F494148
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1463 | 733 | 2924 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0310543|Ga0496102_0310543_638_1453 |
| Length | 271 |
| Sequence | LLRIFVVRWSASGDPPTFSDNDYPTSPSREEAKMSPSQFSRLSLLAAAIGAVALSALTISYSKAAEEAVIIPPPAMDVQAASGMQTAVLAGGCFWGVQGVFQHTAGVVNAVSGYAGGSKMTADYNMVSTGTTGHAESVEIKYDPKKISYGKILQIFFSVVHDPTQLNRQGPDTGTQYRSAIFTTNDEQKKVAEAYISQLNAAKVYKKPIVTKISALDAFFPAEAYHQDYLTLHPNQPYIAYNDIPKVENLKKIFAENYVEKPTLVSARVTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 22 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 32 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 109 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 110 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 149 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 150 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 151 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 152 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 156 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 231 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 242 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 243 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 246 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 253 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 256 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 260 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 261 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 262 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 263 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 264 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 269 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 273 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 274 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 279 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 280 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 281 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 282 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 283 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 284 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 285 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 287 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 288 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 289 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 290 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 291 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 292 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 293 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 296 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 297 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 298 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 299 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 300 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 301 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 302 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 303 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 304 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 305 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 306 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 307 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 308 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 311 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 312 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 389 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 390 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 391 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 392 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 393 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 396 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 397 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 398 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 402 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 438 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 442 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 443 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 444 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 445 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 446 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 447 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 448 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 453 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 454 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 457 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 460 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 461 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 463 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 464 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 465 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 466 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 467 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 468 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 470 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 471 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 472 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 473 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 475 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 476 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 477 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 478 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 480 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 481 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 482 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 483 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 484 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 485 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 486 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 487 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 488 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 489 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 490 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 491 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 492 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 493 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 494 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 495 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 497 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 498 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 499 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 500 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 501 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 502 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 504 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 506 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 508 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 509 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 510 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 511 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 512 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 513 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 514 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 515 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 516 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 517 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 518 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 519 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 520 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 521 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 522 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 523 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 524 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 525 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 526 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 527 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 528 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 529 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 530 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 531 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 532 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 533 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 534 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 535 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 536 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 537 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 538 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 539 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 540 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 541 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 542 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 543 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 544 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 545 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 546 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 547 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 548 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 549 | 2791355199 | |||
| 550 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 551 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 552 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 553 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 554 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 555 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 556 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 557 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 558 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 559 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 560 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 561 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 562 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 563 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 564 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 565 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 566 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 567 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 568 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 569 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 570 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 571 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 572 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 573 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 574 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 575 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 576 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 577 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 578 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 579 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 580 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 581 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 582 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 583 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 584 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 585 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 586 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 587 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 588 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 589 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 590 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 591 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 592 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 593 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 594 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 595 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 596 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 597 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 598 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 599 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 600 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 601 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 602 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 603 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 604 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 605 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 606 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 607 | 2904699407 | |||
| 608 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 609 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 610 | 2906610324 | |||
| 611 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 612 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 613 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 614 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 615 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 616 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 617 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 618 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 619 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 620 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 621 | 2922368715 | |||
| 622 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 623 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 624 | 2922425934 | |||
| 625 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 626 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 627 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 628 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 629 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 630 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 631 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 632 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 633 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 634 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 635 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 636 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 637 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 638 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 639 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 640 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 641 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 642 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 643 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 644 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 645 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 646 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 647 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 648 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 649 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 650 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 651 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 652 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 653 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 654 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 655 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 656 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 657 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 658 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 659 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 660 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 661 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 662 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 663 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 664 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 665 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 666 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 667 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 668 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 669 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 670 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 671 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 672 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 673 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 674 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 675 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 676 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 677 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 678 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 679 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 680 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 681 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 682 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 683 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 684 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 685 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 686 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 687 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 688 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 689 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 690 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 691 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 692 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 693 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 694 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 695 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 696 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 697 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 698 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 699 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 700 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 701 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 702 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 703 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 704 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 705 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 706 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 707 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 708 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 709 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 710 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 711 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 712 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 713 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 714 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 715 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 716 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 717 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 718 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 719 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 720 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 721 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 722 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 723 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 724 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 725 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 726 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 727 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 728 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 729 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 730 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 731 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 732 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 733 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.26 |
| Metatranscriptomes | 1.51 |
| Isolates | 15.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.92 |
| Nodule | 11.21 |
| Rhizoplane | 6.02 |
| Rhizosphere | 58.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0310543 | 3300048905 | Bacteria | 1486 |
| 2 | LJQas_1006154 | 3300000549 | Bacteria | 1502 |
| 3 | JGI24740J21852_10000767 | 3300001979 | Bacteria | 14071 |
| 4 | JGI25155J39150_1000198 | 3300002704 | Bacteria | 25200 |
| 5 | JGI25155J39150_1000408 | 3300002704 | Bacteria | 11785 |
| 6 | JGI25156J39149_1000057 | 3300002705 | Bacteria | 86392 |
| 7 | JGI25156J39149_1002321 | 3300002705 | Bacteria | 6937 |
| 8 | JGI25162J39368_1000277 | 3300002737 | Bacteria | 48696 |
| 9 | JGI25162J39368_1003686 | 3300002737 | Bacteria | 4182 |
| 10 | JGI25154J39366_1000087 | 3300002738 | Bacteria | 86392 |
| 11 | JGI25154J39366_1000925 | 3300002738 | Bacteria | 12344 |
| 12 | JGI25157J39369_1000336 | 3300002741 | Bacteria | 33359 |
| 13 | JGI25152J39213_1002781 | 3300002773 | Bacteria | 6332 |
| 14 | JGI25159J45721_1001498 | 3300002987 | Bacteria | 9580 |
| 15 | Ga0006778J45830_1005206 | 3300003162 | Bacteria | 1262 |
| 16 | Ga0006778J45830_1037934 | 3300003162 | Bacteria | 857 |
| 17 | JGI25406J46586_10000042 | 3300003203 | Bacteria | 56211 |
| 18 | JGI25406J46586_10001462 | 3300003203 | Bacteria | 11132 |
| 19 | JGI25406J46586_10029632 | 3300003203 | Bacteria | 2068 |
| 20 | JGI25165J46597_1003489 | 3300003214 | Bacteria | 3875 |
| 21 | JGI25165J46597_1004533 | 3300003214 | Bacteria | 2945 |
| 22 | JGI25153J46596_10001736 | 3300003215 | Bacteria | 12940 |
| 23 | JGI25153J46596_10003826 | 3300003215 | Bacteria | 8296 |
| 24 | JGI25153J46596_10004140 | 3300003215 | Bacteria | 7883 |
| 25 | JGI25153J46596_10005975 | 3300003215 | Bacteria | 6266 |
| 26 | JGI25153J46596_10011700 | 3300003215 | Bacteria | 3855 |
| 27 | JGI25153J46596_10038013 | 3300003215 | Bacteria | 1523 |
| 28 | JGI25160J50197_1002670 | 3300003354 | Bacteria | 8209 |
| 29 | JGI25160J50197_1009335 | 3300003354 | Bacteria | 3650 |
| 30 | JGI25160J50197_1029710 | 3300003354 | Bacteria | 1439 |
| 31 | Ga0007417J51691_1021109 | 3300003544 | Bacteria | 964 |
| 32 | Ga0006781J51513_1004680 | 3300003568 | Bacteria | 1226 |
| 33 | Ga0007410J51695_1023793 | 3300003574 | Bacteria | 830 |
| 34 | Ga0007416J51690_1011819 | 3300003577 | Bacteria | 1234 |
| 35 | Ga0007429J51699_1006648 | 3300003579 | Bacteria | 1228 |
| 36 | JGI25404J52841_10016701 | 3300003659 | Bacteria | 1592 |
| 37 | JGI25404J52841_10027496 | 3300003659 | Bacteria | 1223 |
| 38 | JGI25404J52841_10058120 | 3300003659 | Bacteria | 811 |
| 39 | Ga0032354_1001469 | 3300003693 | Bacteria | 1355 |
| 40 | Ga0006780_1000642 | 3300003735 | Bacteria | 777 |
| 41 | Ga0055539_1013566 | 3300003752 | Bacteria | 998 |
| 42 | Ga0055532_1000016 | 3300003758 | Bacteria | 327509 |
| 43 | Ga0055524_1029581 | 3300003775 | Bacteria | 1616 |
| 44 | Ga0055528_1008660 | 3300003790 | Bacteria | 4325 |
| 45 | Ga0055531_10006809 | 3300003794 | Bacteria | 6380 |
| 46 | JGI25405J52794_10040334 | 3300003911 | Bacteria | 987 |
| 47 | Ga0055543_1005069 | 3300004625 | Bacteria | 3434 |
| 48 | Ga0058859_11354442 | 3300004798 | Bacteria | 939 |
| 49 | Ga0058861_12010056 | 3300004800 | Bacteria | 1175 |
| 50 | Ga0065165_1001376 | 3300005262 | Bacteria | 26733 |
| 51 | Ga0065165_1003381 | 3300005262 | Bacteria | 11283 |
| 52 | Ga0065165_1006721 | 3300005262 | Bacteria | 5908 |
| 53 | Ga0065165_1042564 | 3300005262 | Bacteria | 1339 |
| 54 | Ga0070683_100353009 | 3300005329 | Bacteria | 1400 |
| 55 | Ga0070670_100166969 | 3300005331 | Bacteria | 1909 |
| 56 | Ga0070677_10027820 | 3300005333 | Bacteria | 2131 |
| 57 | Ga0070666_10091775 | 3300005335 | Bacteria | 2087 |
| 58 | Ga0070666_10546164 | 3300005335 | Bacteria | 843 |
| 59 | Ga0070680_100011514 | 3300005336 | Bacteria | 6846 |
| 60 | Ga0070680_100088017 | 3300005336 | Bacteria | 2568 |
| 61 | Ga0070680_100308636 | 3300005336 | Bacteria | 1342 |
| 62 | Ga0070682_100025295 | 3300005337 | Bacteria | 3541 |
| 63 | Ga0068868_100117433 | 3300005338 | Bacteria | 2167 |
| 64 | Ga0068868_100288646 | 3300005338 | Bacteria | 1390 |
| 65 | Ga0068868_100504877 | 3300005338 | Bacteria | 1060 |
| 66 | Ga0070660_100359116 | 3300005339 | Bacteria | 1200 |
| 67 | Ga0070691_10062835 | 3300005341 | Bacteria | 1789 |
| 68 | Ga0070687_100241257 | 3300005343 | Bacteria | 1118 |
| 69 | Ga0070661_100238131 | 3300005344 | Bacteria | 1400 |
| 70 | Ga0070661_100353940 | 3300005344 | Bacteria | 1153 |
| 71 | Ga0070668_100027694 | 3300005347 | Bacteria | 4302 |
| 72 | Ga0070668_100034676 | 3300005347 | Bacteria | 3846 |
| 73 | Ga0070668_100273988 | 3300005347 | Bacteria | 1407 |
| 74 | Ga0070668_100312648 | 3300005347 | Bacteria | 1320 |
| 75 | Ga0070669_100141703 | 3300005353 | Bacteria | 1854 |
| 76 | Ga0070671_100045130 | 3300005355 | Bacteria | 3663 |
| 77 | Ga0070671_100070957 | 3300005355 | Bacteria | 2907 |
| 78 | Ga0070671_100200942 | 3300005355 | Bacteria | 1690 |
| 79 | Ga0070671_100273068 | 3300005355 | Bacteria | 1437 |
| 80 | Ga0070671_100640921 | 3300005355 | Bacteria | 920 |
| 81 | Ga0070674_100097673 | 3300005356 | Bacteria | 2133 |
| 82 | Ga0070673_100769279 | 3300005364 | Bacteria | 887 |
| 83 | Ga0070688_100013583 | 3300005365 | Bacteria | 4597 |
| 84 | Ga0070688_100154951 | 3300005365 | Bacteria | 1569 |
| 85 | Ga0070659_100052884 | 3300005366 | Bacteria | 3195 |
| 86 | Ga0070659_100214544 | 3300005366 | Bacteria | 1587 |
| 87 | Ga0070659_100330430 | 3300005366 | Bacteria | 1276 |
| 88 | Ga0070659_100519196 | 3300005366 | Bacteria | 1017 |
| 89 | Ga0070659_100691825 | 3300005366 | Bacteria | 881 |
| 90 | Ga0070667_100125652 | 3300005367 | Bacteria | 2235 |
| 91 | Ga0070709_10005526 | 3300005434 | Bacteria | 6844 |
| 92 | Ga0070709_10010952 | 3300005434 | Bacteria | 5037 |
| 93 | Ga0070709_10058749 | 3300005434 | Bacteria | 2440 |
| 94 | Ga0070709_10171116 | 3300005434 | Bacteria | 1518 |
| 95 | Ga0070714_100002233 | 3300005435 | Bacteria | 14249 |
| 96 | Ga0070714_100081991 | 3300005435 | Bacteria | 2809 |
| 97 | Ga0070714_100156494 | 3300005435 | Bacteria | 2058 |
| 98 | Ga0070714_100220629 | 3300005435 | Bacteria | 1742 |
| 99 | Ga0070713_100004820 | 3300005436 | Bacteria | 9135 |
| 100 | Ga0070713_100058748 | 3300005436 | Bacteria | 3209 |
| 101 | Ga0070713_100071226 | 3300005436 | Bacteria | 2937 |
| 102 | Ga0070713_100097470 | 3300005436 | Bacteria | 2541 |
| 103 | Ga0070713_100130356 | 3300005436 | Bacteria | 2216 |
| 104 | Ga0070713_100170583 | 3300005436 | Bacteria | 1949 |
| 105 | Ga0070710_10000549 | 3300005437 | Bacteria | 17726 |
| 106 | Ga0070711_100007048 | 3300005439 | Bacteria | 6817 |
| 107 | Ga0070711_100017942 | 3300005439 | Bacteria | 4511 |
| 108 | Ga0070711_100069372 | 3300005439 | Bacteria | 2480 |
| 109 | Ga0070700_100069003 | 3300005441 | Bacteria | 2249 |
| 110 | Ga0070663_100010930 | 3300005455 | Bacteria | 5673 |
| 111 | Ga0070663_100067660 | 3300005455 | Bacteria | 2592 |
| 112 | Ga0070663_100148879 | 3300005455 | Bacteria | 1793 |
| 113 | Ga0070663_100326240 | 3300005455 | Bacteria | 1236 |
| 114 | Ga0070663_100422958 | 3300005455 | Bacteria | 1093 |
| 115 | Ga0070678_100041320 | 3300005456 | Bacteria | 3268 |
| 116 | Ga0070678_100047311 | 3300005456 | Bacteria | 3090 |
| 117 | Ga0070678_100568549 | 3300005456 | Bacteria | 1008 |
| 118 | Ga0070662_100084819 | 3300005457 | Bacteria | 2367 |
| 119 | Ga0070662_100712441 | 3300005457 | Bacteria | 849 |
| 120 | Ga0070681_10087634 | 3300005458 | Bacteria | 3065 |
| 121 | Ga0070681_10295193 | 3300005458 | Bacteria | 1531 |
| 122 | Ga0068867_100952356 | 3300005459 | Bacteria | 775 |
| 123 | Ga0070685_10168476 | 3300005466 | Bacteria | 1402 |
| 124 | Ga0070685_10336700 | 3300005466 | Bacteria | 1028 |
| 125 | Ga0070706_100158402 | 3300005467 | Bacteria | 2114 |
| 126 | Ga0070707_100033994 | 3300005468 | Bacteria | 4863 |
| 127 | Ga0070707_100581791 | 3300005468 | Bacteria | 1082 |
| 128 | Ga0070699_100149816 | 3300005518 | Bacteria | 2063 |
| 129 | Ga0070684_100010958 | 3300005535 | Bacteria | 7208 |
| 130 | Ga0070697_100320031 | 3300005536 | Bacteria | 1336 |
| 131 | Ga0070697_100729571 | 3300005536 | Bacteria | 875 |
| 132 | Ga0068853_100011007 | 3300005539 | Bacteria | 7336 |
| 133 | Ga0068853_100387662 | 3300005539 | Bacteria | 1306 |
| 134 | Ga0068853_100540120 | 3300005539 | Bacteria | 1103 |
| 135 | Ga0070672_100219817 | 3300005543 | Bacteria | 1593 |
| 136 | Ga0070696_100086014 | 3300005546 | Bacteria | 2232 |
| 137 | Ga0070693_100372648 | 3300005547 | Bacteria | 983 |
| 138 | Ga0070665_100014804 | 3300005548 | Bacteria | 7830 |
| 139 | Ga0070665_100016255 | 3300005548 | Bacteria | 7465 |
| 140 | Ga0070665_100026397 | 3300005548 | Bacteria | 5850 |
| 141 | Ga0070665_100082234 | 3300005548 | Bacteria | 3226 |
| 142 | Ga0070665_100143198 | 3300005548 | Bacteria | 2394 |
| 143 | Ga0070665_100148314 | 3300005548 | Bacteria | 2348 |
| 144 | Ga0070665_100153970 | 3300005548 | Bacteria | 2301 |
| 145 | Ga0070665_100161902 | 3300005548 | Bacteria | 2239 |
| 146 | Ga0070665_100171758 | 3300005548 | Bacteria | 2169 |
| 147 | Ga0070665_100524084 | 3300005548 | Bacteria | 1197 |
| 148 | Ga0068855_100045608 | 3300005563 | Bacteria | 5184 |
| 149 | Ga0068855_100059386 | 3300005563 | Bacteria | 4475 |
| 150 | Ga0068855_100103063 | 3300005563 | Bacteria | 3284 |
| 151 | Ga0068855_100155264 | 3300005563 | Bacteria | 2601 |
| 152 | Ga0068855_100235166 | 3300005563 | Bacteria | 2049 |
| 153 | Ga0068855_100291329 | 3300005563 | Bacteria | 1809 |
| 154 | Ga0070664_100122248 | 3300005564 | Bacteria | 2280 |
| 155 | Ga0070664_100291013 | 3300005564 | Bacteria | 1475 |
| 156 | Ga0068857_100049570 | 3300005577 | Bacteria | 3725 |
| 157 | Ga0068857_100178355 | 3300005577 | Bacteria | 1933 |
| 158 | Ga0068854_100151272 | 3300005578 | Bacteria | 1790 |
| 159 | Ga0068854_100201872 | 3300005578 | Bacteria | 1563 |
| 160 | Ga0068856_100003313 | 3300005614 | Bacteria | 16364 |
| 161 | Ga0068856_100131687 | 3300005614 | Bacteria | 2506 |
| 162 | Ga0068856_100188069 | 3300005614 | Bacteria | 2079 |
| 163 | Ga0068856_100425696 | 3300005614 | Bacteria | 1347 |
| 164 | Ga0068856_100552487 | 3300005614 | Bacteria | 1173 |
| 165 | Ga0068852_100038969 | 3300005616 | Bacteria | 3998 |
| 166 | Ga0068852_100246511 | 3300005616 | Bacteria | 1710 |
| 167 | Ga0068852_100835030 | 3300005616 | Bacteria | 936 |
| 168 | Ga0068864_100069542 | 3300005618 | Bacteria | 3061 |
| 169 | Ga0068866_10111408 | 3300005718 | Bacteria | 1528 |
| 170 | Ga0068861_100168874 | 3300005719 | Bacteria | 1811 |
| 171 | Ga0068851_10011299 | 3300005834 | Bacteria | 4185 |
| 172 | Ga0068851_10244567 | 3300005834 | Bacteria | 1016 |
| 173 | Ga0068863_100267222 | 3300005841 | Bacteria | 1655 |
| 174 | Ga0068863_100301418 | 3300005841 | Bacteria | 1555 |
| 175 | Ga0068863_100390284 | 3300005841 | Bacteria | 1360 |
| 176 | Ga0068858_100073088 | 3300005842 | Bacteria | 3183 |
| 177 | Ga0068858_100094941 | 3300005842 | Bacteria | 2778 |
| 178 | Ga0068858_100476957 | 3300005842 | Bacteria | 1204 |
| 179 | Ga0068860_100000534 | 3300005843 | Bacteria | 46465 |
| 180 | Ga0068860_100153346 | 3300005843 | Bacteria | 2219 |
| 181 | Ga0068860_101072146 | 3300005843 | Bacteria | 825 |
| 182 | Ga0068862_100105017 | 3300005844 | Bacteria | 2476 |
| 183 | Ga0081455_10000815 | 3300005937 | Bacteria | 40097 |
| 184 | Ga0081455_10012165 | 3300005937 | Bacteria | 8597 |
| 185 | Ga0081455_10022180 | 3300005937 | Bacteria | 5941 |
| 186 | Ga0081540_1003580 | 3300005983 | Bacteria | 12204 |
| 187 | Ga0081540_1004327 | 3300005983 | Bacteria | 10875 |
| 188 | Ga0081540_1008358 | 3300005983 | Bacteria | 7233 |
| 189 | Ga0081540_1010413 | 3300005983 | Bacteria | 6302 |
| 190 | Ga0081540_1011157 | 3300005983 | Bacteria | 6030 |
| 191 | Ga0081540_1011347 | 3300005983 | Bacteria | 5960 |
| 192 | Ga0081540_1087692 | 3300005983 | Bacteria | 1378 |
| 193 | Ga0081540_1110169 | 3300005983 | Bacteria | 1166 |
| 194 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 195 | Ga0081539_10000958 | 3300005985 | Bacteria | 54105 |
| 196 | Ga0081539_10030928 | 3300005985 | Bacteria | 3310 |
| 197 | Ga0081539_10128426 | 3300005985 | Bacteria | 1249 |
| 198 | Ga0070717_10000884 | 3300006028 | Bacteria | 19823 |
| 199 | Ga0070717_10003176 | 3300006028 | Bacteria | 11737 |
| 200 | Ga0070717_10063343 | 3300006028 | Bacteria | 3068 |
| 201 | Ga0070717_10791037 | 3300006028 | Bacteria | 863 |
| 202 | Ga0075365_10000529 | 3300006038 | Bacteria | 14696 |
| 203 | Ga0075365_10059515 | 3300006038 | Bacteria | 2546 |
| 204 | Ga0075368_10195728 | 3300006042 | Bacteria | 854 |
| 205 | Ga0075363_100013678 | 3300006048 | Bacteria | 3944 |
| 206 | Ga0075363_100025950 | 3300006048 | Bacteria | 2994 |
| 207 | Ga0075363_100049181 | 3300006048 | Bacteria | 2244 |
| 208 | Ga0075364_10031891 | 3300006051 | Bacteria | 3385 |
| 209 | Ga0075364_10054185 | 3300006051 | Bacteria | 2623 |
| 210 | Ga0075364_10121089 | 3300006051 | Bacteria | 1751 |
| 211 | Ga0070715_10001749 | 3300006163 | Bacteria | 6464 |
| 212 | Ga0070716_100005320 | 3300006173 | Bacteria | 6223 |
| 213 | Ga0070716_100033588 | 3300006173 | Bacteria | 2807 |
| 214 | Ga0070716_100141225 | 3300006173 | Bacteria | 1536 |
| 215 | Ga0070716_100434674 | 3300006173 | Bacteria | 953 |
| 216 | Ga0070712_100024654 | 3300006175 | Bacteria | 3989 |
| 217 | Ga0070712_100857464 | 3300006175 | Bacteria | 782 |
| 218 | Ga0075362_10025311 | 3300006177 | Bacteria | 2525 |
| 219 | Ga0075362_10028330 | 3300006177 | Bacteria | 2405 |
| 220 | Ga0075362_10047595 | 3300006177 | Bacteria | 1910 |
| 221 | Ga0075367_10011261 | 3300006178 | Bacteria | 4725 |
| 222 | Ga0075367_10028491 | 3300006178 | Bacteria | 3186 |
| 223 | Ga0075367_10037617 | 3300006178 | Bacteria | 2813 |
| 224 | Ga0075367_10058666 | 3300006178 | Bacteria | 2290 |
| 225 | Ga0075367_10195637 | 3300006178 | Bacteria | 1262 |
| 226 | Ga0075369_10009378 | 3300006186 | Bacteria | 3801 |
| 227 | Ga0075369_10021528 | 3300006186 | Bacteria | 2651 |
| 228 | Ga0075369_10061887 | 3300006186 | Bacteria | 1634 |
| 229 | Ga0075366_10036160 | 3300006195 | Bacteria | 2911 |
| 230 | Ga0075366_10053729 | 3300006195 | Bacteria | 2393 |
| 231 | Ga0097621_100078434 | 3300006237 | Bacteria | 2744 |
| 232 | Ga0097621_100192342 | 3300006237 | Bacteria | 1767 |
| 233 | Ga0075370_10006177 | 3300006353 | Bacteria | 6008 |
| 234 | Ga0075370_10043189 | 3300006353 | Bacteria | 2547 |
| 235 | Ga0075370_10043400 | 3300006353 | Bacteria | 2541 |
| 236 | Ga0075370_10080200 | 3300006353 | Bacteria | 1875 |
| 237 | Ga0075370_10292859 | 3300006353 | Bacteria | 967 |
| 238 | Ga0068871_100050386 | 3300006358 | Bacteria | 3368 |
| 239 | Ga0068871_100347315 | 3300006358 | Bacteria | 1311 |
| 240 | Ga0075434_100006045 | 3300006871 | Bacteria | 11068 |
| 241 | Ga0099824_1013868 | 3300006942 | Bacteria | 8216 |
| 242 | Ga0099822_1054877 | 3300006943 | Bacteria | 1499 |
| 243 | Ga0099823_1032665 | 3300006944 | Bacteria | 4222 |
| 244 | Ga0099795_10024287 | 3300007788 | Bacteria | 2020 |
| 245 | Ga0099795_10029257 | 3300007788 | Bacteria | 1881 |
| 246 | Ga0105250_10071291 | 3300009092 | Bacteria | 1403 |
| 247 | Ga0105240_10000497 | 3300009093 | Bacteria | 72381 |
| 248 | Ga0105240_10025997 | 3300009093 | Bacteria | 7688 |
| 249 | Ga0105240_10042855 | 3300009093 | Bacteria | 5765 |
| 250 | Ga0105240_10098710 | 3300009093 | Bacteria | 3556 |
| 251 | Ga0105240_10146636 | 3300009093 | Bacteria | 2816 |
| 252 | Ga0105240_10339230 | 3300009093 | Bacteria | 1708 |
| 253 | Ga0105240_10574421 | 3300009093 | Bacteria | 1244 |
| 254 | Ga0105240_10619226 | 3300009093 | Bacteria | 1190 |
| 255 | Ga0111539_10004709 | 3300009094 | Bacteria | 17828 |
| 256 | Ga0111539_10392146 | 3300009094 | Bacteria | 1617 |
| 257 | Ga0105245_10025310 | 3300009098 | Bacteria | 5218 |
| 258 | Ga0105247_10137117 | 3300009101 | Bacteria | 1599 |
| 259 | Ga0105247_10363603 | 3300009101 | Bacteria | 1021 |
| 260 | Ga0105247_10490616 | 3300009101 | Bacteria | 893 |
| 261 | Ga0114129_10419060 | 3300009147 | Bacteria | 1761 |
| 262 | Ga0114129_10431581 | 3300009147 | Bacteria | 1731 |
| 263 | Ga0114129_11129443 | 3300009147 | Bacteria | 980 |
| 264 | Ga0114129_11206551 | 3300009147 | Bacteria | 942 |
| 265 | Ga0105243_10088252 | 3300009148 | Bacteria | 2548 |
| 266 | Ga0105241_10050926 | 3300009174 | Bacteria | 3157 |
| 267 | Ga0105242_10237267 | 3300009176 | Bacteria | 1637 |
| 268 | Ga0105242_10406877 | 3300009176 | Bacteria | 1271 |
| 269 | Ga0105248_10030134 | 3300009177 | Bacteria | 6056 |
| 270 | Ga0105248_10110038 | 3300009177 | Bacteria | 3106 |
| 271 | Ga0105248_10113191 | 3300009177 | Bacteria | 3060 |
| 272 | Ga0105237_10031990 | 3300009545 | Bacteria | 5328 |
| 273 | Ga0105237_10033065 | 3300009545 | Bacteria | 5239 |
| 274 | Ga0105237_10040649 | 3300009545 | Bacteria | 4689 |
| 275 | Ga0105237_10041954 | 3300009545 | Bacteria | 4614 |
| 276 | Ga0105237_10049749 | 3300009545 | Bacteria | 4212 |
| 277 | Ga0105237_10072458 | 3300009545 | Bacteria | 3438 |
| 278 | Ga0105237_10150599 | 3300009545 | Bacteria | 2323 |
| 279 | Ga0105237_10159053 | 3300009545 | Bacteria | 2257 |
| 280 | Ga0105237_10442143 | 3300009545 | Bacteria | 1306 |
| 281 | Ga0105238_10016659 | 3300009551 | Bacteria | 7445 |
| 282 | Ga0105238_10030444 | 3300009551 | Bacteria | 5494 |
| 283 | Ga0105238_10047369 | 3300009551 | Bacteria | 4335 |
| 284 | Ga0105238_10071229 | 3300009551 | Bacteria | 3474 |
| 285 | Ga0105238_10108125 | 3300009551 | Bacteria | 2762 |
| 286 | Ga0105238_10112637 | 3300009551 | Bacteria | 2700 |
| 287 | Ga0105238_10128331 | 3300009551 | Bacteria | 2514 |
| 288 | Ga0105238_10178649 | 3300009551 | Bacteria | 2099 |
| 289 | Ga0105238_10292697 | 3300009551 | Bacteria | 1611 |
| 290 | Ga0105249_10135725 | 3300009553 | Bacteria | 2354 |
| 291 | Ga0105249_10281311 | 3300009553 | Bacteria | 1662 |
| 292 | Ga0105249_11109305 | 3300009553 | Bacteria | 861 |
| 293 | Ga0123342_1013414 | 3300009766 | Bacteria | 8227 |
| 294 | Ga0099796_10008189 | 3300010159 | Bacteria | 2775 |
| 295 | Ga0099796_10047758 | 3300010159 | Bacteria | 1474 |
| 296 | Ga0105239_10144608 | 3300010375 | Bacteria | 2651 |
| 297 | Ga0105239_10567219 | 3300010375 | Bacteria | 1293 |
| 298 | Ga0105246_10062381 | 3300011119 | Bacteria | 2597 |
| 299 | Ga0105246_10280332 | 3300011119 | Bacteria | 1337 |
| 300 | Ga0105246_10297578 | 3300011119 | Bacteria | 1301 |
| 301 | Ga0157371_10024676 | 3300013102 | Bacteria | 4387 |
| 302 | Ga0157371_10100896 | 3300013102 | Bacteria | 2047 |
| 303 | Ga0157370_10017035 | 3300013104 | Bacteria | 7343 |
| 304 | Ga0157370_10029467 | 3300013104 | Bacteria | 5385 |
| 305 | Ga0157370_10230358 | 3300013104 | Bacteria | 1715 |
| 306 | Ga0157369_10013948 | 3300013105 | Bacteria | 9081 |
| 307 | Ga0157369_10014664 | 3300013105 | Bacteria | 8843 |
| 308 | Ga0157369_10026923 | 3300013105 | Bacteria | 6377 |
| 309 | Ga0157374_10007888 | 3300013296 | Bacteria | 9089 |
| 310 | Ga0157374_10022044 | 3300013296 | Bacteria | 5677 |
| 311 | Ga0157374_10047182 | 3300013296 | Bacteria | 3993 |
| 312 | Ga0157374_10347474 | 3300013296 | Bacteria | 1473 |
| 313 | Ga0157374_10752030 | 3300013296 | Bacteria | 989 |
| 314 | Ga0157378_10007047 | 3300013297 | Bacteria | 9813 |
| 315 | Ga0163162_10315157 | 3300013306 | Bacteria | 1697 |
| 316 | Ga0163162_10420843 | 3300013306 | Bacteria | 1468 |
| 317 | Ga0163162_10521253 | 3300013306 | Bacteria | 1318 |
| 318 | Ga0163162_10588232 | 3300013306 | Bacteria | 1240 |
| 319 | Ga0163162_10709274 | 3300013306 | Bacteria | 1127 |
| 320 | Ga0157372_10078452 | 3300013307 | Bacteria | 3731 |
| 321 | Ga0157372_10108336 | 3300013307 | Bacteria | 3179 |
| 322 | Ga0157372_10272871 | 3300013307 | Bacteria | 1966 |
| 323 | Ga0157375_10016901 | 3300013308 | Bacteria | 6572 |
| 324 | Ga0157375_10119355 | 3300013308 | Bacteria | 2745 |
| 325 | Ga0157375_10174904 | 3300013308 | Bacteria | 2296 |
| 326 | Ga0163163_10000003 | 3300014325 | Bacteria | 455102 |
| 327 | Ga0163163_10033749 | 3300014325 | Bacteria | 4953 |
| 328 | Ga0163163_10252399 | 3300014325 | Bacteria | 1814 |
| 329 | Ga0163163_10341237 | 3300014325 | Bacteria | 1553 |
| 330 | Ga0163163_10878467 | 3300014325 | Bacteria | 960 |
| 331 | Ga0157380_10858932 | 3300014326 | Bacteria | 930 |
| 332 | Ga0182008_10001323 | 3300014497 | Bacteria | 16876 |
| 333 | Ga0182008_10061172 | 3300014497 | Bacteria | 1856 |
| 334 | Ga0157379_10789002 | 3300014968 | Bacteria | 896 |
| 335 | Ga0157376_10109424 | 3300014969 | Bacteria | 2429 |
| 336 | Ga0157376_10590605 | 3300014969 | Bacteria | 1104 |
| 337 | Ga0182006_1087717 | 3300015261 | Bacteria | 1124 |
| 338 | Ga0163161_10071147 | 3300017792 | Bacteria | 2545 |
| 339 | Ga0163161_10245265 | 3300017792 | Bacteria | 1395 |
| 340 | Ga0197907_11028214 | 3300020069 | Bacteria | 1562 |
| 341 | Ga0197907_11371172 | 3300020069 | Bacteria | 1108 |
| 342 | Ga0206356_10790464 | 3300020070 | Bacteria | 1424 |
| 343 | Ga0206350_11646629 | 3300020080 | Bacteria | 1677 |
| 344 | Ga0206354_10070692 | 3300020081 | Bacteria | 947 |
| 345 | Ga0206354_10138454 | 3300020081 | Bacteria | 1087 |
| 346 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 347 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 348 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 349 | Ga0214543_1000564 | 3300021327 | Bacteria | 63531 |
| 350 | Ga0213874_10013003 | 3300021377 | Bacteria | 2147 |
| 351 | Ga0213874_10078758 | 3300021377 | Bacteria | 1064 |
| 352 | Ga0213874_10103166 | 3300021377 | Bacteria | 951 |
| 353 | Ga0213876_10046146 | 3300021384 | Bacteria | 2304 |
| 354 | Ga0213876_10086955 | 3300021384 | Bacteria | 1654 |
| 355 | Ga0213875_10097599 | 3300021388 | Bacteria | 1371 |
| 356 | Ga0213871_10016627 | 3300021441 | Bacteria | 1777 |
| 357 | Ga0224712_10030820 | 3300022467 | Bacteria | 1940 |
| 358 | Ga0224712_10064366 | 3300022467 | Bacteria | 1471 |
| 359 | Ga0224712_10070990 | 3300022467 | Bacteria | 1414 |
| 360 | Ga0224712_10139776 | 3300022467 | Bacteria | 1065 |
| 361 | Ga0209435_100016 | 3300025206 | Bacteria | 305566 |
| 362 | Ga0209435_100038 | 3300025206 | Bacteria | 120273 |
| 363 | Ga0209435_100096 | 3300025206 | Bacteria | 38561 |
| 364 | Ga0207672_1002024 | 3300025223 | Bacteria | 1297 |
| 365 | Ga0209147_100023 | 3300025229 | Bacteria | 437803 |
| 366 | Ga0209437_100080 | 3300025233 | Bacteria | 275402 |
| 367 | Ga0209258_100210 | 3300025242 | Bacteria | 117131 |
| 368 | Ga0209646_1000033 | 3300025246 | Bacteria | 369507 |
| 369 | Ga0209646_1000093 | 3300025246 | Bacteria | 183840 |
| 370 | Ga0209026_1000031 | 3300025250 | Bacteria | 325747 |
| 371 | Ga0209677_101880 | 3300025253 | Bacteria | 8513 |
| 372 | Ga0209677_106176 | 3300025253 | Bacteria | 2910 |
| 373 | Ga0209148_1000900 | 3300025254 | Bacteria | 20229 |
| 374 | Ga0209148_1004037 | 3300025254 | Bacteria | 3745 |
| 375 | Ga0209148_1023204 | 3300025254 | Bacteria | 990 |
| 376 | Ga0209759_1000045 | 3300025256 | Bacteria | 235654 |
| 377 | Ga0209759_1000248 | 3300025256 | Bacteria | 80537 |
| 378 | Ga0209129_1001529 | 3300025258 | Bacteria | 12772 |
| 379 | Ga0209233_1001052 | 3300025261 | Bacteria | 11545 |
| 380 | Ga0209233_1001098 | 3300025261 | Bacteria | 11109 |
| 381 | Ga0209233_1003397 | 3300025261 | Bacteria | 5614 |
| 382 | Ga0209233_1003422 | 3300025261 | Bacteria | 5592 |
| 383 | Ga0209455_1001412 | 3300025272 | Bacteria | 10889 |
| 384 | Ga0209455_1004740 | 3300025272 | Bacteria | 4367 |
| 385 | Ga0209455_1004957 | 3300025272 | Bacteria | 4224 |
| 386 | Ga0209673_1002499 | 3300025273 | Bacteria | 12641 |
| 387 | Ga0209673_1015590 | 3300025273 | Bacteria | 2877 |
| 388 | Ga0209025_1019148 | 3300025294 | Bacteria | 3824 |
| 389 | Ga0209564_1003825 | 3300025295 | Bacteria | 9742 |
| 390 | Ga0209564_1012222 | 3300025295 | Bacteria | 3761 |
| 391 | Ga0209564_1015496 | 3300025295 | Bacteria | 3094 |
| 392 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 393 | Ga0209758_1001188 | 3300025297 | Bacteria | 32870 |
| 394 | Ga0209758_1001605 | 3300025297 | Bacteria | 25827 |
| 395 | Ga0209758_1002945 | 3300025297 | Bacteria | 16357 |
| 396 | Ga0209758_1004134 | 3300025297 | Bacteria | 12396 |
| 397 | Ga0209758_1006083 | 3300025297 | Bacteria | 8879 |
| 398 | Ga0209758_1012239 | 3300025297 | Bacteria | 4826 |
| 399 | Ga0209256_1003962 | 3300025299 | Bacteria | 9737 |
| 400 | Ga0209256_1013127 | 3300025299 | Bacteria | 3100 |
| 401 | Ga0207426_1000354 | 3300025302 | Bacteria | 83734 |
| 402 | Ga0207426_1000447 | 3300025302 | Bacteria | 66140 |
| 403 | Ga0207426_1003427 | 3300025302 | Bacteria | 8639 |
| 404 | Ga0207426_1004280 | 3300025302 | Bacteria | 7069 |
| 405 | Ga0209257_1001262 | 3300025304 | Bacteria | 31134 |
| 406 | Ga0209257_1064884 | 3300025304 | Bacteria | 980 |
| 407 | Ga0207656_10020378 | 3300025321 | Bacteria | 2636 |
| 408 | Ga0207692_10001489 | 3300025898 | Bacteria | 8788 |
| 409 | Ga0207642_10143416 | 3300025899 | Bacteria | 1262 |
| 410 | Ga0207688_10090991 | 3300025901 | Bacteria | 1752 |
| 411 | Ga0207647_10019007 | 3300025904 | Bacteria | 4629 |
| 412 | Ga0207647_10095057 | 3300025904 | Bacteria | 1774 |
| 413 | Ga0207647_10128573 | 3300025904 | Bacteria | 1490 |
| 414 | Ga0207647_10186038 | 3300025904 | Bacteria | 1205 |
| 415 | Ga0207647_10215618 | 3300025904 | Bacteria | 1107 |
| 416 | Ga0207647_10249166 | 3300025904 | Bacteria | 1019 |
| 417 | Ga0207685_10003252 | 3300025905 | Bacteria | 3918 |
| 418 | Ga0207699_10006246 | 3300025906 | Bacteria | 5754 |
| 419 | Ga0207699_10035636 | 3300025906 | Bacteria | 2832 |
| 420 | Ga0207699_10412455 | 3300025906 | Bacteria | 963 |
| 421 | Ga0207645_10146099 | 3300025907 | Bacteria | 1542 |
| 422 | Ga0207654_10194396 | 3300025911 | Bacteria | 1332 |
| 423 | Ga0207707_10000827 | 3300025912 | Bacteria | 30384 |
| 424 | Ga0207707_10002566 | 3300025912 | Bacteria | 16278 |
| 425 | Ga0207707_10427961 | 3300025912 | Bacteria | 1134 |
| 426 | Ga0207695_10001268 | 3300025913 | Bacteria | 42942 |
| 427 | Ga0207695_10034685 | 3300025913 | Bacteria | 5483 |
| 428 | Ga0207695_10217169 | 3300025913 | Bacteria | 1820 |
| 429 | Ga0207695_10284239 | 3300025913 | Bacteria | 1548 |
| 430 | Ga0207671_10035618 | 3300025914 | Bacteria | 3692 |
| 431 | Ga0207671_10072431 | 3300025914 | Bacteria | 2572 |
| 432 | Ga0207671_10096180 | 3300025914 | Bacteria | 2237 |
| 433 | Ga0207671_10098760 | 3300025914 | Bacteria | 2209 |
| 434 | Ga0207671_10411173 | 3300025914 | Bacteria | 1076 |
| 435 | Ga0207693_10000565 | 3300025915 | Bacteria | 33481 |
| 436 | Ga0207693_10038353 | 3300025915 | Bacteria | 3774 |
| 437 | Ga0207693_10047306 | 3300025915 | Bacteria | 3380 |
| 438 | Ga0207693_10300721 | 3300025915 | Bacteria | 1257 |
| 439 | Ga0207663_10003532 | 3300025916 | Bacteria | 7669 |
| 440 | Ga0207663_10180633 | 3300025916 | Bacteria | 1507 |
| 441 | Ga0207663_10184937 | 3300025916 | Bacteria | 1491 |
| 442 | Ga0207663_10248595 | 3300025916 | Bacteria | 1308 |
| 443 | Ga0207663_10388809 | 3300025916 | Bacteria | 1064 |
| 444 | Ga0207660_10001934 | 3300025917 | Bacteria | 13823 |
| 445 | Ga0207660_10312940 | 3300025917 | Bacteria | 1252 |
| 446 | Ga0207662_10107841 | 3300025918 | Bacteria | 1733 |
| 447 | Ga0207657_10001315 | 3300025919 | Bacteria | 26383 |
| 448 | Ga0207657_10058186 | 3300025919 | Bacteria | 3327 |
| 449 | Ga0207657_10238645 | 3300025919 | Bacteria | 1452 |
| 450 | Ga0207652_10001089 | 3300025921 | Bacteria | 24596 |
| 451 | Ga0207652_10483385 | 3300025921 | Bacteria | 1115 |
| 452 | Ga0207646_10105609 | 3300025922 | Bacteria | 2526 |
| 453 | Ga0207694_10013374 | 3300025924 | Bacteria | 6181 |
| 454 | Ga0207694_10057271 | 3300025924 | Bacteria | 3029 |
| 455 | Ga0207694_10100380 | 3300025924 | Bacteria | 2293 |
| 456 | Ga0207694_10150477 | 3300025924 | Bacteria | 1875 |
| 457 | Ga0207694_10166699 | 3300025924 | Bacteria | 1782 |
| 458 | Ga0207650_10050383 | 3300025925 | Bacteria | 3079 |
| 459 | Ga0207650_10395791 | 3300025925 | Bacteria | 1143 |
| 460 | Ga0207650_10554119 | 3300025925 | Bacteria | 964 |
| 461 | Ga0207687_10216949 | 3300025927 | Bacteria | 1504 |
| 462 | Ga0207687_10261905 | 3300025927 | Bacteria | 1379 |
| 463 | Ga0207700_10001452 | 3300025928 | Bacteria | 13448 |
| 464 | Ga0207700_10003591 | 3300025928 | Bacteria | 9036 |
| 465 | Ga0207700_10074358 | 3300025928 | Bacteria | 2628 |
| 466 | Ga0207664_10027347 | 3300025929 | Bacteria | 4323 |
| 467 | Ga0207664_10076768 | 3300025929 | Bacteria | 2705 |
| 468 | Ga0207664_10372061 | 3300025929 | Bacteria | 1267 |
| 469 | Ga0207644_10098349 | 3300025931 | Bacteria | 2193 |
| 470 | Ga0207644_10195260 | 3300025931 | Bacteria | 1594 |
| 471 | Ga0207644_10300355 | 3300025931 | Bacteria | 1294 |
| 472 | Ga0207644_10360358 | 3300025931 | Bacteria | 1183 |
| 473 | Ga0207690_10047179 | 3300025932 | Bacteria | 2857 |
| 474 | Ga0207686_10423105 | 3300025934 | Bacteria | 1019 |
| 475 | Ga0207709_10127840 | 3300025935 | Bacteria | 1727 |
| 476 | Ga0207670_10133607 | 3300025936 | Bacteria | 1821 |
| 477 | Ga0207670_10314499 | 3300025936 | Bacteria | 1230 |
| 478 | Ga0207669_10259432 | 3300025937 | Bacteria | 1299 |
| 479 | Ga0207665_10000127 | 3300025939 | Bacteria | 50413 |
| 480 | Ga0207665_10029628 | 3300025939 | Bacteria | 3617 |
| 481 | Ga0207665_10154968 | 3300025939 | Bacteria | 1643 |
| 482 | Ga0207665_10174494 | 3300025939 | Bacteria | 1554 |
| 483 | Ga0207691_10077623 | 3300025940 | Bacteria | 2991 |
| 484 | Ga0207691_10198264 | 3300025940 | Bacteria | 1748 |
| 485 | Ga0207711_10114332 | 3300025941 | Bacteria | 2403 |
| 486 | Ga0207711_10127907 | 3300025941 | Bacteria | 2274 |
| 487 | Ga0207711_10786049 | 3300025941 | Bacteria | 887 |
| 488 | Ga0207689_10070761 | 3300025942 | Bacteria | 2866 |
| 489 | Ga0207661_10001422 | 3300025944 | Bacteria | 16129 |
| 490 | Ga0207661_10122812 | 3300025944 | Bacteria | 2213 |
| 491 | Ga0207661_10235943 | 3300025944 | Bacteria | 1621 |
| 492 | Ga0207679_10589751 | 3300025945 | Bacteria | 1000 |
| 493 | Ga0207667_10012575 | 3300025949 | Bacteria | 9738 |
| 494 | Ga0207667_10072969 | 3300025949 | Bacteria | 3567 |
| 495 | Ga0207667_10147895 | 3300025949 | Bacteria | 2418 |
| 496 | Ga0207667_10166711 | 3300025949 | Bacteria | 2264 |
| 497 | Ga0207667_10679273 | 3300025949 | Bacteria | 1033 |
| 498 | Ga0207712_10057465 | 3300025961 | Bacteria | 2745 |
| 499 | Ga0207712_10093050 | 3300025961 | Bacteria | 2224 |
| 500 | Ga0207712_10177224 | 3300025961 | Bacteria | 1671 |
| 501 | Ga0207668_10117877 | 3300025972 | Bacteria | 2004 |
| 502 | Ga0207668_10186470 | 3300025972 | Bacteria | 1640 |
| 503 | Ga0207640_10334363 | 3300025981 | Bacteria | 1211 |
| 504 | Ga0207658_10044511 | 3300025986 | Bacteria | 3232 |
| 505 | Ga0207658_10093331 | 3300025986 | Bacteria | 2340 |
| 506 | Ga0207677_10038365 | 3300026023 | Bacteria | 3140 |
| 507 | Ga0207677_10369299 | 3300026023 | Bacteria | 1208 |
| 508 | Ga0207703_10104559 | 3300026035 | Bacteria | 2406 |
| 509 | Ga0207639_10038223 | 3300026041 | Bacteria | 3569 |
| 510 | Ga0207639_10169613 | 3300026041 | Bacteria | 1847 |
| 511 | Ga0207639_10631308 | 3300026041 | Bacteria | 990 |
| 512 | Ga0207639_10943170 | 3300026041 | Bacteria | 807 |
| 513 | Ga0207678_10037444 | 3300026067 | Bacteria | 4218 |
| 514 | Ga0207678_10085373 | 3300026067 | Bacteria | 2698 |
| 515 | Ga0207678_10110846 | 3300026067 | Bacteria | 2341 |
| 516 | Ga0207678_10120047 | 3300026067 | Bacteria | 2243 |
| 517 | Ga0207708_10269013 | 3300026075 | Bacteria | 1378 |
| 518 | Ga0207702_10000325 | 3300026078 | Bacteria | 54690 |
| 519 | Ga0207702_10411177 | 3300026078 | Bacteria | 1306 |
| 520 | Ga0207641_10186155 | 3300026088 | Bacteria | 1905 |
| 521 | Ga0207641_10346921 | 3300026088 | Bacteria | 1414 |
| 522 | Ga0207641_10455359 | 3300026088 | Bacteria | 1237 |
| 523 | Ga0207648_10026143 | 3300026089 | Bacteria | 5191 |
| 524 | Ga0207648_10094964 | 3300026089 | Bacteria | 2607 |
| 525 | Ga0207674_10021123 | 3300026116 | Bacteria | 7018 |
| 526 | Ga0207674_10147250 | 3300026116 | Bacteria | 2313 |
| 527 | Ga0207675_100021098 | 3300026118 | Bacteria | 6070 |
| 528 | Ga0207675_100033884 | 3300026118 | Bacteria | 4759 |
| 529 | Ga0207675_100125057 | 3300026118 | Bacteria | 2436 |
| 530 | Ga0207683_10042552 | 3300026121 | Bacteria | 3967 |
| 531 | Ga0207683_10043308 | 3300026121 | Bacteria | 3934 |
| 532 | Ga0207683_10106205 | 3300026121 | Bacteria | 2511 |
| 533 | Ga0207683_10307777 | 3300026121 | Bacteria | 1450 |
| 534 | Ga0207683_10381410 | 3300026121 | Bacteria | 1296 |
| 535 | Ga0207683_10569160 | 3300026121 | Bacteria | 1048 |
| 536 | Ga0207698_10103666 | 3300026142 | Bacteria | 2365 |
| 537 | Ga0207698_10503482 | 3300026142 | Bacteria | 1179 |
| 538 | Ga0209389_1000021 | 3300027296 | Bacteria | 169506 |
| 539 | Ga0209389_1000086 | 3300027296 | Bacteria | 84925 |
| 540 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 541 | Ga0209489_100313 | 3300027361 | Bacteria | 85507 |
| 542 | Ga0209489_105143 | 3300027361 | Bacteria | 23183 |
| 543 | Ga0209700_100483 | 3300027363 | Bacteria | 74857 |
| 544 | Ga0209179_1001603 | 3300027512 | Bacteria | 2832 |
| 545 | Ga0209588_1005183 | 3300027671 | Bacteria | 3720 |
| 546 | Ga0209813_10073923 | 3300027866 | Bacteria | 1114 |
| 547 | Ga0207428_10000153 | 3300027907 | Bacteria | 94107 |
| 548 | Ga0207428_10098549 | 3300027907 | Bacteria | 2262 |
| 549 | Ga0268266_10001864 | 3300028379 | Bacteria | 23828 |
| 550 | Ga0268266_10006918 | 3300028379 | Bacteria | 10320 |
| 551 | Ga0268266_10014519 | 3300028379 | Bacteria | 6770 |
| 552 | Ga0268266_10062975 | 3300028379 | Bacteria | 3202 |
| 553 | Ga0268266_10317439 | 3300028379 | Bacteria | 1457 |
| 554 | Ga0268265_10218137 | 3300028380 | Bacteria | 1667 |
| 555 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 556 | Ga0268264_10067965 | 3300028381 | Bacteria | 3009 |
| 557 | Ga0268264_10155104 | 3300028381 | Bacteria | 2057 |
| 558 | Ga0265326_10059103 | 3300028558 | Bacteria | 1084 |
| 559 | Ga0265334_10024228 | 3300028573 | Bacteria | 2464 |
| 560 | Ga0265334_10090418 | 3300028573 | Bacteria | 1117 |
| 561 | Ga0265323_10002822 | 3300028653 | Bacteria | 7819 |
| 562 | Ga0265336_10005738 | 3300028666 | Bacteria | 4542 |
| 563 | Ga0307517_10000124 | 3300028786 | Bacteria | 115570 |
| 564 | Ga0307515_10009381 | 3300028794 | Bacteria | 18936 |
| 565 | Ga0265338_10001016 | 3300028800 | Bacteria | 47131 |
| 566 | Ga0265339_10001394 | 3300031249 | Bacteria | 17992 |
| 567 | Ga0265339_10054450 | 3300031249 | Bacteria | 2173 |
| 568 | Ga0265331_10102459 | 3300031250 | Bacteria | 1316 |
| 569 | Ga0307513_10153193 | 3300031456 | Bacteria | 2210 |
| 570 | Ga0307513_10648399 | 3300031456 | Bacteria | 763 |
| 571 | Ga0307408_100447596 | 3300031548 | Bacteria | 1120 |
| 572 | Ga0307508_10000063 | 3300031616 | Bacteria | 122536 |
| 573 | Ga0307508_10144279 | 3300031616 | Bacteria | 1985 |
| 574 | Ga0307508_10162486 | 3300031616 | Bacteria | 1837 |
| 575 | Ga0265314_10002593 | 3300031711 | Bacteria | 18286 |
| 576 | Ga0265314_10157186 | 3300031711 | Bacteria | 1387 |
| 577 | Ga0265342_10063479 | 3300031712 | Bacteria | 2171 |
| 578 | Ga0265342_10146097 | 3300031712 | Bacteria | 1316 |
| 579 | Ga0307516_10035746 | 3300031730 | Bacteria | 4980 |
| 580 | Ga0316045_107024 | 3300031815 | Bacteria | 1398 |
| 581 | Ga0307412_10231177 | 3300031911 | Bacteria | 1424 |
| 582 | Ga0307416_100721809 | 3300032002 | Bacteria | 1087 |
| 583 | Ga0307411_10102847 | 3300032005 | Bacteria | 2025 |
| 584 | Ga0307507_10033915 | 3300033179 | Bacteria | 5289 |
| 585 | Ga0307510_10047759 | 3300033180 | Bacteria | 4579 |
| 586 | Ga0307510_10067650 | 3300033180 | Bacteria | 3594 |
| 587 | Ga0307510_10079158 | 3300033180 | Bacteria | 3207 |
| 588 | Ga0307510_10179327 | 3300033180 | Bacteria | 1684 |
| 589 | Ga0315911_1000041 | 3300033442 | Bacteria | 50391 |
| 590 | Ga0373926_0055251 | 3300035083 | Bacteria | 1439 |
| 591 | Ga0373934_0016039 | 3300035086 | Bacteria | 2846 |
| 592 | Ga0373944_0038867 | 3300035089 | Bacteria | 1463 |
| 593 | Ga0373923_0079043 | 3300035111 | Bacteria | 1424 |
| 594 | Ga0373932_0038755 | 3300035112 | Bacteria | 1364 |
| 595 | Ga0373936_0008700 | 3300035113 | Bacteria | 3822 |
| 596 | Ga0373945_0097535 | 3300035116 | Bacteria | 1146 |
| 597 | Ga0373953_0011700 | 3300035117 | Bacteria | 3089 |
| 598 | Ga0373953_0017203 | 3300035117 | Bacteria | 2653 |
| 599 | Ga0373954_0002485 | 3300035118 | Bacteria | 7734 |
| 600 | Ga0373954_0002626 | 3300035118 | Bacteria | 7566 |
| 601 | Ga0373956_0064383 | 3300035119 | Bacteria | 1664 |
| 602 | Ga0373956_0108293 | 3300035119 | Bacteria | 1292 |
| 603 | Ga0373957_0007070 | 3300035120 | Bacteria | 3571 |
| 604 | Ga0373957_0202208 | 3300035120 | Bacteria | 828 |
| 605 | Ga0373960_0132965 | 3300035121 | Bacteria | 836 |
| 606 | Ga0373943_0023109 | 3300035170 | Bacteria | 2888 |
| 607 | Ga0373943_0033966 | 3300035170 | Bacteria | 2432 |
| 608 | Ga0373943_0169966 | 3300035170 | Bacteria | 1192 |
| 609 | Ga0373946_0079414 | 3300035171 | Bacteria | 1433 |
| 610 | Ga0373955_0003095 | 3300035172 | Bacteria | 7279 |
| 611 | Ga0373955_0029659 | 3300035172 | Bacteria | 2847 |
| 612 | Ga0373924_0007214 | 3300035410 | Bacteria | 4006 |
| 613 | Ga0373924_0011253 | 3300035410 | Bacteria | 3319 |
| 614 | Ga0373924_0144945 | 3300035410 | Bacteria | 1037 |
| 615 | Ga0373931_0045065 | 3300035691 | Bacteria | 2328 |
| 616 | Ga0373931_0464179 | 3300035691 | Bacteria | 812 |
| 617 | Ga0373935_0002137 | 3300035692 | Bacteria | 11210 |
| 618 | Ga0373935_0032712 | 3300035692 | Bacteria | 3232 |
| 619 | Ga0373935_0048301 | 3300035692 | Bacteria | 2694 |
| 620 | Ga0373935_0213405 | 3300035692 | Bacteria | 1338 |
| 621 | Ga0373927_0012355 | 3300035695 | Bacteria | 5683 |
| 622 | Ga0373927_0017005 | 3300035695 | Bacteria | 4792 |
| 623 | Ga0373927_0019441 | 3300035695 | Bacteria | 4454 |
| 624 | Ga0373927_0026674 | 3300035695 | Bacteria | 3776 |
| 625 | Ga0373927_0062498 | 3300035695 | Bacteria | 2408 |
| 626 | Ga0373927_0096048 | 3300035695 | Bacteria | 1926 |
| 627 | Ga0373927_0174958 | 3300035695 | Bacteria | 1408 |
| 628 | Ga0373933_0001835 | 3300035724 | Bacteria | 12297 |
| 629 | Ga0373933_0006528 | 3300035724 | Bacteria | 6352 |
| 630 | Ga0373933_0009573 | 3300035724 | Bacteria | 5291 |
| 631 | Ga0373933_0342226 | 3300035724 | Bacteria | 971 |
| 632 | Ga0373947_0033072 | 3300035725 | Bacteria | 3051 |
| 633 | Ga0373947_0054441 | 3300035725 | Bacteria | 2414 |
| 634 | Ga0373947_0066850 | 3300035725 | Bacteria | 2194 |
| 635 | Ga0373947_0159889 | 3300035725 | Bacteria | 1456 |
| 636 | Ga0373947_0275424 | 3300035725 | Bacteria | 1118 |
| 637 | Ga0373937_0089606 | 3300036401 | Bacteria | 2848 |
| 638 | Ga0373937_0232745 | 3300036401 | Bacteria | 1735 |
| 639 | Ga0373937_0798680 | 3300036401 | Bacteria | 891 |
| 640 | Ga0373925_0001877 | 3300037068 | Bacteria | 17454 |
| 641 | Ga0373925_0023145 | 3300037068 | Bacteria | 4533 |
| 642 | Ga0373925_0802946 | 3300037068 | Bacteria | 776 |
| 643 | Ga0395899_0050606 | 3300037312 | Bacteria | 3084 |
| 644 | Ga0395900_0009563 | 3300037418 | Bacteria | 9940 |
| 645 | Ga0395900_0025652 | 3300037418 | Bacteria | 6033 |
| 646 | Ga0395900_0226917 | 3300037418 | Bacteria | 1880 |
| 647 | Ga0395900_0502955 | 3300037418 | Bacteria | 1162 |
| 648 | Ga0395898_0040500 | 3300037466 | Bacteria | 4607 |
| 649 | Ga0395898_0051337 | 3300037466 | Bacteria | 4033 |
| 650 | Ga0395905_0005393 | 3300037471 | Bacteria | 13071 |
| 651 | Ga0436364_0322463 | 3300037853 | Bacteria | 1089 |
| 652 | Ga0436364_0421012 | 3300037853 | Bacteria | 2309 |
| 653 | Ga0395901_0180976 | 3300038443 | Bacteria | 2211 |
| 654 | Ga0395901_0437762 | 3300038443 | Bacteria | 1339 |
| 655 | Ga0436365_0108820 | 3300039437 | Bacteria | 5042 |
| 656 | Ga0436365_1361824 | 3300039437 | Bacteria | 1130 |
| 657 | Ga0436365_1936582 | 3300039437 | Bacteria | 2513 |
| 658 | Ga0436360_0582206 | 3300039438 | Bacteria | 8464 |
| 659 | Ga0436360_0620676 | 3300039438 | Bacteria | 2483 |
| 660 | Ga0436360_0701610 | 3300039438 | Bacteria | 2116 |
| 661 | Ga0436361_0568203 | 3300039447 | Bacteria | 1775 |
| 662 | Ga0436361_0657147 | 3300039447 | Bacteria | 3201 |
| 663 | Ga0436361_0757415 | 3300039447 | Bacteria | 3485 |
| 664 | Ga0436363_0158762 | 3300039450 | Bacteria | 1733 |
| 665 | Ga0436363_0665946 | 3300039450 | Bacteria | 1683 |
| 666 | Ga0436363_0827034 | 3300039450 | Bacteria | 9035 |
| 667 | Ga0436363_1336752 | 3300039450 | Bacteria | 955 |
| 668 | Ga0436363_1697773 | 3300039450 | Bacteria | 3701 |
| 669 | Ga0436362_0336193 | 3300039453 | Bacteria | 1827 |
| 670 | Ga0439465_0072875 | 3300041413 | Bacteria | 1153 |
| 671 | Ga0451802_0169913 | 3300041460 | Bacteria | 1324 |
| 672 | Ga0450918_020862 | 3300042531 | Bacteria | 1145 |
| 673 | Ga0451577_1064199 | 3300042876 | Bacteria | 725 |
| 674 | Ga0466972_0000268 | 3300044658 | Bacteria | 33053 |
| 675 | Ga0466972_0010885 | 3300044658 | Bacteria | 4564 |
| 676 | Ga0466972_0232184 | 3300044658 | Bacteria | 863 |
| 677 | Ga0466966_0052188 | 3300044684 | Bacteria | 2598 |
| 678 | Ga0466961_0000311 | 3300044693 | Bacteria | 32320 |
| 679 | Ga0466961_0042051 | 3300044693 | Bacteria | 2930 |
| 680 | Ga0466963_0454104 | 3300044694 | Bacteria | 904 |
| 681 | Ga0466971_0274903 | 3300044719 | Bacteria | 805 |
| 682 | Ga0466968_0002021 | 3300044735 | Bacteria | 7381 |
| 683 | Ga0466970_0012632 | 3300044765 | Bacteria | 4321 |
| 684 | Ga0466970_0186319 | 3300044765 | Bacteria | 1152 |
| 685 | Ga0466970_0353401 | 3300044765 | Bacteria | 834 |
| 686 | Ga0466960_0010159 | 3300044901 | Bacteria | 3904 |
| 687 | Ga0466959_0045853 | 3300045049 | Bacteria | 3218 |
| 688 | Ga0466959_0052297 | 3300045049 | Bacteria | 2992 |
| 689 | Ga0466959_0126327 | 3300045049 | Bacteria | 1815 |
| 690 | Ga0466959_0450840 | 3300045049 | Bacteria | 872 |
| 691 | Ga0451576_0015673 | 3300045051 | Bacteria | 8391 |
| 692 | Ga0466967_0016558 | 3300045976 | Bacteria | 5819 |
| 693 | Ga0466967_0082354 | 3300045976 | Bacteria | 2908 |
| 694 | Ga0466967_0262376 | 3300045976 | Bacteria | 1653 |
| 695 | Ga0466967_0353595 | 3300045976 | Bacteria | 1422 |
| 696 | Ga0495617_005474 | 3300046452 | Bacteria | 4498 |
| 697 | Ga0495592_0006884 | 3300046454 | Bacteria | 8491 |
| 698 | Ga0495592_0080289 | 3300046454 | Bacteria | 2360 |
| 699 | Ga0495592_0151879 | 3300046454 | Bacteria | 1601 |
| 700 | Ga0495603_0003074 | 3300046455 | Bacteria | 9910 |
| 701 | Ga0495603_0005432 | 3300046455 | Bacteria | 7608 |
| 702 | Ga0495603_0062571 | 3300046455 | Bacteria | 2197 |
| 703 | Ga0495603_0083049 | 3300046455 | Bacteria | 1876 |
| 704 | Ga0495603_0129051 | 3300046455 | Bacteria | 1473 |
| 705 | Ga0495603_0232934 | 3300046455 | Bacteria | 1061 |
| 706 | Ga0495629_0000532 | 3300046459 | Bacteria | 31675 |
| 707 | Ga0495629_0000913 | 3300046459 | Bacteria | 23749 |
| 708 | Ga0495629_0013169 | 3300046459 | Bacteria | 5971 |
| 709 | Ga0495638_0017480 | 3300046460 | Bacteria | 4777 |
| 710 | Ga0495638_0022023 | 3300046460 | Bacteria | 4188 |
| 711 | Ga0495641_0008153 | 3300046461 | Bacteria | 6432 |
| 712 | Ga0495651_0018793 | 3300046462 | Bacteria | 5354 |
| 713 | Ga0495651_0052377 | 3300046462 | Bacteria | 3144 |
| 714 | Ga0495651_0068600 | 3300046462 | Bacteria | 2703 |
| 715 | Ga0495651_0149459 | 3300046462 | Bacteria | 1686 |
| 716 | Ga0495651_0150046 | 3300046462 | Bacteria | 1681 |
| 717 | Ga0495651_0302379 | 3300046462 | Bacteria | 1072 |
| 718 | Ga0495653_0010069 | 3300046463 | Bacteria | 7734 |
| 719 | Ga0495653_0166213 | 3300046463 | Bacteria | 1527 |
| 720 | Ga0495650_0110791 | 3300046471 | Bacteria | 1020 |
| 721 | Ga0495580_0041291 | 3300046472 | Bacteria | 3290 |
| 722 | Ga0495580_0056230 | 3300046472 | Bacteria | 2771 |
| 723 | Ga0495582_0000331 | 3300046473 | Bacteria | 25765 |
| 724 | Ga0495582_0169322 | 3300046473 | Bacteria | 1243 |
| 725 | Ga0495605_0059800 | 3300046474 | Bacteria | 1829 |
| 726 | Ga0495605_0161109 | 3300046474 | Bacteria | 996 |
| 727 | Ga0495605_0216166 | 3300046474 | Bacteria | 830 |
| 728 | Ga0495639_0000147 | 3300046475 | Bacteria | 36171 |
| 729 | Ga0495639_0184197 | 3300046475 | Bacteria | 1017 |
| 730 | Ga0495662_0000716 | 3300046476 | Bacteria | 15801 |
| 731 | Ga0495662_0136179 | 3300046476 | Bacteria | 1208 |
| 732 | Ga0495664_0004013 | 3300046477 | Bacteria | 8034 |
| 733 | Ga0495664_0005574 | 3300046477 | Bacteria | 6920 |
| 734 | Ga0495664_0036527 | 3300046477 | Bacteria | 2896 |
| 735 | Ga0495664_0038112 | 3300046477 | Bacteria | 2837 |
| 736 | Ga0495664_0270126 | 3300046477 | Bacteria | 1028 |
| 737 | Ga0495594_0000113 | 3300046499 | Bacteria | 38231 |
| 738 | Ga0495594_0291170 | 3300046499 | Bacteria | 930 |
| 739 | Ga0495607_0165028 | 3300046501 | Bacteria | 1122 |
| 740 | Ga0495583_0090772 | 3300046506 | Bacteria | 1315 |
| 741 | Ga0495606_0005723 | 3300046507 | Bacteria | 11754 |
| 742 | Ga0495608_0004537 | 3300046511 | Bacteria | 9921 |
| 743 | Ga0495608_0009049 | 3300046511 | Bacteria | 6966 |
| 744 | Ga0495608_0077014 | 3300046511 | Bacteria | 2171 |
| 745 | Ga0495610_0031207 | 3300046512 | Bacteria | 2782 |
| 746 | Ga0495610_0038063 | 3300046512 | Bacteria | 2443 |
| 747 | Ga0495610_0129064 | 3300046512 | Bacteria | 1099 |
| 748 | Ga0495618_0010718 | 3300046514 | Bacteria | 5551 |
| 749 | Ga0495618_0016158 | 3300046514 | Bacteria | 4562 |
| 750 | Ga0495618_0059962 | 3300046514 | Bacteria | 2412 |
| 751 | Ga0495620_0044370 | 3300046515 | Bacteria | 1932 |
| 752 | Ga0495620_0119015 | 3300046515 | Bacteria | 1042 |
| 753 | Ga0495628_0001092 | 3300046516 | Bacteria | 24748 |
| 754 | Ga0495628_0062677 | 3300046516 | Bacteria | 2914 |
| 755 | Ga0495628_0206105 | 3300046516 | Bacteria | 1480 |
| 756 | Ga0495628_0239962 | 3300046516 | Bacteria | 1356 |
| 757 | Ga0495628_0245717 | 3300046516 | Bacteria | 1337 |
| 758 | Ga0495630_0004274 | 3300046517 | Bacteria | 10018 |
| 759 | Ga0495630_0096705 | 3300046517 | Bacteria | 2232 |
| 760 | Ga0495630_0579363 | 3300046517 | Bacteria | 860 |
| 761 | Ga0495631_0025217 | 3300046518 | Bacteria | 2740 |
| 762 | Ga0495632_0096435 | 3300046519 | Bacteria | 1397 |
| 763 | Ga0495632_0111837 | 3300046519 | Bacteria | 1282 |
| 764 | Ga0495637_0031199 | 3300046520 | Bacteria | 2359 |
| 765 | Ga0495643_0036114 | 3300046522 | Bacteria | 2717 |
| 766 | Ga0495643_0191416 | 3300046522 | Bacteria | 987 |
| 767 | Ga0495643_0201458 | 3300046522 | Bacteria | 955 |
| 768 | Ga0495648_0000776 | 3300046524 | Bacteria | 34006 |
| 769 | Ga0495648_0001514 | 3300046524 | Bacteria | 22778 |
| 770 | Ga0495648_0111763 | 3300046524 | Bacteria | 1485 |
| 771 | Ga0495642_0032875 | 3300046528 | Bacteria | 2083 |
| 772 | Ga0495652_0021351 | 3300046529 | Bacteria | 5758 |
| 773 | Ga0495652_0031369 | 3300046529 | Bacteria | 4655 |
| 774 | Ga0495652_0073625 | 3300046529 | Bacteria | 2843 |
| 775 | Ga0495652_0150525 | 3300046529 | Bacteria | 1819 |
| 776 | Ga0495652_0275783 | 3300046529 | Bacteria | 1234 |
| 777 | Ga0495654_0147632 | 3300046530 | Bacteria | 1042 |
| 778 | Ga0495665_0000291 | 3300046531 | Bacteria | 25361 |
| 779 | Ga0495665_0017301 | 3300046531 | Bacteria | 3878 |
| 780 | Ga0495640_0005851 | 3300046533 | Bacteria | 9760 |
| 781 | Ga0495640_0032424 | 3300046533 | Bacteria | 3722 |
| 782 | Ga0495640_0050334 | 3300046533 | Bacteria | 2870 |
| 783 | Ga0495640_0051488 | 3300046533 | Bacteria | 2830 |
| 784 | Ga0495587_0007337 | 3300046536 | Bacteria | 7146 |
| 785 | Ga0495587_0018944 | 3300046536 | Bacteria | 4265 |
| 786 | Ga0495587_0021240 | 3300046536 | Bacteria | 4003 |
| 787 | Ga0495587_0054532 | 3300046536 | Bacteria | 2356 |
| 788 | Ga0495598_0042422 | 3300046537 | Bacteria | 1335 |
| 789 | Ga0495609_0072648 | 3300046538 | Bacteria | 1510 |
| 790 | Ga0495597_0133670 | 3300046542 | Bacteria | 1027 |
| 791 | Ga0495645_0006636 | 3300046543 | Bacteria | 8039 |
| 792 | Ga0495645_0006977 | 3300046543 | Bacteria | 7853 |
| 793 | Ga0495645_0037792 | 3300046543 | Bacteria | 3520 |
| 794 | Ga0495622_0004379 | 3300046557 | Bacteria | 6576 |
| 795 | Ga0495622_0009802 | 3300046557 | Bacteria | 4429 |
| 796 | Ga0495633_0139616 | 3300046558 | Bacteria | 1120 |
| 797 | Ga0495667_0014817 | 3300046559 | Bacteria | 5269 |
| 798 | Ga0495667_0038192 | 3300046559 | Bacteria | 3198 |
| 799 | Ga0495667_0063781 | 3300046559 | Bacteria | 2411 |
| 800 | Ga0495667_0158948 | 3300046559 | Bacteria | 1454 |
| 801 | Ga0495667_0338480 | 3300046559 | Bacteria | 951 |
| 802 | Ga0495668_0053955 | 3300046616 | Bacteria | 2222 |
| 803 | Ga0495668_0216692 | 3300046616 | Bacteria | 1048 |
| 804 | Ga0495634_0003174 | 3300046642 | Bacteria | 13304 |
| 805 | Ga0495634_0011850 | 3300046642 | Bacteria | 6337 |
| 806 | Ga0495634_0226375 | 3300046642 | Bacteria | 1152 |
| 807 | Ga0495611_0017586 | 3300046648 | Bacteria | 3059 |
| 808 | Ga0495625_0000888 | 3300046660 | Bacteria | 40400 |
| 809 | Ga0495625_0077443 | 3300046660 | Bacteria | 2323 |
| 810 | Ga0495625_0357388 | 3300046660 | Bacteria | 921 |
| 811 | Ga0495635_0000491 | 3300046663 | Bacteria | 24925 |
| 812 | Ga0495635_0007428 | 3300046663 | Bacteria | 7647 |
| 813 | Ga0495635_0028493 | 3300046663 | Bacteria | 3882 |
| 814 | Ga0495635_0178771 | 3300046663 | Bacteria | 1442 |
| 815 | Ga0495659_0019004 | 3300046664 | Bacteria | 2296 |
| 816 | Ga0495659_0080509 | 3300046664 | Bacteria | 1235 |
| 817 | Ga0495588_0012745 | 3300046674 | Bacteria | 3984 |
| 818 | Ga0495588_0057864 | 3300046674 | Bacteria | 2003 |
| 819 | Ga0495588_0208071 | 3300046674 | Bacteria | 1033 |
| 820 | Ga0495657_0011578 | 3300046675 | Bacteria | 6590 |
| 821 | Ga0495657_0021093 | 3300046675 | Bacteria | 4678 |
| 822 | Ga0495657_0023411 | 3300046675 | Bacteria | 4414 |
| 823 | Ga0495657_0176096 | 3300046675 | Bacteria | 1315 |
| 824 | Ga0495599_0019185 | 3300046678 | Bacteria | 4263 |
| 825 | Ga0495599_0023100 | 3300046678 | Bacteria | 3886 |
| 826 | Ga0495599_0078126 | 3300046678 | Bacteria | 2066 |
| 827 | Ga0495599_0122084 | 3300046678 | Bacteria | 1619 |
| 828 | Ga0495623_0115298 | 3300046679 | Bacteria | 1624 |
| 829 | Ga0495623_0120508 | 3300046679 | Bacteria | 1579 |
| 830 | Ga0495646_0031381 | 3300046680 | Bacteria | 3311 |
| 831 | Ga0495646_0040428 | 3300046680 | Bacteria | 2872 |
| 832 | Ga0495646_0049680 | 3300046680 | Bacteria | 2545 |
| 833 | Ga0495646_0165379 | 3300046680 | Bacteria | 1222 |
| 834 | Ga0495646_0254712 | 3300046680 | Bacteria | 939 |
| 835 | Ga0495647_0007692 | 3300046681 | Bacteria | 3618 |
| 836 | Ga0495647_0016960 | 3300046681 | Bacteria | 2572 |
| 837 | Ga0495647_0042172 | 3300046681 | Bacteria | 1741 |
| 838 | Ga0495658_0001211 | 3300046683 | Bacteria | 13552 |
| 839 | Ga0495658_0007033 | 3300046683 | Bacteria | 5551 |
| 840 | Ga0495658_0327898 | 3300046683 | Bacteria | 971 |
| 841 | Ga0495613_0002051 | 3300046689 | Bacteria | 15316 |
| 842 | Ga0495613_0104978 | 3300046689 | Bacteria | 2040 |
| 843 | Ga0495613_0109386 | 3300046689 | Bacteria | 1993 |
| 844 | Ga0495613_0249616 | 3300046689 | Bacteria | 1239 |
| 845 | Ga0495624_0008987 | 3300046690 | Bacteria | 6944 |
| 846 | Ga0495624_0053556 | 3300046690 | Bacteria | 2547 |
| 847 | Ga0495624_0242967 | 3300046690 | Bacteria | 1089 |
| 848 | Ga0495624_0304827 | 3300046690 | Bacteria | 960 |
| 849 | Ga0495600_0008599 | 3300046809 | Bacteria | 6279 |
| 850 | Ga0495600_0080311 | 3300046809 | Bacteria | 2129 |
| 851 | Ga0495600_0103729 | 3300046809 | Bacteria | 1853 |
| 852 | Ga0495581_0000620 | 3300047315 | Bacteria | 18623 |
| 853 | Ga0495581_0025894 | 3300047315 | Bacteria | 3402 |
| 854 | Ga0495581_0154759 | 3300047315 | Bacteria | 1340 |
| 855 | Ga0495581_0229963 | 3300047315 | Bacteria | 1085 |
| 856 | Ga0495604_0005882 | 3300047317 | Bacteria | 9725 |
| 857 | Ga0495604_0034678 | 3300047317 | Bacteria | 3992 |
| 858 | Ga0495604_0147868 | 3300047317 | Bacteria | 1673 |
| 859 | Ga0495674_0001226 | 3300047319 | Bacteria | 24884 |
| 860 | Ga0495674_0004909 | 3300047319 | Bacteria | 12856 |
| 861 | Ga0495674_0023635 | 3300047319 | Bacteria | 5661 |
| 862 | Ga0495674_0074047 | 3300047319 | Bacteria | 2934 |
| 863 | Ga0495674_0111936 | 3300047319 | Bacteria | 2313 |
| 864 | Ga0495672_0088113 | 3300047320 | Bacteria | 1712 |
| 865 | Ga0495672_0224730 | 3300047320 | Bacteria | 925 |
| 866 | Ga0495672_0242940 | 3300047320 | Bacteria | 878 |
| 867 | Ga0495676_0044749 | 3300047321 | Bacteria | 3610 |
| 868 | Ga0495676_0111442 | 3300047321 | Bacteria | 2007 |
| 869 | Ga0495676_0145248 | 3300047321 | Bacteria | 1695 |
| 870 | Ga0495676_0216065 | 3300047321 | Bacteria | 1324 |
| 871 | Ga0495676_0417388 | 3300047321 | Bacteria | 888 |
| 872 | Ga0495680_0006961 | 3300047322 | Bacteria | 10433 |
| 873 | Ga0495680_0025019 | 3300047322 | Bacteria | 4944 |
| 874 | Ga0495680_0095272 | 3300047322 | Bacteria | 2225 |
| 875 | Ga0495683_0188214 | 3300047323 | Bacteria | 938 |
| 876 | Ga0495675_0005368 | 3300047444 | Bacteria | 7809 |
| 877 | Ga0495675_0016604 | 3300047444 | Bacteria | 4658 |
| 878 | Ga0495675_0039087 | 3300047444 | Bacteria | 3021 |
| 879 | Ga0495685_152001 | 3300047447 | Bacteria | 752 |
| 880 | Ga0495673_0038526 | 3300047469 | Bacteria | 2174 |
| 881 | Ga0495673_0042363 | 3300047469 | Bacteria | 2044 |
| 882 | Ga0495673_0043580 | 3300047469 | Bacteria | 2007 |
| 883 | Ga0495684_0000897 | 3300047471 | Bacteria | 24092 |
| 884 | Ga0495684_0052148 | 3300047471 | Bacteria | 3121 |
| 885 | Ga0495684_0172219 | 3300047471 | Bacteria | 1609 |
| 886 | Ga0495686_0018504 | 3300047472 | Bacteria | 4672 |
| 887 | Ga0495686_0051010 | 3300047472 | Bacteria | 2598 |
| 888 | Ga0495686_0060450 | 3300047472 | Bacteria | 2355 |
| 889 | Ga0495686_0127067 | 3300047472 | Bacteria | 1515 |
| 890 | Ga0495686_0226041 | 3300047472 | Bacteria | 1062 |
| 891 | Ga0495593_0000389 | 3300047673 | Bacteria | 24349 |
| 892 | Ga0495593_0113880 | 3300047673 | Bacteria | 1380 |
| 893 | Ga0495602_0000296 | 3300048088 | Bacteria | 45726 |
| 894 | Ga0495602_0013144 | 3300048088 | Bacteria | 8469 |
| 895 | Ga0495602_0048749 | 3300048088 | Bacteria | 3802 |
| 896 | Ga0495626_0044330 | 3300048091 | Bacteria | 2082 |
| 897 | Ga0496100_0012832 | 3300048903 | Bacteria | 4817 |
| 898 | Ga0496100_0046173 | 3300048903 | Bacteria | 2799 |
| 899 | Ga0496100_0067873 | 3300048903 | Bacteria | 2370 |
| 900 | Ga0496100_0288218 | 3300048903 | Bacteria | 1226 |
| 901 | Ga0496100_0305044 | 3300048903 | Bacteria | 1192 |
| 902 | Ga0496101_0059039 | 3300048904 | Bacteria | 2780 |
| 903 | Ga0496102_0052153 | 3300048905 | Bacteria | 3726 |
| 904 | Ga0496102_0092413 | 3300048905 | Bacteria | 2802 |
| 905 | Ga0496102_0093921 | 3300048905 | Bacteria | 2779 |
| 906 | Ga0496103_0087932 | 3300048906 | Bacteria | 1959 |
| 907 | Ga0496103_0425452 | 3300048906 | Bacteria | 852 |
| 908 | Ga0496103_0451226 | 3300048906 | Bacteria | 825 |
| 909 | Ga0496104_0009605 | 3300048907 | Bacteria | 8613 |
| 910 | Ga0496104_0011964 | 3300048907 | Bacteria | 7786 |
| 911 | Ga0496104_0031565 | 3300048907 | Bacteria | 4927 |
| 912 | Ga0496104_0057600 | 3300048907 | Bacteria | 3676 |
| 913 | Ga0496104_0115515 | 3300048907 | Bacteria | 2575 |
| 914 | Ga0496104_0158543 | 3300048907 | Bacteria | 2171 |
| 915 | Ga0496105_0023344 | 3300048908 | Bacteria | 5014 |
| 916 | Ga0496105_0036534 | 3300048908 | Bacteria | 4047 |
| 917 | Ga0496105_0054431 | 3300048908 | Bacteria | 3303 |
| 918 | Ga0496105_0069715 | 3300048908 | Bacteria | 2906 |
| 919 | Ga0496105_0110603 | 3300048908 | Bacteria | 2268 |
| 920 | Ga0496105_0157413 | 3300048908 | Bacteria | 1865 |
| 921 | Ga0496106_0006109 | 3300048909 | Bacteria | 8908 |
| 922 | Ga0496106_0011496 | 3300048909 | Bacteria | 6547 |
| 923 | Ga0496106_0011990 | 3300048909 | Bacteria | 6397 |
| 924 | Ga0496106_0135844 | 3300048909 | Bacteria | 1931 |
| 925 | Ga0496107_0018364 | 3300048910 | Bacteria | 4924 |
| 926 | Ga0496107_0028844 | 3300048910 | Bacteria | 3946 |
| 927 | Ga0496107_0033816 | 3300048910 | Bacteria | 3659 |
| 928 | Ga0496107_0083233 | 3300048910 | Bacteria | 2333 |
| 929 | Ga0496107_0089542 | 3300048910 | Bacteria | 2247 |
| 930 | Ga0496107_0265871 | 3300048910 | Bacteria | 1276 |
| 931 | Ga0496107_0296295 | 3300048910 | Bacteria | 1204 |
| 932 | Ga0496108_0000764 | 3300048911 | Bacteria | 25051 |
| 933 | Ga0496108_0009713 | 3300048911 | Bacteria | 7799 |
| 934 | Ga0496108_0028405 | 3300048911 | Bacteria | 4628 |
| 935 | Ga0496108_0270666 | 3300048911 | Bacteria | 1478 |
| 936 | Ga0496108_0743687 | 3300048911 | Bacteria | 849 |
| 937 | Ga0496109_0004357 | 3300048912 | Bacteria | 11828 |
| 938 | Ga0496109_0009522 | 3300048912 | Bacteria | 8280 |
| 939 | Ga0496109_0009612 | 3300048912 | Bacteria | 8246 |
| 940 | Ga0496109_0022973 | 3300048912 | Bacteria | 5530 |
| 941 | Ga0496109_0056204 | 3300048912 | Bacteria | 3591 |
| 942 | Ga0496109_0068250 | 3300048912 | Bacteria | 3259 |
| 943 | Ga0496109_0197123 | 3300048912 | Bacteria | 1893 |
| 944 | Ga0496109_0387945 | 3300048912 | Bacteria | 1319 |
| 945 | Ga0496110_0027878 | 3300048913 | Bacteria | 4846 |
| 946 | Ga0496110_0070020 | 3300048913 | Bacteria | 3107 |
| 947 | Ga0496110_0078286 | 3300048913 | Bacteria | 2943 |
| 948 | Ga0496110_0083574 | 3300048913 | Bacteria | 2848 |
| 949 | Ga0496110_0379849 | 3300048913 | Bacteria | 1287 |
| 950 | Ga0496110_0394115 | 3300048913 | Bacteria | 1262 |
| 951 | Ga0496110_0428776 | 3300048913 | Bacteria | 1205 |
| 952 | Ga0496111_0001105 | 3300048914 | Bacteria | 14931 |
| 953 | Ga0496111_0011921 | 3300048914 | Bacteria | 5874 |
| 954 | Ga0496111_0049580 | 3300048914 | Bacteria | 3028 |
| 955 | Ga0496111_0173121 | 3300048914 | Bacteria | 1604 |
| 956 | Ga0496112_0000052 | 3300048915 | Bacteria | 81285 |
| 957 | Ga0496112_0004212 | 3300048915 | Bacteria | 12130 |
| 958 | Ga0496112_0004915 | 3300048915 | Bacteria | 11438 |
| 959 | Ga0496112_0013107 | 3300048915 | Bacteria | 7650 |
| 960 | Ga0496112_0023568 | 3300048915 | Bacteria | 5882 |
| 961 | Ga0496112_0025554 | 3300048915 | Bacteria | 5671 |
| 962 | Ga0496112_0026567 | 3300048915 | Bacteria | 5574 |
| 963 | Ga0496112_0038470 | 3300048915 | Bacteria | 4671 |
| 964 | Ga0496112_0125607 | 3300048915 | Bacteria | 2536 |
| 965 | Ga0496113_0002366 | 3300048916 | Bacteria | 10928 |
| 966 | Ga0496113_0045330 | 3300048916 | Bacteria | 3261 |
| 967 | Ga0496113_0159709 | 3300048916 | Bacteria | 1781 |
| 968 | Ga0496113_0490827 | 3300048916 | Bacteria | 986 |
| 969 | Ga0496113_0759438 | 3300048916 | Bacteria | 772 |
| 970 | Ga0496114_0037653 | 3300048917 | Bacteria | 4001 |
| 971 | Ga0496114_0118920 | 3300048917 | Bacteria | 2271 |
| 972 | Ga0496114_0175359 | 3300048917 | Bacteria | 1870 |
| 973 | Ga0496114_0244542 | 3300048917 | Bacteria | 1578 |
| 974 | Ga0496114_0379366 | 3300048917 | Bacteria | 1251 |
| 975 | Ga0496115_0009221 | 3300048918 | Bacteria | 7326 |
| 976 | Ga0496115_0061653 | 3300048918 | Bacteria | 3024 |
| 977 | Ga0496115_0185245 | 3300048918 | Bacteria | 1720 |
| 978 | Ga0496115_0279239 | 3300048918 | Bacteria | 1371 |
| 979 | Ga0496116_0005214 | 3300048919 | Bacteria | 12168 |
| 980 | Ga0496116_0040362 | 3300048919 | Bacteria | 3214 |
| 981 | Ga0496117_0016824 | 3300048920 | Bacteria | 6145 |
| 982 | Ga0496117_0219159 | 3300048920 | Bacteria | 1060 |
| 983 | Ga0496117_0260907 | 3300048920 | Bacteria | 939 |
| 984 | Ga0496118_0019126 | 3300048921 | Bacteria | 6135 |
| 985 | Ga0496118_0072041 | 3300048921 | Bacteria | 2484 |
| 986 | Ga0496118_0197593 | 3300048921 | Bacteria | 1195 |
| 987 | Ga0496118_0263421 | 3300048921 | Bacteria | 971 |
| 988 | Ga0496119_0010049 | 3300048922 | Bacteria | 8006 |
| 989 | Ga0496119_0059543 | 3300048922 | Bacteria | 2293 |
| 990 | Ga0496119_0201349 | 3300048922 | Bacteria | 1030 |
| 991 | Ga0496120_0219816 | 3300048923 | Bacteria | 908 |
| 992 | Ga0496121_0001057 | 3300048924 | Bacteria | 48772 |
| 993 | Ga0496121_0001543 | 3300048924 | Bacteria | 38548 |
| 994 | Ga0496121_0009515 | 3300048924 | Bacteria | 11148 |
| 995 | Ga0496121_0017186 | 3300048924 | Bacteria | 7408 |
| 996 | Ga0496121_0020788 | 3300048924 | Bacteria | 6471 |
| 997 | Ga0496121_0047906 | 3300048924 | Bacteria | 3641 |
| 998 | Ga0496121_0054922 | 3300048924 | Bacteria | 3323 |
| 999 | Ga0496121_0094560 | 3300048924 | Bacteria | 2325 |
| 1000 | Ga0496121_0288475 | 3300048924 | Bacteria | 1119 |
| 1001 | Ga0496122_0000063 | 3300048925 | Bacteria | 241378 |
| 1002 | Ga0496122_0000375 | 3300048925 | Bacteria | 95681 |
| 1003 | Ga0496122_0057569 | 3300048925 | Bacteria | 2885 |
| 1004 | Ga0496123_0000117 | 3300048926 | Bacteria | 161679 |
| 1005 | Ga0496123_0000267 | 3300048926 | Bacteria | 104282 |
| 1006 | Ga0496123_0091273 | 3300048926 | Bacteria | 1807 |
| 1007 | Ga0496124_0127208 | 3300048927 | Bacteria | 2028 |
| 1008 | Ga0496124_0158870 | 3300048927 | Bacteria | 1764 |
| 1009 | Ga0496124_0197816 | 3300048927 | Bacteria | 1531 |
| 1010 | Ga0496124_0299559 | 3300048927 | Bacteria | 1162 |
| 1011 | Ga0496125_0000694 | 3300048928 | Bacteria | 55573 |
| 1012 | Ga0496125_0010987 | 3300048928 | Bacteria | 9087 |
| 1013 | Ga0496125_0015170 | 3300048928 | Bacteria | 7464 |
| 1014 | Ga0496125_0047355 | 3300048928 | Bacteria | 3597 |
| 1015 | Ga0496125_0105823 | 3300048928 | Bacteria | 2055 |
| 1016 | Ga0496125_0151299 | 3300048928 | Bacteria | 1593 |
| 1017 | Ga0496125_0152594 | 3300048928 | Bacteria | 1584 |
| 1018 | Ga0496125_0276335 | 3300048928 | Bacteria | 1043 |
| 1019 | Ga0496126_0005900 | 3300048929 | Bacteria | 13814 |
| 1020 | Ga0496126_0011116 | 3300048929 | Bacteria | 9349 |
| 1021 | Ga0496126_0016331 | 3300048929 | Bacteria | 7427 |
| 1022 | Ga0496126_0018583 | 3300048929 | Bacteria | 6881 |
| 1023 | Ga0496126_0037396 | 3300048929 | Bacteria | 4530 |
| 1024 | Ga0496126_0059599 | 3300048929 | Bacteria | 3437 |
| 1025 | Ga0496126_0077667 | 3300048929 | Bacteria | 2943 |
| 1026 | Ga0496126_0102738 | 3300048929 | Bacteria | 2498 |
| 1027 | Ga0496126_0104250 | 3300048929 | Bacteria | 2477 |
| 1028 | Ga0496126_0105850 | 3300048929 | Bacteria | 2455 |
| 1029 | Ga0496126_0135635 | 3300048929 | Bacteria | 2123 |
| 1030 | Ga0496126_0147005 | 3300048929 | Bacteria | 2023 |
| 1031 | Ga0496126_0312937 | 3300048929 | Bacteria | 1292 |
| 1032 | Ga0496126_0467551 | 3300048929 | Bacteria | 1013 |
| 1033 | Ga0496126_0730971 | 3300048929 | Bacteria | 766 |
| 1034 | Ga0495682_0042087 | 3300049460 | Bacteria | 1674 |
| 1035 | Ga0501031_0000655 | 3300049568 | Bacteria | 20505 |
| 1036 | Ga0501031_0001803 | 3300049568 | Bacteria | 13455 |
| 1037 | Ga0501031_0163876 | 3300049568 | Bacteria | 1453 |
| 1038 | Ga0501031_0428737 | 3300049568 | Bacteria | 855 |
| 1039 | Ga0501032_0000161 | 3300049569 | Bacteria | 54292 |
| 1040 | Ga0501032_0159161 | 3300049569 | Bacteria | 1483 |
| 1041 | Ga0501032_0182983 | 3300049569 | Bacteria | 1371 |
| 1042 | Ga0501033_0000672 | 3300049570 | Bacteria | 31550 |
| 1043 | Ga0501033_0001580 | 3300049570 | Bacteria | 20051 |
| 1044 | Ga0501033_0006379 | 3300049570 | Bacteria | 9241 |
| 1045 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 1046 | Ga0501034_0024633 | 3300049571 | Bacteria | 6120 |
| 1047 | Ga0501036_0000250 | 3300049572 | Bacteria | 36419 |
| 1048 | Ga0501036_0265193 | 3300049572 | Bacteria | 1438 |
| 1049 | Ga0501037_0000030 | 3300049573 | Bacteria | 136148 |
| 1050 | Ga0501037_0001059 | 3300049573 | Bacteria | 20381 |
| 1051 | Ga0501037_0033396 | 3300049573 | Bacteria | 3800 |
| 1052 | Ga0501037_0116571 | 3300049573 | Bacteria | 1922 |
| 1053 | Ga0501038_0000826 | 3300049574 | Bacteria | 27582 |
| 1054 | Ga0501038_0004208 | 3300049574 | Bacteria | 13371 |
| 1055 | Ga0501038_0057490 | 3300049574 | Bacteria | 3339 |
| 1056 | Ga0501038_0074567 | 3300049574 | Bacteria | 2870 |
| 1057 | Ga0501038_0205716 | 3300049574 | Bacteria | 1577 |
| 1058 | Ga0501039_0012015 | 3300049575 | Bacteria | 6598 |
| 1059 | Ga0501040_0500770 | 3300049576 | Bacteria | 876 |
| 1060 | Ga0501041_0151158 | 3300049577 | Bacteria | 1450 |
| 1061 | Ga0501042_0073646 | 3300049578 | Bacteria | 2443 |
| 1062 | Ga0501043_0000357 | 3300049579 | Bacteria | 41554 |
| 1063 | Ga0501043_0023451 | 3300049579 | Bacteria | 4839 |
| 1064 | Ga0501043_0579497 | 3300049579 | Bacteria | 831 |
| 1065 | Ga0501046_0023974 | 3300049580 | Bacteria | 5010 |
| 1066 | Ga0501046_0091706 | 3300049580 | Bacteria | 2336 |
| 1067 | Ga0501046_0326812 | 3300049580 | Bacteria | 1117 |
| 1068 | Ga0501047_0001531 | 3300049581 | Bacteria | 22591 |
| 1069 | Ga0501047_0013515 | 3300049581 | Bacteria | 7740 |
| 1070 | Ga0501047_0208882 | 3300049581 | Bacteria | 1811 |
| 1071 | Ga0501048_0000477 | 3300049582 | Bacteria | 27978 |
| 1072 | Ga0501067_0000068 | 3300049583 | Bacteria | 59338 |
| 1073 | Ga0501067_0083381 | 3300049583 | Bacteria | 1773 |
| 1074 | Ga0501068_0001116 | 3300049584 | Bacteria | 14202 |
| 1075 | Ga0501070_0002354 | 3300049586 | Bacteria | 16597 |
| 1076 | Ga0501070_0042138 | 3300049586 | Bacteria | 3802 |
| 1077 | Ga0501070_0204948 | 3300049586 | Bacteria | 1620 |
| 1078 | Ga0501072_0000835 | 3300049588 | Bacteria | 22655 |
| 1079 | Ga0501072_0258072 | 3300049588 | Bacteria | 1388 |
| 1080 | Ga0501072_0300148 | 3300049588 | Bacteria | 1277 |
| 1081 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 1082 | Ga0501073_0114093 | 3300049589 | Bacteria | 1873 |
| 1083 | Ga0501073_0222140 | 3300049589 | Bacteria | 1305 |
| 1084 | Ga0501073_0309438 | 3300049589 | Bacteria | 1090 |
| 1085 | Ga0501074_0000716 | 3300049590 | Bacteria | 20790 |
| 1086 | Ga0501079_0000251 | 3300049741 | Bacteria | 32618 |
| 1087 | Ga0501080_0004321 | 3300049742 | Bacteria | 12621 |
| 1088 | Ga0501080_0083252 | 3300049742 | Bacteria | 2972 |
| 1089 | Ga0501080_0311972 | 3300049742 | Bacteria | 1425 |
| 1090 | Ga0501083_0039237 | 3300049744 | Bacteria | 3216 |
| 1091 | Ga0501280_000775 | 3300049776 | Bacteria | 6972 |
| 1092 | Ga0501035_0000067 | 3300049822 | Bacteria | 129204 |
| 1093 | Ga0501035_0035252 | 3300049822 | Bacteria | 4541 |
| 1094 | Ga0501035_0036075 | 3300049822 | Bacteria | 4483 |
| 1095 | Ga0501035_0122045 | 3300049822 | Bacteria | 2277 |
| 1096 | Ga0501035_0329252 | 3300049822 | Bacteria | 1282 |
| 1097 | Ga0501035_0373790 | 3300049822 | Bacteria | 1189 |
| 1098 | Ga0501044_0002804 | 3300049823 | Bacteria | 19858 |
| 1099 | Ga0501044_0004858 | 3300049823 | Bacteria | 15027 |
| 1100 | Ga0501044_0064150 | 3300049823 | Bacteria | 3751 |
| 1101 | Ga0501044_0142659 | 3300049823 | Bacteria | 2383 |
| 1102 | Ga0501044_0622559 | 3300049823 | Bacteria | 971 |
| 1103 | Ga0501044_0645009 | 3300049823 | Bacteria | 948 |
| 1104 | Ga0501045_0164291 | 3300049824 | Bacteria | 1653 |
| 1105 | nmdc:mga03683_16686_c1 | 3300050489 | Bacteria | 2763 |
| 1106 | nmdc:mga03n38_533_c1 | 3300050490 | Bacteria | 9651 |
| 1107 | nmdc:mga00v17_23676_c1 | 3300050491 | Bacteria | 3554 |
| 1108 | nmdc:mga00v17_26685_c1 | 3300050491 | Bacteria | 3368 |
| 1109 | nmdc:mga00v17_43888_c1 | 3300050491 | Bacteria | 2694 |
| 1110 | nmdc:mga00v17_79611_c1 | 3300050491 | Bacteria | 2044 |
| 1111 | nmdc:mga0yw44_141158_c1 | 3300050492 | Bacteria | 1566 |
| 1112 | nmdc:mga0yw44_4925_c2 | 3300050492 | Bacteria | 3992 |
| 1113 | nmdc:mga0yw44_96245_c1 | 3300050492 | Bacteria | 1879 |
| 1114 | nmdc:mga0k408_120724_c1 | 3300050493 | Bacteria | 1552 |
| 1115 | nmdc:mga0k408_237919_c1 | 3300050493 | Bacteria | 1087 |
| 1116 | nmdc:mga0k408_274974_c1 | 3300050493 | Bacteria | 1005 |
| 1117 | nmdc:mga06z11_100307_c1 | 3300050494 | Bacteria | 1587 |
| 1118 | nmdc:mga06z11_21201_c1 | 3300050494 | Bacteria | 3016 |
| 1119 | nmdc:mga06z11_250804_c1 | 3300050494 | Bacteria | 1042 |
| 1120 | nmdc:mga06z11_345722_c1 | 3300050494 | Bacteria | 890 |
| 1121 | nmdc:mga06z11_35246_c1 | 3300050494 | Bacteria | 2462 |
| 1122 | nmdc:mga07m45_139324_c1 | 3300050496 | Bacteria | 1405 |
| 1123 | nmdc:mga07m45_2114_c1 | 3300050496 | Bacteria | 9242 |
| 1124 | nmdc:mga07m45_241183_c1 | 3300050496 | Bacteria | 1052 |
| 1125 | nmdc:mga07m45_40194_c1 | 3300050496 | Bacteria | 2617 |
| 1126 | nmdc:mga05p37_734481_c1 | 3300050507 | Bacteria | 1091 |
| 1127 | nmdc:mga0qj67_227519_c1 | 3300050509 | Bacteria | 1513 |
| 1128 | nmdc:mga08y16_34_c1 | 3300050511 | Bacteria | 164092 |
| 1129 | nmdc:mga0n895_586141_c1 | 3300050512 | Bacteria | 1118 |
| 1130 | nmdc:mga0n895_8338_c1 | 3300050512 | Bacteria | 8968 |
| 1131 | nmdc:mga08x19_220984_c1 | 3300050514 | Bacteria | 1301 |
| 1132 | nmdc:mga0sz30_10116_c1 | 3300050516 | Bacteria | 3607 |
| 1133 | nmdc:mga0sz30_167649_c1 | 3300050516 | Bacteria | 974 |
| 1134 | Ga0495601_0000749 | 3300053077 | Bacteria | 17465 |
| 1135 | Ga0495601_0015596 | 3300053077 | Bacteria | 4593 |
| 1136 | Ga0495601_0134564 | 3300053077 | Bacteria | 1611 |
| 1137 | Ga0495601_0209693 | 3300053077 | Bacteria | 1273 |
| 1138 | Ga0495601_0374656 | 3300053077 | Bacteria | 924 |
| 1139 | Ga0495612_0000707 | 3300053078 | Bacteria | 13532 |
| 1140 | Ga0495612_0040544 | 3300053078 | Bacteria | 1897 |
| 1141 | Ga0495612_0061626 | 3300053078 | Bacteria | 1554 |
| 1142 | Ga0495612_0076464 | 3300053078 | Bacteria | 1402 |
| 1143 | Ga0495612_0241613 | 3300053078 | Bacteria | 802 |
| 1144 | Ga0500635_0007052 | 3300053080 | Bacteria | 3032 |
| 1145 | Ga0495595_0019377 | 3300053084 | Bacteria | 2951 |
| 1146 | Ga0495595_0020690 | 3300053084 | Bacteria | 2866 |
| 1147 | Ga0495595_0025669 | 3300053084 | Bacteria | 2613 |
| 1148 | Ga0495595_0029233 | 3300053084 | Bacteria | 2465 |
| 1149 | Ga0495595_0241509 | 3300053084 | Bacteria | 904 |
| 1150 | Ga0495619_0010830 | 3300053085 | Bacteria | 5738 |
| 1151 | Ga0495619_0039935 | 3300053085 | Bacteria | 3065 |
| 1152 | Ga0495619_0063210 | 3300053085 | Bacteria | 2466 |
| 1153 | Ga0495619_0117863 | 3300053085 | Bacteria | 1818 |
| 1154 | Ga0495619_0133930 | 3300053085 | Bacteria | 1704 |
| 1155 | Ga0495619_0447829 | 3300053085 | Bacteria | 890 |
| 1156 | Ga0500578_0155667 | 3300053086 | Bacteria | 1421 |
| 1157 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 1158 | Ga0500643_079769 | 3300053087 | Bacteria | 900 |
| 1159 | Ga0500644_0008381 | 3300053088 | Bacteria | 2728 |
| 1160 | Ga0500646_0041940 | 3300053090 | Bacteria | 1291 |
| 1161 | Ga0500651_0071542 | 3300053093 | Bacteria | 2158 |
| 1162 | Ga0500566_0000751 | 3300053094 | Bacteria | 18265 |
| 1163 | Ga0500566_0003091 | 3300053094 | Bacteria | 9947 |
| 1164 | Ga0500566_0105695 | 3300053094 | Bacteria | 1537 |
| 1165 | Ga0500566_0123505 | 3300053094 | Bacteria | 1393 |
| 1166 | Ga0500641_0001845 | 3300053096 | Bacteria | 7514 |
| 1167 | Ga0500641_0008013 | 3300053096 | Bacteria | 3765 |
| 1168 | Ga0500641_0067011 | 3300053096 | Bacteria | 1504 |
| 1169 | Ga0500641_0097233 | 3300053096 | Bacteria | 1261 |
| 1170 | Ga0500648_094847 | 3300053097 | Bacteria | 1666 |
| 1171 | Ga0500650_0004589 | 3300053098 | Bacteria | 5014 |
| 1172 | Ga0500555_008692 | 3300053103 | Bacteria | 2898 |
| 1173 | Ga0500556_0000238 | 3300053104 | Bacteria | 44627 |
| 1174 | Ga0500556_0064238 | 3300053104 | Bacteria | 1358 |
| 1175 | Ga0500557_003716 | 3300053105 | Bacteria | 3083 |
| 1176 | Ga0500562_038244 | 3300053108 | Bacteria | 1274 |
| 1177 | Ga0500569_006994 | 3300053109 | Bacteria | 2509 |
| 1178 | Ga0500569_014547 | 3300053109 | Bacteria | 1950 |
| 1179 | Ga0500572_000585 | 3300053111 | Bacteria | 12313 |
| 1180 | Ga0500592_000799 | 3300053116 | Bacteria | 5164 |
| 1181 | Ga0500592_024540 | 3300053116 | Bacteria | 972 |
| 1182 | Ga0500595_002375 | 3300053119 | Bacteria | 9407 |
| 1183 | Ga0500595_003407 | 3300053119 | Bacteria | 7437 |
| 1184 | Ga0500595_007814 | 3300053119 | Bacteria | 4408 |
| 1185 | Ga0500595_019669 | 3300053119 | Bacteria | 2445 |
| 1186 | Ga0500608_004588 | 3300053122 | Bacteria | 5377 |
| 1187 | Ga0500617_148009 | 3300053124 | Bacteria | 933 |
| 1188 | Ga0500618_032582 | 3300053125 | Bacteria | 1218 |
| 1189 | Ga0500626_067116 | 3300053128 | Bacteria | 1599 |
| 1190 | Ga0500642_0000092 | 3300053130 | Bacteria | 45651 |
| 1191 | Ga0500642_0000109 | 3300053130 | Bacteria | 40031 |
| 1192 | Ga0500652_001613 | 3300053131 | Bacteria | 6864 |
| 1193 | Ga0500559_0000492 | 3300053136 | Bacteria | 27669 |
| 1194 | Ga0500559_0029582 | 3300053136 | Bacteria | 2346 |
| 1195 | Ga0500559_0062637 | 3300053136 | Bacteria | 1661 |
| 1196 | Ga0500568_0002222 | 3300053139 | Bacteria | 11652 |
| 1197 | Ga0500568_0045737 | 3300053139 | Bacteria | 1741 |
| 1198 | Ga0500568_0079638 | 3300053139 | Bacteria | 1245 |
| 1199 | Ga0500573_0006467 | 3300053140 | Bacteria | 6347 |
| 1200 | Ga0500577_0000135 | 3300053142 | Bacteria | 17919 |
| 1201 | Ga0500579_114888 | 3300053143 | Bacteria | 1335 |
| 1202 | Ga0500586_001127 | 3300053145 | Bacteria | 5524 |
| 1203 | Ga0500590_021786 | 3300053148 | Bacteria | 3325 |
| 1204 | Ga0500590_040995 | 3300053148 | Bacteria | 2383 |
| 1205 | Ga0500590_091519 | 3300053148 | Bacteria | 1476 |
| 1206 | Ga0500604_0062277 | 3300053151 | Bacteria | 1174 |
| 1207 | Ga0500616_0000197 | 3300053153 | Bacteria | 98372 |
| 1208 | Ga0500616_0260809 | 3300053153 | Bacteria | 736 |
| 1209 | Ga0500622_0000966 | 3300053156 | Bacteria | 24386 |
| 1210 | Ga0500622_0025854 | 3300053156 | Bacteria | 3099 |
| 1211 | Ga0500627_0030431 | 3300053158 | Bacteria | 2260 |
| 1212 | Ga0500633_0022583 | 3300053160 | Bacteria | 1929 |
| 1213 | Ga0500634_0012476 | 3300053161 | Bacteria | 4426 |
| 1214 | Ga0500634_0019449 | 3300053161 | Bacteria | 3659 |
| 1215 | Ga0500638_004107 | 3300053162 | Bacteria | 5536 |
| 1216 | Ga0500636_0003333 | 3300053177 | Bacteria | 9023 |
| 1217 | Ga0500636_0026379 | 3300053177 | Bacteria | 3432 |
| 1218 | Ga0500636_0036683 | 3300053177 | Bacteria | 2900 |
| 1219 | Ga0500636_0077322 | 3300053177 | Bacteria | 1922 |
| 1220 | Ga0500637_0000090 | 3300053178 | Bacteria | 32448 |
| 1221 | Ga0500637_0094288 | 3300053178 | Bacteria | 1734 |
| 1222 | Ga0500637_0282160 | 3300053178 | Bacteria | 913 |
| 1223 | Ga0500625_022262 | 3300053729 | Bacteria | 2992 |
| 1224 | Ga0500645_026052 | 3300053730 | Bacteria | 1780 |
| 1225 | Ga0500645_062200 | 3300053730 | Bacteria | 1078 |
| 1226 | Ga0500609_004261 | 3300053731 | Bacteria | 1984 |
| 1227 | Ga0500609_018634 | 3300053731 | Bacteria | 945 |
| 1228 | Ga0500596_000284 | 3300053735 | Bacteria | 9009 |
| 1229 | Ga0500599_002093 | 3300053736 | Bacteria | 2370 |
| 1230 | Ga0500601_000997 | 3300053737 | Bacteria | 3280 |
| 1231 | Ga0501084_0012720 | 3300054114 | Bacteria | 6970 |
| 1232 | Ga0590077_025092 | 3300059426 | Bacteria | 1283 |
| 1233 | Ga0501082_0008921 | 3300060353 | Bacteria | 8653 |
| 1234 | Ga0466962_0067990 | 3300061719 | Bacteria | 1701 |
| 1235 | Ga0466962_0186089 | 3300061719 | Bacteria | 1013 |
| 1236 | 2507511372 | 2507262055 | Bacteria | 8048963 |
| 1237 | 2508545166 | 2508501009 | Bacteria | 7784016 |
| 1238 | 2508694009 | 2508501042 | Bacteria | 8719808 |
| 1239 | 2509074743 | 2508501114 | Bacteria | 7082538 |
| 1240 | 2509146650 | 2508501128 | Bacteria | 8613869 |
| 1241 | 2511248911 | 2511231003 | Bacteria | 5606035 |
| 1242 | 2511394253 | 2511231028 | Bacteria | 8046582 |
| 1243 | 2513624147 | 2513237092 | Bacteria | 8341956 |
| 1244 | 2513641110 | 2513237094 | Bacteria | 8789602 |
| 1245 | 2513648539 | 2513237095 | Bacteria | 8976980 |
| 1246 | 2513656083 | 2513237096 | Bacteria | 8722461 |
| 1247 | 2513675266 | 2513237098 | Bacteria | 9902361 |
| 1248 | 2513696383 | 2513237101 | Bacteria | 7952346 |
| 1249 | 2513702622 | 2513237102 | Bacteria | 7703324 |
| 1250 | 2513717832 | 2513237104 | Bacteria | 10034502 |
| 1251 | 2513862889 | 2513237137 | Bacteria | 9558895 |
| 1252 | 2513887693 | 2513237141 | Bacteria | 8496279 |
| 1253 | 2513920908 | 2513237145 | Bacteria | 8979722 |
| 1254 | 2517101114 | 2517093001 | Bacteria | 9002274 |
| 1255 | 2517895904 | 2517572143 | Bacteria | 9484767 |
| 1256 | 2524439944 | 2524023205 | Bacteria | 8918781 |
| 1257 | 2524469134 | 2524023210 | Bacteria | 9029266 |
| 1258 | 2524534772 | 2524023228 | Bacteria | 10118060 |
| 1259 | 2528853992 | 2528768022 | Bacteria | 10457665 |
| 1260 | 2535518040 | 2534681796 | Bacteria | 7146037 |
| 1261 | 2550697216 | 2548876994 | Bacteria | 4904866 |
| 1262 | 2603857526 | 2602042107 | Bacteria | 6226103 |
| 1263 | 2617348475 | 2617270735 | Bacteria | 9163226 |
| 1264 | 2617375020 | 2617270741 | Bacteria | 8201522 |
| 1265 | 2644287239 | 2643221651 | Bacteria | 4798932 |
| 1266 | 2671122695 | 2667528175 | Bacteria | 7532676 |
| 1267 | 2671693394 | 2671180139 | Bacteria | 4196045 |
| 1268 | 2723842889 | 2721755755 | Bacteria | 8322773 |
| 1269 | 2728754209 | 2728368998 | Bacteria | 8720350 |
| 1270 | 2745075775 | 2744054633 | Bacteria | 8678936 |
| 1271 | 2765464362 | 2765235802 | Bacteria | 5618596 |
| 1272 | 2770194713 | 2767802442 | Bacteria | 5747986 |
| 1273 | 2776272502 | 2775506902 | Bacteria | 6208009 |
| 1274 | 2776284442 | 2775506904 | Bacteria | 5954060 |
| 1275 | 2793061666 | 2791355196 | Bacteria | 7323613 |
| 1276 | 2793069670 | 2791355197 | Bacteria | 8420563 |
| 1277 | 2793080229 | |||
| 1278 | 2818243421 | 2816332527 | Bacteria | 8933356 |
| 1279 | 2819591372 | 2818991445 | Bacteria | 4955017 |
| 1280 | 2824609163 | 2824600985 | Bacteria | 8488197 |
| 1281 | 2824616848 | 2824609381 | Bacteria | 8672835 |
| 1282 | 2824624998 | 2824617872 | Bacteria | 8814715 |
| 1283 | 2824633865 | 2824626560 | Bacteria | 8813858 |
| 1284 | 2824641021 | 2824635225 | Bacteria | 8785348 |
| 1285 | 2824651537 | 2824644064 | Bacteria | 8743947 |
| 1286 | 2824661142 | 2824653114 | Bacteria | 8493680 |
| 1287 | 2824668414 | 2824661429 | Bacteria | 9877870 |
| 1288 | 2824683647 | 2824679649 | Bacteria | 8248951 |
| 1289 | 2824711470 | 2824704595 | Bacteria | 9667483 |
| 1290 | 2824721520 | 2824714736 | Bacteria | 8717648 |
| 1291 | 2824728288 | 2824723954 | Bacteria | 8758240 |
| 1292 | 2824739573 | 2824732956 | Bacteria | 7810675 |
| 1293 | 2824751854 | 2824746037 | Bacteria | 7911610 |
| 1294 | 2824754185 | 2824753945 | Bacteria | 9787441 |
| 1295 | 2824773242 | 2824763712 | Bacteria | 9792355 |
| 1296 | 2824780583 | 2824773399 | Bacteria | 8360218 |
| 1297 | 2839994278 | 2839993093 | Bacteria | 5512535 |
| 1298 | 2840769320 | 2840764183 | Bacteria | 6358399 |
| 1299 | 2841961530 | 2841957949 | Bacteria | 8652217 |
| 1300 | 2842042336 | 2842038055 | Bacteria | 8002051 |
| 1301 | 2842050379 | 2842045827 | Bacteria | 8006841 |
| 1302 | 2844316540 | 2844315083 | Bacteria | 8138177 |
| 1303 | 2847939150 | 2847930680 | Bacteria | 9342022 |
| 1304 | 2849081872 | 2849076700 | Bacteria | 7039503 |
| 1305 | 2857512631 | 2857509624 | Bacteria | 7472071 |
| 1306 | 2857526913 | 2857524615 | Bacteria | 6615449 |
| 1307 | 2874606449 | 2874604998 | Bacteria | 7834745 |
| 1308 | 2874613957 | 2874612657 | Bacteria | 8252029 |
| 1309 | 2874625617 | 2874620515 | Bacteria | 8290088 |
| 1310 | 2874633719 | 2874628541 | Bacteria | 8630250 |
| 1311 | 2876766327 | 2876761206 | Bacteria | 10111113 |
| 1312 | 2876809978 | 2876808645 | Bacteria | 8824342 |
| 1313 | 2879084622 | 2879083081 | Bacteria | 8587928 |
| 1314 | 2879100819 | 2879099564 | Bacteria | 10442239 |
| 1315 | 2879113715 | 2879110137 | Bacteria | 8907982 |
| 1316 | 2881367322 | 2881364244 | Bacteria | 7710352 |
| 1317 | 2881668712 | 2881665667 | Bacteria | 8175609 |
| 1318 | 2884815253 | 2884811622 | Bacteria | 5552861 |
| 1319 | 2884815264 | 2884811622 | Bacteria | 5552861 |
| 1320 | 2884837171 | 2884836552 | Bacteria | 5219991 |
| 1321 | 2884853463 | 2884852848 | Bacteria | 5221161 |
| 1322 | 2885373763 | 2885366525 | Bacteria | 8326213 |
| 1323 | 2885377854 | 2885374607 | Bacteria | 8927485 |
| 1324 | 2888386926 | 2888378607 | Bacteria | 9652610 |
| 1325 | 2888389621 | 2888388044 | Bacteria | 7304136 |
| 1326 | 2888421467 | 2888419890 | Bacteria | 7857137 |
| 1327 | 2889033803 | 2889033259 | Bacteria | 9099371 |
| 1328 | 2893070070 | 2893066018 | Bacteria | 6158120 |
| 1329 | 2896155420 | 2896154374 | Bacteria | 5221518 |
| 1330 | 2903731402 | 2903727486 | Bacteria | 8281579 |
| 1331 | 2903756009 | 2903748898 | Bacteria | 9972761 |
| 1332 | 2903771445 | 2903768456 | Bacteria | 9749579 |
| 1333 | 2904579048 | 2904578770 | Bacteria | 5302906 |
| 1334 | 2904673563 | 2904666416 | Bacteria | 8226587 |
| 1335 | 2904693383 | 2904690495 | Bacteria | 9412302 |
| 1336 | 2904707037 | |||
| 1337 | 2904719516 | 2904711408 | Bacteria | 9771557 |
| 1338 | 2906603776 | 2906602504 | Bacteria | 8295279 |
| 1339 | 2906615631 | |||
| 1340 | 2906626723 | 2906626472 | Bacteria | 8826946 |
| 1341 | 2906635584 | 2906635258 | Bacteria | 8601019 |
| 1342 | 2906646122 | 2906643746 | Bacteria | 8722424 |
| 1343 | 2906665064 | 2906660503 | Bacteria | 8595048 |
| 1344 | 2908745548 | 2908739725 | Bacteria | 8628932 |
| 1345 | 2908763537 | 2908756301 | Bacteria | 8864324 |
| 1346 | 2908777504 | 2908775508 | Bacteria | 8092255 |
| 1347 | 2919078030 | 2919073203 | Bacteria | 6531949 |
| 1348 | 2919122124 | 2919119836 | Bacteria | 5208557 |
| 1349 | 2922367203 | 2922361189 | Bacteria | 7436256 |
| 1350 | 2922377058 | |||
| 1351 | 2922390070 | 2922386360 | Bacteria | 7017218 |
| 1352 | 2922398212 | 2922393267 | Bacteria | 8285685 |
| 1353 | 2922432375 | |||
| 1354 | 2928521936 | 2928521798 | Bacteria | 4960112 |
| 1355 | 2929619109 | 2929615660 | Bacteria | 9193770 |
| 1356 | 2929628396 | 2929624759 | Bacteria | 9339455 |
| 1357 | 2932791316 | 2932784394 | Bacteria | 9704911 |
| 1358 | 2932795744 | 2932794094 | Bacteria | 7915132 |
| 1359 | 2932801982 | 2932801729 | Bacteria | 7987968 |
| 1360 | 2932817658 | 2932809354 | Bacteria | 9135765 |
| 1361 | 2932826944 | 2932818245 | Bacteria | 9955613 |
| 1362 | 2932833115 | 2932828146 | Bacteria | 9745859 |
| 1363 | 2933581031 | 2933577622 | Bacteria | 9116884 |
| 1364 | 2935612301 | 2935608549 | Bacteria | 8203142 |
| 1365 | 2935623844 | 2935616580 | Bacteria | 9032984 |
| 1366 | 2935630797 | 2935630451 | Bacteria | 8169952 |
| 1367 | 2935639619 | 2935638405 | Bacteria | 10015038 |
| 1368 | 2935650141 | 2935648319 | Bacteria | 8801166 |
| 1369 | 2935658288 | 2935656913 | Bacteria | 8965014 |
| 1370 | 2935667542 | 2935665750 | Bacteria | 9571747 |
| 1371 | 2935682895 | 2935675223 | Bacteria | 9928132 |
| 1372 | 2935687558 | 2935684952 | Bacteria | 9590419 |
| 1373 | 2935696470 | 2935694250 | Bacteria | 9291695 |
| 1374 | 2935705283 | 2935703347 | Bacteria | 10242284 |
| 1375 | 2935719018 | 2935713505 | Bacteria | 9608509 |
| 1376 | 2935728670 | 2935722832 | Bacteria | 9608746 |
| 1377 | 2935736734 | 2935732158 | Bacteria | 9706831 |
| 1378 | 2935746264 | 2935741537 | Bacteria | 9707219 |
| 1379 | 2935753524 | 2935750917 | Bacteria | 9590372 |
| 1380 | 2935767721 | 2935760218 | Bacteria | 9817913 |
| 1381 | 2935770483 | 2935769743 | Bacteria | 7878163 |
| 1382 | 2935782490 | 2935777560 | Bacteria | 8077691 |
| 1383 | 2935786464 | 2935785616 | Bacteria | 7962367 |
| 1384 | 2935794519 | 2935793552 | Bacteria | 8012592 |
| 1385 | 2935807028 | 2935801545 | Bacteria | 9301974 |
| 1386 | 2935814057 | 2935810662 | Bacteria | 9401221 |
| 1387 | 2935823789 | 2935819856 | Bacteria | 8261050 |
| 1388 | 2935829101 | 2935827899 | Bacteria | 10038562 |
| 1389 | 2935845364 | 2935837841 | Bacteria | 9454360 |
| 1390 | 2935854427 | 2935847175 | Bacteria | 8228321 |
| 1391 | 2935861931 | 2935855204 | Bacteria | 9035059 |
| 1392 | 2935872819 | 2935864058 | Bacteria | 9784707 |
| 1393 | 2935880394 | 2935873716 | Bacteria | 9632195 |
| 1394 | 2935886170 | 2935883170 | Bacteria | 7964738 |
| 1395 | 2935913479 | 2935908558 | Bacteria | 8568796 |
| 1396 | 2935923376 | 2935916978 | Bacteria | 9113783 |
| 1397 | 2935931204 | 2935926038 | Bacteria | 8601059 |
| 1398 | 2935935486 | 2935934488 | Bacteria | 8602579 |
| 1399 | 2935947052 | 2935942939 | Bacteria | 8599779 |
| 1400 | 2935953853 | 2935951376 | Bacteria | 8602333 |
| 1401 | 2935961510 | 2935959822 | Bacteria | 7869783 |
| 1402 | 2935968879 | 2935967501 | Bacteria | 8603075 |
| 1403 | 2935985920 | 2935984226 | Bacteria | 8302647 |
| 1404 | 2935995004 | 2935992306 | Bacteria | 9802711 |
| 1405 | 2936006097 | 2936002035 | Bacteria | 9362176 |
| 1406 | 2936013300 | 2936011229 | Bacteria | 8801034 |
| 1407 | 2936021613 | 2936019824 | Bacteria | 8804134 |
| 1408 | 2936030593 | 2936028420 | Bacteria | 8965941 |
| 1409 | 2936039612 | 2936037263 | Bacteria | 9446081 |
| 1410 | 2936047807 | 2936046547 | Bacteria | 8903709 |
| 1411 | 2936057809 | 2936055302 | Bacteria | 8785755 |
| 1412 | 2940559437 | 2940556831 | Bacteria | 9590747 |
| 1413 | 2941507449 | 2941507105 | Bacteria | 8166816 |
| 1414 | 2941515876 | 2941515067 | Bacteria | 8166720 |
| 1415 | 2941523416 | 2941523033 | Bacteria | 8169134 |
| 1416 | 2941537005 | 2941531003 | Bacteria | 7653939 |
| 1417 | 2941545665 | 2941538514 | Bacteria | 9402094 |
| 1418 | 2954014707 | 2954011201 | Bacteria | 4762601 |
| 1419 | 3002142675 | 3002141150 | Bacteria | 5254435 |
| 1420 | 3005476663 | 3005474847 | Bacteria | 9259049 |
| 1421 | 3005489140 | 3005483717 | Bacteria | 7877331 |
| 1422 | 3005511194 | 3005506211 | Bacteria | 6943378 |
| 1423 | 3005592045 | 3005587118 | Bacteria | 7794411 |
| 1424 | 3005596170 | 3005594810 | Bacteria | 8716512 |
| 1425 | 3005712109 | 3005710791 | Bacteria | 7622528 |
| 1426 | 3005719350 | 3005718088 | Bacteria | 8283608 |
| 1427 | 8005264703 | 8005258706 | Bacteria | 6184835 |
| 1428 | 8005327197 | 8005321885 | Bacteria | 5795980 |
| 1429 | 8006934816 | 8006933436 | Bacteria | 10410654 |
| 1430 | 8006966721 | 8006964411 | Bacteria | 8966052 |
| 1431 | 8006974784 | 8006973647 | Bacteria | 10679141 |
| 1432 | 8006989640 | 8006984368 | Bacteria | 9651211 |
| 1433 | 8006998023 | 8006994254 | Bacteria | 8309700 |
| 1434 | 8016516924 | 8016511872 | Bacteria | 9921665 |
| 1435 | 8016524504 | 8016522445 | Bacteria | 8156687 |
| 1436 | 8016538064 | 8016530956 | Bacteria | 8155261 |
| 1437 | 8016542340 | 8016539877 | Bacteria | 8155419 |
| 1438 | 8016550937 | 8016548790 | Bacteria | 8155074 |
| 1439 | 8016559350 | 8016557553 | Bacteria | 8154380 |
| 1440 | 8016567727 | 8016566248 | Bacteria | 8158151 |
| 1441 | 8016580421 | 8016575299 | Bacteria | 8154085 |
| 1442 | 8016588631 | 8016583857 | Bacteria | 10421953 |
| 1443 | 8016597291 | 8016595262 | Bacteria | 8149947 |
| 1444 | 8016604968 | 8016603502 | Bacteria | 8731218 |
| 1445 | 8016620043 | 8016613128 | Bacteria | 8794220 |
| 1446 | 8016624262 | 8016622563 | Bacteria | 7999408 |
| 1447 | 8016637671 | 8016630954 | Bacteria | 9217207 |
| 1448 | 8017059646 | 8017057580 | Bacteria | 10023680 |
| 1449 | 8019537732 | 8019530166 | Bacteria | 8155624 |
| 1450 | 8019539362 | 8019538911 | Bacteria | 7872763 |
| 1451 | 8019563838 | 8019555841 | Bacteria | 9642137 |
| 1452 | 8019573907 | 8019565922 | Bacteria | 9639779 |
| 1453 | 8019579120 | 8019576017 | Bacteria | 10049540 |
| 1454 | 8019597174 | 8019586578 | Bacteria | 10212056 |
| 1455 | 8019604517 | 8019597564 | Bacteria | 10041141 |
| 1456 | 8019650393 | 8019648815 | Bacteria | 10014479 |
| 1457 | 8019694562 | 8019687851 | Bacteria | 8712826 |
| 1458 | 8055749633 | 8055742211 | Bacteria | 9226248 |
| 1459 | 8056675058 | 8056673599 | Bacteria | 7871253 |
| 1460 | 8056681855 | 8056681323 | Bacteria | 8472857 |
| 1461 | 8056696253 | 8056689827 | Bacteria | 6712655 |
| 1462 | 8056973848 | 8056967851 | Bacteria | 9038162 |
| 1463 | Ga0496102_0310543 | |||
| 1464 | LJQas_1006154 | |||
| 1465 | JGI24740J21852_10000767 | |||
| 1466 | JGI25155J39150_1000198 | |||
| 1467 | JGI25155J39150_1000408 | |||
| 1468 | JGI25156J39149_1000057 | |||
| 1469 | JGI25156J39149_1002321 | |||
| 1470 | JGI25162J39368_1000277 | |||
| 1471 | JGI25162J39368_1003686 | |||
| 1472 | JGI25154J39366_1000087 | |||
| 1473 | JGI25154J39366_1000925 | |||
| 1474 | JGI25157J39369_1000336 | |||
| 1475 | JGI25152J39213_1002781 | |||
| 1476 | JGI25159J45721_1001498 | |||
| 1477 | Ga0006778J45830_1005206 | |||
| 1478 | Ga0006778J45830_1037934 | |||
| 1479 | JGI25406J46586_10000042 | |||
| 1480 | JGI25406J46586_10001462 | |||
| 1481 | JGI25406J46586_10029632 | |||
| 1482 | JGI25165J46597_1003489 | |||
| 1483 | JGI25165J46597_1004533 | |||
| 1484 | JGI25153J46596_10001736 | |||
| 1485 | JGI25153J46596_10003826 | |||
| 1486 | JGI25153J46596_10004140 | |||
| 1487 | JGI25153J46596_10005975 | |||
| 1488 | JGI25153J46596_10011700 | |||
| 1489 | JGI25153J46596_10038013 | |||
| 1490 | JGI25160J50197_1002670 | |||
| 1491 | JGI25160J50197_1009335 | |||
| 1492 | JGI25160J50197_1029710 | |||
| 1493 | Ga0007417J51691_1021109 | |||
| 1494 | Ga0006781J51513_1004680 | |||
| 1495 | Ga0007410J51695_1023793 | |||
| 1496 | Ga0007416J51690_1011819 | |||
| 1497 | Ga0007429J51699_1006648 | |||
| 1498 | JGI25404J52841_10016701 | |||
| 1499 | JGI25404J52841_10027496 | |||
| 1500 | JGI25404J52841_10058120 | |||
| 1501 | Ga0032354_1001469 | |||
| 1502 | Ga0006780_1000642 | |||
| 1503 | Ga0055539_1013566 | |||
| 1504 | Ga0055532_1000016 | |||
| 1505 | Ga0055524_1029581 | |||
| 1506 | Ga0055528_1008660 | |||
| 1507 | Ga0055531_10006809 | |||
| 1508 | JGI25405J52794_10040334 | |||
| 1509 | Ga0055543_1005069 | |||
| 1510 | Ga0058859_11354442 | |||
| 1511 | Ga0058861_12010056 | |||
| 1512 | Ga0065165_1001376 | |||
| 1513 | Ga0065165_1003381 | |||
| 1514 | Ga0065165_1006721 | |||
| 1515 | Ga0065165_1042564 | |||
| 1516 | Ga0070683_100353009 | |||
| 1517 | Ga0070670_100166969 | |||
| 1518 | Ga0070677_10027820 | |||
| 1519 | Ga0070666_10091775 | |||
| 1520 | Ga0070666_10546164 | |||
| 1521 | Ga0070680_100011514 | |||
| 1522 | Ga0070680_100088017 | |||
| 1523 | Ga0070680_100308636 | |||
| 1524 | Ga0070682_100025295 | |||
| 1525 | Ga0068868_100117433 | |||
| 1526 | Ga0068868_100288646 | |||
| 1527 | Ga0068868_100504877 | |||
| 1528 | Ga0070660_100359116 | |||
| 1529 | Ga0070691_10062835 | |||
| 1530 | Ga0070687_100241257 | |||
| 1531 | Ga0070661_100238131 | |||
| 1532 | Ga0070661_100353940 | |||
| 1533 | Ga0070668_100027694 | |||
| 1534 | Ga0070668_100034676 | |||
| 1535 | Ga0070668_100273988 | |||
| 1536 | Ga0070668_100312648 | |||
| 1537 | Ga0070669_100141703 | |||
| 1538 | Ga0070671_100045130 | |||
| 1539 | Ga0070671_100070957 | |||
| 1540 | Ga0070671_100200942 | |||
| 1541 | Ga0070671_100273068 | |||
| 1542 | Ga0070671_100640921 | |||
| 1543 | Ga0070674_100097673 | |||
| 1544 | Ga0070673_100769279 | |||
| 1545 | Ga0070688_100013583 | |||
| 1546 | Ga0070688_100154951 | |||
| 1547 | Ga0070659_100052884 | |||
| 1548 | Ga0070659_100214544 | |||
| 1549 | Ga0070659_100330430 | |||
| 1550 | Ga0070659_100519196 | |||
| 1551 | Ga0070659_100691825 | |||
| 1552 | Ga0070667_100125652 | |||
| 1553 | Ga0070709_10005526 | |||
| 1554 | Ga0070709_10010952 | |||
| 1555 | Ga0070709_10058749 | |||
| 1556 | Ga0070709_10171116 | |||
| 1557 | Ga0070714_100002233 | |||
| 1558 | Ga0070714_100081991 | |||
| 1559 | Ga0070714_100156494 | |||
| 1560 | Ga0070714_100220629 | |||
| 1561 | Ga0070713_100004820 | |||
| 1562 | Ga0070713_100058748 | |||
| 1563 | Ga0070713_100071226 | |||
| 1564 | Ga0070713_100097470 | |||
| 1565 | Ga0070713_100130356 | |||
| 1566 | Ga0070713_100170583 | |||
| 1567 | Ga0070710_10000549 | |||
| 1568 | Ga0070711_100007048 | |||
| 1569 | Ga0070711_100017942 | |||
| 1570 | Ga0070711_100069372 | |||
| 1571 | Ga0070700_100069003 | |||
| 1572 | Ga0070663_100010930 | |||
| 1573 | Ga0070663_100067660 | |||
| 1574 | Ga0070663_100148879 | |||
| 1575 | Ga0070663_100326240 | |||
| 1576 | Ga0070663_100422958 | |||
| 1577 | Ga0070678_100041320 | |||
| 1578 | Ga0070678_100047311 | |||
| 1579 | Ga0070678_100568549 | |||
| 1580 | Ga0070662_100084819 | |||
| 1581 | Ga0070662_100712441 | |||
| 1582 | Ga0070681_10087634 | |||
| 1583 | Ga0070681_10295193 | |||
| 1584 | Ga0068867_100952356 | |||
| 1585 | Ga0070685_10168476 | |||
| 1586 | Ga0070685_10336700 | |||
| 1587 | Ga0070706_100158402 | |||
| 1588 | Ga0070707_100033994 | |||
| 1589 | Ga0070707_100581791 | |||
| 1590 | Ga0070699_100149816 | |||
| 1591 | Ga0070684_100010958 | |||
| 1592 | Ga0070697_100320031 | |||
| 1593 | Ga0070697_100729571 | |||
| 1594 | Ga0068853_100011007 | |||
| 1595 | Ga0068853_100387662 | |||
| 1596 | Ga0068853_100540120 | |||
| 1597 | Ga0070672_100219817 | |||
| 1598 | Ga0070696_100086014 | |||
| 1599 | Ga0070693_100372648 | |||
| 1600 | Ga0070665_100014804 | |||
| 1601 | Ga0070665_100016255 | |||
| 1602 | Ga0070665_100026397 | |||
| 1603 | Ga0070665_100082234 | |||
| 1604 | Ga0070665_100143198 | |||
| 1605 | Ga0070665_100148314 | |||
| 1606 | Ga0070665_100153970 | |||
| 1607 | Ga0070665_100161902 | |||
| 1608 | Ga0070665_100171758 | |||
| 1609 | Ga0070665_100524084 | |||
| 1610 | Ga0068855_100045608 | |||
| 1611 | Ga0068855_100059386 | |||
| 1612 | Ga0068855_100103063 | |||
| 1613 | Ga0068855_100155264 | |||
| 1614 | Ga0068855_100235166 | |||
| 1615 | Ga0068855_100291329 | |||
| 1616 | Ga0070664_100122248 | |||
| 1617 | Ga0070664_100291013 | |||
| 1618 | Ga0068857_100049570 | |||
| 1619 | Ga0068857_100178355 | |||
| 1620 | Ga0068854_100151272 | |||
| 1621 | Ga0068854_100201872 | |||
| 1622 | Ga0068856_100003313 | |||
| 1623 | Ga0068856_100131687 | |||
| 1624 | Ga0068856_100188069 | |||
| 1625 | Ga0068856_100425696 | |||
| 1626 | Ga0068856_100552487 | |||
| 1627 | Ga0068852_100038969 | |||
| 1628 | Ga0068852_100246511 | |||
| 1629 | Ga0068852_100835030 | |||
| 1630 | Ga0068864_100069542 | |||
| 1631 | Ga0068866_10111408 | |||
| 1632 | Ga0068861_100168874 | |||
| 1633 | Ga0068851_10011299 | |||
| 1634 | Ga0068851_10244567 | |||
| 1635 | Ga0068863_100267222 | |||
| 1636 | Ga0068863_100301418 | |||
| 1637 | Ga0068863_100390284 | |||
| 1638 | Ga0068858_100073088 | |||
| 1639 | Ga0068858_100094941 | |||
| 1640 | Ga0068858_100476957 | |||
| 1641 | Ga0068860_100000534 | |||
| 1642 | Ga0068860_100153346 | |||
| 1643 | Ga0068860_101072146 | |||
| 1644 | Ga0068862_100105017 | |||
| 1645 | Ga0081455_10000815 | |||
| 1646 | Ga0081455_10012165 | |||
| 1647 | Ga0081455_10022180 | |||
| 1648 | Ga0081540_1003580 | |||
| 1649 | Ga0081540_1004327 | |||
| 1650 | Ga0081540_1008358 | |||
| 1651 | Ga0081540_1010413 | |||
| 1652 | Ga0081540_1011157 | |||
| 1653 | Ga0081540_1011347 | |||
| 1654 | Ga0081540_1087692 | |||
| 1655 | Ga0081540_1110169 | |||
| 1656 | Ga0081539_10000099 | |||
| 1657 | Ga0081539_10000958 | |||
| 1658 | Ga0081539_10030928 | |||
| 1659 | Ga0081539_10128426 | |||
| 1660 | Ga0070717_10000884 | |||
| 1661 | Ga0070717_10003176 | |||
| 1662 | Ga0070717_10063343 | |||
| 1663 | Ga0070717_10791037 | |||
| 1664 | Ga0075365_10000529 | |||
| 1665 | Ga0075365_10059515 | |||
| 1666 | Ga0075368_10195728 | |||
| 1667 | Ga0075363_100013678 | |||
| 1668 | Ga0075363_100025950 | |||
| 1669 | Ga0075363_100049181 | |||
| 1670 | Ga0075364_10031891 | |||
| 1671 | Ga0075364_10054185 | |||
| 1672 | Ga0075364_10121089 | |||
| 1673 | Ga0070715_10001749 | |||
| 1674 | Ga0070716_100005320 | |||
| 1675 | Ga0070716_100033588 | |||
| 1676 | Ga0070716_100141225 | |||
| 1677 | Ga0070716_100434674 | |||
| 1678 | Ga0070712_100024654 | |||
| 1679 | Ga0070712_100857464 | |||
| 1680 | Ga0075362_10025311 | |||
| 1681 | Ga0075362_10028330 | |||
| 1682 | Ga0075362_10047595 | |||
| 1683 | Ga0075367_10011261 | |||
| 1684 | Ga0075367_10028491 | |||
| 1685 | Ga0075367_10037617 | |||
| 1686 | Ga0075367_10058666 | |||
| 1687 | Ga0075367_10195637 | |||
| 1688 | Ga0075369_10009378 | |||
| 1689 | Ga0075369_10021528 | |||
| 1690 | Ga0075369_10061887 | |||
| 1691 | Ga0075366_10036160 | |||
| 1692 | Ga0075366_10053729 | |||
| 1693 | Ga0097621_100078434 | |||
| 1694 | Ga0097621_100192342 | |||
| 1695 | Ga0075370_10006177 | |||
| 1696 | Ga0075370_10043189 | |||
| 1697 | Ga0075370_10043400 | |||
| 1698 | Ga0075370_10080200 | |||
| 1699 | Ga0075370_10292859 | |||
| 1700 | Ga0068871_100050386 | |||
| 1701 | Ga0068871_100347315 | |||
| 1702 | Ga0075434_100006045 | |||
| 1703 | Ga0099824_1013868 | |||
| 1704 | Ga0099822_1054877 | |||
| 1705 | Ga0099823_1032665 | |||
| 1706 | Ga0099795_10024287 | |||
| 1707 | Ga0099795_10029257 | |||
| 1708 | Ga0105250_10071291 | |||
| 1709 | Ga0105240_10000497 | |||
| 1710 | Ga0105240_10025997 | |||
| 1711 | Ga0105240_10042855 | |||
| 1712 | Ga0105240_10098710 | |||
| 1713 | Ga0105240_10146636 | |||
| 1714 | Ga0105240_10339230 | |||
| 1715 | Ga0105240_10574421 | |||
| 1716 | Ga0105240_10619226 | |||
| 1717 | Ga0111539_10004709 | |||
| 1718 | Ga0111539_10392146 | |||
| 1719 | Ga0105245_10025310 | |||
| 1720 | Ga0105247_10137117 | |||
| 1721 | Ga0105247_10363603 | |||
| 1722 | Ga0105247_10490616 | |||
| 1723 | Ga0114129_10419060 | |||
| 1724 | Ga0114129_10431581 | |||
| 1725 | Ga0114129_11129443 | |||
| 1726 | Ga0114129_11206551 | |||
| 1727 | Ga0105243_10088252 | |||
| 1728 | Ga0105241_10050926 | |||
| 1729 | Ga0105242_10237267 | |||
| 1730 | Ga0105242_10406877 | |||
| 1731 | Ga0105248_10030134 | |||
| 1732 | Ga0105248_10110038 | |||
| 1733 | Ga0105248_10113191 | |||
| 1734 | Ga0105237_10031990 | |||
| 1735 | Ga0105237_10033065 | |||
| 1736 | Ga0105237_10040649 | |||
| 1737 | Ga0105237_10041954 | |||
| 1738 | Ga0105237_10049749 | |||
| 1739 | Ga0105237_10072458 | |||
| 1740 | Ga0105237_10150599 | |||
| 1741 | Ga0105237_10159053 | |||
| 1742 | Ga0105237_10442143 | |||
| 1743 | Ga0105238_10016659 | |||
| 1744 | Ga0105238_10030444 | |||
| 1745 | Ga0105238_10047369 | |||
| 1746 | Ga0105238_10071229 | |||
| 1747 | Ga0105238_10108125 | |||
| 1748 | Ga0105238_10112637 | |||
| 1749 | Ga0105238_10128331 | |||
| 1750 | Ga0105238_10178649 | |||
| 1751 | Ga0105238_10292697 | |||
| 1752 | Ga0105249_10135725 | |||
| 1753 | Ga0105249_10281311 | |||
| 1754 | Ga0105249_11109305 | |||
| 1755 | Ga0123342_1013414 | |||
| 1756 | Ga0099796_10008189 | |||
| 1757 | Ga0099796_10047758 | |||
| 1758 | Ga0105239_10144608 | |||
| 1759 | Ga0105239_10567219 | |||
| 1760 | Ga0105246_10062381 | |||
| 1761 | Ga0105246_10280332 | |||
| 1762 | Ga0105246_10297578 | |||
| 1763 | Ga0157371_10024676 | |||
| 1764 | Ga0157371_10100896 | |||
| 1765 | Ga0157370_10017035 | |||
| 1766 | Ga0157370_10029467 | |||
| 1767 | Ga0157370_10230358 | |||
| 1768 | Ga0157369_10013948 | |||
| 1769 | Ga0157369_10014664 | |||
| 1770 | Ga0157369_10026923 | |||
| 1771 | Ga0157374_10007888 | |||
| 1772 | Ga0157374_10022044 | |||
| 1773 | Ga0157374_10047182 | |||
| 1774 | Ga0157374_10347474 | |||
| 1775 | Ga0157374_10752030 | |||
| 1776 | Ga0157378_10007047 | |||
| 1777 | Ga0163162_10315157 | |||
| 1778 | Ga0163162_10420843 | |||
| 1779 | Ga0163162_10521253 | |||
| 1780 | Ga0163162_10588232 | |||
| 1781 | Ga0163162_10709274 | |||
| 1782 | Ga0157372_10078452 | |||
| 1783 | Ga0157372_10108336 | |||
| 1784 | Ga0157372_10272871 | |||
| 1785 | Ga0157375_10016901 | |||
| 1786 | Ga0157375_10119355 | |||
| 1787 | Ga0157375_10174904 | |||
| 1788 | Ga0163163_10000003 | |||
| 1789 | Ga0163163_10033749 | |||
| 1790 | Ga0163163_10252399 | |||
| 1791 | Ga0163163_10341237 | |||
| 1792 | Ga0163163_10878467 | |||
| 1793 | Ga0157380_10858932 | |||
| 1794 | Ga0182008_10001323 | |||
| 1795 | Ga0182008_10061172 | |||
| 1796 | Ga0157379_10789002 | |||
| 1797 | Ga0157376_10109424 | |||
| 1798 | Ga0157376_10590605 | |||
| 1799 | Ga0182006_1087717 | |||
| 1800 | Ga0163161_10071147 | |||
| 1801 | Ga0163161_10245265 | |||
| 1802 | Ga0197907_11028214 | |||
| 1803 | Ga0197907_11371172 | |||
| 1804 | Ga0206356_10790464 | |||
| 1805 | Ga0206350_11646629 | |||
| 1806 | Ga0206354_10070692 | |||
| 1807 | Ga0206354_10138454 | |||
| 1808 | Ga0214544_1000005 | |||
| 1809 | Ga0214542_1000004 | |||
| 1810 | Ga0214545_1000005 | |||
| 1811 | Ga0214543_1000564 | |||
| 1812 | Ga0213874_10013003 | |||
| 1813 | Ga0213874_10078758 | |||
| 1814 | Ga0213874_10103166 | |||
| 1815 | Ga0213876_10046146 | |||
| 1816 | Ga0213876_10086955 | |||
| 1817 | Ga0213875_10097599 | |||
| 1818 | Ga0213871_10016627 | |||
| 1819 | Ga0224712_10030820 | |||
| 1820 | Ga0224712_10064366 | |||
| 1821 | Ga0224712_10070990 | |||
| 1822 | Ga0224712_10139776 | |||
| 1823 | Ga0209435_100016 | |||
| 1824 | Ga0209435_100038 | |||
| 1825 | Ga0209435_100096 | |||
| 1826 | Ga0207672_1002024 | |||
| 1827 | Ga0209147_100023 | |||
| 1828 | Ga0209437_100080 | |||
| 1829 | Ga0209258_100210 | |||
| 1830 | Ga0209646_1000033 | |||
| 1831 | Ga0209646_1000093 | |||
| 1832 | Ga0209026_1000031 | |||
| 1833 | Ga0209677_101880 | |||
| 1834 | Ga0209677_106176 | |||
| 1835 | Ga0209148_1000900 | |||
| 1836 | Ga0209148_1004037 | |||
| 1837 | Ga0209148_1023204 | |||
| 1838 | Ga0209759_1000045 | |||
| 1839 | Ga0209759_1000248 | |||
| 1840 | Ga0209129_1001529 | |||
| 1841 | Ga0209233_1001052 | |||
| 1842 | Ga0209233_1001098 | |||
| 1843 | Ga0209233_1003397 | |||
| 1844 | Ga0209233_1003422 | |||
| 1845 | Ga0209455_1001412 | |||
| 1846 | Ga0209455_1004740 | |||
| 1847 | Ga0209455_1004957 | |||
| 1848 | Ga0209673_1002499 | |||
| 1849 | Ga0209673_1015590 | |||
| 1850 | Ga0209025_1019148 | |||
| 1851 | Ga0209564_1003825 | |||
| 1852 | Ga0209564_1012222 | |||
| 1853 | Ga0209564_1015496 | |||
| 1854 | Ga0209758_1000102 | |||
| 1855 | Ga0209758_1001188 | |||
| 1856 | Ga0209758_1001605 | |||
| 1857 | Ga0209758_1002945 | |||
| 1858 | Ga0209758_1004134 | |||
| 1859 | Ga0209758_1006083 | |||
| 1860 | Ga0209758_1012239 | |||
| 1861 | Ga0209256_1003962 | |||
| 1862 | Ga0209256_1013127 | |||
| 1863 | Ga0207426_1000354 | |||
| 1864 | Ga0207426_1000447 | |||
| 1865 | Ga0207426_1003427 | |||
| 1866 | Ga0207426_1004280 | |||
| 1867 | Ga0209257_1001262 | |||
| 1868 | Ga0209257_1064884 | |||
| 1869 | Ga0207656_10020378 | |||
| 1870 | Ga0207692_10001489 | |||
| 1871 | Ga0207642_10143416 | |||
| 1872 | Ga0207688_10090991 | |||
| 1873 | Ga0207647_10019007 | |||
| 1874 | Ga0207647_10095057 | |||
| 1875 | Ga0207647_10128573 | |||
| 1876 | Ga0207647_10186038 | |||
| 1877 | Ga0207647_10215618 | |||
| 1878 | Ga0207647_10249166 | |||
| 1879 | Ga0207685_10003252 | |||
| 1880 | Ga0207699_10006246 | |||
| 1881 | Ga0207699_10035636 | |||
| 1882 | Ga0207699_10412455 | |||
| 1883 | Ga0207645_10146099 | |||
| 1884 | Ga0207654_10194396 | |||
| 1885 | Ga0207707_10000827 | |||
| 1886 | Ga0207707_10002566 | |||
| 1887 | Ga0207707_10427961 | |||
| 1888 | Ga0207695_10001268 | |||
| 1889 | Ga0207695_10034685 | |||
| 1890 | Ga0207695_10217169 | |||
| 1891 | Ga0207695_10284239 | |||
| 1892 | Ga0207671_10035618 | |||
| 1893 | Ga0207671_10072431 | |||
| 1894 | Ga0207671_10096180 | |||
| 1895 | Ga0207671_10098760 | |||
| 1896 | Ga0207671_10411173 | |||
| 1897 | Ga0207693_10000565 | |||
| 1898 | Ga0207693_10038353 | |||
| 1899 | Ga0207693_10047306 | |||
| 1900 | Ga0207693_10300721 | |||
| 1901 | Ga0207663_10003532 | |||
| 1902 | Ga0207663_10180633 | |||
| 1903 | Ga0207663_10184937 | |||
| 1904 | Ga0207663_10248595 | |||
| 1905 | Ga0207663_10388809 | |||
| 1906 | Ga0207660_10001934 | |||
| 1907 | Ga0207660_10312940 | |||
| 1908 | Ga0207662_10107841 | |||
| 1909 | Ga0207657_10001315 | |||
| 1910 | Ga0207657_10058186 | |||
| 1911 | Ga0207657_10238645 | |||
| 1912 | Ga0207652_10001089 | |||
| 1913 | Ga0207652_10483385 | |||
| 1914 | Ga0207646_10105609 | |||
| 1915 | Ga0207694_10013374 | |||
| 1916 | Ga0207694_10057271 | |||
| 1917 | Ga0207694_10100380 | |||
| 1918 | Ga0207694_10150477 | |||
| 1919 | Ga0207694_10166699 | |||
| 1920 | Ga0207650_10050383 | |||
| 1921 | Ga0207650_10395791 | |||
| 1922 | Ga0207650_10554119 | |||
| 1923 | Ga0207687_10216949 | |||
| 1924 | Ga0207687_10261905 | |||
| 1925 | Ga0207700_10001452 | |||
| 1926 | Ga0207700_10003591 | |||
| 1927 | Ga0207700_10074358 | |||
| 1928 | Ga0207664_10027347 | |||
| 1929 | Ga0207664_10076768 | |||
| 1930 | Ga0207664_10372061 | |||
| 1931 | Ga0207644_10098349 | |||
| 1932 | Ga0207644_10195260 | |||
| 1933 | Ga0207644_10300355 | |||
| 1934 | Ga0207644_10360358 | |||
| 1935 | Ga0207690_10047179 | |||
| 1936 | Ga0207686_10423105 | |||
| 1937 | Ga0207709_10127840 | |||
| 1938 | Ga0207670_10133607 | |||
| 1939 | Ga0207670_10314499 | |||
| 1940 | Ga0207669_10259432 | |||
| 1941 | Ga0207665_10000127 | |||
| 1942 | Ga0207665_10029628 | |||
| 1943 | Ga0207665_10154968 | |||
| 1944 | Ga0207665_10174494 | |||
| 1945 | Ga0207691_10077623 | |||
| 1946 | Ga0207691_10198264 | |||
| 1947 | Ga0207711_10114332 | |||
| 1948 | Ga0207711_10127907 | |||
| 1949 | Ga0207711_10786049 | |||
| 1950 | Ga0207689_10070761 | |||
| 1951 | Ga0207661_10001422 | |||
| 1952 | Ga0207661_10122812 | |||
| 1953 | Ga0207661_10235943 | |||
| 1954 | Ga0207679_10589751 | |||
| 1955 | Ga0207667_10012575 | |||
| 1956 | Ga0207667_10072969 | |||
| 1957 | Ga0207667_10147895 | |||
| 1958 | Ga0207667_10166711 | |||
| 1959 | Ga0207667_10679273 | |||
| 1960 | Ga0207712_10057465 | |||
| 1961 | Ga0207712_10093050 | |||
| 1962 | Ga0207712_10177224 | |||
| 1963 | Ga0207668_10117877 | |||
| 1964 | Ga0207668_10186470 | |||
| 1965 | Ga0207640_10334363 | |||
| 1966 | Ga0207658_10044511 | |||
| 1967 | Ga0207658_10093331 | |||
| 1968 | Ga0207677_10038365 | |||
| 1969 | Ga0207677_10369299 | |||
| 1970 | Ga0207703_10104559 | |||
| 1971 | Ga0207639_10038223 | |||
| 1972 | Ga0207639_10169613 | |||
| 1973 | Ga0207639_10631308 | |||
| 1974 | Ga0207639_10943170 | |||
| 1975 | Ga0207678_10037444 | |||
| 1976 | Ga0207678_10085373 | |||
| 1977 | Ga0207678_10110846 | |||
| 1978 | Ga0207678_10120047 | |||
| 1979 | Ga0207708_10269013 | |||
| 1980 | Ga0207702_10000325 | |||
| 1981 | Ga0207702_10411177 | |||
| 1982 | Ga0207641_10186155 | |||
| 1983 | Ga0207641_10346921 | |||
| 1984 | Ga0207641_10455359 | |||
| 1985 | Ga0207648_10026143 | |||
| 1986 | Ga0207648_10094964 | |||
| 1987 | Ga0207674_10021123 | |||
| 1988 | Ga0207674_10147250 | |||
| 1989 | Ga0207675_100021098 | |||
| 1990 | Ga0207675_100033884 | |||
| 1991 | Ga0207675_100125057 | |||
| 1992 | Ga0207683_10042552 | |||
| 1993 | Ga0207683_10043308 | |||
| 1994 | Ga0207683_10106205 | |||
| 1995 | Ga0207683_10307777 | |||
| 1996 | Ga0207683_10381410 | |||
| 1997 | Ga0207683_10569160 | |||
| 1998 | Ga0207698_10103666 | |||
| 1999 | Ga0207698_10503482 | |||
| 2000 | Ga0209389_1000021 | |||
| 2001 | Ga0209389_1000086 | |||
| 2002 | Ga0209589_1000027 | |||
| 2003 | Ga0209489_100313 | |||
| 2004 | Ga0209489_105143 | |||
| 2005 | Ga0209700_100483 | |||
| 2006 | Ga0209179_1001603 | |||
| 2007 | Ga0209588_1005183 | |||
| 2008 | Ga0209813_10073923 | |||
| 2009 | Ga0207428_10000153 | |||
| 2010 | Ga0207428_10098549 | |||
| 2011 | Ga0268266_10001864 | |||
| 2012 | Ga0268266_10006918 | |||
| 2013 | Ga0268266_10014519 | |||
| 2014 | Ga0268266_10062975 | |||
| 2015 | Ga0268266_10317439 | |||
| 2016 | Ga0268265_10218137 | |||
| 2017 | Ga0268264_10000174 | |||
| 2018 | Ga0268264_10067965 | |||
| 2019 | Ga0268264_10155104 | |||
| 2020 | Ga0265326_10059103 | |||
| 2021 | Ga0265334_10024228 | |||
| 2022 | Ga0265334_10090418 | |||
| 2023 | Ga0265323_10002822 | |||
| 2024 | Ga0265336_10005738 | |||
| 2025 | Ga0307517_10000124 | |||
| 2026 | Ga0307515_10009381 | |||
| 2027 | Ga0265338_10001016 | |||
| 2028 | Ga0265339_10001394 | |||
| 2029 | Ga0265339_10054450 | |||
| 2030 | Ga0265331_10102459 | |||
| 2031 | Ga0307513_10153193 | |||
| 2032 | Ga0307513_10648399 | |||
| 2033 | Ga0307408_100447596 | |||
| 2034 | Ga0307508_10000063 | |||
| 2035 | Ga0307508_10144279 | |||
| 2036 | Ga0307508_10162486 | |||
| 2037 | Ga0265314_10002593 | |||
| 2038 | Ga0265314_10157186 | |||
| 2039 | Ga0265342_10063479 | |||
| 2040 | Ga0265342_10146097 | |||
| 2041 | Ga0307516_10035746 | |||
| 2042 | Ga0316045_107024 | |||
| 2043 | Ga0307412_10231177 | |||
| 2044 | Ga0307416_100721809 | |||
| 2045 | Ga0307411_10102847 | |||
| 2046 | Ga0307507_10033915 | |||
| 2047 | Ga0307510_10047759 | |||
| 2048 | Ga0307510_10067650 | |||
| 2049 | Ga0307510_10079158 | |||
| 2050 | Ga0307510_10179327 | |||
| 2051 | Ga0315911_1000041 | |||
| 2052 | Ga0373926_0055251 | |||
| 2053 | Ga0373934_0016039 | |||
| 2054 | Ga0373944_0038867 | |||
| 2055 | Ga0373923_0079043 | |||
| 2056 | Ga0373932_0038755 | |||
| 2057 | Ga0373936_0008700 | |||
| 2058 | Ga0373945_0097535 | |||
| 2059 | Ga0373953_0011700 | |||
| 2060 | Ga0373953_0017203 | |||
| 2061 | Ga0373954_0002485 | |||
| 2062 | Ga0373954_0002626 | |||
| 2063 | Ga0373956_0064383 | |||
| 2064 | Ga0373956_0108293 | |||
| 2065 | Ga0373957_0007070 | |||
| 2066 | Ga0373957_0202208 | |||
| 2067 | Ga0373960_0132965 | |||
| 2068 | Ga0373943_0023109 | |||
| 2069 | Ga0373943_0033966 | |||
| 2070 | Ga0373943_0169966 | |||
| 2071 | Ga0373946_0079414 | |||
| 2072 | Ga0373955_0003095 | |||
| 2073 | Ga0373955_0029659 | |||
| 2074 | Ga0373924_0007214 | |||
| 2075 | Ga0373924_0011253 | |||
| 2076 | Ga0373924_0144945 | |||
| 2077 | Ga0373931_0045065 | |||
| 2078 | Ga0373931_0464179 | |||
| 2079 | Ga0373935_0002137 | |||
| 2080 | Ga0373935_0032712 | |||
| 2081 | Ga0373935_0048301 | |||
| 2082 | Ga0373935_0213405 | |||
| 2083 | Ga0373927_0012355 | |||
| 2084 | Ga0373927_0017005 | |||
| 2085 | Ga0373927_0019441 | |||
| 2086 | Ga0373927_0026674 | |||
| 2087 | Ga0373927_0062498 | |||
| 2088 | Ga0373927_0096048 | |||
| 2089 | Ga0373927_0174958 | |||
| 2090 | Ga0373933_0001835 | |||
| 2091 | Ga0373933_0006528 | |||
| 2092 | Ga0373933_0009573 | |||
| 2093 | Ga0373933_0342226 | |||
| 2094 | Ga0373947_0033072 | |||
| 2095 | Ga0373947_0054441 | |||
| 2096 | Ga0373947_0066850 | |||
| 2097 | Ga0373947_0159889 | |||
| 2098 | Ga0373947_0275424 | |||
| 2099 | Ga0373937_0089606 | |||
| 2100 | Ga0373937_0232745 | |||
| 2101 | Ga0373937_0798680 | |||
| 2102 | Ga0373925_0001877 | |||
| 2103 | Ga0373925_0023145 | |||
| 2104 | Ga0373925_0802946 | |||
| 2105 | Ga0395899_0050606 | |||
| 2106 | Ga0395900_0009563 | |||
| 2107 | Ga0395900_0025652 | |||
| 2108 | Ga0395900_0226917 | |||
| 2109 | Ga0395900_0502955 | |||
| 2110 | Ga0395898_0040500 | |||
| 2111 | Ga0395898_0051337 | |||
| 2112 | Ga0395905_0005393 | |||
| 2113 | Ga0436364_0322463 | |||
| 2114 | Ga0436364_0421012 | |||
| 2115 | Ga0395901_0180976 | |||
| 2116 | Ga0395901_0437762 | |||
| 2117 | Ga0436365_0108820 | |||
| 2118 | Ga0436365_1361824 | |||
| 2119 | Ga0436365_1936582 | |||
| 2120 | Ga0436360_0582206 | |||
| 2121 | Ga0436360_0620676 | |||
| 2122 | Ga0436360_0701610 | |||
| 2123 | Ga0436361_0568203 | |||
| 2124 | Ga0436361_0657147 | |||
| 2125 | Ga0436361_0757415 | |||
| 2126 | Ga0436363_0158762 | |||
| 2127 | Ga0436363_0665946 | |||
| 2128 | Ga0436363_0827034 | |||
| 2129 | Ga0436363_1336752 | |||
| 2130 | Ga0436363_1697773 | |||
| 2131 | Ga0436362_0336193 | |||
| 2132 | Ga0439465_0072875 | |||
| 2133 | Ga0451802_0169913 | |||
| 2134 | Ga0450918_020862 | |||
| 2135 | Ga0451577_1064199 | |||
| 2136 | Ga0466972_0000268 | |||
| 2137 | Ga0466972_0010885 | |||
| 2138 | Ga0466972_0232184 | |||
| 2139 | Ga0466966_0052188 | |||
| 2140 | Ga0466961_0000311 | |||
| 2141 | Ga0466961_0042051 | |||
| 2142 | Ga0466963_0454104 | |||
| 2143 | Ga0466971_0274903 | |||
| 2144 | Ga0466968_0002021 | |||
| 2145 | Ga0466970_0012632 | |||
| 2146 | Ga0466970_0186319 | |||
| 2147 | Ga0466970_0353401 | |||
| 2148 | Ga0466960_0010159 | |||
| 2149 | Ga0466959_0045853 | |||
| 2150 | Ga0466959_0052297 | |||
| 2151 | Ga0466959_0126327 | |||
| 2152 | Ga0466959_0450840 | |||
| 2153 | Ga0451576_0015673 | |||
| 2154 | Ga0466967_0016558 | |||
| 2155 | Ga0466967_0082354 | |||
| 2156 | Ga0466967_0262376 | |||
| 2157 | Ga0466967_0353595 | |||
| 2158 | Ga0495617_005474 | |||
| 2159 | Ga0495592_0006884 | |||
| 2160 | Ga0495592_0080289 | |||
| 2161 | Ga0495592_0151879 | |||
| 2162 | Ga0495603_0003074 | |||
| 2163 | Ga0495603_0005432 | |||
| 2164 | Ga0495603_0062571 | |||
| 2165 | Ga0495603_0083049 | |||
| 2166 | Ga0495603_0129051 | |||
| 2167 | Ga0495603_0232934 | |||
| 2168 | Ga0495629_0000532 | |||
| 2169 | Ga0495629_0000913 | |||
| 2170 | Ga0495629_0013169 | |||
| 2171 | Ga0495638_0017480 | |||
| 2172 | Ga0495638_0022023 | |||
| 2173 | Ga0495641_0008153 | |||
| 2174 | Ga0495651_0018793 | |||
| 2175 | Ga0495651_0052377 | |||
| 2176 | Ga0495651_0068600 | |||
| 2177 | Ga0495651_0149459 | |||
| 2178 | Ga0495651_0150046 | |||
| 2179 | Ga0495651_0302379 | |||
| 2180 | Ga0495653_0010069 | |||
| 2181 | Ga0495653_0166213 | |||
| 2182 | Ga0495650_0110791 | |||
| 2183 | Ga0495580_0041291 | |||
| 2184 | Ga0495580_0056230 | |||
| 2185 | Ga0495582_0000331 | |||
| 2186 | Ga0495582_0169322 | |||
| 2187 | Ga0495605_0059800 | |||
| 2188 | Ga0495605_0161109 | |||
| 2189 | Ga0495605_0216166 | |||
| 2190 | Ga0495639_0000147 | |||
| 2191 | Ga0495639_0184197 | |||
| 2192 | Ga0495662_0000716 | |||
| 2193 | Ga0495662_0136179 | |||
| 2194 | Ga0495664_0004013 | |||
| 2195 | Ga0495664_0005574 | |||
| 2196 | Ga0495664_0036527 | |||
| 2197 | Ga0495664_0038112 | |||
| 2198 | Ga0495664_0270126 | |||
| 2199 | Ga0495594_0000113 | |||
| 2200 | Ga0495594_0291170 | |||
| 2201 | Ga0495607_0165028 | |||
| 2202 | Ga0495583_0090772 | |||
| 2203 | Ga0495606_0005723 | |||
| 2204 | Ga0495608_0004537 | |||
| 2205 | Ga0495608_0009049 | |||
| 2206 | Ga0495608_0077014 | |||
| 2207 | Ga0495610_0031207 | |||
| 2208 | Ga0495610_0038063 | |||
| 2209 | Ga0495610_0129064 | |||
| 2210 | Ga0495618_0010718 | |||
| 2211 | Ga0495618_0016158 | |||
| 2212 | Ga0495618_0059962 | |||
| 2213 | Ga0495620_0044370 | |||
| 2214 | Ga0495620_0119015 | |||
| 2215 | Ga0495628_0001092 | |||
| 2216 | Ga0495628_0062677 | |||
| 2217 | Ga0495628_0206105 | |||
| 2218 | Ga0495628_0239962 | |||
| 2219 | Ga0495628_0245717 | |||
| 2220 | Ga0495630_0004274 | |||
| 2221 | Ga0495630_0096705 | |||
| 2222 | Ga0495630_0579363 | |||
| 2223 | Ga0495631_0025217 | |||
| 2224 | Ga0495632_0096435 | |||
| 2225 | Ga0495632_0111837 | |||
| 2226 | Ga0495637_0031199 | |||
| 2227 | Ga0495643_0036114 | |||
| 2228 | Ga0495643_0191416 | |||
| 2229 | Ga0495643_0201458 | |||
| 2230 | Ga0495648_0000776 | |||
| 2231 | Ga0495648_0001514 | |||
| 2232 | Ga0495648_0111763 | |||
| 2233 | Ga0495642_0032875 | |||
| 2234 | Ga0495652_0021351 | |||
| 2235 | Ga0495652_0031369 | |||
| 2236 | Ga0495652_0073625 | |||
| 2237 | Ga0495652_0150525 | |||
| 2238 | Ga0495652_0275783 | |||
| 2239 | Ga0495654_0147632 | |||
| 2240 | Ga0495665_0000291 | |||
| 2241 | Ga0495665_0017301 | |||
| 2242 | Ga0495640_0005851 | |||
| 2243 | Ga0495640_0032424 | |||
| 2244 | Ga0495640_0050334 | |||
| 2245 | Ga0495640_0051488 | |||
| 2246 | Ga0495587_0007337 | |||
| 2247 | Ga0495587_0018944 | |||
| 2248 | Ga0495587_0021240 | |||
| 2249 | Ga0495587_0054532 | |||
| 2250 | Ga0495598_0042422 | |||
| 2251 | Ga0495609_0072648 | |||
| 2252 | Ga0495597_0133670 | |||
| 2253 | Ga0495645_0006636 | |||
| 2254 | Ga0495645_0006977 | |||
| 2255 | Ga0495645_0037792 | |||
| 2256 | Ga0495622_0004379 | |||
| 2257 | Ga0495622_0009802 | |||
| 2258 | Ga0495633_0139616 | |||
| 2259 | Ga0495667_0014817 | |||
| 2260 | Ga0495667_0038192 | |||
| 2261 | Ga0495667_0063781 | |||
| 2262 | Ga0495667_0158948 | |||
| 2263 | Ga0495667_0338480 | |||
| 2264 | Ga0495668_0053955 | |||
| 2265 | Ga0495668_0216692 | |||
| 2266 | Ga0495634_0003174 | |||
| 2267 | Ga0495634_0011850 | |||
| 2268 | Ga0495634_0226375 | |||
| 2269 | Ga0495611_0017586 | |||
| 2270 | Ga0495625_0000888 | |||
| 2271 | Ga0495625_0077443 | |||
| 2272 | Ga0495625_0357388 | |||
| 2273 | Ga0495635_0000491 | |||
| 2274 | Ga0495635_0007428 | |||
| 2275 | Ga0495635_0028493 | |||
| 2276 | Ga0495635_0178771 | |||
| 2277 | Ga0495659_0019004 | |||
| 2278 | Ga0495659_0080509 | |||
| 2279 | Ga0495588_0012745 | |||
| 2280 | Ga0495588_0057864 | |||
| 2281 | Ga0495588_0208071 | |||
| 2282 | Ga0495657_0011578 | |||
| 2283 | Ga0495657_0021093 | |||
| 2284 | Ga0495657_0023411 | |||
| 2285 | Ga0495657_0176096 | |||
| 2286 | Ga0495599_0019185 | |||
| 2287 | Ga0495599_0023100 | |||
| 2288 | Ga0495599_0078126 | |||
| 2289 | Ga0495599_0122084 | |||
| 2290 | Ga0495623_0115298 | |||
| 2291 | Ga0495623_0120508 | |||
| 2292 | Ga0495646_0031381 | |||
| 2293 | Ga0495646_0040428 | |||
| 2294 | Ga0495646_0049680 | |||
| 2295 | Ga0495646_0165379 | |||
| 2296 | Ga0495646_0254712 | |||
| 2297 | Ga0495647_0007692 | |||
| 2298 | Ga0495647_0016960 | |||
| 2299 | Ga0495647_0042172 | |||
| 2300 | Ga0495658_0001211 | |||
| 2301 | Ga0495658_0007033 | |||
| 2302 | Ga0495658_0327898 | |||
| 2303 | Ga0495613_0002051 | |||
| 2304 | Ga0495613_0104978 | |||
| 2305 | Ga0495613_0109386 | |||
| 2306 | Ga0495613_0249616 | |||
| 2307 | Ga0495624_0008987 | |||
| 2308 | Ga0495624_0053556 | |||
| 2309 | Ga0495624_0242967 | |||
| 2310 | Ga0495624_0304827 | |||
| 2311 | Ga0495600_0008599 | |||
| 2312 | Ga0495600_0080311 | |||
| 2313 | Ga0495600_0103729 | |||
| 2314 | Ga0495581_0000620 | |||
| 2315 | Ga0495581_0025894 | |||
| 2316 | Ga0495581_0154759 | |||
| 2317 | Ga0495581_0229963 | |||
| 2318 | Ga0495604_0005882 | |||
| 2319 | Ga0495604_0034678 | |||
| 2320 | Ga0495604_0147868 | |||
| 2321 | Ga0495674_0001226 | |||
| 2322 | Ga0495674_0004909 | |||
| 2323 | Ga0495674_0023635 | |||
| 2324 | Ga0495674_0074047 | |||
| 2325 | Ga0495674_0111936 | |||
| 2326 | Ga0495672_0088113 | |||
| 2327 | Ga0495672_0224730 | |||
| 2328 | Ga0495672_0242940 | |||
| 2329 | Ga0495676_0044749 | |||
| 2330 | Ga0495676_0111442 | |||
| 2331 | Ga0495676_0145248 | |||
| 2332 | Ga0495676_0216065 | |||
| 2333 | Ga0495676_0417388 | |||
| 2334 | Ga0495680_0006961 | |||
| 2335 | Ga0495680_0025019 | |||
| 2336 | Ga0495680_0095272 | |||
| 2337 | Ga0495683_0188214 | |||
| 2338 | Ga0495675_0005368 | |||
| 2339 | Ga0495675_0016604 | |||
| 2340 | Ga0495675_0039087 | |||
| 2341 | Ga0495685_152001 | |||
| 2342 | Ga0495673_0038526 | |||
| 2343 | Ga0495673_0042363 | |||
| 2344 | Ga0495673_0043580 | |||
| 2345 | Ga0495684_0000897 | |||
| 2346 | Ga0495684_0052148 | |||
| 2347 | Ga0495684_0172219 | |||
| 2348 | Ga0495686_0018504 | |||
| 2349 | Ga0495686_0051010 | |||
| 2350 | Ga0495686_0060450 | |||
| 2351 | Ga0495686_0127067 | |||
| 2352 | Ga0495686_0226041 | |||
| 2353 | Ga0495593_0000389 | |||
| 2354 | Ga0495593_0113880 | |||
| 2355 | Ga0495602_0000296 | |||
| 2356 | Ga0495602_0013144 | |||
| 2357 | Ga0495602_0048749 | |||
| 2358 | Ga0495626_0044330 | |||
| 2359 | Ga0496100_0012832 | |||
| 2360 | Ga0496100_0046173 | |||
| 2361 | Ga0496100_0067873 | |||
| 2362 | Ga0496100_0288218 | |||
| 2363 | Ga0496100_0305044 | |||
| 2364 | Ga0496101_0059039 | |||
| 2365 | Ga0496102_0052153 | |||
| 2366 | Ga0496102_0092413 | |||
| 2367 | Ga0496102_0093921 | |||
| 2368 | Ga0496103_0087932 | |||
| 2369 | Ga0496103_0425452 | |||
| 2370 | Ga0496103_0451226 | |||
| 2371 | Ga0496104_0009605 | |||
| 2372 | Ga0496104_0011964 | |||
| 2373 | Ga0496104_0031565 | |||
| 2374 | Ga0496104_0057600 | |||
| 2375 | Ga0496104_0115515 | |||
| 2376 | Ga0496104_0158543 | |||
| 2377 | Ga0496105_0023344 | |||
| 2378 | Ga0496105_0036534 | |||
| 2379 | Ga0496105_0054431 | |||
| 2380 | Ga0496105_0069715 | |||
| 2381 | Ga0496105_0110603 | |||
| 2382 | Ga0496105_0157413 | |||
| 2383 | Ga0496106_0006109 | |||
| 2384 | Ga0496106_0011496 | |||
| 2385 | Ga0496106_0011990 | |||
| 2386 | Ga0496106_0135844 | |||
| 2387 | Ga0496107_0018364 | |||
| 2388 | Ga0496107_0028844 | |||
| 2389 | Ga0496107_0033816 | |||
| 2390 | Ga0496107_0083233 | |||
| 2391 | Ga0496107_0089542 | |||
| 2392 | Ga0496107_0265871 | |||
| 2393 | Ga0496107_0296295 | |||
| 2394 | Ga0496108_0000764 | |||
| 2395 | Ga0496108_0009713 | |||
| 2396 | Ga0496108_0028405 | |||
| 2397 | Ga0496108_0270666 | |||
| 2398 | Ga0496108_0743687 | |||
| 2399 | Ga0496109_0004357 | |||
| 2400 | Ga0496109_0009522 | |||
| 2401 | Ga0496109_0009612 | |||
| 2402 | Ga0496109_0022973 | |||
| 2403 | Ga0496109_0056204 | |||
| 2404 | Ga0496109_0068250 | |||
| 2405 | Ga0496109_0197123 | |||
| 2406 | Ga0496109_0387945 | |||
| 2407 | Ga0496110_0027878 | |||
| 2408 | Ga0496110_0070020 | |||
| 2409 | Ga0496110_0078286 | |||
| 2410 | Ga0496110_0083574 | |||
| 2411 | Ga0496110_0379849 | |||
| 2412 | Ga0496110_0394115 | |||
| 2413 | Ga0496110_0428776 | |||
| 2414 | Ga0496111_0001105 | |||
| 2415 | Ga0496111_0011921 | |||
| 2416 | Ga0496111_0049580 | |||
| 2417 | Ga0496111_0173121 | |||
| 2418 | Ga0496112_0000052 | |||
| 2419 | Ga0496112_0004212 | |||
| 2420 | Ga0496112_0004915 | |||
| 2421 | Ga0496112_0013107 | |||
| 2422 | Ga0496112_0023568 | |||
| 2423 | Ga0496112_0025554 | |||
| 2424 | Ga0496112_0026567 | |||
| 2425 | Ga0496112_0038470 | |||
| 2426 | Ga0496112_0125607 | |||
| 2427 | Ga0496113_0002366 | |||
| 2428 | Ga0496113_0045330 | |||
| 2429 | Ga0496113_0159709 | |||
| 2430 | Ga0496113_0490827 | |||
| 2431 | Ga0496113_0759438 | |||
| 2432 | Ga0496114_0037653 | |||
| 2433 | Ga0496114_0118920 | |||
| 2434 | Ga0496114_0175359 | |||
| 2435 | Ga0496114_0244542 | |||
| 2436 | Ga0496114_0379366 | |||
| 2437 | Ga0496115_0009221 | |||
| 2438 | Ga0496115_0061653 | |||
| 2439 | Ga0496115_0185245 | |||
| 2440 | Ga0496115_0279239 | |||
| 2441 | Ga0496116_0005214 | |||
| 2442 | Ga0496116_0040362 | |||
| 2443 | Ga0496117_0016824 | |||
| 2444 | Ga0496117_0219159 | |||
| 2445 | Ga0496117_0260907 | |||
| 2446 | Ga0496118_0019126 | |||
| 2447 | Ga0496118_0072041 | |||
| 2448 | Ga0496118_0197593 | |||
| 2449 | Ga0496118_0263421 | |||
| 2450 | Ga0496119_0010049 | |||
| 2451 | Ga0496119_0059543 | |||
| 2452 | Ga0496119_0201349 | |||
| 2453 | Ga0496120_0219816 | |||
| 2454 | Ga0496121_0001057 | |||
| 2455 | Ga0496121_0001543 | |||
| 2456 | Ga0496121_0009515 | |||
| 2457 | Ga0496121_0017186 | |||
| 2458 | Ga0496121_0020788 | |||
| 2459 | Ga0496121_0047906 | |||
| 2460 | Ga0496121_0054922 | |||
| 2461 | Ga0496121_0094560 | |||
| 2462 | Ga0496121_0288475 | |||
| 2463 | Ga0496122_0000063 | |||
| 2464 | Ga0496122_0000375 | |||
| 2465 | Ga0496122_0057569 | |||
| 2466 | Ga0496123_0000117 | |||
| 2467 | Ga0496123_0000267 | |||
| 2468 | Ga0496123_0091273 | |||
| 2469 | Ga0496124_0127208 | |||
| 2470 | Ga0496124_0158870 | |||
| 2471 | Ga0496124_0197816 | |||
| 2472 | Ga0496124_0299559 | |||
| 2473 | Ga0496125_0000694 | |||
| 2474 | Ga0496125_0010987 | |||
| 2475 | Ga0496125_0015170 | |||
| 2476 | Ga0496125_0047355 | |||
| 2477 | Ga0496125_0105823 | |||
| 2478 | Ga0496125_0151299 | |||
| 2479 | Ga0496125_0152594 | |||
| 2480 | Ga0496125_0276335 | |||
| 2481 | Ga0496126_0005900 | |||
| 2482 | Ga0496126_0011116 | |||
| 2483 | Ga0496126_0016331 | |||
| 2484 | Ga0496126_0018583 | |||
| 2485 | Ga0496126_0037396 | |||
| 2486 | Ga0496126_0059599 | |||
| 2487 | Ga0496126_0077667 | |||
| 2488 | Ga0496126_0102738 | |||
| 2489 | Ga0496126_0104250 | |||
| 2490 | Ga0496126_0105850 | |||
| 2491 | Ga0496126_0135635 | |||
| 2492 | Ga0496126_0147005 | |||
| 2493 | Ga0496126_0312937 | |||
| 2494 | Ga0496126_0467551 | |||
| 2495 | Ga0496126_0730971 | |||
| 2496 | Ga0495682_0042087 | |||
| 2497 | Ga0501031_0000655 | |||
| 2498 | Ga0501031_0001803 | |||
| 2499 | Ga0501031_0163876 | |||
| 2500 | Ga0501031_0428737 | |||
| 2501 | Ga0501032_0000161 | |||
| 2502 | Ga0501032_0159161 | |||
| 2503 | Ga0501032_0182983 | |||
| 2504 | Ga0501033_0000672 | |||
| 2505 | Ga0501033_0001580 | |||
| 2506 | Ga0501033_0006379 | |||
| 2507 | Ga0501034_0000072 | |||
| 2508 | Ga0501034_0024633 | |||
| 2509 | Ga0501036_0000250 | |||
| 2510 | Ga0501036_0265193 | |||
| 2511 | Ga0501037_0000030 | |||
| 2512 | Ga0501037_0001059 | |||
| 2513 | Ga0501037_0033396 | |||
| 2514 | Ga0501037_0116571 | |||
| 2515 | Ga0501038_0000826 | |||
| 2516 | Ga0501038_0004208 | |||
| 2517 | Ga0501038_0057490 | |||
| 2518 | Ga0501038_0074567 | |||
| 2519 | Ga0501038_0205716 | |||
| 2520 | Ga0501039_0012015 | |||
| 2521 | Ga0501040_0500770 | |||
| 2522 | Ga0501041_0151158 | |||
| 2523 | Ga0501042_0073646 | |||
| 2524 | Ga0501043_0000357 | |||
| 2525 | Ga0501043_0023451 | |||
| 2526 | Ga0501043_0579497 | |||
| 2527 | Ga0501046_0023974 | |||
| 2528 | Ga0501046_0091706 | |||
| 2529 | Ga0501046_0326812 | |||
| 2530 | Ga0501047_0001531 | |||
| 2531 | Ga0501047_0013515 | |||
| 2532 | Ga0501047_0208882 | |||
| 2533 | Ga0501048_0000477 | |||
| 2534 | Ga0501067_0000068 | |||
| 2535 | Ga0501067_0083381 | |||
| 2536 | Ga0501068_0001116 | |||
| 2537 | Ga0501070_0002354 | |||
| 2538 | Ga0501070_0042138 | |||
| 2539 | Ga0501070_0204948 | |||
| 2540 | Ga0501072_0000835 | |||
| 2541 | Ga0501072_0258072 | |||
| 2542 | Ga0501072_0300148 | |||
| 2543 | Ga0501073_0000009 | |||
| 2544 | Ga0501073_0114093 | |||
| 2545 | Ga0501073_0222140 | |||
| 2546 | Ga0501073_0309438 | |||
| 2547 | Ga0501074_0000716 | |||
| 2548 | Ga0501079_0000251 | |||
| 2549 | Ga0501080_0004321 | |||
| 2550 | Ga0501080_0083252 | |||
| 2551 | Ga0501080_0311972 | |||
| 2552 | Ga0501083_0039237 | |||
| 2553 | Ga0501280_000775 | |||
| 2554 | Ga0501035_0000067 | |||
| 2555 | Ga0501035_0035252 | |||
| 2556 | Ga0501035_0036075 | |||
| 2557 | Ga0501035_0122045 | |||
| 2558 | Ga0501035_0329252 | |||
| 2559 | Ga0501035_0373790 | |||
| 2560 | Ga0501044_0002804 | |||
| 2561 | Ga0501044_0004858 | |||
| 2562 | Ga0501044_0064150 | |||
| 2563 | Ga0501044_0142659 | |||
| 2564 | Ga0501044_0622559 | |||
| 2565 | Ga0501044_0645009 | |||
| 2566 | Ga0501045_0164291 | |||
| 2567 | nmdc:mga03683_16686_c1 | |||
| 2568 | nmdc:mga03n38_533_c1 | |||
| 2569 | nmdc:mga00v17_23676_c1 | |||
| 2570 | nmdc:mga00v17_26685_c1 | |||
| 2571 | nmdc:mga00v17_43888_c1 | |||
| 2572 | nmdc:mga00v17_79611_c1 | |||
| 2573 | nmdc:mga0yw44_141158_c1 | |||
| 2574 | nmdc:mga0yw44_4925_c2 | |||
| 2575 | nmdc:mga0yw44_96245_c1 | |||
| 2576 | nmdc:mga0k408_120724_c1 | |||
| 2577 | nmdc:mga0k408_237919_c1 | |||
| 2578 | nmdc:mga0k408_274974_c1 | |||
| 2579 | nmdc:mga06z11_100307_c1 | |||
| 2580 | nmdc:mga06z11_21201_c1 | |||
| 2581 | nmdc:mga06z11_250804_c1 | |||
| 2582 | nmdc:mga06z11_345722_c1 | |||
| 2583 | nmdc:mga06z11_35246_c1 | |||
| 2584 | nmdc:mga07m45_139324_c1 | |||
| 2585 | nmdc:mga07m45_2114_c1 | |||
| 2586 | nmdc:mga07m45_241183_c1 | |||
| 2587 | nmdc:mga07m45_40194_c1 | |||
| 2588 | nmdc:mga05p37_734481_c1 | |||
| 2589 | nmdc:mga0qj67_227519_c1 | |||
| 2590 | nmdc:mga08y16_34_c1 | |||
| 2591 | nmdc:mga0n895_586141_c1 | |||
| 2592 | nmdc:mga0n895_8338_c1 | |||
| 2593 | nmdc:mga08x19_220984_c1 | |||
| 2594 | nmdc:mga0sz30_10116_c1 | |||
| 2595 | nmdc:mga0sz30_167649_c1 | |||
| 2596 | Ga0495601_0000749 | |||
| 2597 | Ga0495601_0015596 | |||
| 2598 | Ga0495601_0134564 | |||
| 2599 | Ga0495601_0209693 | |||
| 2600 | Ga0495601_0374656 | |||
| 2601 | Ga0495612_0000707 | |||
| 2602 | Ga0495612_0040544 | |||
| 2603 | Ga0495612_0061626 | |||
| 2604 | Ga0495612_0076464 | |||
| 2605 | Ga0495612_0241613 | |||
| 2606 | Ga0500635_0007052 | |||
| 2607 | Ga0495595_0019377 | |||
| 2608 | Ga0495595_0020690 | |||
| 2609 | Ga0495595_0025669 | |||
| 2610 | Ga0495595_0029233 | |||
| 2611 | Ga0495595_0241509 | |||
| 2612 | Ga0495619_0010830 | |||
| 2613 | Ga0495619_0039935 | |||
| 2614 | Ga0495619_0063210 | |||
| 2615 | Ga0495619_0117863 | |||
| 2616 | Ga0495619_0133930 | |||
| 2617 | Ga0495619_0447829 | |||
| 2618 | Ga0500578_0155667 | |||
| 2619 | Ga0500643_000016 | |||
| 2620 | Ga0500643_079769 | |||
| 2621 | Ga0500644_0008381 | |||
| 2622 | Ga0500646_0041940 | |||
| 2623 | Ga0500651_0071542 | |||
| 2624 | Ga0500566_0000751 | |||
| 2625 | Ga0500566_0003091 | |||
| 2626 | Ga0500566_0105695 | |||
| 2627 | Ga0500566_0123505 | |||
| 2628 | Ga0500641_0001845 | |||
| 2629 | Ga0500641_0008013 | |||
| 2630 | Ga0500641_0067011 | |||
| 2631 | Ga0500641_0097233 | |||
| 2632 | Ga0500648_094847 | |||
| 2633 | Ga0500650_0004589 | |||
| 2634 | Ga0500555_008692 | |||
| 2635 | Ga0500556_0000238 | |||
| 2636 | Ga0500556_0064238 | |||
| 2637 | Ga0500557_003716 | |||
| 2638 | Ga0500562_038244 | |||
| 2639 | Ga0500569_006994 | |||
| 2640 | Ga0500569_014547 | |||
| 2641 | Ga0500572_000585 | |||
| 2642 | Ga0500592_000799 | |||
| 2643 | Ga0500592_024540 | |||
| 2644 | Ga0500595_002375 | |||
| 2645 | Ga0500595_003407 | |||
| 2646 | Ga0500595_007814 | |||
| 2647 | Ga0500595_019669 | |||
| 2648 | Ga0500608_004588 | |||
| 2649 | Ga0500617_148009 | |||
| 2650 | Ga0500618_032582 | |||
| 2651 | Ga0500626_067116 | |||
| 2652 | Ga0500642_0000092 | |||
| 2653 | Ga0500642_0000109 | |||
| 2654 | Ga0500652_001613 | |||
| 2655 | Ga0500559_0000492 | |||
| 2656 | Ga0500559_0029582 | |||
| 2657 | Ga0500559_0062637 | |||
| 2658 | Ga0500568_0002222 | |||
| 2659 | Ga0500568_0045737 | |||
| 2660 | Ga0500568_0079638 | |||
| 2661 | Ga0500573_0006467 | |||
| 2662 | Ga0500577_0000135 | |||
| 2663 | Ga0500579_114888 | |||
| 2664 | Ga0500586_001127 | |||
| 2665 | Ga0500590_021786 | |||
| 2666 | Ga0500590_040995 | |||
| 2667 | Ga0500590_091519 | |||
| 2668 | Ga0500604_0062277 | |||
| 2669 | Ga0500616_0000197 | |||
| 2670 | Ga0500616_0260809 | |||
| 2671 | Ga0500622_0000966 | |||
| 2672 | Ga0500622_0025854 | |||
| 2673 | Ga0500627_0030431 | |||
| 2674 | Ga0500633_0022583 | |||
| 2675 | Ga0500634_0012476 | |||
| 2676 | Ga0500634_0019449 | |||
| 2677 | Ga0500638_004107 | |||
| 2678 | Ga0500636_0003333 | |||
| 2679 | Ga0500636_0026379 | |||
| 2680 | Ga0500636_0036683 | |||
| 2681 | Ga0500636_0077322 | |||
| 2682 | Ga0500637_0000090 | |||
| 2683 | Ga0500637_0094288 | |||
| 2684 | Ga0500637_0282160 | |||
| 2685 | Ga0500625_022262 | |||
| 2686 | Ga0500645_026052 | |||
| 2687 | Ga0500645_062200 | |||
| 2688 | Ga0500609_004261 | |||
| 2689 | Ga0500609_018634 | |||
| 2690 | Ga0500596_000284 | |||
| 2691 | Ga0500599_002093 | |||
| 2692 | Ga0500601_000997 | |||
| 2693 | Ga0501084_0012720 | |||
| 2694 | Ga0590077_025092 | |||
| 2695 | Ga0501082_0008921 | |||
| 2696 | Ga0466962_0067990 | |||
| 2697 | Ga0466962_0186089 | |||
| 2698 | 2507511372 | |||
| 2699 | 2508545166 | |||
| 2700 | 2508694009 | |||
| 2701 | 2509074743 | |||
| 2702 | 2509146650 | |||
| 2703 | 2511248911 | |||
| 2704 | 2511394253 | |||
| 2705 | 2513624147 | |||
| 2706 | 2513641110 | |||
| 2707 | 2513648539 | |||
| 2708 | 2513656083 | |||
| 2709 | 2513675266 | |||
| 2710 | 2513696383 | |||
| 2711 | 2513702622 | |||
| 2712 | 2513717832 | |||
| 2713 | 2513862889 | |||
| 2714 | 2513887693 | |||
| 2715 | 2513920908 | |||
| 2716 | 2517101114 | |||
| 2717 | 2517895904 | |||
| 2718 | 2524439944 | |||
| 2719 | 2524469134 | |||
| 2720 | 2524534772 | |||
| 2721 | 2528853992 | |||
| 2722 | 2535518040 | |||
| 2723 | 2550697216 | |||
| 2724 | 2603857526 | |||
| 2725 | 2617348475 | |||
| 2726 | 2617375020 | |||
| 2727 | 2644287239 | |||
| 2728 | 2671122695 | |||
| 2729 | 2671693394 | |||
| 2730 | 2723842889 | |||
| 2731 | 2728754209 | |||
| 2732 | 2745075775 | |||
| 2733 | 2765464362 | |||
| 2734 | 2770194713 | |||
| 2735 | 2776272502 | |||
| 2736 | 2776284442 | |||
| 2737 | 2793061666 | |||
| 2738 | 2793069670 | |||
| 2739 | 2793080229 | |||
| 2740 | 2818243421 | |||
| 2741 | 2819591372 | |||
| 2742 | 2824609163 | |||
| 2743 | 2824616848 | |||
| 2744 | 2824624998 | |||
| 2745 | 2824633865 | |||
| 2746 | 2824641021 | |||
| 2747 | 2824651537 | |||
| 2748 | 2824661142 | |||
| 2749 | 2824668414 | |||
| 2750 | 2824683647 | |||
| 2751 | 2824711470 | |||
| 2752 | 2824721520 | |||
| 2753 | 2824728288 | |||
| 2754 | 2824739573 | |||
| 2755 | 2824751854 | |||
| 2756 | 2824754185 | |||
| 2757 | 2824773242 | |||
| 2758 | 2824780583 | |||
| 2759 | 2839994278 | |||
| 2760 | 2840769320 | |||
| 2761 | 2841961530 | |||
| 2762 | 2842042336 | |||
| 2763 | 2842050379 | |||
| 2764 | 2844316540 | |||
| 2765 | 2847939150 | |||
| 2766 | 2849081872 | |||
| 2767 | 2857512631 | |||
| 2768 | 2857526913 | |||
| 2769 | 2874606449 | |||
| 2770 | 2874613957 | |||
| 2771 | 2874625617 | |||
| 2772 | 2874633719 | |||
| 2773 | 2876766327 | |||
| 2774 | 2876809978 | |||
| 2775 | 2879084622 | |||
| 2776 | 2879100819 | |||
| 2777 | 2879113715 | |||
| 2778 | 2881367322 | |||
| 2779 | 2881668712 | |||
| 2780 | 2884815253 | |||
| 2781 | 2884815264 | |||
| 2782 | 2884837171 | |||
| 2783 | 2884853463 | |||
| 2784 | 2885373763 | |||
| 2785 | 2885377854 | |||
| 2786 | 2888386926 | |||
| 2787 | 2888389621 | |||
| 2788 | 2888421467 | |||
| 2789 | 2889033803 | |||
| 2790 | 2893070070 | |||
| 2791 | 2896155420 | |||
| 2792 | 2903731402 | |||
| 2793 | 2903756009 | |||
| 2794 | 2903771445 | |||
| 2795 | 2904579048 | |||
| 2796 | 2904673563 | |||
| 2797 | 2904693383 | |||
| 2798 | 2904707037 | |||
| 2799 | 2904719516 | |||
| 2800 | 2906603776 | |||
| 2801 | 2906615631 | |||
| 2802 | 2906626723 | |||
| 2803 | 2906635584 | |||
| 2804 | 2906646122 | |||
| 2805 | 2906665064 | |||
| 2806 | 2908745548 | |||
| 2807 | 2908763537 | |||
| 2808 | 2908777504 | |||
| 2809 | 2919078030 | |||
| 2810 | 2919122124 | |||
| 2811 | 2922367203 | |||
| 2812 | 2922377058 | |||
| 2813 | 2922390070 | |||
| 2814 | 2922398212 | |||
| 2815 | 2922432375 | |||
| 2816 | 2928521936 | |||
| 2817 | 2929619109 | |||
| 2818 | 2929628396 | |||
| 2819 | 2932791316 | |||
| 2820 | 2932795744 | |||
| 2821 | 2932801982 | |||
| 2822 | 2932817658 | |||
| 2823 | 2932826944 | |||
| 2824 | 2932833115 | |||
| 2825 | 2933581031 | |||
| 2826 | 2935612301 | |||
| 2827 | 2935623844 | |||
| 2828 | 2935630797 | |||
| 2829 | 2935639619 | |||
| 2830 | 2935650141 | |||
| 2831 | 2935658288 | |||
| 2832 | 2935667542 | |||
| 2833 | 2935682895 | |||
| 2834 | 2935687558 | |||
| 2835 | 2935696470 | |||
| 2836 | 2935705283 | |||
| 2837 | 2935719018 | |||
| 2838 | 2935728670 | |||
| 2839 | 2935736734 | |||
| 2840 | 2935746264 | |||
| 2841 | 2935753524 | |||
| 2842 | 2935767721 | |||
| 2843 | 2935770483 | |||
| 2844 | 2935782490 | |||
| 2845 | 2935786464 | |||
| 2846 | 2935794519 | |||
| 2847 | 2935807028 | |||
| 2848 | 2935814057 | |||
| 2849 | 2935823789 | |||
| 2850 | 2935829101 | |||
| 2851 | 2935845364 | |||
| 2852 | 2935854427 | |||
| 2853 | 2935861931 | |||
| 2854 | 2935872819 | |||
| 2855 | 2935880394 | |||
| 2856 | 2935886170 | |||
| 2857 | 2935913479 | |||
| 2858 | 2935923376 | |||
| 2859 | 2935931204 | |||
| 2860 | 2935935486 | |||
| 2861 | 2935947052 | |||
| 2862 | 2935953853 | |||
| 2863 | 2935961510 | |||
| 2864 | 2935968879 | |||
| 2865 | 2935985920 | |||
| 2866 | 2935995004 | |||
| 2867 | 2936006097 | |||
| 2868 | 2936013300 | |||
| 2869 | 2936021613 | |||
| 2870 | 2936030593 | |||
| 2871 | 2936039612 | |||
| 2872 | 2936047807 | |||
| 2873 | 2936057809 | |||
| 2874 | 2940559437 | |||
| 2875 | 2941507449 | |||
| 2876 | 2941515876 | |||
| 2877 | 2941523416 | |||
| 2878 | 2941537005 | |||
| 2879 | 2941545665 | |||
| 2880 | 2954014707 | |||
| 2881 | 3002142675 | |||
| 2882 | 3005476663 | |||
| 2883 | 3005489140 | |||
| 2884 | 3005511194 | |||
| 2885 | 3005592045 | |||
| 2886 | 3005596170 | |||
| 2887 | 3005712109 | |||
| 2888 | 3005719350 | |||
| 2889 | 8005264703 | |||
| 2890 | 8005327197 | |||
| 2891 | 8006934816 | |||
| 2892 | 8006966721 | |||
| 2893 | 8006974784 | |||
| 2894 | 8006989640 | |||
| 2895 | 8006998023 | |||
| 2896 | 8016516924 | |||
| 2897 | 8016524504 | |||
| 2898 | 8016538064 | |||
| 2899 | 8016542340 | |||
| 2900 | 8016550937 | |||
| 2901 | 8016559350 | |||
| 2902 | 8016567727 | |||
| 2903 | 8016580421 | |||
| 2904 | 8016588631 | |||
| 2905 | 8016597291 | |||
| 2906 | 8016604968 | |||
| 2907 | 8016620043 | |||
| 2908 | 8016624262 | |||
| 2909 | 8016637671 | |||
| 2910 | 8017059646 | |||
| 2911 | 8019537732 | |||
| 2912 | 8019539362 | |||
| 2913 | 8019563838 | |||
| 2914 | 8019573907 | |||
| 2915 | 8019579120 | |||
| 2916 | 8019597174 | |||
| 2917 | 8019604517 | |||
| 2918 | 8019650393 | |||
| 2919 | 8019694562 | |||
| 2920 | 8055749633 | |||
| 2921 | 8056675058 | |||
| 2922 | 8056681855 | |||
| 2923 | 8056696253 | |||
| 2924 | 8056973848 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gwb-assembly1.cif.gz_A-2 | crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 | 0.9656 | 51 | 201 |
| 3bqg-assembly1.cif.gz_A | structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) | 0.9524 | 49 | 201 |
| 3bqe-assembly1.cif.gz_A | structure of the central domain (msra) of neisseria meningitidis pilb (reduced form) | 0.9496 | 49 | 201 |
| 1nwa-assembly1.cif.gz_A | structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine | 0.9493 | 49 | 201 |
| 7e43-assembly2.cif.gz_A | structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori | 0.9473 | 49 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9599 | 51 | 198 | 3.30.1060.10 |
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.941 | 51 | 198 | 3.30.1060.10 |
| af_P9WJM5_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9361 | 47 | 205 | 3.30.1060.10 |
| af_B6TNT5_14_185_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9112 | 43 | 202 | 3.30.1060.10 |
| af_Q09859_1_167_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9069 | 51 | 208 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5W4M2-F1-model_v4 | deleted | 0.9965 | 53 | 231 |
|
| AF-A0A2L1CRP3-F1-model_v4 | deleted | 0.9963 | 30 | 233 |
|
| AF-A0A2V7ITR3-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9937 | 53 | 225 |
GO:0008113
GO:0033744 GO:0036211 |
| AF-A0A7Z1N7L7-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9934 | 77 | 225 |
GO:0008113
|
| AF-A0A522GLU1-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9929 | 40 | 231 |
GO:0008113
GO:0033744 GO:0036211 |