207658_103190201	327
535	3300026023	Ga0207677_10006541	Ga0207677_100065413	327
536	3300026041	Ga0207639_10117369	Ga0207639_101173692	327
537	3300026041	Ga0207639_10216317	Ga0207639_102163171	327
538	3300026067	Ga0207678_10010050	Ga0207678_100100503	327
539	3300026067	Ga0207678_10017167	Ga0207678_100171672	327
540	3300026078	Ga0207702_10419976	Ga0207702_104199761	327
541	3300026089	Ga0207648_10056675	Ga0207648_100566754	327
542	3300026116	Ga0207674_10002015	Ga0207674_1000201518	327
543	3300026121	Ga0207683_10036702	Ga0207683_100367025	327
544	3300026142	Ga0207698_10054491	Ga0207698_100544913	327
545	3300026142	Ga0207698_10135706	Ga0207698_101357063	327
546	3300028379	Ga0268266_10210245	Ga0268266_102102452	327
547	3300031507	Ga0307509_10000004	Ga0307509_10000004104	327
548	3300031852	Ga0307410_10041567	Ga0307410_100415672	327
549	3300035086	Ga0373934_0073585	Ga0373934_0073585_319_1311	327
550	3300035112	Ga0373932_0000847	Ga0373932_0000847_4582_5568	327
551	3300035114	Ga0373939_0066423	Ga0373939_0066423_67_1056	327
552	3300035117	Ga0373953_0016847	Ga0373953_0016847_324_1316	327
553	3300035170	Ga0373943_0054539	Ga0373943_0054539_535_1527	327
554	3300035172	Ga0373955_0052344	Ga0373955_0052344_904_1896	327
555	3300035207	Ga0373942_0017356	Ga0373942_0017356_464_1453	327
556	3300035691	Ga0373931_0014304	Ga0373931_0014304_1620_2609	327
557	3300035695	Ga0373927_0020679	Ga0373927_0020679_1215_2207	327
558	3300036401	Ga0373937_0176427	Ga0373937_0176427_140_1132	327
559	3300037068	Ga0373925_0411067	Ga0373925_0411067_15_1007	327
560	3300037418	Ga0395900_0128604	Ga0395900_0128604_1264_2256	327
561	3300037418	Ga0395900_0331314	Ga0395900_0331314_294_1286	327
562	3300037471	Ga0395905_0003971	Ga0395905_0003971_11111_12103	327
563	3300037471	Ga0395905_0315405	Ga0395905_0315405_238_1230	327
564	3300037471	Ga0395905_0381297	Ga0395905_0381297_192_1184	327
565	3300037471	Ga0395905_0388311	Ga0395905_0388311_285_1277	327
566	3300038443	Ga0395901_0016819	Ga0395901_0016819_6048_7040	327
567	3300038443	Ga0395901_0103888	Ga0395901_0103888_1327_2319	327
568	3300042876	Ga0451577_0000029	Ga0451577_0000029_207295_208287	327
569	3300042876	Ga0451577_0002390	Ga0451577_0002390_5593_6591	327
570	3300044673	Ga0453683_0000304	Ga0453683_0000304_13310_14308	327
571	3300044712	Ga0453684_0000088	Ga0453684_0000088_207194_208186	327
572	3300044712	Ga0453684_0002540	Ga0453684_0002540_3025_4023	327
573	3300044712	Ga0453684_0011873	Ga0453684_0011873_5198_6190	327
574	3300045051	Ga0451576_0000967	Ga0451576_0000967_39967_40965	327
575	3300045051	Ga0451576_0010145	Ga0451576_0010145_2553_3545	327
576	3300045051	Ga0451576_0010705	Ga0451576_0010705_1717_2706	327
577	3300045051	Ga0451576_0028725	Ga0451576_0028725_3718_4710	327
578	3300045051	Ga0451576_0425934	Ga0451576_0425934_174_1166	327
579	3300046525	Ga0495663_0050632	Ga0495663_0050632_115_1119	327
580	3300046537	Ga0495598_0041552	Ga0495598_0041552_67_1059	327
581	3300046539	Ga0495621_0005242	Ga0495621_0005242_1773_2777	327
582	3300046539	Ga0495621_0055957	Ga0495621_0055957_247_1236	327
583	3300046663	Ga0495635_0159173	Ga0495635_0159173_487_1479	327
584	3300046674	Ga0495588_0094181	Ga0495588_0094181_209_1201	327
585	3300046684	Ga0495669_0036187	Ga0495669_0036187_316_1344	327
586	3300047318	Ga0495636_0018531	Ga0495636_0018531_1388_2380	327
587	3300047319	Ga0495674_0034418	Ga0495674_0034418_236_1222	327
588	3300047443	Ga0495687_025454	Ga0495687_025454_411_1403	327
589	3300047472	Ga0495686_0024587	Ga0495686_0024587_958_2046	327
590	3300048907	Ga0496104_0017415	Ga0496104_0017415_1309_2301	327
591	3300048909	Ga0496106_0000374	Ga0496106_0000374_25496_26482	327
592	3300048911	Ga0496108_0058260	Ga0496108_0058260_2017_3009	327
593	3300048912	Ga0496109_0010084	Ga0496109_0010084_771_1763	327
594	3300048912	Ga0496109_0182928	Ga0496109_0182928_435_1427	327
595	3300048913	Ga0496110_0079758	Ga0496110_0079758_1761_2753	327
596	3300048915	Ga0496112_0047332	Ga0496112_0047332_551_1543	327
597	3300048916	Ga0496113_0014936	Ga0496113_0014936_2108_3100	327
598	3300048916	Ga0496113_0017306	Ga0496113_0017306_867_1859	327
599	3300048917	Ga0496114_0052739	Ga0496114_0052739_1103_2089	327
600	3300048917	Ga0496114_0244831	Ga0496114_0244831_521_1513	327
601	3300048918	Ga0496115_0021986	Ga0496115_0021986_1851_2843	327
602	3300048920	Ga0496117_0065846	Ga0496117_0065846_1404_2390	327
603	3300048921	Ga0496118_0003745	Ga0496118_0003745_5846_6832	327
604	3300048924	Ga0496121_0000685	Ga0496121_0000685_34692_35678	327
605	3300048927	Ga0496124_0000974	Ga0496124_0000974_29382_30368	327
606	3300048929	Ga0496126_0003665	Ga0496126_0003665_1015_2001	327
607	3300050507	nmdc:mga05p37_196924_c1	nmdc:mga05p37_196924_c1_1395_2384	327
608	3300050507	nmdc:mga05p37_23422_c1	nmdc:mga05p37_23422_c1_6299_7291	327
609	3300050514	nmdc:mga08x19_68425_c1	nmdc:mga08x19_68425_c1_1270_2259	327
610	3300050515	nmdc:mga0a205_145987_c1	nmdc:mga0a205_145987_c1_418_1407	327
611	3300050515	nmdc:mga0a205_158350_c1	nmdc:mga0a205_158350_c1_779_1771	327
612	3300053124	Ga0500617_074176	Ga0500617_074176_72_1064	327
613	3300053131	Ga0500652_084156	Ga0500652_084156_192_1184	327
614	3300053146	Ga0500588_0012559	Ga0500588_0012559_442_1434	327
615	3300053153	Ga0500616_0000075	Ga0500616_0000075_94356_95390	327
616	3300053153	Ga0500616_0007137	Ga0500616_0007137_3950_4948	327
617	3300053159	Ga0500630_058058	Ga0500630_058058_579_1568	327
618	3300053178	Ga0500637_0086765	Ga0500637_0086765_43_1035	327
619	3300053739	Ga0500587_001312	Ga0500587_001312_367_1353	327
620	3300005293	Ga0065715_10032990	Ga0065715_100329902	328
621	3300005327	Ga0070658_10002477	Ga0070658_100024778	328
622	3300005327	Ga0070658_10079789	Ga0070658_100797893	328
623	3300005329	Ga0070683_100248243	Ga0070683_1002482431	328
624	3300005347	Ga0070668_100077282	Ga0070668_1000772821	328
625	3300005347	Ga0070668_100174029	Ga0070668_1001740292	328
626	3300005353	Ga0070669_100054872	Ga0070669_1000548723	328
627	3300005354	Ga0070675_100006648	Ga0070675_1000066486	328
628	3300005436	Ga0070713_100100813	Ga0070713_1001008132	328
629	3300005445	Ga0070708_100055901	Ga0070708_1000559013	328
630	3300005445	Ga0070708_100278506	Ga0070708_1002785062	328
631	3300005458	Ga0070681_10136822	Ga0070681_101368222	328
632	3300005467	Ga0070706_100030508	Ga0070706_1000305083	328
633	3300005467	Ga0070706_100053627	Ga0070706_1000536274	328
634	3300005468	Ga0070707_100032730	Ga0070707_1000327303	328
635	3300005471	Ga0070698_100197491	Ga0070698_1001974912	328
636	3300005530	Ga0070679_100050861	Ga0070679_1000508612	328
637	3300005536	Ga0070697_100023026	Ga0070697_1000230264	328
638	3300005563	Ga0068855_100092984	Ga0068855_1000929844	328
639	3300005617	Ga0068859_100188335	Ga0068859_1001883352	328
640	3300005719	Ga0068861_100033020	Ga0068861_1000330203	328
641	3300005841	Ga0068863_100151927	Ga0068863_1001519271	328
642	3300005842	Ga0068858_100211624	Ga0068858_1002116242	328
643	3300005842	Ga0068858_100234562	Ga0068858_1002345622	328
644	3300005843	Ga0068860_100388499	Ga0068860_1003884992	328
645	3300006028	Ga0070717_10057717	Ga0070717_100577172	328
646	3300006852	Ga0075433_10013122	Ga0075433_100131228	328
647	3300006880	Ga0075429_100251377	Ga0075429_1002513772	328
648	3300006914	Ga0075436_100029897	Ga0075436_1000298972	328
649	3300006931	Ga0097620_100188348	Ga0097620_1001883481	328
650	3300006931	Ga0097620_100503283	Ga0097620_1005032832	328
651	3300007076	Ga0075435_100320429	Ga0075435_1003204292	328
652	3300009093	Ga0105240_10120378	Ga0105240_101203784	328
653	3300009147	Ga0114129_10110862	Ga0114129_101108624	328
654	3300009177	Ga0105248_10003006	Ga0105248_100030062	328
655	3300009553	Ga0105249_10395821	Ga0105249_103958212	328
656	3300013104	Ga0157370_10060625	Ga0157370_100606251	328
657	3300013296	Ga0157374_10021307	Ga0157374_100213074	328
658	3300013296	Ga0157374_10073372	Ga0157374_100733724	328
659	3300013306	Ga0163162_10171897	Ga0163162_101718972	328
660	3300014325	Ga0163163_10093324	Ga0163163_100933242	328
661	3300025909	Ga0207705_10011244	Ga0207705_100112442	328
662	3300025910	Ga0207684_10016127	Ga0207684_100161273	328
663	3300025910	Ga0207684_10218664	Ga0207684_102186642	328
664	3300025910	Ga0207684_10423980	Ga0207684_104239802	328
665	3300025912	Ga0207707_10083627	Ga0207707_100836272	328
666	3300025913	Ga0207695_10093194	Ga0207695_100931941	328
667	3300025915	Ga0207693_10068868	Ga0207693_100688684	328
668	3300025918	Ga0207662_10106424	Ga0207662_101064241	328
669	3300025922	Ga0207646_10023357	Ga0207646_100233574	328
670	3300025923	Ga0207681_10025544	Ga0207681_100255443	328
671	3300025925	Ga0207650_10427942	Ga0207650_104279421	328
672	3300025926	Ga0207659_10007427	Ga0207659_100074276	328
673	3300025926	Ga0207659_10138536	Ga0207659_101385362	328
674	3300025941	Ga0207711_10141629	Ga0207711_101416292	328
675	3300025972	Ga0207668_10009998	Ga0207668_100099981	328
676	3300026035	Ga0207703_10204932	Ga0207703_102049321	328
677	3300028379	Ga0268266_10206215	Ga0268266_102062152	328
678	3300031241	Ga0265325_10007021	Ga0265325_100070218	328
679	3300031241	Ga0265325_10060186	Ga0265325_100601862	328
680	3300031251	Ga0265327_10001337	Ga0265327_1000133724	328
681	3300031852	Ga0307410_10009755	Ga0307410_100097554	328
682	3300031911	Ga0307412_10047716	Ga0307412_100477162	328
683	3300031995	Ga0307409_100022159	Ga0307409_1000221592	328
684	3300035091	Ga0373951_0009188	Ga0373951_0009188_631_1626	328
685	3300035113	Ga0373936_0003143	Ga0373936_0003143_2019_3011	328
686	3300044712	Ga0453684_0116546	Ga0453684_0116546_2158_3153	328
687	3300046453	Ga0495627_001924	Ga0495627_001924_7097_8089	328
688	3300046458	Ga0495591_000002	Ga0495591_000002_33047_34039	328
689	3300046462	Ga0495651_0238000	Ga0495651_0238000_25_1017	328
690	3300046474	Ga0495605_0000731	Ga0495605_0000731_19044_20036	328
691	3300046501	Ga0495607_0000045	Ga0495607_0000045_26430_27422	328
692	3300046520	Ga0495637_0003264	Ga0495637_0003264_4964_5956	328
693	3300046524	Ga0495648_0127090	Ga0495648_0127090_297_1289	328
694	3300046542	Ga0495597_0000023	Ga0495597_0000023_26149_27141	328
695	3300046660	Ga0495625_0000966	Ga0495625_0000966_3857_4849	328
696	3300046692	Ga0495671_0108760	Ga0495671_0108760_121_1113	328
697	3300046694	Ga0495649_0008742	Ga0495649_0008742_4480_5475	328
698	3300047318	Ga0495636_0002324	Ga0495636_0002324_5526_6518	328
699	3300047319	Ga0495674_0139894	Ga0495674_0139894_301_1293	328
700	3300047320	Ga0495672_0009608	Ga0495672_0009608_5085_6155	328
701	3300047471	Ga0495684_0024417	Ga0495684_0024417_2946_3938	328
702	3300049679	Ga0501249_000322	Ga0501249_000322_3082_4083	328
703	3300049850	Ga0501204_000981	Ga0501204_000981_1651_2652	328
704	3300050515	nmdc:mga0a205_44905_c1	nmdc:mga0a205_44905_c1_325_1320	328
705	3300050515	nmdc:mga0a205_7359_c1	nmdc:mga0a205_7359_c1_2448_3446	328
706	3300053157	Ga0500624_000165	Ga0500624_000165_19148_20140	328
707	3300002737	JGI25162J39368_1001022	JGI25162J39368_10010229	329
708	3300002737	JGI25162J39368_1001952	JGI25162J39368_10019524	329
709	3300002739	JGI25158J39367_1001102	JGI25158J39367_10011024	329
710	3300002741	JGI25157J39369_1002857	JGI25157J39369_10028575	329
711	3300002772	JGI25164J39214_1000447	JGI25164J39214_100044720	329
712	3300002772	JGI25164J39214_1000744	JGI25164J39214_10007447	329
713	3300002987	JGI25159J45721_1000012	JGI25159J45721_100001253	329
714	3300003187	JGI25151J46595_10001546	JGI25151J46595_1000154613	329
715	3300003203	JGI25406J46586_10003401	JGI25406J46586_100034016	329
716	3300003214	JGI25165J46597_1000006	JGI25165J46597_100000691	329
717	3300003214	JGI25165J46597_1000276	JGI25165J46597_100027663	329
718	3300003214	JGI25165J46597_1000623	JGI25165J46597_100062327	329
719	3300003354	JGI25160J50197_1000042	JGI25160J50197_1000042100	329
720	3300003354	JGI25160J50197_1000165	JGI25160J50197_100016516	329
721	3300003354	JGI25160J50197_1014129	JGI25160J50197_10141293	329
722	3300003374	JGI25161J50226_1000164	JGI25161J50226_100016416	329
723	3300003374	JGI25161J50226_1000254	JGI25161J50226_10002547	329
724	3300003752	Ga0055539_1007848	Ga0055539_10078481	329
725	3300003756	Ga0055533_1008213	Ga0055533_10082131	329
726	3300003760	Ga0055527_1000037	Ga0055527_10000379	329
727	3300003761	Ga0055535_1000059	Ga0055535_10000599	329
728	3300003762	Ga0055542_1000086	Ga0055542_100008687	329
729	3300003763	Ga0055529_1000231	Ga0055529_100023145	329
730	3300003771	Ga0055526_1000599	Ga0055526_10005999	329
731	3300003771	Ga0055526_1003483	Ga0055526_10034832	329
732	3300003771	Ga0055526_1003967	Ga0055526_10039672	329
733	3300003773	Ga0055537_1000244	Ga0055537_100024430	329
734	3300003773	Ga0055537_1000470	Ga0055537_100047019	329
735	3300003775	Ga0055524_1000549	Ga0055524_100054917	329
736	3300003775	Ga0055524_1001372	Ga0055524_10013726	329
737	3300003781	Ga0055536_1007706	Ga0055536_10077063	329
738	3300003784	Ga0055534_1000030	Ga0055534_100003025	329
739	3300003784	Ga0055534_1015193	Ga0055534_10151931	329
740	3300003790	Ga0055528_1000269	Ga0055528_100026927	329
741	3300003790	Ga0055528_1000340	Ga0055528_10003407	329
742	3300003790	Ga0055528_1000801	Ga0055528_10008013	329
743	3300003791	Ga0055530_10001875	Ga0055530_1000187517	329
744	3300003791	Ga0055530_10002168	Ga0055530_1000216811	329
745	3300003794	Ga0055531_10010018	Ga0055531_100100183	329
746	3300003794	Ga0055531_10024152	Ga0055531_100241522	329
747	3300003794	Ga0055531_10051168	Ga0055531_100511681	329
748	3300004625	Ga0055543_1000153	Ga0055543_100015316	329
749	3300004625	Ga0055543_1001671	Ga0055543_10016716	329
750	3300004625	Ga0055543_1002317	Ga0055543_10023172	329
751	3300005262	Ga0065165_1000174	Ga0065165_100017453	329
752	3300005262	Ga0065165_1000682	Ga0065165_10006828	329
753	3300005262	Ga0065165_1004055	Ga0065165_10040555	329
754	3300005290	Ga0065712_10000846	Ga0065712_100008464	329
755	3300005290	Ga0065712_10094372	Ga0065712_100943722	329
756	3300005293	Ga0065715_10001921	Ga0065715_1000192111	329
757	3300005293	Ga0065715_10019492	Ga0065715_100194923	329
758	3300005293	Ga0065715_10152955	Ga0065715_101529552	329
759	3300005295	Ga0065707_10081942	Ga0065707_1008194222	329
760	3300005331	Ga0070670_100442557	Ga0070670_1004425571	329
761	3300005338	Ga0068868_100177431	Ga0068868_1001774312	329
762	3300005341	Ga0070691_10000183	Ga0070691_1000018310	329
763	3300005341	Ga0070691_10041394	Ga0070691_100413942	329
764	3300005345	Ga0070692_10191728	Ga0070692_101917282	329
765	3300005354	Ga0070675_100056036	Ga0070675_1000560362	329
766	3300005355	Ga0070671_100001094	Ga0070671_10000109417	329
767	3300005355	Ga0070671_100002455	Ga0070671_1000024557	329
768	3300005355	Ga0070671_100373497	Ga0070671_1003734972	329
769	3300005356	Ga0070674_100003982	Ga0070674_1000039824	329
770	3300005356	Ga0070674_100017906	Ga0070674_1000179064	329
771	3300005365	Ga0070688_100043714	Ga0070688_1000437141	329
772	3300005365	Ga0070688_100145921	Ga0070688_1001459212	329
773	3300005366	Ga0070659_100001976	Ga0070659_10000197612	329
774	3300005434	Ga0070709_10122244	Ga0070709_101222442	329
775	3300005435	Ga0070714_100000085	Ga0070714_10000008559	329
776	3300005436	Ga0070713_100000703	Ga0070713_10000070321	329
777	3300005438	Ga0070701_10062442	Ga0070701_100624422	329
778	3300005439	Ga0070711_100001959	Ga0070711_1000019592	329
779	3300005439	Ga0070711_100009519	Ga0070711_1000095191	329
780	3300005455	Ga0070663_100144387	Ga0070663_1001443872	329
781	3300005456	Ga0070678_100268350	Ga0070678_1002683501	329
782	3300005458	Ga0070681_10004342	Ga0070681_100043429	329
783	3300005458	Ga0070681_10018144	Ga0070681_100181445	329
784	3300005459	Ga0068867_100305109	Ga0068867_1003051091	329
785	3300005459	Ga0068867_100319973	Ga0068867_1003199732	329
786	3300005468	Ga0070707_100224699	Ga0070707_1002246993	329
787	3300005530	Ga0070679_100017613	Ga0070679_1000176135	329
788	3300005548	Ga0070665_100074470	Ga0070665_1000744702	329
789	3300005548	Ga0070665_100091922	Ga0070665_1000919221	329
790	3300005548	Ga0070665_100117053	Ga0070665_1001170533	329
791	3300005548	Ga0070665_100165114	Ga0070665_1001651142	329
792	3300005563	Ga0068855_100139997	Ga0068855_1001399972	329
793	3300005563	Ga0068855_100141848	Ga0068855_1001418482	329
794	3300005578	Ga0068854_100043547	Ga0068854_1000435472	329
795	3300005578	Ga0068854_100254673	Ga0068854_1002546731	329
796	3300005614	Ga0068856_100001530	Ga0068856_10000153012	329
797	3300005614	Ga0068856_100016751	Ga0068856_1000167516	329
798	3300005615	Ga0070702_100004988	Ga0070702_1000049883	329
799	3300005616	Ga0068852_100124920	Ga0068852_1001249203	329
800	3300005616	Ga0068852_100284034	Ga0068852_1002840342	329
801	3300005616	Ga0068852_100495632	Ga0068852_1004956321	329
802	3300005617	Ga0068859_100061105	Ga0068859_1000611052	329
803	3300005617	Ga0068859_100152242	Ga0068859_1001522422	329
804	3300005618	Ga0068864_100007366	Ga0068864_1000073664	329
805	3300005618	Ga0068864_100009370	Ga0068864_1000093707	329
806	3300005618	Ga0068864_100025329	Ga0068864_1000253294	329
807	3300005618	Ga0068864_100081456	Ga0068864_1000814563	329
808	3300005618	Ga0068864_100514845	Ga0068864_1005148451	329
809	3300005719	Ga0068861_100053495	Ga0068861_1000534951	329
810	3300005719	Ga0068861_100166984	Ga0068861_1001669842	329
811	3300005840	Ga0068870_10020403	Ga0068870_100204032	329
812	3300005841	Ga0068863_100002506	Ga0068863_10000250615	329
813	3300005843	Ga0068860_100082893	Ga0068860_1000828932	329
814	3300005844	Ga0068862_100089341	Ga0068862_1000893413	329
815	3300005937	Ga0081455_10181904	Ga0081455_101819043	329
816	3300005983	Ga0081540_1006686	Ga0081540_10066864	329
817	3300005983	Ga0081540_1032749	Ga0081540_10327493	329
818	3300005985	Ga0081539_10006956	Ga0081539_100069564	329
819	3300006028	Ga0070717_10023490	Ga0070717_100234905	329
820	3300006028	Ga0070717_10025193	Ga0070717_100251932	329
821	3300006038	Ga0075365_10000340	Ga0075365_100003406	329
822	3300006038	Ga0075365_10176176	Ga0075365_101761761	329
823	3300006042	Ga0075368_10006019	Ga0075368_100060192	329
824	3300006048	Ga0075363_100025070	Ga0075363_1000250702	329
825	3300006175	Ga0070712_100000250	Ga0070712_10000025015	329
826	3300006177	Ga0075362_10006915	Ga0075362_100069152	329
827	3300006177	Ga0075362_10020833	Ga0075362_100208333	329
828	3300006177	Ga0075362_10053958	Ga0075362_100539583	329
829	3300006177	Ga0075362_10130118	Ga0075362_101301181	329
830	3300006178	Ga0075367_10004257	Ga0075367_100042574	329
831	3300006178	Ga0075367_10023667	Ga0075367_100236672	329
832	3300006178	Ga0075367_10037982	Ga0075367_100379823	329
833	3300006186	Ga0075369_10000332	Ga0075369_100003325	329
834	3300006195	Ga0075366_10005556	Ga0075366_100055566	329
835	3300006237	Ga0097621_100053865	Ga0097621_1000538652	329
836	3300006237	Ga0097621_100240254	Ga0097621_1002402542	329
837	3300006353	Ga0075370_10001635	Ga0075370_100016353	329
838	3300006353	Ga0075370_10110190	Ga0075370_101101902	329
839	3300006358	Ga0068871_100109978	Ga0068871_1001099782	329
840	3300006844	Ga0075428_100397354	Ga0075428_1003973541	329
841	3300006852	Ga0075433_10091148	Ga0075433_100911482	329
842	3300006852	Ga0075433_10173039	Ga0075433_101730392	329
843	3300006871	Ga0075434_100118130	Ga0075434_1001181302	329
844	3300006880	Ga0075429_100012926	Ga0075429_1000129264	329
845	3300006881	Ga0068865_100354455	Ga0068865_1003544552	329
846	3300006931	Ga0097620_100061104	Ga0097620_1000611042	329
847	3300006931	Ga0097620_100152251	Ga0097620_1001522514	329
848	3300006946	Ga0079104_1000014	Ga0079104_1000014175	329
849	3300006946	Ga0079104_1006514	Ga0079104_10065143	329
850	3300009011	Ga0105251_10001873	Ga0105251_1000187315	329
851	3300009036	Ga0105244_10004923	Ga0105244_100049237	329
852	3300009092	Ga0105250_10013970	Ga0105250_100139702	329
853	3300009092	Ga0105250_10047074	Ga0105250_100470742	329
854	3300009093	Ga0105240_10003365	Ga0105240_1000336523	329
855	3300009093	Ga0105240_10010237	Ga0105240_100102375	329
856	3300009093	Ga0105240_10029221	Ga0105240_100292216	329
857	3300009093	Ga0105240_10068502	Ga0105240_100685023	329
858	3300009093	Ga0105240_10375253	Ga0105240_103752531	329
859	3300009101	Ga0105247_10038872	Ga0105247_100388722	329
860	3300009101	Ga0105247_10070710	Ga0105247_100707102	329
861	3300009148	Ga0105243_10054865	Ga0105243_100548652	329
862	3300009174	Ga0105241_10215047	Ga0105241_102150472	329
863	3300009177	Ga0105248_10016781	Ga0105248_100167814	329
864	3300009177	Ga0105248_10328710	Ga0105248_103287102	329
865	3300009545	Ga0105237_10003924	Ga0105237_100039245	329
866	3300009551	Ga0105238_10035051	Ga0105238_100350514	329
867	3300009551	Ga0105238_10143500	Ga0105238_101435002	329
868	3300009553	Ga0105249_10010686	Ga0105249_100106864	329
869	3300009553	Ga0105249_10023126	Ga0105249_100231267	329
870	3300009553	Ga0105249_10466128	Ga0105249_104661282	329
871	3300009765	Ga0123341_1052966	Ga0123341_10529662	329
872	3300009766	Ga0123342_1015355	Ga0123342_10153553	329
873	3300010375	Ga0105239_10023776	Ga0105239_100237763	329
874	3300010375	Ga0105239_10023954	Ga0105239_100239544	329
875	3300010375	Ga0105239_10029706	Ga0105239_100297062	329
876	3300010375	Ga0105239_10325960	Ga0105239_103259602	329
877	3300013100	Ga0157373_10035021	Ga0157373_100350213	329
878	3300013102	Ga0157371_10106200	Ga0157371_101062001	329
879	3300013104	Ga0157370_10012653	Ga0157370_100126532	329
880	3300013104	Ga0157370_10134530	Ga0157370_101345301	329
881	3300013104	Ga0157370_10217923	Ga0157370_102179232	329
882	3300013105	Ga0157369_10022567	Ga0157369_100225676	329
883	3300013105	Ga0157369_10050990	Ga0157369_100509904	329
884	3300013296	Ga0157374_10011205	Ga0157374_100112054	329
885	3300013297	Ga0157378_10174355	Ga0157378_101743552	329
886	3300013306	Ga0163162_10013542	Ga0163162_100135427	329
887	3300013306	Ga0163162_10018081	Ga0163162_100180813	329
888	3300013306	Ga0163162_10113890	Ga0163162_101138902	329
889	3300013307	Ga0157372_10001861	Ga0157372_1000186115	329
890	3300013308	Ga0157375_10008987	Ga0157375_100089875	329
891	3300013308	Ga0157375_10139236	Ga0157375_101392362	329
892	3300013308	Ga0157375_10462466	Ga0157375_104624662	329
893	3300014325	Ga0163163_10004790	Ga0163163_100047902	329
894	3300014325	Ga0163163_10010492	Ga0163163_100104927	329
895	3300014325	Ga0163163_10014605	Ga0163163_100146059	329
896	3300014325	Ga0163163_10055841	Ga0163163_100558413	329
897	3300014325	Ga0163163_10093282	Ga0163163_100932822	329
898	3300014325	Ga0163163_10115546	Ga0163163_101155463	329
899	3300014325	Ga0163163_10134921	Ga0163163_101349212	329
900	3300014326	Ga0157380_10012041	Ga0157380_100120412	329
901	3300014326	Ga0157380_10038532	Ga0157380_100385323	329
902	3300014497	Ga0182008_10017131	Ga0182008_100171313	329
903	3300014497	Ga0182008_10029515	Ga0182008_100295152	329
904	3300015261	Ga0182006_1003576	Ga0182006_10035761	329
905	3300015262	Ga0182007_10002153	Ga0182007_100021538	329
906	3300015262	Ga0182007_10005298	Ga0182007_100052985	329
907	3300017792	Ga0163161_10010040	Ga0163161_100100407	329
908	3300017792	Ga0163161_10110900	Ga0163161_101109002	329
909	3300021384	Ga0213876_10000206	Ga0213876_1000020636	329
910	3300022739	Ga0228711_1010103	Ga0228711_10101033	329
911	3300022740	Ga0228710_1010335	Ga0228710_101033513	329
912	3300025208	Ga0209436_100648	Ga0209436_1006486	329
913	3300025226	Ga0209674_100816	Ga0209674_10081613	329
914	3300025226	Ga0209674_103735	Ga0209674_1037352	329
915	3300025228	Ga0209672_100074	Ga0209672_10007485	329
916	3300025231	Ga0207427_100044	Ga0207427_10004477	329
917	3300025231	Ga0207427_100088	Ga0207427_10008876	329
918	3300025231	Ga0207427_100191	Ga0207427_10019127	329
919	3300025233	Ga0209437_100005	Ga0209437_100005299	329
920	3300025233	Ga0209437_100023	Ga0209437_100023414	329
921	3300025233	Ga0209437_100167	Ga0209437_10016776	329
922	3300025242	Ga0209258_100004	Ga0209258_1000041225	329
923	3300025242	Ga0209258_100008	Ga0209258_100008850	329
924	3300025242	Ga0209258_107940	Ga0209258_1079402	329
925	3300025250	Ga0209026_1000051	Ga0209026_100005133	329
926	3300025253	Ga0209677_101073	Ga0209677_1010733	329
927	3300025254	Ga0209148_1000041	Ga0209148_1000041352	329
928	3300025256	Ga0209759_1021998	Ga0209759_10219982	329
929	3300025258	Ga0209129_1014413	Ga0209129_10144132	329
930	3300025261	Ga0209233_1000010	Ga0209233_1000010672	329
931	3300025261	Ga0209233_1000011	Ga0209233_1000011642	329
932	3300025261	Ga0209233_1000046	Ga0209233_100004676	329
933	3300025261	Ga0209233_1000062	Ga0209233_100006261	329
934	3300025261	Ga0209233_1006618	Ga0209233_10066185	329
935	3300025263	Ga0209565_1000024	Ga0209565_1000024134	329
936	3300025263	Ga0209565_1006649	Ga0209565_10066492	329
937	3300025272	Ga0209455_1000007	Ga0209455_1000007970	329
938	3300025273	Ga0209673_1000013	Ga0209673_1000013186	329
939	3300025273	Ga0209673_1000237	Ga0209673_100023711	329
940	3300025273	Ga0209673_1000325	Ga0209673_100032572	329
941	3300025273	Ga0209673_1006678	Ga0209673_10066782	329
942	3300025284	Ga0209130_1000075	Ga0209130_1000075102	329
943	3300025284	Ga0209130_1000310	Ga0209130_100031018	329
944	3300025291	Ga0209675_1000107	Ga0209675_100010726	329
945	3300025291	Ga0209675_1001321	Ga0209675_10013218	329
946	3300025292	Ga0209676_1001452	Ga0209676_10014527	329
947	3300025292	Ga0209676_1003114	Ga0209676_10031145	329
948	3300025292	Ga0209676_1024523	Ga0209676_10245231	329
949	3300025294	Ga0209025_1000747	Ga0209025_10007478	329
950	3300025295	Ga0209564_1000264	Ga0209564_100026477	329
951	3300025295	Ga0209564_1000422	Ga0209564_100042231	329
952	3300025295	Ga0209564_1000834	Ga0209564_100083431	329
953	3300025295	Ga0209564_1001458	Ga0209564_10014583	329
954	3300025297	Ga0209758_1006281	Ga0209758_100628110	329
955	3300025298	Ga0209050_1000201	Ga0209050_1000201123	329
956	3300025298	Ga0209050_1001448	Ga0209050_100144819	329
957	3300025298	Ga0209050_1005253	Ga0209050_10052532	329
958	3300025298	Ga0209050_1026796	Ga0209050_10267963	329
959	3300025299	Ga0209256_1000245	Ga0209256_100024575	329
960	3300025299	Ga0209256_1000369	Ga0209256_100036921	329
961	3300025299	Ga0209256_1000768	Ga0209256_100076831	329
962	3300025299	Ga0209256_1001381	Ga0209256_100138118	329
963	3300025299	Ga0209256_1003963	Ga0209256_10039638	329
964	3300025299	Ga0209256_1004988	Ga0209256_10049884	329
965	3300025299	Ga0209256_1007290	Ga0209256_10072902	329
966	3300025302	Ga0207426_1000039	Ga0207426_1000039399	329
967	3300025302	Ga0207426_1000069	Ga0207426_1000069305	329
968	3300025302	Ga0207426_1000163	Ga0207426_1000163102	329
969	3300025303	Ga0209051_1001000	Ga0209051_100100013	329
970	3300025303	Ga0209051_1019262	Ga0209051_10192622	329
971	3300025304	Ga0209257_1000208	Ga0209257_1000208126	329
972	3300025304	Ga0209257_1001401	Ga0209257_100140120	329
973	3300025304	Ga0209257_1008238	Ga0209257_10082385	329
974	3300025304	Ga0209257_1019193	Ga0209257_10191932	329
975	3300025315	Ga0207697_10015513	Ga0207697_100155132	329
976	3300025711	Ga0207696_1001046	Ga0207696_100104612	329
977	3300025728	Ga0207655_1001026	Ga0207655_100102618	329
978	3300025728	Ga0207655_1021264	Ga0207655_10212643	329
979	3300025735	Ga0207713_1078235	Ga0207713_10782351	329
980	3300025898	Ga0207692_10002549	Ga0207692_100025498	329
981	3300025899	Ga0207642_10027365	Ga0207642_100273653	329
982	3300025901	Ga0207688_10028540	Ga0207688_100285403	329
983	3300025906	Ga0207699_10086114	Ga0207699_100861142	329
984	3300025908	Ga0207643_10001041	Ga0207643_100010415	329
985	3300025909	Ga0207705_10009047	Ga0207705_100090473	329
986	3300025911	Ga0207654_10000458	Ga0207654_1000045816	329
987	3300025912	Ga0207707_10002463	Ga0207707_1000246311	329
988	3300025912	Ga0207707_10013761	Ga0207707_100137613	329
989	3300025912	Ga0207707_10246107	Ga0207707_102461071	329
990	3300025913	Ga0207695_10003786	Ga0207695_1000378615	329
991	3300025913	Ga0207695_10005481	Ga0207695_100054818	329
992	3300025913	Ga0207695_10039157	Ga0207695_100391573	329
993	3300025913	Ga0207695_10050552	Ga0207695_100505523	329
994	3300025913	Ga0207695_10213725	Ga0207695_102137251	329
995	3300025914	Ga0207671_10002406	Ga0207671_100024069	329
996	3300025915	Ga0207693_10000015	Ga0207693_10000015114	329
997	3300025916	Ga0207663_10001639	Ga0207663_100016394	329
998	3300025916	Ga0207663_10023654	Ga0207663_100236544	329
999	3300025918	Ga0207662_10103306	Ga0207662_101033062	329
1000	3300025919	Ga0207657_10043878	Ga0207657_100438782	329
1001	3300025919	Ga0207657_10107843	Ga0207657_101078432	329
1002	3300025921	Ga0207652_10012273	Ga0207652_100122735	329
1003	3300025921	Ga0207652_10324028	Ga0207652_103240281	329
1004	3300025922	Ga0207646_10007690	Ga0207646_1000769011	329
1005	3300025924	Ga0207694_10044666	Ga0207694_100446662	329
1006	3300025924	Ga0207694_10266878	Ga0207694_102668781	329
1007	3300025925	Ga0207650_10008887	Ga0207650_100088874	329
1008	3300025925	Ga0207650_10042618	Ga0207650_100426184	329
1009	3300025928	Ga0207700_10000095	Ga0207700_1000009510	329
1010	3300025928	Ga0207700_10003302	Ga0207700_100033023	329
1011	3300025928	Ga0207700_10081433	Ga0207700_100814332	329
1012	3300025929	Ga0207664_10000164	Ga0207664_100001641	329
1013	3300025929	Ga0207664_10128175	Ga0207664_101281752	329
1014	3300025932	Ga0207690_10009965	Ga0207690_100099653	329
1015	3300025932	Ga0207690_10152956	Ga0207690_101529562	329
1016	3300025934	Ga0207686_10035304	Ga0207686_100353042	329
1017	3300025935	Ga0207709_10003858	Ga0207709_100038587	329
1018	3300025935	Ga0207709_10158982	Ga0207709_101589822	329
1019	3300025937	Ga0207669_10003444	Ga0207669_100034443	329
1020	3300025941	Ga0207711_10130020	Ga0207711_101300201	329
1021	3300025942	Ga0207689_10003862	Ga0207689_100038626	329
1022	3300025944	Ga0207661_10300052	Ga0207661_103000522	329
1023	3300025949	Ga0207667_10246348	Ga0207667_102463481	329
1024	3300025961	Ga0207712_10014570	Ga0207712_100145703	329
1025	3300025961	Ga0207712_10100581	Ga0207712_101005813	329
1026	3300025961	Ga0207712_10151630	Ga0207712_101516302	329
1027	3300025972	Ga0207668_10058327	Ga0207668_100583273	329
1028	3300025981	Ga0207640_10192935	Ga0207640_101929352	329
1029	3300025981	Ga0207640_10217133	Ga0207640_102171331	329
1030	3300025981	Ga0207640_10245145	Ga0207640_102451451	329
1031	3300026023	Ga0207677_10076037	Ga0207677_100760371	329
1032	3300026075	Ga0207708_10018263	Ga0207708_100182634	329
1033	3300026078	Ga0207702_10001070	Ga0207702_1000107024	329
1034	3300026078	Ga0207702_10099176	Ga0207702_100991762	329
1035	3300026078	Ga0207702_10110439	Ga0207702_101104392	329
1036	3300026088	Ga0207641_10018222	Ga0207641_100182223	329
1037	3300026088	Ga0207641_10022087	Ga0207641_100220875	329
1038	3300026088	Ga0207641_10036177	Ga0207641_100361774	329
1039	3300026088	Ga0207641_10051387	Ga0207641_100513873	329
1040	3300026089	Ga0207648_10028429	Ga0207648_100284291	329
1041	3300026095	Ga0207676_10007421	Ga0207676_100074212	329
1042	3300026095	Ga0207676_10051558	Ga0207676_100515583	329
1043	3300026095	Ga0207676_10150610	Ga0207676_101506101	329
1044	3300026116	Ga0207674_10112580	Ga0207674_101125802	329
1045	3300026116	Ga0207674_10197882	Ga0207674_101978822	329
1046	3300026118	Ga0207675_100025344	Ga0207675_1000253445	329
1047	3300026118	Ga0207675_100060823	Ga0207675_1000608235	329
1048	3300026118	Ga0207675_100174869	Ga0207675_1001748691	329
1049	3300026118	Ga0207675_100388717	Ga0207675_1003887171	329
1050	3300026121	Ga0207683_10001725	Ga0207683_1000172513	329
1051	3300026121	Ga0207683_10244892	Ga0207683_102448922	329
1052	3300026142	Ga0207698_10075775	Ga0207698_100757752	329
1053	3300026142	Ga0207698_10565426	Ga0207698_105654261	329
1054	3300027111	Ga0209281_1000032	Ga0209281_1000032175	329
1055	3300027296	Ga0209389_1000103	Ga0209389_10001033	329
1056	3300027866	Ga0209813_10002280	Ga0209813_100022805	329
1057	3300028379	Ga0268266_10015730	Ga0268266_100157305	329
1058	3300028379	Ga0268266_10053097	Ga0268266_100530972	329
1059	3300028379	Ga0268266_10143384	Ga0268266_101433842	329
1060	3300028380	Ga0268265_10233890	Ga0268265_102338901	329
1061	3300028381	Ga0268264_10106779	Ga0268264_101067793	329
1062	3300028573	Ga0265334_10000413	Ga0265334_100004136	329
1063	3300028666	Ga0265336_10002094	Ga0265336_100020945	329
1064	3300028786	Ga0307517_10090532	Ga0307517_100905323	329
1065	3300028794	Ga0307515_10000109	Ga0307515_1000010996	329
1066	3300028794	Ga0307515_10001259	Ga0307515_1000125923	329
1067	3300028794	Ga0307515_10008042	Ga0307515_100080425	329
1068	3300028794	Ga0307515_10121215	Ga0307515_101212151	329
1069	3300028800	Ga0265338_10048393	Ga0265338_100483932	329
1070	3300030522	Ga0307512_10050486	Ga0307512_100504863	329
1071	3300031238	Ga0265332_10020144	Ga0265332_100201442	329
1072	3300031239	Ga0265328_10008226	Ga0265328_100082262	329
1073	3300031239	Ga0265328_10015756	Ga0265328_100157563	329
1074	3300031240	Ga0265320_10028438	Ga0265320_100284383	329
1075	3300031241	Ga0265325_10025630	Ga0265325_100256304	329
1076	3300031241	Ga0265325_10079283	Ga0265325_100792831	329
1077	3300031247	Ga0265340_10121671	Ga0265340_101216711	329
1078	3300031249	Ga0265339_10000017	Ga0265339_1000001728	329
1079	3300031249	Ga0265339_10009489	Ga0265339_100094892	329
1080	3300031344	Ga0265316_10031939	Ga0265316_100319392	329
1081	3300031344	Ga0265316_10079707	Ga0265316_100797072	329
1082	3300031456	Ga0307513_10012800	Ga0307513_100128007	329
1083	3300031456	Ga0307513_10019854	Ga0307513_100198541	329
1084	3300031456	Ga0307513_10100115	Ga0307513_101001154	329
1085	3300031507	Ga0307509_10003494	Ga0307509_100034948	329
1086	3300031507	Ga0307509_10225311	Ga0307509_102253112	329
1087	3300031595	Ga0265313_10039997	Ga0265313_100399972	329
1088	3300031616	Ga0307508_10000166	Ga0307508_1000016616	329
1089	3300031616	Ga0307508_10026258	Ga0307508_100262585	329
1090	3300031616	Ga0307508_10080456	Ga0307508_100804562	329
1091	3300031691	Ga0316579_10010492	Ga0316579_100104925	329
1092	3300031712	Ga0265342_10004192	Ga0265342_100041925	329
1093	3300031712	Ga0265342_10007899	Ga0265342_100078994	329
1094	3300031730	Ga0307516_10013100	Ga0307516_100131008	329
1095	3300031730	Ga0307516_10107977	Ga0307516_101079772	329
1096	3300031730	Ga0307516_10380971	Ga0307516_103809711	329
1097	3300031733	Ga0316577_10005506	Ga0316577_100055062	329
1098	3300031824	Ga0307413_10010666	Ga0307413_100106662	329
1099	3300031852	Ga0307410_10009966	Ga0307410_100099661	329
1100	3300031911	Ga0307412_10000073	Ga0307412_1000007372	329
1101	3300032004	Ga0307414_10000521	Ga0307414_100005215	329
1102	3300032005	Ga0307411_10159911	Ga0307411_101599111	329
1103	3300033179	Ga0307507_10090245	Ga0307507_100902452	329
1104	3300033179	Ga0307507_10102221	Ga0307507_101022212	329
1105	3300033179	Ga0307507_10255223	Ga0307507_102552231	329
1106	3300035113	Ga0373936_0014042	Ga0373936_0014042_1128_2123	329
1107	3300035172	Ga0373955_0012412	Ga0373955_0012412_2647_3642	329
1108	3300035172	Ga0373955_0036029	Ga0373955_0036029_187_1200	329
1109	3300035172	Ga0373955_0089868	Ga0373955_0089868_716_1708	329
1110	3300035207	Ga0373942_0006271	Ga0373942_0006271_1418_2416	329
1111	3300035695	Ga0373927_0001173	Ga0373927_0001173_5504_6493	329
1112	3300035724	Ga0373933_0015935	Ga0373933_0015935_3160_4155	329
1113	3300035724	Ga0373933_0058334	Ga0373933_0058334_192_1181	329
1114	3300036401	Ga0373937_0038118	Ga0373937_0038118_2236_3228	329
1115	3300036401	Ga0373937_0063688	Ga0373937_0063688_1778_2770	329
1116	3300036401	Ga0373937_0201814	Ga0373937_0201814_570_1565	329
1117	3300036401	Ga0373937_0207784	Ga0373937_0207784_601_1596	329
1118	3300036712	Ga0316584_0003543	Ga0316584_0003543_4460_5455	329
1119	3300037068	Ga0373925_0001435	Ga0373925_0001435_874_1863	329
1120	3300039437	Ga0436365_0880687	Ga0436365_0880687_9701_10699	329
1121	3300041491	Ga0451833_0452954	Ga0451833_0452954_73_1062	329
1122	3300041492	Ga0451835_0639535	Ga0451835_0639535_178_1167	329
1123	3300041494	Ga0451837_0518878	Ga0451837_0518878_89_1078	329
1124	3300041496	Ga0451839_1038663	Ga0451839_1038663_1786_2775	329
1125	3300041498	Ga0451841_0840586	Ga0451841_0840586_169_1158	329
1126	3300041501	Ga0451845_0125421	Ga0451845_0125421_3474_4463	329
1127	3300041503	Ga0451847_0385431	Ga0451847_0385431_1317_2306	329
1128	3300041507	Ga0451851_0082242	Ga0451851_0082242_3113_4114	329
1129	3300041507	Ga0451851_0254372	Ga0451851_0254372_9353_10342	329
1130	3300041509	Ga0451843_0051522	Ga0451843_0051522_1301_2290	329
1131	3300041511	Ga0451855_1207873	Ga0451855_1207873_369_1370	329
1132	3300041511	Ga0451855_1245641	Ga0451855_1245641_1145_2134	329
1133	3300041512	Ga0451853_2815247	Ga0451853_2815247_1778_2767	329
1134	3300042006	Ga0439432_020827	Ga0439432_020827_830_1822	329
1135	3300042876	Ga0451577_0011763	Ga0451577_0011763_6448_7443	329
1136	3300042876	Ga0451577_0213228	Ga0451577_0213228_157_1221	329
1137	3300044673	Ga0453683_0000277	Ga0453683_0000277_7071_8066	329
1138	3300044673	Ga0453683_0001087	Ga0453683_0001087_9352_10347	329
1139	3300044712	Ga0453684_0002678	Ga0453684_0002678_20388_21452	329
1140	3300044712	Ga0453684_0005232	Ga0453684_0005232_15628_16623	329
1141	3300044712	Ga0453684_0062625	Ga0453684_0062625_935_1930	329
1142	3300044712	Ga0453684_0547489	Ga0453684_0547489_132_1133	329
1143	3300045051	Ga0451576_0011104	Ga0451576_0011104_7436_8431	329
1144	3300045051	Ga0451576_0178845	Ga0451576_0178845_896_1888	329
1145	3300045051	Ga0451576_0184786	Ga0451576_0184786_793_1788	329
1146	3300046452	Ga0495617_000166	Ga0495617_000166_8378_9370	329
1147	3300046452	Ga0495617_032055	Ga0495617_032055_526_1521	329
1148	3300046453	Ga0495627_059893	Ga0495627_059893_10_1005	329
1149	3300046455	Ga0495603_0000025	Ga0495603_0000025_8953_9945	329
1150	3300046458	Ga0495591_000009	Ga0495591_000009_256221_257213	329
1151	3300046458	Ga0495591_010385	Ga0495591_010385_106_1098	329
1152	3300046459	Ga0495629_0005209	Ga0495629_0005209_8036_9025	329
1153	3300046460	Ga0495638_0000147	Ga0495638_0000147_55754_56746	329
1154	3300046460	Ga0495638_0000373	Ga0495638_0000373_13588_14577	329
1155	3300046460	Ga0495638_0005596	Ga0495638_0005596_7088_8077	329
1156	3300046460	Ga0495638_0014238	Ga0495638_0014238_603_1595	329
1157	3300046460	Ga0495638_0046711	Ga0495638_0046711_1398_2390	329
1158	3300046460	Ga0495638_0115149	Ga0495638_0115149_168_1160	329
1159	3300046460	Ga0495638_0157978	Ga0495638_0157978_38_1159	329
1160	3300046460	Ga0495638_0178137	Ga0495638_0178137_99_1094	329
1161	3300046462	Ga0495651_0111174	Ga0495651_0111174_717_1706	329
1162	3300046463	Ga0495653_0044424	Ga0495653_0044424_1187_2179	329
1163	3300046463	Ga0495653_0171407	Ga0495653_0171407_486_1481	329
1164	3300046471	Ga0495650_0082565	Ga0495650_0082565_192_1181	329
1165	3300046472	Ga0495580_0014469	Ga0495580_0014469_4714_5712	329
1166	3300046474	Ga0495605_0000517	Ga0495605_0000517_3617_4609	329
1167	3300046474	Ga0495605_0024517	Ga0495605_0024517_676_1665	329
1168	3300046474	Ga0495605_0062376	Ga0495605_0062376_323_1312	329
1169	3300046477	Ga0495664_0163437	Ga0495664_0163437_282_1271	329
1170	3300046491	Ga0495584_0004896	Ga0495584_0004896_1215_2207	329
1171	3300046492	Ga0495585_0001928	Ga0495585_0001928_2037_3029	329
1172	3300046492	Ga0495585_0003186	Ga0495585_0003186_3536_4531	329
1173	3300046492	Ga0495585_0034770	Ga0495585_0034770_1215_2204	329
1174	3300046499	Ga0495594_0000383	Ga0495594_0000383_11320_12315	329
1175	3300046499	Ga0495594_0000849	Ga0495594_0000849_7074_8069	329
1176	3300046499	Ga0495594_0002139	Ga0495594_0002139_4669_5688	329
1177	3300046499	Ga0495594_0132515	Ga0495594_0132515_361_1353	329
1178	3300046500	Ga0495596_0041675	Ga0495596_0041675_35_1030	329
1179	3300046501	Ga0495607_0000136	Ga0495607_0000136_8294_9286	329
1180	3300046501	Ga0495607_0000323	Ga0495607_0000323_48312_49304	329
1181	3300046501	Ga0495607_0003007	Ga0495607_0003007_6995_7987	329
1182	3300046501	Ga0495607_0030430	Ga0495607_0030430_169_1161	329
1183	3300046501	Ga0495607_0031272	Ga0495607_0031272_242_1231	329
1184	3300046501	Ga0495607_0046990	Ga0495607_0046990_294_1289	329
1185	3300046501	Ga0495607_0059138	Ga0495607_0059138_189_1178	329
1186	3300046506	Ga0495583_0000037	Ga0495583_0000037_10516_11514	329
1187	3300046506	Ga0495583_0009208	Ga0495583_0009208_3418_4413	329
1188	3300046507	Ga0495606_0003254	Ga0495606_0003254_8332_9321	329
1189	3300046507	Ga0495606_0004151	Ga0495606_0004151_3407_4399	329
1190	3300046507	Ga0495606_0005518	Ga0495606_0005518_5752_6744	329
1191	3300046507	Ga0495606_0046227	Ga0495606_0046227_792_1784	329
1192	3300046507	Ga0495606_0087013	Ga0495606_0087013_45_1037	329
1193	3300046507	Ga0495606_0199574	Ga0495606_0199574_63_1058	329
1194	3300046512	Ga0495610_0001982	Ga0495610_0001982_14401_15393	329
1195	3300046512	Ga0495610_0009411	Ga0495610_0009411_2487_3485	329
1196	3300046512	Ga0495610_0029421	Ga0495610_0029421_977_1972	329
1197	3300046512	Ga0495610_0059577	Ga0495610_0059577_116_1105	329
1198	3300046513	Ga0495616_0000165	Ga0495616_0000165_6495_7487	329
1199	3300046513	Ga0495616_0007637	Ga0495616_0007637_4865_5959	329
1200	3300046513	Ga0495616_0018236	Ga0495616_0018236_2273_3265	329
1201	3300046513	Ga0495616_0021630	Ga0495616_0021630_1632_2624	329
1202	3300046513	Ga0495616_0023716	Ga0495616_0023716_1611_2606	329
1203	3300046513	Ga0495616_0043088	Ga0495616_0043088_1124_2113	329
1204	3300046513	Ga0495616_0047868	Ga0495616_0047868_894_1886	329
1205	3300046513	Ga0495616_0081326	Ga0495616_0081326_49_1095	329
1206	3300046515	Ga0495620_0012713	Ga0495620_0012713_1974_2963	329
1207	3300046515	Ga0495620_0092615	Ga0495620_0092615_21_1082	329
1208	3300046517	Ga0495630_0003428	Ga0495630_0003428_6950_7969	329
1209	3300046518	Ga0495631_0000076	Ga0495631_0000076_16279_17271	329
1210	3300046518	Ga0495631_0001470	Ga0495631_0001470_4878_5873	329
1211	3300046518	Ga0495631_0007732	Ga0495631_0007732_2070_3065	329
1212	3300046519	Ga0495632_0003297	Ga0495632_0003297_8091_9086	329
1213	3300046519	Ga0495632_0020778	Ga0495632_0020778_829_1821	329
1214	3300046519	Ga0495632_0045411	Ga0495632_0045411_139_1131	329
1215	3300046519	Ga0495632_0053055	Ga0495632_0053055_805_1899	329
1216	3300046519	Ga0495632_0061000	Ga0495632_0061000_679_1674	329
1217	3300046520	Ga0495637_0012651	Ga0495637_0012651_2095_3087	329
1218	3300046520	Ga0495637_0017699	Ga0495637_0017699_847_1842	329
1219	3300046522	Ga0495643_0000653	Ga0495643_0000653_26938_28170	329
1220	3300046522	Ga0495643_0005280	Ga0495643_0005280_6264_7253	329
1221	3300046522	Ga0495643_0145154	Ga0495643_0145154_39_1034	329
1222	3300046523	Ga0495644_0000012	Ga0495644_0000012_35118_36113	329
1223	3300046523	Ga0495644_0000421	Ga0495644_0000421_5236_6231	329
1224	3300046523	Ga0495644_0000934	Ga0495644_0000934_3167_4156	329
1225	3300046524	Ga0495648_0000068	Ga0495648_0000068_109692_110690	329
1226	3300046524	Ga0495648_0005126	Ga0495648_0005126_1961_2953	329
1227	3300046525	Ga0495663_0000757	Ga0495663_0000757_6790_7782	329
1228	3300046525	Ga0495663_0000830	Ga0495663_0000830_5183_6175	329
1229	3300046526	Ga0495666_0053296	Ga0495666_0053296_252_1244	329
1230	3300046530	Ga0495654_0000045	Ga0495654_0000045_121204_122220	329
1231	3300046530	Ga0495654_0005443	Ga0495654_0005443_5418_6443	329
1232	3300046530	Ga0495654_0012708	Ga0495654_0012708_3148_4137	329
1233	3300046530	Ga0495654_0021836	Ga0495654_0021836_2237_3229	329
1234	3300046530	Ga0495654_0025735	Ga0495654_0025735_592_1584	329
1235	3300046530	Ga0495654_0061059	Ga0495654_0061059_225_1220	329
1236	3300046530	Ga0495654_0106744	Ga0495654_0106744_174_1163	329
1237	3300046533	Ga0495640_0028430	Ga0495640_0028430_2523_3542	329
1238	3300046538	Ga0495609_0000020	Ga0495609_0000020_236018_237010	329
1239	3300046538	Ga0495609_0011523	Ga0495609_0011523_2708_3700	329
1240	3300046538	Ga0495609_0038113	Ga0495609_0038113_379_1374	329
1241	3300046538	Ga0495609_0048454	Ga0495609_0048454_137_1126	329
1242	3300046542	Ga0495597_0028618	Ga0495597_0028618_139_1131	329
1243	3300046543	Ga0495645_0007209	Ga0495645_0007209_3157_4146	329
1244	3300046543	Ga0495645_0017619	Ga0495645_0017619_1537_2526	329
1245	3300046557	Ga0495622_0001980	Ga0495622_0001980_7078_8070	329
1246	3300046558	Ga0495633_0002695	Ga0495633_0002695_2978_3970	329
1247	3300046558	Ga0495633_0003416	Ga0495633_0003416_6186_7178	329
1248	3300046558	Ga0495633_0059847	Ga0495633_0059847_254_1249	329
1249	3300046559	Ga0495667_0140943	Ga0495667_0140943_47_1042	329
1250	3300046615	Ga0495656_0083201	Ga0495656_0083201_214_1317	329
1251	3300046616	Ga0495668_0006629	Ga0495668_0006629_725_1720	329
1252	3300046616	Ga0495668_0007922	Ga0495668_0007922_5340_6335	329
1253	3300046616	Ga0495668_0008246	Ga0495668_0008246_795_1787	329
1254	3300046616	Ga0495668_0020574	Ga0495668_0020574_1233_2231	329
1255	3300046616	Ga0495668_0047693	Ga0495668_0047693_1173_2171	329
1256	3300046616	Ga0495668_0070845	Ga0495668_0070845_415_1404	329
1257	3300046616	Ga0495668_0199983	Ga0495668_0199983_62_1054	329
1258	3300046642	Ga0495634_0000347	Ga0495634_0000347_28652_29644	329
1259	3300046642	Ga0495634_0083463	Ga0495634_0083463_1002_2015	329
1260	3300046648	Ga0495611_0001754	Ga0495611_0001754_7665_8654	329
1261	3300046648	Ga0495611_0028540	Ga0495611_0028540_502_1497	329
1262	3300046660	Ga0495625_0001325	Ga0495625_0001325_10329_11321	329
1263	3300046660	Ga0495625_0001742	Ga0495625_0001742_252_1247	329
1264	3300046660	Ga0495625_0003377	Ga0495625_0003377_7861_8856	329
1265	3300046660	Ga0495625_0004397	Ga0495625_0004397_6948_7973	329
1266	3300046660	Ga0495625_0005317	Ga0495625_0005317_5454_6446	329
1267	3300046660	Ga0495625_0005641	Ga0495625_0005641_6850_7842	329
1268	3300046660	Ga0495625_0027398	Ga0495625_0027398_964_1959	329
1269	3300046660	Ga0495625_0090243	Ga0495625_0090243_811_1803	329
1270	3300046660	Ga0495625_0151306	Ga0495625_0151306_360_1550	329
1271	3300046663	Ga0495635_0000210	Ga0495635_0000210_35390_36382	329
1272	3300046663	Ga0495635_0119264	Ga0495635_0119264_102_1121	329
1273	3300046665	Ga0495661_0033542	Ga0495661_0033542_1021_2010	329
1274	3300046674	Ga0495588_0001410	Ga0495588_0001410_7230_8222	329
1275	3300046674	Ga0495588_0016794	Ga0495588_0016794_896_1891	329
1276	3300046679	Ga0495623_0002958	Ga0495623_0002958_1799_2791	329
1277	3300046680	Ga0495646_0046615	Ga0495646_0046615_381_1373	329
1278	3300046680	Ga0495646_0063678	Ga0495646_0063678_295_1284	329
1279	3300046683	Ga0495658_0011198	Ga0495658_0011198_779_1798	329
1280	3300046683	Ga0495658_0098037	Ga0495658_0098037_102_1091	329
1281	3300046684	Ga0495669_0002111	Ga0495669_0002111_6112_7107	329
1282	3300046689	Ga0495613_0019346	Ga0495613_0019346_1608_2597	329
1283	3300046689	Ga0495613_0028188	Ga0495613_0028188_1260_2279	329
1284	3300046691	Ga0495670_0000591	Ga0495670_0000591_493_1485	329
1285	3300046691	Ga0495670_0004799	Ga0495670_0004799_3522_4517	329
1286	3300046691	Ga0495670_0037019	Ga0495670_0037019_340_1335	329
1287	3300046694	Ga0495649_0008742	Ga0495649_0008742_3468_4466	329
1288	3300046694	Ga0495649_0037397	Ga0495649_0037397_912_1904	329
1289	3300046694	Ga0495649_0074890	Ga0495649_0074890_159_1148	329
1290	3300046694	Ga0495649_0097661	Ga0495649_0097661_124_1116	329
1291	3300046794	Ga0495589_0004141	Ga0495589_0004141_1613_2638	329
1292	3300046794	Ga0495589_0016509	Ga0495589_0016509_1363_2355	329
1293	3300046809	Ga0495600_0149491	Ga0495600_0149491_452_1441	329
1294	3300046810	Ga0495660_0002045	Ga0495660_0002045_5233_6228	329
1295	3300046810	Ga0495660_0002788	Ga0495660_0002788_2356_3348	329
1296	3300046810	Ga0495660_0004038	Ga0495660_0004038_2126_3118	329
1297	3300046810	Ga0495660_0108584	Ga0495660_0108584_213_1205	329
1298	3300047317	Ga0495604_0005952	Ga0495604_0005952_5880_6869	329
1299	3300047317	Ga0495604_0049788	Ga0495604_0049788_1436_2428	329
1300	3300047318	Ga0495636_0056562	Ga0495636_0056562_233_1222	329
1301	3300047319	Ga0495674_0006547	Ga0495674_0006547_5990_7009	329
1302	3300047319	Ga0495674_0017477	Ga0495674_0017477_4746_5738	329
1303	3300047319	Ga0495674_0091874	Ga0495674_0091874_1184_2239	329
1304	3300047320	Ga0495672_0000587	Ga0495672_0000587_22038_23030	329
1305	3300047320	Ga0495672_0000994	Ga0495672_0000994_26715_27707	329
1306	3300047320	Ga0495672_0021250	Ga0495672_0021250_207_1199	329
1307	3300047320	Ga0495672_0100568	Ga0495672_0100568_387_1376	329
1308	3300047322	Ga0495680_0006234	Ga0495680_0006234_6798_7790	329
1309	3300047323	Ga0495683_0072296	Ga0495683_0072296_207_1196	329
1310	3300047446	Ga0495679_054250	Ga0495679_054250_127_1125	329
1311	3300047447	Ga0495685_079206	Ga0495685_079206_24_1019	329
1312	3300047469	Ga0495673_0000078	Ga0495673_0000078_151205_152197	329
1313	3300047469	Ga0495673_0000191	Ga0495673_0000191_75523_76521	329
1314	3300047469	Ga0495673_0000446	Ga0495673_0000446_4067_5065	329
1315	3300047469	Ga0495673_0000885	Ga0495673_0000885_4131_5183	329
1316	3300047469	Ga0495673_0013171	Ga0495673_0013171_2311_3303	329
1317	3300047469	Ga0495673_0033786	Ga0495673_0033786_743_1735	329
1318	3300047470	Ga0495681_0007225	Ga0495681_0007225_5867_6859	329
1319	3300047470	Ga0495681_0009252	Ga0495681_0009252_3011_4003	329
1320	3300047470	Ga0495681_0033133	Ga0495681_0033133_914_1906	329
1321	3300047470	Ga0495681_0041247	Ga0495681_0041247_911_1906	329
1322	3300047470	Ga0495681_0128054	Ga0495681_0128054_18_1007	329
1323	3300047471	Ga0495684_0060516	Ga0495684_0060516_1126_2115	329
1324	3300047471	Ga0495684_0063470	Ga0495684_0063470_1772_2785	329
1325	3300047472	Ga0495686_0002819	Ga0495686_0002819_12687_13679	329
1326	3300047472	Ga0495686_0003424	Ga0495686_0003424_5775_6767	329
1327	3300047472	Ga0495686_0020460	Ga0495686_0020460_1851_2849	329
1328	3300047472	Ga0495686_0029221	Ga0495686_0029221_45_1037	329
1329	3300047472	Ga0495686_0117846	Ga0495686_0117846_192_1364	329
1330	3300048091	Ga0495626_0017801	Ga0495626_0017801_265_1257	329
1331	3300048091	Ga0495626_0034074	Ga0495626_0034074_1023_2012	329
1332	3300048091	Ga0495626_0061767	Ga0495626_0061767_411_1400	329
1333	3300048905	Ga0496102_0000444	Ga0496102_0000444_28339_29331	329
1334	3300048906	Ga0496103_0000290	Ga0496103_0000290_27843_28835	329
1335	3300048907	Ga0496104_0014718	Ga0496104_0014718_385_1389	329
1336	3300048907	Ga0496104_0034145	Ga0496104_0034145_1213_2202	329
1337	3300048907	Ga0496104_0081095	Ga0496104_0081095_582_1577	329
1338	3300048908	Ga0496105_0188591	Ga0496105_0188591_238_1236	329
1339	3300048909	Ga0496106_0001689	Ga0496106_0001689_7403_8392	329
1340	3300048911	Ga0496108_0067701	Ga0496108_0067701_1496_2494	329
1341	3300048913	Ga0496110_0029498	Ga0496110_0029498_2920_3918	329
1342	3300048914	Ga0496111_0000302	Ga0496111_0000302_5516_6505	329
1343	3300048915	Ga0496112_0022761	Ga0496112_0022761_511_1509	329
1344	3300048915	Ga0496112_0097322	Ga0496112_0097322_967_1965	329
1345	3300048916	Ga0496113_0004936	Ga0496113_0004936_2055_3044	329
1346	3300048916	Ga0496113_0053931	Ga0496113_0053931_1060_2052	329
1347	3300048917	Ga0496114_0011054	Ga0496114_0011054_6063_7067	329
1348	3300048917	Ga0496114_0069483	Ga0496114_0069483_247_1239	329
1349	3300048917	Ga0496114_0436724	Ga0496114_0436724_126_1118	329
1350	3300048918	Ga0496115_0060376	Ga0496115_0060376_1015_2019	329
1351	3300048918	Ga0496115_0086072	Ga0496115_0086072_827_1819	329
1352	3300048918	Ga0496115_0136579	Ga0496115_0136579_152_1144	329
1353	3300048919	Ga0496116_0000201	Ga0496116_0000201_62582_63571	329
1354	3300048919	Ga0496116_0001025	Ga0496116_0001025_32300_33289	329
1355	3300048919	Ga0496116_0015807	Ga0496116_0015807_3475_4467	329
1356	3300048919	Ga0496116_0025899	Ga0496116_0025899_3025_4017	329
1357	3300048920	Ga0496117_0000437	Ga0496117_0000437_29243_30235	329
1358	3300048920	Ga0496117_0002386	Ga0496117_0002386_5187_6179	329
1359	3300048920	Ga0496117_0018996	Ga0496117_0018996_3858_4847	329
1360	3300048921	Ga0496118_0000430	Ga0496118_0000430_29255_30247	329
1361	3300048921	Ga0496118_0005120	Ga0496118_0005120_4777_5769	329
1362	3300048921	Ga0496118_0006887	Ga0496118_0006887_6612_7601	329
1363	3300048921	Ga0496118_0014231	Ga0496118_0014231_3574_4563	329
1364	3300048922	Ga0496119_0000505	Ga0496119_0000505_43946_44941	329
1365	3300048922	Ga0496119_0125061	Ga0496119_0125061_374_1366	329
1366	3300048923	Ga0496120_0001008	Ga0496120_0001008_28609_29604	329
1367	3300048924	Ga0496121_0005880	Ga0496121_0005880_4321_5310	329
1368	3300048924	Ga0496121_0015440	Ga0496121_0015440_6683_7675	329
1369	3300048924	Ga0496121_0025282	Ga0496121_0025282_756_1745	329
1370	3300048924	Ga0496121_0275095	Ga0496121_0275095_89_1078	329
1371	3300048925	Ga0496122_0000533	Ga0496122_0000533_62563_63552	329
1372	3300048925	Ga0496122_0012873	Ga0496122_0012873_7040_8032	329
1373	3300048925	Ga0496122_0031169	Ga0496122_0031169_1421_2413	329
1374	3300048925	Ga0496122_0038935	Ga0496122_0038935_1203_2192	329
1375	3300048925	Ga0496122_0063210	Ga0496122_0063210_420_1409	329
1376	3300048926	Ga0496123_0000406	Ga0496123_0000406_15333_16322	329
1377	3300048926	Ga0496123_0031480	Ga0496123_0031480_713_1705	329
1378	3300048927	Ga0496124_0000390	Ga0496124_0000390_7060_8052	329
1379	3300048927	Ga0496124_0003213	Ga0496124_0003213_18957_19946	329
1380	3300048927	Ga0496124_0023815	Ga0496124_0023815_1839_2831	329
1381	3300048927	Ga0496124_0031787	Ga0496124_0031787_625_1614	329
1382	3300048928	Ga0496125_0026773	Ga0496125_0026773_2959_3948	329
1383	3300048928	Ga0496125_0066506	Ga0496125_0066506_1748_2740	329
1384	3300048928	Ga0496125_0072180	Ga0496125_0072180_710_1702	329
1385	3300048929	Ga0496126_0000298	Ga0496126_0000298_41464_42453	329
1386	3300048929	Ga0496126_0092205	Ga0496126_0092205_16_1008	329
1387	3300049459	Ga0495678_019065	Ga0495678_019065_1840_2829	329
1388	3300049459	Ga0495678_020225	Ga0495678_020225_1193_2182	329
1389	3300049460	Ga0495682_0000152	Ga0495682_0000152_6490_7482	329
1390	3300049460	Ga0495682_0000232	Ga0495682_0000232_25424_26467	329
1391	3300049460	Ga0495682_0004996	Ga0495682_0004996_3651_4676	329
1392	3300049460	Ga0495682_0018079	Ga0495682_0018079_1036_2034	329
1393	3300049460	Ga0495682_0025606	Ga0495682_0025606_596_1594	329
1394	3300049460	Ga0495682_0033954	Ga0495682_0033954_32_1024	329
1395	3300049569	Ga0501032_0020016	Ga0501032_0020016_2720_3715	329
1396	3300049570	Ga0501033_0250040	Ga0501033_0250040_29_1024	329
1397	3300049574	Ga0501038_0407347	Ga0501038_0407347_24_1019	329
1398	3300049579	Ga0501043_0076012	Ga0501043_0076012_724_1719	329
1399	3300049580	Ga0501046_0073740	Ga0501046_0073740_996_1991	329
1400	3300050489	nmdc:mga03683_6515_c1	nmdc:mga03683_6515_c1_869_1858	329
1401	3300050492	nmdc:mga0yw44_850_c1	nmdc:mga0yw44_850_c1_7708_8703	329
1402	3300050493	nmdc:mga0k408_3147_c1	nmdc:mga0k408_3147_c1_5741_6736	329
1403	3300050494	nmdc:mga06z11_234_c1	nmdc:mga06z11_234_c1_14345_15346	329
1404	3300050495	nmdc:mga04h51_2709_c1	nmdc:mga04h51_2709_c1_3086_4087	329
1405	3300050496	nmdc:mga07m45_49940_c1	nmdc:mga07m45_49940_c1_195_1184	329
1406	3300050496	nmdc:mga07m45_9082_c1	nmdc:mga07m45_9082_c1_2730_3725	329
1407	3300050511	nmdc:mga08y16_352008_c1	nmdc:mga08y16_352008_c1_353_1387	329
1408	3300050512	nmdc:mga0n895_28533_c1	nmdc:mga0n895_28533_c1_1172_2170	329
1409	3300050513	nmdc:mga0rr50_252643_c1	nmdc:mga0rr50_252643_c1_394_1419	329
1410	3300050515	nmdc:mga0a205_35620_c1	nmdc:mga0a205_35620_c1_1464_2462	329
1411	3300050515	nmdc:mga0a205_73303_c1	nmdc:mga0a205_73303_c1_1217_2215	329
1412	3300053077	Ga0495601_0009042	Ga0495601_0009042_713_1726	329
1413	3300053078	Ga0495612_0097108	Ga0495612_0097108_219_1232	329
1414	3300053086	Ga0500578_0122290	Ga0500578_0122290_492_1487	329
1415	3300053086	Ga0500578_0168211	Ga0500578_0168211_58_1050	329
1416	3300053087	Ga0500643_000004	Ga0500643_000004_260688_261686	329
1417	3300053087	Ga0500643_000024	Ga0500643_000024_218684_219676	329
1418	3300053087	Ga0500643_011992	Ga0500643_011992_2030_3025	329
1419	3300053088	Ga0500644_0000126	Ga0500644_0000126_17925_18923	329
1420	3300053093	Ga0500651_0000009	Ga0500651_0000009_140173_141168	329
1421	3300053093	Ga0500651_0001730	Ga0500651_0001730_23_1015	329
1422	3300053093	Ga0500651_0043727	Ga0500651_0043727_682_1677	329
1423	3300053103	Ga0500555_002604	Ga0500555_002604_3033_4031	329
1424	3300053104	Ga0500556_0000005	Ga0500556_0000005_106434_107423	329
1425	3300053105	Ga0500557_039403	Ga0500557_039403_70_1065	329
1426	3300053109	Ga0500569_026385	Ga0500569_026385_35_1030	329
1427	3300053111	Ga0500572_000454	Ga0500572_000454_11564_12553	329
1428	3300053118	Ga0500594_0000563	Ga0500594_0000563_5849_6844	329
1429	3300053123	Ga0500614_031737	Ga0500614_031737_288_1277	329
1430	3300053125	Ga0500618_000025	Ga0500618_000025_32509_33504	329
1431	3300053125	Ga0500618_000035	Ga0500618_000035_83044_84042	329
1432	3300053125	Ga0500618_000116	Ga0500618_000116_26883_27878	329
1433	3300053125	Ga0500618_000344	Ga0500618_000344_21979_22968	329
1434	3300053125	Ga0500618_041767	Ga0500618_041767_12_1004	329
1435	3300053134	Ga0500658_0009392	Ga0500658_0009392_2478_3467	329
1436	3300053136	Ga0500559_0000048	Ga0500559_0000048_20077_21069	329
1437	3300053136	Ga0500559_0000315	Ga0500559_0000315_15397_16389	329
1438	3300053136	Ga0500559_0020365	Ga0500559_0020365_849_1844	329
1439	3300053138	Ga0500564_000018	Ga0500564_000018_23320_24318	329
1440	3300053138	Ga0500564_055018	Ga0500564_055018_104_1093	329
1441	3300053139	Ga0500568_0000168	Ga0500568_0000168_12459_13448	329
1442	3300053139	Ga0500568_0000328	Ga0500568_0000328_1917_2906	329
1443	3300053139	Ga0500568_0005320	Ga0500568_0005320_3164_4186	329
1444	3300053140	Ga0500573_0000021	Ga0500573_0000021_87694_88689	329
1445	3300053140	Ga0500573_0000355	Ga0500573_0000355_7206_8195	329
1446	3300053148	Ga0500590_016349	Ga0500590_016349_1551_2540	329
1447	3300053151	Ga0500604_0023312	Ga0500604_0023312_191_1186	329
1448	3300053153	Ga0500616_0001366	Ga0500616_0001366_9642_10631	329
1449	3300053153	Ga0500616_0017374	Ga0500616_0017374_1097_2086	329
1450	3300053153	Ga0500616_0023622	Ga0500616_0023622_308_1303	329
1451	3300053153	Ga0500616_0029219	Ga0500616_0029219_95_1090	329
1452	3300053156	Ga0500622_0120376	Ga0500622_0120376_27_1022	329
1453	3300053157	Ga0500624_000086	Ga0500624_000086_35344_36333	329
1454	3300053161	Ga0500634_0000115	Ga0500634_0000115_9877_10869	329
1455	3300053161	Ga0500634_0007159	Ga0500634_0007159_3361_4356	329
1456	3300053163	Ga0500639_034262	Ga0500639_034262_149_1141	329
1457	3300053177	Ga0500636_0004803	Ga0500636_0004803_195_1190	329
1458	3300053177	Ga0500636_0009650	Ga0500636_0009650_4562_5557	329
1459	3300053177	Ga0500636_0040354	Ga0500636_0040354_1357_2352	329
1460	3300053177	Ga0500636_0041222	Ga0500636_0041222_1269_2267	329
1461	3300053729	Ga0500625_000006	Ga0500625_000006_159872_160861	329
1462	3300053730	Ga0500645_001044	Ga0500645_001044_9448_10440	329
1463	iso_pu_bacteria	2767802442	2770197501	329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

80

377

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3v0u-assembly1.cif.gz_A	crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding	0.9387	1	308
3v0t-assembly1.cif.gz_A	crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding	0.9294	1	311
3uyi-assembly1.cif.gz_A-2	crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding	0.9086	1	308
8hnq-assembly1.cif.gz_A	the structure of a alcohol dehydrogenase akr13b2 with nadp	0.9085	3	305
6ky6-assembly2.cif.gz_B	crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc	0.9083	1	307

ID	Description	Score	Start	End	Superfamily
af_F4HPY8_8_325_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.954	1	328	3.20.20.100
af_P49249_9_269_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9448	2	253	3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9402	72	328	3.20.20.100
af_Q09923_6_337_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.94	4	329	3.20.20.100
3v0uA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9387	1	308	3.20.20.100

ID	Description	Score	Start	End	GO Terms
AF-A0A328TDJ7-F1-model_v4	Aldo/keto reductase family protein	1.001	123	206	GO:0004033 GO:0005737
AF-A0A7X1W0Z7-F1-model_v4	deleted	0.9969	1	329
AF-A0A7X1W0Z7-F1-model_v4	deleted	0.9939	1	329
AF-A0A1A7KG11-F1-model_v4	General stress protein 69 (EC 1.1.1.-)	0.9868	1	329	GO:0004033 GO:0005737
AF-A0A2V9HFB4-F1-model_v4	Aldo/keto reductase	0.9865	1	327	GO:0004033 GO:0005737

Feature Viewer

pLDDT	pTM	Quality
97.04	0.94	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F494146

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00248

Aldo_ket_red

Aldo/keto reductase family

80

377

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map