F494151

General Info

Members Datasets Scaffolds Average Seq Length
1464 391 2928 315

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100000317|Ga0070696_10000031710
Length 333
Sequence LTDVRGHRVDNGAADENITQRVSTEGADLLTLAGVNDSNLLELSRLFGVKVSLRGEAMVISGASEFVQRATGVGRRMVEIARQRDELTPDDVLRLGDDPLADRDNGESPGDGVTRIALPGTRKVIQAKTNGQAEYLVKIAENDIVVGIGPAGTGKTYLAVAAAVDAFTKKRVRRIVLARPAVEAGENLGFLPGDMQAKVDPYLRPLYDALDDMMPFEKVQRALETRTIEVAPLAFMRGRTLNDAFVIVDEAQNATAMQMKMLLTRLGVNSRMVITGDKTQVDLPKGESGLTQVERLLPGIDGIAFQYFNETDVVRHRLVRDIIRAYESEEAKA

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
201 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
202 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
207 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
208 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
218 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
241 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
250 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
251 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
252 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
256 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
263 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
264 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
265 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
330 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
355 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
356 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
357 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
358 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
359 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
360 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
361 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
367 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
368 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
369 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
370 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.07
Nodule 0
Rhizoplane 4.03
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100000317 3300005546 Bacteria 29318
2 Ga0058863_11613365 3300004799 Bacteria 1749
3 Ga0058863_11923594 3300004799 Bacteria 1081
4 Ga0058862_10074850 3300004803 Bacteria 1310
5 Ga0065715_10125066 3300005293 Bacteria 2139
6 Ga0065715_10171985 3300005293 Bacteria 1540
7 Ga0065715_10210423 3300005293 Bacteria 1317
8 Ga0065707_10179456 3300005295 Bacteria 1428
9 Ga0070658_10002410 3300005327 Bacteria 15652
10 Ga0070658_10009372 3300005327 Bacteria 7866
11 Ga0070658_10019543 3300005327 Bacteria 5424
12 Ga0070658_10119251 3300005327 Bacteria 2191
13 Ga0070658_10138528 3300005327 Bacteria 2032
14 Ga0070658_10151769 3300005327 Bacteria 1940
15 Ga0070676_10001069 3300005328 Bacteria 13653
16 Ga0070676_10039372 3300005328 Bacteria 2734
17 Ga0070676_10092138 3300005328 Bacteria 1858
18 Ga0070683_100002655 3300005329 Bacteria 14296
19 Ga0070683_100011177 3300005329 Bacteria 7745
20 Ga0070683_100015270 3300005329 Bacteria 6743
21 Ga0070683_100029316 3300005329 Bacteria 4981
22 Ga0070683_100096198 3300005329 Bacteria 2785
23 Ga0070683_100252130 3300005329 Bacteria 1679
24 Ga0070683_100402232 3300005329 Bacteria 1306
25 Ga0070690_100013146 3300005330 Bacteria 4885
26 Ga0070690_100024816 3300005330 Bacteria 3690
27 Ga0070690_100028256 3300005330 Bacteria 3473
28 Ga0070690_100084348 3300005330 Bacteria 2083
29 Ga0070670_100001025 3300005331 Bacteria 22087
30 Ga0070670_100006438 3300005331 Bacteria 9940
31 Ga0070670_100006705 3300005331 Bacteria 9757
32 Ga0070670_100187744 3300005331 Bacteria 1795
33 Ga0070677_10065616 3300005333 Bacteria 1511
34 Ga0068869_100003272 3300005334 Bacteria 9890
35 Ga0068869_100021978 3300005334 Bacteria 4391
36 Ga0068869_100033554 3300005334 Bacteria 3624
37 Ga0070680_100000152 3300005336 Bacteria 42779
38 Ga0070680_100000886 3300005336 Bacteria 21194
39 Ga0070680_100004530 3300005336 Bacteria 10465
40 Ga0070680_100004938 3300005336 Bacteria 10041
41 Ga0070680_100030842 3300005336 Bacteria 4307
42 Ga0070680_100035601 3300005336 Bacteria 4020
43 Ga0070680_100039564 3300005336 Bacteria 3816
44 Ga0070680_100052859 3300005336 Bacteria 3315
45 Ga0070680_100072152 3300005336 Bacteria 2838
46 Ga0070680_100080018 3300005336 Bacteria 2694
47 Ga0070680_100093716 3300005336 Bacteria 2488
48 Ga0070680_100153002 3300005336 Bacteria 1937
49 Ga0070682_100003997 3300005337 Bacteria 8192
50 Ga0070682_100007320 3300005337 Bacteria 6225
51 Ga0070682_100017197 3300005337 Bacteria 4213
52 Ga0068868_100029687 3300005338 Bacteria 4189
53 Ga0068868_100046330 3300005338 Bacteria 3403
54 Ga0070660_100100684 3300005339 Bacteria 2289
55 Ga0070660_100119932 3300005339 Bacteria 2098
56 Ga0070660_100208789 3300005339 Bacteria 1585
57 Ga0070689_100016644 3300005340 Bacteria 5382
58 Ga0070689_100135420 3300005340 Bacteria 1978
59 Ga0070689_100260200 3300005340 Bacteria 1434
60 Ga0070691_10002555 3300005341 Bacteria 8115
61 Ga0070691_10019303 3300005341 Bacteria 3144
62 Ga0070687_100012322 3300005343 Bacteria 3773
63 Ga0070687_100014623 3300005343 Bacteria 3529
64 Ga0070687_100165301 3300005343 Bacteria 1312
65 Ga0070661_100000555 3300005344 Bacteria 28645
66 Ga0070661_100013380 3300005344 Bacteria 5758
67 Ga0070661_100018782 3300005344 Bacteria 4920
68 Ga0070661_100123730 3300005344 Bacteria 1939
69 Ga0070692_10007973 3300005345 Bacteria 4698
70 Ga0070692_10048202 3300005345 Bacteria 2206
71 Ga0070692_10053898 3300005345 Bacteria 2099
72 Ga0070692_10066924 3300005345 Bacteria 1905
73 Ga0070668_100000088 3300005347 Bacteria 57110
74 Ga0070668_100028995 3300005347 Bacteria 4202
75 Ga0070668_100057181 3300005347 Bacteria 3014
76 Ga0070668_100083335 3300005347 Bacteria 2510
77 Ga0070668_100114398 3300005347 Bacteria 2150
78 Ga0070668_100177320 3300005347 Bacteria 1739
79 Ga0070669_100004309 3300005353 Bacteria 10287
80 Ga0070669_100005368 3300005353 Bacteria 9247
81 Ga0070669_100017493 3300005353 Bacteria 5113
82 Ga0070669_100028355 3300005353 Bacteria 4032
83 Ga0070669_100045624 3300005353 Bacteria 3194
84 Ga0070675_100000328 3300005354 Bacteria 32107
85 Ga0070675_100002562 3300005354 Bacteria 13607
86 Ga0070675_100062482 3300005354 Bacteria 3077
87 Ga0070675_100118846 3300005354 Bacteria 2244
88 Ga0070675_100190756 3300005354 Bacteria 1775
89 Ga0070675_100218278 3300005354 Bacteria 1660
90 Ga0070671_100021339 3300005355 Bacteria 5290
91 Ga0070671_100024452 3300005355 Bacteria 4945
92 Ga0070671_100063276 3300005355 Bacteria 3081
93 Ga0070671_100148877 3300005355 Bacteria 1976
94 Ga0070674_100010741 3300005356 Bacteria 5552
95 Ga0070674_100131764 3300005356 Bacteria 1865
96 Ga0070674_100132554 3300005356 Bacteria 1860
97 Ga0070674_100242032 3300005356 Bacteria 1413
98 Ga0070673_100027745 3300005364 Bacteria 4200
99 Ga0070673_100030061 3300005364 Bacteria 4059
100 Ga0070673_100041619 3300005364 Bacteria 3536
101 Ga0070673_100187543 3300005364 Bacteria 1774
102 Ga0070688_100018644 3300005365 Bacteria 4008
103 Ga0070688_100068534 3300005365 Bacteria 2262
104 Ga0070659_100004735 3300005366 Bacteria 9720
105 Ga0070659_100006879 3300005366 Bacteria 8236
106 Ga0070659_100022459 3300005366 Bacteria 4817
107 Ga0070659_100120479 3300005366 Bacteria 2124
108 Ga0070659_100274042 3300005366 Bacteria 1402
109 Ga0070659_100369874 3300005366 Bacteria 1206
110 Ga0070667_100026870 3300005367 Bacteria 4790
111 Ga0070667_100063795 3300005367 Bacteria 3123
112 Ga0070667_100113059 3300005367 Bacteria 2356
113 Ga0070667_100223573 3300005367 Bacteria 1676
114 Ga0070703_10003216 3300005406 Bacteria 4661
115 Ga0070703_10025184 3300005406 Bacteria 1763
116 Ga0070709_10000468 3300005434 Bacteria 23965
117 Ga0070709_10004856 3300005434 Bacteria 7270
118 Ga0070709_10065735 3300005434 Bacteria 2323
119 Ga0070714_100000878 3300005435 Bacteria 21352
120 Ga0070714_100003440 3300005435 Bacteria 11794
121 Ga0070714_100004574 3300005435 Bacteria 10435
122 Ga0070714_100005291 3300005435 Bacteria 9836
123 Ga0070714_100223639 3300005435 Bacteria 1731
124 Ga0070713_100004689 3300005436 Bacteria 9232
125 Ga0070701_10002215 3300005438 Bacteria 7431
126 Ga0070701_10005194 3300005438 Bacteria 5353
127 Ga0070711_100000106 3300005439 Bacteria 44087
128 Ga0070711_100018042 3300005439 Bacteria 4502
129 Ga0070711_100058475 3300005439 Bacteria 2673
130 Ga0070711_100060818 3300005439 Bacteria 2627
131 Ga0070705_100001229 3300005440 Bacteria 13860
132 Ga0070705_100004234 3300005440 Bacteria 7002
133 Ga0070705_100004882 3300005440 Bacteria 6530
134 Ga0070705_100041548 3300005440 Bacteria 2623
135 Ga0070705_100156067 3300005440 Bacteria 1520
136 Ga0070694_100001804 3300005444 Bacteria 12675
137 Ga0070694_100002816 3300005444 Bacteria 10321
138 Ga0070694_100024506 3300005444 Bacteria 3894
139 Ga0070694_100025286 3300005444 Bacteria 3841
140 Ga0070694_100037396 3300005444 Bacteria 3219
141 Ga0070694_100041223 3300005444 Bacteria 3079
142 Ga0070694_100049747 3300005444 Bacteria 2823
143 Ga0070694_100080357 3300005444 Bacteria 2265
144 Ga0070708_100000070 3300005445 Bacteria 67477
145 Ga0070708_100004270 3300005445 Bacteria 11231
146 Ga0070708_100004497 3300005445 Bacteria 10969
147 Ga0070708_100010495 3300005445 Bacteria 7509
148 Ga0070708_100011885 3300005445 Bacteria 7089
149 Ga0070708_100048072 3300005445 Bacteria 3770
150 Ga0070708_100051729 3300005445 Bacteria 3640
151 Ga0070708_100076038 3300005445 Bacteria 3032
152 Ga0070708_100294665 3300005445 Bacteria 1527
153 Ga0070663_100178772 3300005455 Bacteria 1644
154 Ga0070678_100123855 3300005456 Bacteria 2043
155 Ga0070678_100158857 3300005456 Bacteria 1829
156 Ga0070678_100235270 3300005456 Bacteria 1529
157 Ga0070662_100002729 3300005457 Bacteria 10902
158 Ga0070662_100040602 3300005457 Bacteria 3314
159 Ga0070662_100050122 3300005457 Bacteria 3012
160 Ga0070662_100080800 3300005457 Bacteria 2421
161 Ga0070662_100095795 3300005457 Bacteria 2238
162 Ga0070662_100209292 3300005457 Bacteria 1551
163 Ga0070662_100380569 3300005457 Bacteria 1162
164 Ga0070681_10000687 3300005458 Bacteria 28037
165 Ga0070681_10000828 3300005458 Bacteria 25847
166 Ga0070681_10002894 3300005458 Bacteria 15865
167 Ga0070681_10004863 3300005458 Bacteria 12885
168 Ga0070681_10016300 3300005458 Bacteria 7414
169 Ga0070681_10018968 3300005458 Bacteria 6885
170 Ga0070681_10024729 3300005458 Bacteria 6042
171 Ga0070681_10062448 3300005458 Bacteria 3699
172 Ga0070681_10070720 3300005458 Bacteria 3454
173 Ga0070681_10160414 3300005458 Bacteria 2172
174 Ga0070681_10235006 3300005458 Bacteria 1747
175 Ga0068867_100003262 3300005459 Bacteria 11431
176 Ga0068867_100029692 3300005459 Bacteria 3940
177 Ga0068867_100121175 3300005459 Bacteria 2022
178 Ga0068867_100139266 3300005459 Bacteria 1895
179 Ga0070685_10057967 3300005466 Bacteria 2256
180 Ga0070685_10192296 3300005466 Bacteria 1321
181 Ga0070706_100001388 3300005467 Bacteria 25672
182 Ga0070706_100034447 3300005467 Bacteria 4678
183 Ga0070706_100038625 3300005467 Bacteria 4406
184 Ga0070706_100041249 3300005467 Bacteria 4261
185 Ga0070706_100043850 3300005467 Bacteria 4132
186 Ga0070706_100091223 3300005467 Bacteria 2826
187 Ga0070706_100100227 3300005467 Bacteria 2691
188 Ga0070706_100134024 3300005467 Bacteria 2312
189 Ga0070706_100424654 3300005467 Bacteria 1237
190 Ga0070707_100001831 3300005468 Bacteria 20420
191 Ga0070707_100004854 3300005468 Bacteria 12600
192 Ga0070707_100016176 3300005468 Bacteria 7000
193 Ga0070707_100017971 3300005468 Bacteria 6650
194 Ga0070707_100019833 3300005468 Bacteria 6338
195 Ga0070707_100021571 3300005468 Bacteria 6089
196 Ga0070707_100041321 3300005468 Bacteria 4413
197 Ga0070707_100070532 3300005468 Bacteria 3366
198 Ga0070707_100098677 3300005468 Bacteria 2829
199 Ga0070707_100436629 3300005468 Bacteria 1270
200 Ga0070698_100000109 3300005471 Bacteria 69210
201 Ga0070698_100002614 3300005471 Bacteria 19841
202 Ga0070698_100011076 3300005471 Bacteria 9583
203 Ga0070698_100011389 3300005471 Bacteria 9436
204 Ga0070698_100013629 3300005471 Bacteria 8606
205 Ga0070698_100024231 3300005471 Bacteria 6332
206 Ga0070698_100029252 3300005471 Bacteria 5718
207 Ga0070698_100093517 3300005471 Bacteria 2986
208 Ga0070698_100098417 3300005471 Bacteria 2899
209 Ga0070698_100180777 3300005471 Bacteria 2048
210 Ga0070699_100000091 3300005518 Bacteria 86800
211 Ga0070699_100001290 3300005518 Bacteria 23120
212 Ga0070699_100004566 3300005518 Bacteria 12261
213 Ga0070699_100006637 3300005518 Bacteria 10062
214 Ga0070699_100011321 3300005518 Bacteria 7705
215 Ga0070699_100014131 3300005518 Bacteria 6869
216 Ga0070699_100019989 3300005518 Bacteria 5771
217 Ga0070699_100028904 3300005518 Bacteria 4779
218 Ga0070699_100059529 3300005518 Bacteria 3309
219 Ga0070699_100096483 3300005518 Bacteria 2589
220 Ga0070699_100104185 3300005518 Bacteria 2488
221 Ga0070699_100122878 3300005518 Bacteria 2284
222 Ga0070699_100219618 3300005518 Bacteria 1694
223 Ga0070699_100227032 3300005518 Bacteria 1665
224 Ga0070699_100454068 3300005518 Bacteria 1162
225 Ga0070679_100000443 3300005530 Bacteria 35227
226 Ga0070679_100003946 3300005530 Bacteria 13654
227 Ga0070679_100010155 3300005530 Bacteria 8925
228 Ga0070679_100018907 3300005530 Bacteria 6691
229 Ga0070679_100028602 3300005530 Bacteria 5496
230 Ga0070679_100030974 3300005530 Bacteria 5284
231 Ga0070679_100040136 3300005530 Bacteria 4656
232 Ga0070679_100045265 3300005530 Bacteria 4385
233 Ga0070679_100049987 3300005530 Bacteria 4164
234 Ga0070679_100099123 3300005530 Bacteria 2901
235 Ga0070679_100105650 3300005530 Bacteria 2802
236 Ga0070679_100130360 3300005530 Bacteria 2496
237 Ga0070679_100142918 3300005530 Bacteria 2372
238 Ga0070679_100315920 3300005530 Bacteria 1512
239 Ga0070684_100002554 3300005535 Bacteria 13445
240 Ga0070684_100005481 3300005535 Bacteria 9723
241 Ga0070684_100017764 3300005535 Bacteria 5846
242 Ga0070684_100034489 3300005535 Bacteria 4327
243 Ga0070684_100044061 3300005535 Bacteria 3857
244 Ga0070684_100051427 3300005535 Bacteria 3579
245 Ga0070684_100054192 3300005535 Bacteria 3494
246 Ga0070684_100152944 3300005535 Bacteria 2091
247 Ga0070684_100175731 3300005535 Bacteria 1946
248 Ga0070684_100543332 3300005535 Bacteria 1078
249 Ga0070697_100003922 3300005536 Bacteria 11429
250 Ga0070697_100004414 3300005536 Bacteria 10802
251 Ga0070697_100004575 3300005536 Bacteria 10624
252 Ga0070697_100008439 3300005536 Bacteria 8039
253 Ga0070697_100008663 3300005536 Bacteria 7943
254 Ga0070697_100011976 3300005536 Bacteria 6789
255 Ga0070697_100017195 3300005536 Bacteria 5686
256 Ga0070697_100031239 3300005536 Bacteria 4282
257 Ga0070697_100065842 3300005536 Bacteria 2962
258 Ga0070697_100203013 3300005536 Bacteria 1685
259 Ga0070697_100377816 3300005536 Bacteria 1227
260 Ga0070697_100398648 3300005536 Bacteria 1194
261 Ga0068853_100013245 3300005539 Bacteria 6731
262 Ga0068853_100035769 3300005539 Bacteria 4220
263 Ga0068853_100061189 3300005539 Bacteria 3256
264 Ga0068853_100101499 3300005539 Bacteria 2544
265 Ga0068853_100107663 3300005539 Bacteria 2472
266 Ga0070672_100020937 3300005543 Bacteria 4779
267 Ga0070672_100028075 3300005543 Bacteria 4205
268 Ga0070672_100039619 3300005543 Bacteria 3611
269 Ga0070672_100044873 3300005543 Bacteria 3416
270 Ga0070672_100229243 3300005543 Bacteria 1560
271 Ga0070672_100266460 3300005543 Bacteria 1446
272 Ga0070672_100520383 3300005543 Bacteria 1030
273 Ga0070686_100075921 3300005544 Bacteria 2212
274 Ga0070686_100116573 3300005544 Bacteria 1828
275 Ga0070695_100001357 3300005545 Bacteria 13567
276 Ga0070695_100003221 3300005545 Bacteria 9526
277 Ga0070695_100061283 3300005545 Bacteria 2441
278 Ga0070695_100064463 3300005545 Bacteria 2384
279 Ga0070695_100248108 3300005545 Bacteria 1294
280 Ga0070696_100001642 3300005546 Bacteria 14675
281 Ga0070696_100001747 3300005546 Bacteria 14253
282 Ga0070696_100002480 3300005546 Bacteria 12229
283 Ga0070696_100002806 3300005546 Bacteria 11567
284 Ga0070696_100003579 3300005546 Bacteria 10350
285 Ga0070696_100013854 3300005546 Bacteria 5413
286 Ga0070696_100015640 3300005546 Bacteria 5098
287 Ga0070696_100050330 3300005546 Bacteria 2896
288 Ga0070696_100068067 3300005546 Bacteria 2499
289 Ga0070696_100119506 3300005546 Bacteria 1906
290 Ga0070696_100211549 3300005546 Bacteria 1451
291 Ga0070693_100002712 3300005547 Bacteria 8139
292 Ga0070693_100024732 3300005547 Bacteria 3224
293 Ga0070665_100010586 3300005548 Bacteria 9338
294 Ga0070704_100000390 3300005549 Bacteria 20114
295 Ga0070704_100011539 3300005549 Bacteria 5420
296 Ga0070704_100018243 3300005549 Bacteria 4481
297 Ga0070704_100037225 3300005549 Bacteria 3322
298 Ga0070704_100044111 3300005549 Bacteria 3096
299 Ga0070704_100055681 3300005549 Bacteria 2805
300 Ga0070704_100242323 3300005549 Bacteria 1476
301 Ga0068855_100046695 3300005563 Bacteria 5118
302 Ga0068855_100064329 3300005563 Bacteria 4278
303 Ga0068855_100065622 3300005563 Bacteria 4232
304 Ga0068855_100074497 3300005563 Bacteria 3942
305 Ga0068855_100115999 3300005563 Bacteria 3069
306 Ga0068855_100496168 3300005563 Bacteria 1327
307 Ga0070664_100002134 3300005564 Bacteria 15844
308 Ga0070664_100042116 3300005564 Bacteria 3855
309 Ga0070664_100057446 3300005564 Bacteria 3308
310 Ga0070664_100062616 3300005564 Bacteria 3172
311 Ga0070664_100080556 3300005564 Bacteria 2805
312 Ga0070664_100123605 3300005564 Bacteria 2268
313 Ga0070664_100141850 3300005564 Bacteria 2116
314 Ga0070664_100228373 3300005564 Bacteria 1668
315 Ga0070664_100517087 3300005564 Bacteria 1101
316 Ga0068857_100005765 3300005577 Bacteria 10587
317 Ga0068857_100009491 3300005577 Bacteria 8450
318 Ga0068857_100014469 3300005577 Bacteria 6883
319 Ga0068857_100021305 3300005577 Bacteria 5706
320 Ga0068857_100073283 3300005577 Bacteria 3051
321 Ga0068857_100298562 3300005577 Bacteria 1485
322 Ga0068854_100002669 3300005578 Bacteria 11059
323 Ga0068854_100005444 3300005578 Bacteria 8038
324 Ga0068854_100304321 3300005578 Bacteria 1291
325 Ga0068854_100341113 3300005578 Bacteria 1224
326 Ga0068856_100043500 3300005614 Bacteria 4419
327 Ga0068856_100174247 3300005614 Bacteria 2164
328 Ga0070702_100102677 3300005615 Bacteria 1757
329 Ga0070702_100165314 3300005615 Bacteria 1434
330 Ga0070702_100211475 3300005615 Bacteria 1291
331 Ga0068852_100004225 3300005616 Bacteria 10138
332 Ga0068852_100030810 3300005616 Bacteria 4420
333 Ga0068852_100085610 3300005616 Bacteria 2808
334 Ga0068852_100137693 3300005616 Bacteria 2255
335 Ga0068859_100023845 3300005617 Bacteria 6142
336 Ga0068859_100044907 3300005617 Bacteria 4439
337 Ga0068859_100065663 3300005617 Bacteria 3662
338 Ga0068859_100097008 3300005617 Bacteria 3001
339 Ga0068859_100244257 3300005617 Bacteria 1885
340 Ga0068859_100366039 3300005617 Bacteria 1537
341 Ga0068864_100008318 3300005618 Bacteria 8558
342 Ga0068864_100046006 3300005618 Bacteria 3744
343 Ga0068864_100195762 3300005618 Bacteria 1854
344 Ga0068864_100244664 3300005618 Bacteria 1663
345 Ga0068866_10015087 3300005718 Bacteria 3427
346 Ga0068861_100000232 3300005719 Bacteria 30370
347 Ga0068861_100048396 3300005719 Bacteria 3214
348 Ga0068861_100245889 3300005719 Bacteria 1524
349 Ga0068870_10021110 3300005840 Bacteria 3182
350 Ga0068870_10149111 3300005840 Bacteria 1376
351 Ga0068863_100010547 3300005841 Bacteria 8971
352 Ga0068863_100025110 3300005841 Bacteria 5683
353 Ga0068863_100057210 3300005841 Bacteria 3691
354 Ga0068858_100006089 3300005842 Bacteria 11768
355 Ga0068858_100020276 3300005842 Bacteria 6217
356 Ga0068860_100059679 3300005843 Bacteria 3626
357 Ga0068860_100071997 3300005843 Bacteria 3284
358 Ga0068860_100150247 3300005843 Bacteria 2243
359 Ga0068862_100002069 3300005844 Bacteria 18108
360 Ga0068862_100011123 3300005844 Bacteria 7430
361 Ga0068862_100031129 3300005844 Bacteria 4501
362 Ga0068862_100045625 3300005844 Bacteria 3739
363 Ga0068862_100141767 3300005844 Bacteria 2134
364 Ga0081455_10066286 3300005937 Bacteria 3016
365 Ga0081455_10078672 3300005937 Bacteria 2709
366 Ga0081539_10000103 3300005985 Bacteria 197839
367 Ga0081539_10014467 3300005985 Bacteria 5832
368 Ga0070717_10035604 3300006028 Bacteria 4032
369 Ga0070716_100005697 3300006173 Bacteria 6049
370 Ga0070716_100159979 3300006173 Bacteria 1458
371 Ga0070712_100070343 3300006175 Bacteria 2500
372 Ga0070712_100227287 3300006175 Bacteria 1480
373 Ga0097621_100223741 3300006237 Bacteria 1641
374 Ga0068871_100046727 3300006358 Bacteria 3488
375 Ga0068871_100079935 3300006358 Bacteria 2706
376 Ga0075428_100006240 3300006844 Bacteria 13255
377 Ga0075428_100036169 3300006844 Bacteria 5440
378 Ga0075428_100038265 3300006844 Bacteria 5278
379 Ga0075428_100289374 3300006844 Bacteria 1762
380 Ga0075428_100301665 3300006844 Bacteria 1722
381 Ga0075430_100026935 3300006846 Bacteria 4889
382 Ga0075430_100028403 3300006846 Bacteria 4753
383 Ga0075431_100006384 3300006847 Bacteria 11704
384 Ga0075431_100010914 3300006847 Bacteria 9139
385 Ga0075431_100012188 3300006847 Bacteria 8676
386 Ga0075431_100036869 3300006847 Bacteria 5038
387 Ga0075431_100130630 3300006847 Bacteria 2591
388 Ga0075433_10000226 3300006852 Bacteria 32302
389 Ga0075433_10027154 3300006852 Bacteria 4853
390 Ga0075433_10034435 3300006852 Bacteria 4350
391 Ga0075433_10073280 3300006852 Bacteria 3011
392 Ga0075433_10083859 3300006852 Bacteria 2813
393 Ga0075433_10247934 3300006852 Bacteria 1580
394 Ga0075433_10310334 3300006852 Bacteria 1396
395 Ga0075434_100000723 3300006871 Bacteria 25875
396 Ga0075434_100004748 3300006871 Bacteria 12295
397 Ga0075434_100011395 3300006871 Bacteria 8387
398 Ga0075434_100013916 3300006871 Bacteria 7674
399 Ga0075434_100032355 3300006871 Bacteria 5158
400 Ga0075434_100132014 3300006871 Bacteria 2517
401 Ga0075429_100002036 3300006880 Bacteria 16825
402 Ga0075429_100012920 3300006880 Bacteria 7244
403 Ga0075429_100026135 3300006880 Bacteria 5068
404 Ga0075429_100053736 3300006880 Bacteria 3504
405 Ga0075429_100095024 3300006880 Bacteria 2599
406 Ga0075429_100147985 3300006880 Bacteria 2056
407 Ga0075429_100237465 3300006880 Bacteria 1596
408 Ga0068865_100007779 3300006881 Bacteria 6609
409 Ga0068865_100010159 3300006881 Bacteria 5851
410 Ga0068865_100010998 3300006881 Bacteria 5648
411 Ga0068865_100035616 3300006881 Bacteria 3349
412 Ga0075436_100002070 3300006914 Bacteria 13843
413 Ga0075436_100002833 3300006914 Bacteria 11873
414 Ga0075436_100020329 3300006914 Bacteria 4557
415 Ga0075436_100020492 3300006914 Bacteria 4538
416 Ga0075436_100031013 3300006914 Bacteria 3679
417 Ga0075436_100190519 3300006914 Bacteria 1451
418 Ga0075436_100285816 3300006914 Bacteria 1180
419 Ga0097620_100023845 3300006931 Bacteria 6142
420 Ga0097620_100044906 3300006931 Bacteria 4439
421 Ga0097620_100065668 3300006931 Bacteria 3662
422 Ga0097620_100097003 3300006931 Bacteria 3001
423 Ga0097620_100244256 3300006931 Bacteria 1885
424 Ga0097620_100366081 3300006931 Bacteria 1537
425 Ga0075435_100033106 3300007076 Bacteria 4085
426 Ga0075435_100124023 3300007076 Bacteria 2157
427 Ga0075435_100178598 3300007076 Bacteria 1794
428 Ga0075435_100476766 3300007076 Bacteria 1077
429 Ga0099794_10000041 3300007265 Bacteria 50642
430 Ga0099794_10002901 3300007265 Bacteria 6445
431 Ga0099794_10061899 3300007265 Bacteria 1819
432 Ga0099794_10152790 3300007265 Bacteria 1172
433 Ga0105240_10022751 3300009093 Bacteria 8303
434 Ga0105240_10026683 3300009093 Bacteria 7578
435 Ga0105240_10030258 3300009093 Bacteria 7038
436 Ga0105240_10062666 3300009093 Bacteria 4628
437 Ga0105240_10164862 3300009093 Bacteria 2629
438 Ga0105240_10323005 3300009093 Bacteria 1758
439 Ga0111539_10021889 3300009094 Bacteria 7860
440 Ga0111539_10032525 3300009094 Bacteria 6333
441 Ga0111539_10042199 3300009094 Bacteria 5481
442 Ga0111539_10051533 3300009094 Bacteria 4901
443 Ga0105245_10038166 3300009098 Bacteria 4273
444 Ga0105245_10042591 3300009098 Bacteria 4051
445 Ga0105245_10091566 3300009098 Bacteria 2799
446 Ga0105245_10322920 3300009098 Bacteria 1521
447 Ga0114129_10000482 3300009147 Bacteria 48090
448 Ga0114129_10007380 3300009147 Bacteria 15651
449 Ga0114129_10014906 3300009147 Bacteria 11074
450 Ga0114129_10068850 3300009147 Bacteria 4933
451 Ga0114129_10091011 3300009147 Bacteria 4228
452 Ga0114129_10158085 3300009147 Bacteria 3098
453 Ga0114129_10212754 3300009147 Bacteria 2613
454 Ga0114129_10219170 3300009147 Bacteria 2568
455 Ga0114129_10228830 3300009147 Bacteria 2505
456 Ga0114129_10330892 3300009147 Bacteria 2023
457 Ga0114129_10345550 3300009147 Bacteria 1972
458 Ga0114129_10540071 3300009147 Bacteria 1517
459 Ga0114129_10786781 3300009147 Bacteria 1215
460 Ga0105241_10058318 3300009174 Bacteria 2965
461 Ga0105241_10098937 3300009174 Bacteria 2315
462 Ga0105241_10129516 3300009174 Bacteria 2041
463 Ga0105242_10001589 3300009176 Bacteria 17858
464 Ga0105242_10006083 3300009176 Bacteria 9307
465 Ga0105242_10011676 3300009176 Bacteria 6758
466 Ga0105248_10000977 3300009177 Bacteria 31755
467 Ga0105248_10003124 3300009177 Bacteria 18328
468 Ga0105248_10036018 3300009177 Bacteria 5535
469 Ga0105248_10087258 3300009177 Bacteria 3511
470 Ga0105248_10325282 3300009177 Bacteria 1732
471 Ga0105238_10000007 3300009551 Bacteria 309725
472 Ga0105238_10119760 3300009551 Bacteria 2612
473 Ga0105249_10000078 3300009553 Bacteria 140030
474 Ga0105249_10001142 3300009553 Bacteria 23486
475 Ga0105249_10003811 3300009553 Bacteria 13018
476 Ga0105249_10007349 3300009553 Bacteria 9603
477 Ga0105249_10013047 3300009553 Bacteria 7334
478 Ga0105249_10043169 3300009553 Bacteria 4102
479 Ga0105239_10010617 3300010375 Bacteria 10302
480 Ga0105239_10013408 3300010375 Bacteria 9107
481 Ga0105239_10040907 3300010375 Bacteria 5079
482 Ga0105246_10037375 3300011119 Bacteria 3259
483 Ga0157373_10001188 3300013100 Bacteria 19929
484 Ga0157373_10048475 3300013100 Bacteria 3028
485 Ga0157373_10089526 3300013100 Bacteria 2168
486 Ga0157373_10092492 3300013100 Bacteria 2130
487 Ga0157373_10203380 3300013100 Bacteria 1396
488 Ga0157371_10052735 3300013102 Bacteria 2888
489 Ga0157371_10054753 3300013102 Bacteria 2832
490 Ga0157371_10076645 3300013102 Bacteria 2368
491 Ga0157370_10002250 3300013104 Bacteria 23451
492 Ga0157370_10016352 3300013104 Bacteria 7513
493 Ga0157370_10026600 3300013104 Bacteria 5710
494 Ga0157370_10091054 3300013104 Bacteria 2864
495 Ga0157370_10205130 3300013104 Bacteria 1828
496 Ga0157369_10006892 3300013105 Bacteria 13111
497 Ga0157369_10050847 3300013105 Bacteria 4486
498 Ga0157369_10078170 3300013105 Bacteria 3545
499 Ga0157369_10121427 3300013105 Bacteria 2772
500 Ga0157369_10143481 3300013105 Bacteria 2526
501 Ga0157374_10074796 3300013296 Bacteria 3200
502 Ga0157374_10187416 3300013296 Bacteria 2023
503 Ga0157374_10261198 3300013296 Bacteria 1705
504 Ga0157378_10000460 3300013297 Bacteria 38850
505 Ga0157378_10028113 3300013297 Bacteria 4960
506 Ga0157378_10172947 3300013297 Bacteria 2027
507 Ga0163162_10002411 3300013306 Bacteria 17589
508 Ga0163162_10075177 3300013306 Bacteria 3438
509 Ga0163162_10125473 3300013306 Bacteria 2673
510 Ga0163162_10154470 3300013306 Bacteria 2414
511 Ga0163162_10193472 3300013306 Bacteria 2162
512 Ga0163162_10504766 3300013306 Bacteria 1340
513 Ga0157372_10005848 3300013307 Bacteria 13101
514 Ga0157372_10008921 3300013307 Bacteria 10653
515 Ga0157372_10011199 3300013307 Bacteria 9541
516 Ga0157372_10011305 3300013307 Bacteria 9497
517 Ga0157372_10018234 3300013307 Bacteria 7545
518 Ga0157372_10065515 3300013307 Bacteria 4079
519 Ga0157372_10111598 3300013307 Bacteria 3133
520 Ga0157372_10195027 3300013307 Bacteria 2346
521 Ga0157372_10279397 3300013307 Bacteria 1941
522 Ga0157372_10324820 3300013307 Bacteria 1792
523 Ga0157372_10524279 3300013307 Bacteria 1381
524 Ga0157375_10028212 3300013308 Bacteria 5258
525 Ga0157375_10046809 3300013308 Bacteria 4220
526 Ga0157375_10066297 3300013308 Bacteria 3603
527 Ga0157375_10227516 3300013308 Bacteria 2024
528 Ga0157375_10317799 3300013308 Bacteria 1722
529 Ga0157375_10357016 3300013308 Bacteria 1627
530 Ga0163163_10038659 3300014325 Bacteria 4652
531 Ga0163163_10057510 3300014325 Bacteria 3846
532 Ga0163163_10215945 3300014325 Bacteria 1967
533 Ga0163163_10222601 3300014325 Bacteria 1936
534 Ga0157380_10097607 3300014326 Bacteria 2439
535 Ga0157380_10357008 3300014326 Bacteria 1370
536 Ga0157377_10003523 3300014745 Bacteria 7086
537 Ga0157379_10005920 3300014968 Bacteria 10529
538 Ga0157376_10015363 3300014969 Bacteria 5782
539 Ga0157376_10050068 3300014969 Bacteria 3464
540 Ga0157376_10250247 3300014969 Bacteria 1655
541 Ga0157376_10370887 3300014969 Bacteria 1376
542 Ga0163161_10055588 3300017792 Bacteria 2874
543 Ga0163161_10092369 3300017792 Bacteria 2241
544 Ga0163161_10256440 3300017792 Bacteria 1364
545 Ga0206356_10686293 3300020070 Bacteria 3447
546 Ga0206354_11043160 3300020081 Bacteria 3215
547 Ga0213876_10100162 3300021384 Bacteria 1536
548 Ga0213875_10003244 3300021388 Bacteria 9330
549 Ga0207697_10078783 3300025315 Bacteria 1387
550 Ga0207653_10000037 3300025885 Bacteria 99765
551 Ga0207653_10007039 3300025885 Bacteria 3511
552 Ga0207682_10017990 3300025893 Bacteria 2759
553 Ga0207682_10087006 3300025893 Bacteria 1349
554 Ga0207642_10000684 3300025899 Bacteria 10439
555 Ga0207642_10042071 3300025899 Bacteria 2005
556 Ga0207688_10061651 3300025901 Bacteria 2114
557 Ga0207680_10042801 3300025903 Bacteria 2652
558 Ga0207647_10010471 3300025904 Bacteria 6550
559 Ga0207699_10007060 3300025906 Bacteria 5474
560 Ga0207699_10019989 3300025906 Bacteria 3581
561 Ga0207699_10059131 3300025906 Bacteria 2296
562 Ga0207699_10315829 3300025906 Bacteria 1095
563 Ga0207645_10002892 3300025907 Bacteria 13281
564 Ga0207645_10004847 3300025907 Bacteria 9877
565 Ga0207645_10005647 3300025907 Bacteria 9039
566 Ga0207645_10036027 3300025907 Bacteria 3176
567 Ga0207645_10137566 3300025907 Bacteria 1591
568 Ga0207643_10031640 3300025908 Bacteria 2951
569 Ga0207643_10047789 3300025908 Bacteria 2423
570 Ga0207705_10015677 3300025909 Bacteria 5442
571 Ga0207705_10018615 3300025909 Bacteria 4965
572 Ga0207705_10029915 3300025909 Bacteria 3884
573 Ga0207705_10036540 3300025909 Bacteria 3515
574 Ga0207705_10053823 3300025909 Bacteria 2900
575 Ga0207684_10002946 3300025910 Bacteria 16860
576 Ga0207684_10004712 3300025910 Bacteria 12791
577 Ga0207684_10058258 3300025910 Bacteria 3277
578 Ga0207684_10102868 3300025910 Bacteria 2442
579 Ga0207684_10107252 3300025910 Bacteria 2390
580 Ga0207684_10168869 3300025910 Bacteria 1885
581 Ga0207654_10000405 3300025911 Bacteria 25039
582 Ga0207654_10027981 3300025911 Bacteria 3069
583 Ga0207654_10053394 3300025911 Bacteria 2332
584 Ga0207654_10063551 3300025911 Bacteria 2167
585 Ga0207654_10074715 3300025911 Bacteria 2023
586 Ga0207707_10000485 3300025912 Bacteria 41294
587 Ga0207707_10002384 3300025912 Bacteria 16938
588 Ga0207707_10003274 3300025912 Bacteria 14387
589 Ga0207707_10003323 3300025912 Bacteria 14288
590 Ga0207707_10024667 3300025912 Bacteria 5263
591 Ga0207707_10026242 3300025912 Bacteria 5093
592 Ga0207707_10026472 3300025912 Bacteria 5069
593 Ga0207707_10039734 3300025912 Bacteria 4112
594 Ga0207707_10045217 3300025912 Bacteria 3837
595 Ga0207707_10048264 3300025912 Bacteria 3708
596 Ga0207707_10126952 3300025912 Bacteria 2231
597 Ga0207707_10158819 3300025912 Bacteria 1977
598 Ga0207707_10241244 3300025912 Bacteria 1571
599 Ga0207695_10000824 3300025913 Bacteria 57448
600 Ga0207695_10002609 3300025913 Bacteria 26412
601 Ga0207695_10022198 3300025913 Bacteria 7217
602 Ga0207695_10107870 3300025913 Bacteria 2770
603 Ga0207671_10092027 3300025914 Bacteria 2286
604 Ga0207693_10010681 3300025915 Bacteria 7453
605 Ga0207693_10042228 3300025915 Bacteria 3590
606 Ga0207693_10234453 3300025915 Bacteria 1441
607 Ga0207663_10000086 3300025916 Bacteria 44126
608 Ga0207663_10115754 3300025916 Bacteria 1827
609 Ga0207660_10000035 3300025917 Bacteria 65610
610 Ga0207660_10006296 3300025917 Bacteria 7698
611 Ga0207660_10007581 3300025917 Bacteria 7023
612 Ga0207660_10009333 3300025917 Bacteria 6350
613 Ga0207660_10023410 3300025917 Bacteria 4171
614 Ga0207660_10027246 3300025917 Bacteria 3897
615 Ga0207660_10066551 3300025917 Bacteria 2607
616 Ga0207660_10089981 3300025917 Bacteria 2273
617 Ga0207660_10113576 3300025917 Bacteria 2042
618 Ga0207660_10126494 3300025917 Bacteria 1941
619 Ga0207660_10142869 3300025917 Bacteria 1831
620 Ga0207660_10174662 3300025917 Bacteria 1665
621 Ga0207660_10210764 3300025917 Bacteria 1521
622 Ga0207662_10005756 3300025918 Bacteria 6633
623 Ga0207662_10063035 3300025918 Bacteria 2229
624 Ga0207662_10106890 3300025918 Bacteria 1741
625 Ga0207657_10004320 3300025919 Bacteria 15059
626 Ga0207657_10008543 3300025919 Bacteria 10382
627 Ga0207657_10017905 3300025919 Bacteria 6778
628 Ga0207657_10023091 3300025919 Bacteria 5800
629 Ga0207657_10050505 3300025919 Bacteria 3620
630 Ga0207657_10371924 3300025919 Bacteria 1126
631 Ga0207649_10000422 3300025920 Bacteria 31054
632 Ga0207649_10009822 3300025920 Bacteria 5244
633 Ga0207649_10013088 3300025920 Bacteria 4626
634 Ga0207649_10014915 3300025920 Bacteria 4360
635 Ga0207652_10000609 3300025921 Bacteria 35652
636 Ga0207652_10001738 3300025921 Bacteria 19002
637 Ga0207652_10003988 3300025921 Bacteria 12063
638 Ga0207652_10023620 3300025921 Bacteria 5095
639 Ga0207652_10035781 3300025921 Bacteria 4194
640 Ga0207652_10044607 3300025921 Bacteria 3778
641 Ga0207652_10046587 3300025921 Bacteria 3700
642 Ga0207652_10049770 3300025921 Bacteria 3588
643 Ga0207652_10093481 3300025921 Bacteria 2646
644 Ga0207652_10113107 3300025921 Bacteria 2409
645 Ga0207652_10119150 3300025921 Bacteria 2347
646 Ga0207652_10147589 3300025921 Bacteria 2105
647 Ga0207652_10205776 3300025921 Bacteria 1771
648 Ga0207652_10208663 3300025921 Bacteria 1758
649 Ga0207652_10408343 3300025921 Bacteria 1225
650 Ga0207646_10002881 3300025922 Bacteria 19958
651 Ga0207646_10008799 3300025922 Bacteria 10074
652 Ga0207646_10012044 3300025922 Bacteria 8330
653 Ga0207646_10035407 3300025922 Bacteria 4509
654 Ga0207646_10068609 3300025922 Bacteria 3167
655 Ga0207646_10269466 3300025922 Bacteria 1539
656 Ga0207681_10000537 3300025923 Bacteria 26181
657 Ga0207681_10009827 3300025923 Bacteria 5850
658 Ga0207681_10013509 3300025923 Bacteria 5056
659 Ga0207681_10022498 3300025923 Bacteria 4021
660 Ga0207694_10000007 3300025924 Bacteria 595422
661 Ga0207694_10024190 3300025924 Bacteria 4611
662 Ga0207650_10027143 3300025925 Bacteria 4095
663 Ga0207650_10027664 3300025925 Bacteria 4060
664 Ga0207650_10036278 3300025925 Bacteria 3586
665 Ga0207659_10037058 3300025926 Bacteria 3383
666 Ga0207659_10040111 3300025926 Bacteria 3271
667 Ga0207659_10049707 3300025926 Bacteria 2975
668 Ga0207659_10075629 3300025926 Bacteria 2472
669 Ga0207659_10085950 3300025926 Bacteria 2338
670 Ga0207659_10153841 3300025926 Bacteria 1798
671 Ga0207687_10061485 3300025927 Bacteria 2652
672 Ga0207664_10007042 3300025929 Bacteria 7791
673 Ga0207664_10022408 3300025929 Bacteria 4716
674 Ga0207664_10160503 3300025929 Bacteria 1917
675 Ga0207644_10009253 3300025931 Bacteria 6463
676 Ga0207644_10102521 3300025931 Bacteria 2152
677 Ga0207690_10031285 3300025932 Bacteria 3403
678 Ga0207690_10056130 3300025932 Bacteria 2655
679 Ga0207690_10153660 3300025932 Bacteria 1708
680 Ga0207690_10226554 3300025932 Bacteria 1433
681 Ga0207706_10000055 3300025933 Bacteria 114144
682 Ga0207706_10000116 3300025933 Bacteria 85356
683 Ga0207706_10004147 3300025933 Bacteria 13662
684 Ga0207706_10005574 3300025933 Bacteria 11731
685 Ga0207706_10029722 3300025933 Bacteria 4877
686 Ga0207706_10067044 3300025933 Bacteria 3158
687 Ga0207706_10134032 3300025933 Bacteria 2179
688 Ga0207706_10170997 3300025933 Bacteria 1909
689 Ga0207686_10000621 3300025934 Bacteria 22058
690 Ga0207686_10036441 3300025934 Bacteria 2962
691 Ga0207686_10067885 3300025934 Bacteria 2282
692 Ga0207686_10098938 3300025934 Bacteria 1943
693 Ga0207709_10001211 3300025935 Bacteria 18545
694 Ga0207709_10167078 3300025935 Bacteria 1541
695 Ga0207709_10207934 3300025935 Bacteria 1402
696 Ga0207670_10036402 3300025936 Bacteria 3200
697 Ga0207670_10272360 3300025936 Bacteria 1316
698 Ga0207669_10005007 3300025937 Bacteria 5892
699 Ga0207669_10055517 3300025937 Bacteria 2399
700 Ga0207669_10070325 3300025937 Bacteria 2194
701 Ga0207669_10114956 3300025937 Bacteria 1813
702 Ga0207704_10002778 3300025938 Bacteria 7899
703 Ga0207704_10010731 3300025938 Bacteria 4482
704 Ga0207704_10054867 3300025938 Bacteria 2432
705 Ga0207665_10024529 3300025939 Bacteria 3977
706 Ga0207691_10000129 3300025940 Bacteria 69176
707 Ga0207691_10004042 3300025940 Bacteria 14222
708 Ga0207691_10027758 3300025940 Bacteria 5305
709 Ga0207691_10037433 3300025940 Bacteria 4493
710 Ga0207691_10037824 3300025940 Bacteria 4467
711 Ga0207691_10061175 3300025940 Bacteria 3421
712 Ga0207691_10103722 3300025940 Bacteria 2535
713 Ga0207691_10104846 3300025940 Bacteria 2519
714 Ga0207691_10106620 3300025940 Bacteria 2495
715 Ga0207691_10202398 3300025940 Bacteria 1727
716 Ga0207711_10001868 3300025941 Bacteria 19198
717 Ga0207711_10024068 3300025941 Bacteria 5097
718 Ga0207711_10047223 3300025941 Bacteria 3680
719 Ga0207711_10068303 3300025941 Bacteria 3078
720 Ga0207711_10121032 3300025941 Bacteria 2336
721 Ga0207689_10003669 3300025942 Bacteria 13999
722 Ga0207689_10031774 3300025942 Bacteria 4391
723 Ga0207689_10043643 3300025942 Bacteria 3706
724 Ga0207689_10134896 3300025942 Bacteria 2033
725 Ga0207661_10004017 3300025944 Bacteria 10287
726 Ga0207661_10005197 3300025944 Bacteria 9151
727 Ga0207661_10007276 3300025944 Bacteria 7876
728 Ga0207661_10015415 3300025944 Bacteria 5623
729 Ga0207661_10020678 3300025944 Bacteria 4924
730 Ga0207661_10026394 3300025944 Bacteria 4426
731 Ga0207661_10175794 3300025944 Bacteria 1866
732 Ga0207661_10234972 3300025944 Bacteria 1625
733 Ga0207679_10000382 3300025945 Bacteria 31883
734 Ga0207679_10001463 3300025945 Bacteria 14789
735 Ga0207679_10011578 3300025945 Bacteria 5722
736 Ga0207679_10050243 3300025945 Bacteria 3045
737 Ga0207679_10056727 3300025945 Bacteria 2893
738 Ga0207679_10087046 3300025945 Bacteria 2404
739 Ga0207679_10129486 3300025945 Bacteria 2022
740 Ga0207679_10196192 3300025945 Bacteria 1683
741 Ga0207679_10211673 3300025945 Bacteria 1626
742 Ga0207679_10278175 3300025945 Bacteria 1434
743 Ga0207667_10001972 3300025949 Bacteria 25704
744 Ga0207667_10026735 3300025949 Bacteria 6297
745 Ga0207667_10112701 3300025949 Bacteria 2805
746 Ga0207667_10159242 3300025949 Bacteria 2323
747 Ga0207667_10302464 3300025949 Bacteria 1634
748 Ga0207651_10034842 3300025960 Bacteria 3265
749 Ga0207651_10080830 3300025960 Bacteria 2341
750 Ga0207651_10161516 3300025960 Bacteria 1757
751 Ga0207651_10235608 3300025960 Bacteria 1489
752 Ga0207651_10247154 3300025960 Bacteria 1457
753 Ga0207712_10000568 3300025961 Bacteria 29835
754 Ga0207712_10000920 3300025961 Bacteria 21293
755 Ga0207712_10001023 3300025961 Bacteria 19837
756 Ga0207712_10003424 3300025961 Bacteria 10027
757 Ga0207712_10016554 3300025961 Bacteria 4777
758 Ga0207712_10071192 3300025961 Bacteria 2500
759 Ga0207668_10019781 3300025972 Bacteria 4263
760 Ga0207668_10032208 3300025972 Bacteria 3461
761 Ga0207668_10067976 3300025972 Bacteria 2531
762 Ga0207668_10103554 3300025972 Bacteria 2120
763 Ga0207668_10165909 3300025972 Bacteria 1726
764 Ga0207640_10000266 3300025981 Bacteria 35167
765 Ga0207658_10036784 3300025986 Bacteria 3512
766 Ga0207658_10107644 3300025986 Bacteria 2197
767 Ga0207658_10167698 3300025986 Bacteria 1806
768 Ga0207658_10199911 3300025986 Bacteria 1668
769 Ga0207658_10414093 3300025986 Bacteria 1187
770 Ga0207677_10056609 3300026023 Bacteria 2687
771 Ga0207703_10063190 3300026035 Bacteria 3035
772 Ga0207703_10318713 3300026035 Bacteria 1423
773 Ga0207639_10042397 3300026041 Bacteria 3410
774 Ga0207639_10046480 3300026041 Bacteria 3276
775 Ga0207639_10051298 3300026041 Bacteria 3137
776 Ga0207639_10118134 3300026041 Bacteria 2174
777 Ga0207678_10000997 3300026067 Bacteria 25795
778 Ga0207678_10322975 3300026067 Bacteria 1328
779 Ga0207708_10017949 3300026075 Bacteria 5323
780 Ga0207708_10024447 3300026075 Bacteria 4569
781 Ga0207708_10040758 3300026075 Bacteria 3541
782 Ga0207702_10012826 3300026078 Bacteria 6972
783 Ga0207702_10177516 3300026078 Bacteria 1958
784 Ga0207702_10563192 3300026078 Bacteria 1115
785 Ga0207641_10007222 3300026088 Bacteria 9257
786 Ga0207641_10023120 3300026088 Bacteria 5122
787 Ga0207648_10000168 3300026089 Bacteria 67700
788 Ga0207648_10019374 3300026089 Bacteria 6142
789 Ga0207648_10034353 3300026089 Bacteria 4470
790 Ga0207648_10089068 3300026089 Bacteria 2695
791 Ga0207648_10107066 3300026089 Bacteria 2454
792 Ga0207648_10110611 3300026089 Bacteria 2412
793 Ga0207648_10277181 3300026089 Bacteria 1499
794 Ga0207676_10003052 3300026095 Bacteria 11949
795 Ga0207676_10010017 3300026095 Bacteria 6745
796 Ga0207676_10027749 3300026095 Bacteria 4221
797 Ga0207676_10072208 3300026095 Bacteria 2773
798 Ga0207676_10109037 3300026095 Bacteria 2313
799 Ga0207676_10142137 3300026095 Bacteria 2056
800 Ga0207676_10328035 3300026095 Bacteria 1407
801 Ga0207674_10000096 3300026116 Bacteria 98870
802 Ga0207674_10001035 3300026116 Bacteria 36267
803 Ga0207674_10002037 3300026116 Bacteria 25651
804 Ga0207674_10026295 3300026116 Bacteria 6186
805 Ga0207674_10162407 3300026116 Bacteria 2188
806 Ga0207674_10260232 3300026116 Bacteria 1682
807 Ga0207675_100000073 3300026118 Bacteria 76959
808 Ga0207675_100082219 3300026118 Bacteria 3020
809 Ga0207675_100127371 3300026118 Bacteria 2413
810 Ga0207675_100223187 3300026118 Bacteria 1816
811 Ga0207675_100248533 3300026118 Bacteria 1721
812 Ga0207675_100279281 3300026118 Bacteria 1622
813 Ga0207675_100306757 3300026118 Bacteria 1547
814 Ga0207683_10009858 3300026121 Bacteria 8148
815 Ga0207683_10064189 3300026121 Bacteria 3236
816 Ga0207698_10004945 3300026142 Bacteria 8168
817 Ga0207698_10009882 3300026142 Bacteria 6102
818 Ga0207698_10263876 3300026142 Bacteria 1583
819 Ga0207698_10328043 3300026142 Bacteria 1436
820 Ga0209996_1004696 3300027395 Bacteria 1742
821 Ga0209995_1009876 3300027471 Bacteria 1546
822 Ga0209968_1001462 3300027526 Bacteria 3587
823 Ga0209999_1002452 3300027543 Bacteria 3278
824 Ga0209999_1002844 3300027543 Bacteria 3068
825 Ga0209588_1000994 3300027671 Bacteria 7282
826 Ga0209588_1001408 3300027671 Bacteria 6269
827 Ga0209971_1028568 3300027682 Bacteria 1335
828 Ga0209998_10002222 3300027717 Bacteria 4497
829 Ga0209998_10008358 3300027717 Bacteria 2144
830 Ga0209974_10041763 3300027876 Bacteria 1527
831 Ga0207428_10041933 3300027907 Bacteria 3703
832 Ga0268265_10001598 3300028380 Bacteria 18718
833 Ga0268265_10014095 3300028380 Bacteria 5448
834 Ga0268265_10037581 3300028380 Bacteria 3555
835 Ga0268265_10069091 3300028380 Bacteria 2742
836 Ga0268265_10207097 3300028380 Bacteria 1706
837 Ga0268264_10011258 3300028381 Bacteria 7392
838 Ga0268264_10015480 3300028381 Bacteria 6252
839 Ga0268264_10067016 3300028381 Bacteria 3029
840 Ga0265332_10033758 3300031238 Bacteria 2226
841 Ga0265332_10043995 3300031238 Bacteria 1927
842 Ga0307408_100002866 3300031548 Bacteria 11950
843 Ga0307408_100013069 3300031548 Bacteria 5510
844 Ga0307408_100042568 3300031548 Bacteria 3227
845 Ga0307408_100079342 3300031548 Bacteria 2449
846 Ga0307408_100085978 3300031548 Bacteria 2363
847 Ga0307408_100096700 3300031548 Bacteria 2241
848 Ga0307408_100111705 3300031548 Bacteria 2100
849 Ga0307408_100119478 3300031548 Bacteria 2039
850 Ga0307408_100185856 3300031548 Bacteria 1670
851 Ga0307408_100216672 3300031548 Bacteria 1560
852 Ga0307408_100392721 3300031548 Bacteria 1189
853 Ga0316575_10000708 3300031665 Bacteria 9970
854 Ga0316579_10017603 3300031691 Bacteria 3135
855 Ga0316579_10026974 3300031691 Bacteria 2605
856 Ga0265314_10023982 3300031711 Bacteria 4636
857 Ga0316576_10002854 3300031727 Bacteria 9961
858 Ga0316576_10025589 3300031727 Bacteria 4134
859 Ga0316576_10027763 3300031727 Bacteria 3980
860 Ga0316576_10073020 3300031727 Bacteria 2534
861 Ga0316576_10085709 3300031727 Bacteria 2341
862 Ga0316576_10092063 3300031727 Bacteria 2259
863 Ga0316578_10000354 3300031728 Bacteria 14516
864 Ga0316578_10008357 3300031728 Bacteria 5263
865 Ga0316578_10031288 3300031728 Bacteria 3031
866 Ga0316578_10077790 3300031728 Bacteria 1970
867 Ga0316578_10084370 3300031728 Bacteria 1892
868 Ga0307405_10000394 3300031731 Bacteria 16368
869 Ga0307405_10002899 3300031731 Bacteria 7722
870 Ga0307405_10022437 3300031731 Bacteria 3569
871 Ga0307405_10028888 3300031731 Bacteria 3235
872 Ga0307405_10043695 3300031731 Bacteria 2736
873 Ga0307405_10175055 3300031731 Bacteria 1535
874 Ga0307405_10193380 3300031731 Bacteria 1471
875 Ga0307405_10363667 3300031731 Bacteria 1120
876 Ga0307405_10365559 3300031731 Bacteria 1118
877 Ga0316577_10001110 3300031733 Bacteria 12260
878 Ga0316577_10016655 3300031733 Bacteria 4055
879 Ga0316577_10040812 3300031733 Bacteria 2595
880 Ga0316577_10051699 3300031733 Bacteria 2292
881 Ga0307413_10002977 3300031824 Bacteria 7015
882 Ga0307413_10005323 3300031824 Bacteria 5729
883 Ga0307413_10013697 3300031824 Bacteria 4089
884 Ga0307413_10015127 3300031824 Bacteria 3945
885 Ga0307413_10016161 3300031824 Bacteria 3845
886 Ga0307413_10018129 3300031824 Bacteria 3685
887 Ga0307413_10028408 3300031824 Bacteria 3115
888 Ga0307413_10110760 3300031824 Bacteria 1837
889 Ga0307410_10000662 3300031852 Bacteria 14250
890 Ga0307410_10001342 3300031852 Bacteria 11027
891 Ga0307410_10004088 3300031852 Bacteria 7470
892 Ga0307410_10027491 3300031852 Bacteria 3596
893 Ga0307410_10041722 3300031852 Bacteria 3027
894 Ga0307410_10064132 3300031852 Bacteria 2523
895 Ga0307410_10092857 3300031852 Bacteria 2146
896 Ga0307410_10093376 3300031852 Bacteria 2141
897 Ga0307410_10110446 3300031852 Bacteria 1989
898 Ga0307406_10002048 3300031901 Bacteria 11012
899 Ga0307406_10010808 3300031901 Bacteria 5158
900 Ga0307406_10019353 3300031901 Bacteria 3994
901 Ga0307406_10023303 3300031901 Bacteria 3682
902 Ga0307406_10026506 3300031901 Bacteria 3482
903 Ga0307406_10040948 3300031901 Bacteria 2884
904 Ga0307406_10066795 3300031901 Bacteria 2342
905 Ga0307406_10187265 3300031901 Bacteria 1512
906 Ga0307407_10000456 3300031903 Bacteria 12509
907 Ga0307407_10003422 3300031903 Bacteria 6502
908 Ga0307407_10019065 3300031903 Bacteria 3486
909 Ga0307407_10025433 3300031903 Bacteria 3120
910 Ga0307407_10053209 3300031903 Bacteria 2328
911 Ga0307407_10062166 3300031903 Bacteria 2186
912 Ga0307407_10068995 3300031903 Bacteria 2096
913 Ga0307407_10074410 3300031903 Bacteria 2032
914 Ga0307407_10149679 3300031903 Bacteria 1515
915 Ga0307407_10177229 3300031903 Bacteria 1409
916 Ga0307412_10005958 3300031911 Bacteria 6870
917 Ga0307412_10017562 3300031911 Bacteria 4284
918 Ga0307412_10029024 3300031911 Bacteria 3468
919 Ga0307412_10054625 3300031911 Bacteria 2652
920 Ga0307412_10212241 3300031911 Bacteria 1478
921 Ga0307412_10212677 3300031911 Bacteria 1477
922 Ga0307412_10217832 3300031911 Bacteria 1461
923 Ga0307409_100000213 3300031995 Bacteria 23199
924 Ga0307409_100004409 3300031995 Bacteria 7903
925 Ga0307409_100008013 3300031995 Bacteria 6368
926 Ga0307409_100012191 3300031995 Bacteria 5466
927 Ga0307409_100015997 3300031995 Bacteria 4947
928 Ga0307409_100025397 3300031995 Bacteria 4155
929 Ga0307409_100026045 3300031995 Bacteria 4117
930 Ga0307409_100028466 3300031995 Bacteria 3981
931 Ga0307409_100069080 3300031995 Bacteria 2797
932 Ga0307409_100080899 3300031995 Bacteria 2624
933 Ga0307409_100105235 3300031995 Bacteria 2352
934 Ga0307409_100114970 3300031995 Bacteria 2265
935 Ga0307409_100125882 3300031995 Bacteria 2179
936 Ga0307409_100128290 3300031995 Bacteria 2162
937 Ga0307409_100223129 3300031995 Bacteria 1703
938 Ga0307409_100228793 3300031995 Bacteria 1684
939 Ga0307416_100000358 3300032002 Bacteria 23736
940 Ga0307416_100004593 3300032002 Bacteria 8352
941 Ga0307416_100008017 3300032002 Bacteria 6766
942 Ga0307416_100010738 3300032002 Bacteria 6067
943 Ga0307416_100011581 3300032002 Bacteria 5891
944 Ga0307416_100015995 3300032002 Bacteria 5199
945 Ga0307416_100073603 3300032002 Bacteria 2849
946 Ga0307416_100099971 3300032002 Bacteria 2521
947 Ga0307416_100106534 3300032002 Bacteria 2457
948 Ga0307416_100191027 3300032002 Bacteria 1931
949 Ga0307416_100226508 3300032002 Bacteria 1798
950 Ga0307416_100561961 3300032002 Bacteria 1216
951 Ga0307414_10001787 3300032004 Bacteria 11127
952 Ga0307414_10024780 3300032004 Bacteria 3831
953 Ga0307414_10027258 3300032004 Bacteria 3690
954 Ga0307414_10036290 3300032004 Bacteria 3290
955 Ga0307414_10059013 3300032004 Bacteria 2707
956 Ga0307414_10089645 3300032004 Bacteria 2280
957 Ga0307414_10131238 3300032004 Bacteria 1945
958 Ga0307414_10137084 3300032004 Bacteria 1910
959 Ga0307414_10139893 3300032004 Bacteria 1893
960 Ga0307414_10199547 3300032004 Bacteria 1626
961 Ga0307414_10238778 3300032004 Bacteria 1503
962 Ga0307411_10001361 3300032005 Bacteria 9888
963 Ga0307411_10006797 3300032005 Bacteria 5758
964 Ga0307411_10017585 3300032005 Bacteria 4079
965 Ga0307411_10021736 3300032005 Bacteria 3761
966 Ga0307411_10044613 3300032005 Bacteria 2846
967 Ga0307411_10049317 3300032005 Bacteria 2735
968 Ga0307411_10060202 3300032005 Bacteria 2520
969 Ga0307411_10140107 3300032005 Bacteria 1782
970 Ga0307411_10263390 3300032005 Bacteria 1362
971 Ga0307415_100005406 3300032126 Bacteria 6780
972 Ga0307415_100009214 3300032126 Bacteria 5517
973 Ga0307415_100014499 3300032126 Bacteria 4637
974 Ga0307415_100020478 3300032126 Bacteria 4039
975 Ga0307415_100021732 3300032126 Bacteria 3950
976 Ga0307415_100037278 3300032126 Bacteria 3193
977 Ga0307415_100128242 3300032126 Bacteria 1915
978 Ga0307415_100133336 3300032126 Bacteria 1884
979 Ga0307415_100191733 3300032126 Bacteria 1613
980 Ga0307415_100258977 3300032126 Bacteria 1418
981 Ga0316583_10000577 3300032133 Bacteria 11091
982 Ga0316580_10013751 3300032139 Bacteria 2466
983 Ga0373950_0006063 3300034818 Bacteria 1828
984 Ga0373959_0000432 3300034820 Bacteria 8015
985 Ga0373959_0004785 3300034820 Bacteria 2197
986 Ga0373938_0017699 3300034957 Bacteria 1406
987 Ga0373926_0019552 3300035083 Bacteria 2335
988 Ga0373934_0000319 3300035086 Bacteria 16910
989 Ga0373934_0002820 3300035086 Bacteria 6367
990 Ga0373934_0009088 3300035086 Bacteria 3717
991 Ga0373940_0008027 3300035088 Bacteria 2407
992 Ga0373944_0022241 3300035089 Bacteria 1841
993 Ga0373944_0052869 3300035089 Bacteria 1284
994 Ga0373953_0023613 3300035117 Bacteria 2329
995 Ga0373954_0003610 3300035118 Bacteria 6583
996 Ga0373956_0011441 3300035119 Bacteria 3657
997 Ga0373957_0053860 3300035120 Bacteria 1544
998 Ga0373957_0121286 3300035120 Bacteria 1058
999 Ga0373943_0000549 3300035170 Bacteria 16230
1000 Ga0373943_0044911 3300035170 Bacteria 2151
1001 Ga0373955_0000540 3300035172 Bacteria 16052
1002 Ga0373955_0003972 3300035172 Bacteria 6529
1003 Ga0373955_0011027 3300035172 Bacteria 4291
1004 Ga0316574_0015867 3300035398 Bacteria 4377
1005 Ga0316574_0025290 3300035398 Bacteria 3562
1006 Ga0316574_0055042 3300035398 Bacteria 2486
1007 Ga0373924_0091374 3300035410 Bacteria 1302
1008 Ga0373924_0132030 3300035410 Bacteria 1087
1009 Ga0373931_0011137 3300035691 Bacteria 4339
1010 Ga0373931_0019052 3300035691 Bacteria 3420
1011 Ga0373935_0004661 3300035692 Bacteria 8061
1012 Ga0373927_0007244 3300035695 Bacteria 7525
1013 Ga0373927_0076400 3300035695 Bacteria 2169
1014 Ga0373933_0000499 3300035724 Bacteria 24433
1015 Ga0373933_0006055 3300035724 Bacteria 6581
1016 Ga0373947_0000580 3300035725 Bacteria 21452
1017 Ga0373937_0001442 3300036401 Bacteria 19885
1018 Ga0373937_0001736 3300036401 Bacteria 18330
1019 Ga0373937_0034278 3300036401 Bacteria 4618
1020 Ga0373937_0046957 3300036401 Bacteria 3950
1021 Ga0373937_0063692 3300036401 Bacteria 3391
1022 Ga0373937_0127509 3300036401 Bacteria 2375
1023 Ga0316582_0072461 3300036647 Bacteria 2233
1024 Ga0316582_0129643 3300036647 Bacteria 1693
1025 Ga0316584_0004901 3300036712 Bacteria 8905
1026 Ga0316584_0038181 3300036712 Bacteria 3571
1027 Ga0316584_0209713 3300036712 Bacteria 1434
1028 Ga0373925_0001431 3300037068 Bacteria 20677
1029 Ga0373925_0072484 3300037068 Bacteria 2606
1030 Ga0373925_0164240 3300037068 Bacteria 1750
1031 Ga0373925_0287715 3300037068 Bacteria 1325
1032 Ga0395899_0032220 3300037312 Bacteria 3938
1033 Ga0395905_0046569 3300037471 Bacteria 4067
1034 Ga0316581_0010550 3300037588 Bacteria 2565
1035 Ga0436364_1446815 3300037853 Bacteria 11657
1036 Ga0395901_0049273 3300038443 Bacteria 4376
1037 Ga0395901_0078322 3300038443 Bacteria 3451
1038 Ga0436365_0332204 3300039437 Bacteria 2683
1039 Ga0439439_0007066 3300041406 Bacteria 2617
1040 Ga0439457_022918 3300042014 Bacteria 1382
1041 Ga0439462_0036350 3300042015 Bacteria 1311
1042 Ga0450923_004990 3300042125 Bacteria 2118
1043 Ga0451577_0000016 3300042876 Bacteria 531002
1044 Ga0451577_0012754 3300042876 Bacteria 7883
1045 Ga0451577_0164655 3300042876 Bacteria 1998
1046 Ga0453683_0020096 3300044673 Bacteria 4269
1047 Ga0453683_0049913 3300044673 Bacteria 2622
1048 Ga0453683_0052131 3300044673 Bacteria 2562
1049 Ga0453683_0102734 3300044673 Bacteria 1795
1050 Ga0466965_0089429 3300044683 Bacteria 1565
1051 Ga0466966_0036039 3300044684 Bacteria 3195
1052 Ga0466961_0021024 3300044693 Bacteria 4199
1053 Ga0453684_0000368 3300044712 Bacteria 185018
1054 Ga0453684_0019321 3300044712 Bacteria 10381
1055 Ga0453684_0270060 3300044712 Bacteria 1944
1056 Ga0466957_0206407 3300044842 Bacteria 1292
1057 Ga0466960_0192540 3300044901 Bacteria 1110
1058 Ga0451576_0010003 3300045051 Bacteria 10931
1059 Ga0451576_0018465 3300045051 Bacteria 7645
1060 Ga0451576_0021204 3300045051 Bacteria 7063
1061 Ga0451576_0033329 3300045051 Bacteria 5474
1062 Ga0451576_0057044 3300045051 Bacteria 4083
1063 Ga0451576_0076832 3300045051 Bacteria 3475
1064 Ga0451576_0082509 3300045051 Bacteria 3343
1065 Ga0451576_0293603 3300045051 Bacteria 1699
1066 Ga0466958_0173464 3300045836 Bacteria 1366
1067 Ga0466967_0080800 3300045976 Bacteria 2935
1068 Ga0466967_0101799 3300045976 Bacteria 2626
1069 Ga0466967_0103174 3300045976 Bacteria 2610
1070 Ga0466967_0318726 3300045976 Bacteria 1499
1071 Ga0495592_0009404 3300046454 Bacteria 7351
1072 Ga0495603_0005008 3300046455 Bacteria 7925
1073 Ga0495603_0011722 3300046455 Bacteria 5307
1074 Ga0495603_0033808 3300046455 Bacteria 3076
1075 Ga0495629_0070215 3300046459 Bacteria 2444
1076 Ga0495629_0101203 3300046459 Bacteria 2011
1077 Ga0495641_0025177 3300046461 Bacteria 2923
1078 Ga0495651_0001411 3300046462 Bacteria 18653
1079 Ga0495651_0009551 3300046462 Bacteria 7453
1080 Ga0495651_0036788 3300046462 Bacteria 3811
1081 Ga0495653_0008915 3300046463 Bacteria 8202
1082 Ga0495653_0018299 3300046463 Bacteria 5693
1083 Ga0495653_0065451 3300046463 Bacteria 2736
1084 Ga0495580_0003447 3300046472 Bacteria 13470
1085 Ga0495580_0073719 3300046472 Bacteria 2383
1086 Ga0495580_0160105 3300046472 Bacteria 1558
1087 Ga0495580_0242135 3300046472 Bacteria 1236
1088 Ga0495582_0008456 3300046473 Bacteria 5679
1089 Ga0495582_0100710 3300046473 Bacteria 1617
1090 Ga0495639_0001681 3300046475 Bacteria 9825
1091 Ga0495639_0005477 3300046475 Bacteria 5466
1092 Ga0495664_0002618 3300046477 Bacteria 9679
1093 Ga0495664_0005946 3300046477 Bacteria 6720
1094 Ga0495664_0059152 3300046477 Bacteria 2281
1095 Ga0495664_0173936 3300046477 Bacteria 1306
1096 Ga0495594_0002309 3300046499 Bacteria 9931
1097 Ga0495594_0008467 3300046499 Bacteria 5301
1098 Ga0495608_0006333 3300046511 Bacteria 8395
1099 Ga0495608_0019948 3300046511 Bacteria 4610
1100 Ga0495608_0051142 3300046511 Bacteria 2739
1101 Ga0495618_0019976 3300046514 Bacteria 4123
1102 Ga0495618_0150938 3300046514 Bacteria 1484
1103 Ga0495628_0006895 3300046516 Bacteria 9872
1104 Ga0495628_0017832 3300046516 Bacteria 5893
1105 Ga0495628_0038526 3300046516 Bacteria 3826
1106 Ga0495628_0110015 3300046516 Bacteria 2120
1107 Ga0495630_0005984 3300046517 Bacteria 8598
1108 Ga0495630_0009425 3300046517 Bacteria 7019
1109 Ga0495630_0010790 3300046517 Bacteria 6595
1110 Ga0495630_0034688 3300046517 Bacteria 3768
1111 Ga0495630_0174674 3300046517 Bacteria 1637
1112 Ga0495630_0177150 3300046517 Bacteria 1625
1113 Ga0495630_0180801 3300046517 Bacteria 1608
1114 Ga0495643_0000008 3300046522 Bacteria 367010
1115 Ga0495663_0056074 3300046525 Bacteria 1230
1116 Ga0495666_0003940 3300046526 Bacteria 7504
1117 Ga0495666_0010349 3300046526 Bacteria 4649
1118 Ga0495642_0079883 3300046528 Bacteria 1376
1119 Ga0495652_0000859 3300046529 Bacteria 35014
1120 Ga0495652_0001382 3300046529 Bacteria 26986
1121 Ga0495652_0015457 3300046529 Bacteria 6835
1122 Ga0495652_0027043 3300046529 Bacteria 5059
1123 Ga0495652_0233608 3300046529 Bacteria 1373
1124 Ga0495665_0000677 3300046531 Bacteria 17457
1125 Ga0495665_0018268 3300046531 Bacteria 3768
1126 Ga0495665_0042870 3300046531 Bacteria 2407
1127 Ga0495640_0009684 3300046533 Bacteria 7492
1128 Ga0495640_0014353 3300046533 Bacteria 5998
1129 Ga0495640_0072628 3300046533 Bacteria 2305
1130 Ga0495640_0081970 3300046533 Bacteria 2144
1131 Ga0495586_0001306 3300046535 Bacteria 13889
1132 Ga0495586_0071020 3300046535 Bacteria 1902
1133 Ga0495586_0113348 3300046535 Bacteria 1510
1134 Ga0495587_0000360 3300046536 Bacteria 32695
1135 Ga0495587_0001414 3300046536 Bacteria 15949
1136 Ga0495587_0004216 3300046536 Bacteria 9515
1137 Ga0495587_0031682 3300046536 Bacteria 3200
1138 Ga0495587_0215635 3300046536 Bacteria 1083
1139 Ga0495645_0001196 3300046543 Bacteria 17732
1140 Ga0495645_0001984 3300046543 Bacteria 13903
1141 Ga0495645_0017482 3300046543 Bacteria 5138
1142 Ga0495645_0177035 3300046543 Bacteria 1464
1143 Ga0495667_0004915 3300046559 Bacteria 9039
1144 Ga0495667_0013907 3300046559 Bacteria 5434
1145 Ga0495667_0092353 3300046559 Bacteria 1960
1146 Ga0495634_0006940 3300046642 Bacteria 8553
1147 Ga0495634_0028041 3300046642 Bacteria 3912
1148 Ga0495634_0226603 3300046642 Bacteria 1151
1149 Ga0495635_0000299 3300046663 Bacteria 31934
1150 Ga0495635_0005634 3300046663 Bacteria 8726
1151 Ga0495635_0126716 3300046663 Bacteria 1741
1152 Ga0495659_0004294 3300046664 Bacteria 4491
1153 Ga0495588_0000514 3300046674 Bacteria 18704
1154 Ga0495657_0003790 3300046675 Bacteria 12230
1155 Ga0495657_0023341 3300046675 Bacteria 4421
1156 Ga0495599_0000395 3300046678 Bacteria 24958
1157 Ga0495599_0195546 3300046678 Bacteria 1243
1158 Ga0495623_0002015 3300046679 Bacteria 13636
1159 Ga0495623_0008673 3300046679 Bacteria 6602
1160 Ga0495623_0035931 3300046679 Bacteria 3175
1161 Ga0495623_0051600 3300046679 Bacteria 2601
1162 Ga0495623_0052477 3300046679 Bacteria 2576
1163 Ga0495646_0002501 3300046680 Bacteria 11286
1164 Ga0495646_0022846 3300046680 Bacteria 3940
1165 Ga0495647_0003603 3300046681 Bacteria 4968
1166 Ga0495658_0001660 3300046683 Bacteria 11572
1167 Ga0495658_0007314 3300046683 Bacteria 5458
1168 Ga0495658_0063924 3300046683 Bacteria 2119
1169 Ga0495613_0020546 3300046689 Bacteria 4922
1170 Ga0495613_0028351 3300046689 Bacteria 4163
1171 Ga0495613_0039747 3300046689 Bacteria 3487
1172 Ga0495613_0047188 3300046689 Bacteria 3182
1173 Ga0495624_0114461 3300046690 Bacteria 1658
1174 Ga0495600_0000095 3300046809 Bacteria 48392
1175 Ga0495600_0006625 3300046809 Bacteria 7056
1176 Ga0495600_0083341 3300046809 Bacteria 2087
1177 Ga0495581_0000585 3300047315 Bacteria 19041
1178 Ga0495581_0022877 3300047315 Bacteria 3620
1179 Ga0495581_0058709 3300047315 Bacteria 2222
1180 Ga0495604_0003090 3300047317 Bacteria 13320
1181 Ga0495604_0006235 3300047317 Bacteria 9461
1182 Ga0495604_0112329 3300047317 Bacteria 1985
1183 Ga0495604_0116233 3300047317 Bacteria 1943
1184 Ga0495604_0258970 3300047317 Bacteria 1183
1185 Ga0495674_0000884 3300047319 Bacteria 28750
1186 Ga0495674_0003021 3300047319 Bacteria 16377
1187 Ga0495674_0013476 3300047319 Bacteria 7688
1188 Ga0495672_0007178 3300047320 Bacteria 8423
1189 Ga0495676_0074643 3300047321 Bacteria 2596
1190 Ga0495676_0134295 3300047321 Bacteria 1782
1191 Ga0495680_0002867 3300047322 Bacteria 17322
1192 Ga0495680_0074369 3300047322 Bacteria 2580
1193 Ga0495675_0031956 3300047444 Bacteria 3361
1194 Ga0495684_0000800 3300047471 Bacteria 25586
1195 Ga0495684_0023090 3300047471 Bacteria 4784
1196 Ga0495684_0031147 3300047471 Bacteria 4094
1197 Ga0495684_0128965 3300047471 Bacteria 1901
1198 Ga0495684_0145926 3300047471 Bacteria 1772
1199 Ga0495684_0182833 3300047471 Bacteria 1553
1200 Ga0495593_0000691 3300047673 Bacteria 19474
1201 Ga0495593_0061810 3300047673 Bacteria 1959
1202 Ga0495593_0107661 3300047673 Bacteria 1425
1203 Ga0495602_0016778 3300048088 Bacteria 7353
1204 Ga0495602_0022463 3300048088 Bacteria 6174
1205 Ga0495602_0025919 3300048088 Bacteria 5666
1206 Ga0495614_0028389 3300048089 Bacteria 2410
1207 Ga0496100_0175879 3300048903 Bacteria 1545
1208 Ga0496101_0062284 3300048904 Bacteria 2712
1209 Ga0496101_0183323 3300048904 Bacteria 1613
1210 Ga0496102_0026559 3300048905 Bacteria 5166
1211 Ga0496102_0032086 3300048905 Bacteria 4718
1212 Ga0496102_0191323 3300048905 Bacteria 1928
1213 Ga0496103_0063986 3300048906 Bacteria 2292
1214 Ga0496104_0007186 3300048907 Bacteria 9819
1215 Ga0496104_0014815 3300048907 Bacteria 7047
1216 Ga0496104_0015208 3300048907 Bacteria 6967
1217 Ga0496104_0031225 3300048907 Bacteria 4953
1218 Ga0496104_0226698 3300048907 Bacteria 1781
1219 Ga0496106_0007036 3300048909 Bacteria 8310
1220 Ga0496106_0008502 3300048909 Bacteria 7593
1221 Ga0496106_0027185 3300048909 Bacteria 4261
1222 Ga0496106_0126654 3300048909 Bacteria 2000
1223 Ga0496107_0181561 3300048910 Bacteria 1562
1224 Ga0496107_0222767 3300048910 Bacteria 1403
1225 Ga0496108_0002484 3300048911 Bacteria 14756
1226 Ga0496108_0003517 3300048911 Bacteria 12554
1227 Ga0496108_0045652 3300048911 Bacteria 3659
1228 Ga0496108_0052468 3300048911 Bacteria 3417
1229 Ga0496108_0055904 3300048911 Bacteria 3315
1230 Ga0496108_0301029 3300048911 Bacteria 1397
1231 Ga0496109_0006923 3300048912 Bacteria 9567
1232 Ga0496109_0009441 3300048912 Bacteria 8315
1233 Ga0496109_0010400 3300048912 Bacteria 7946
1234 Ga0496109_0020450 3300048912 Bacteria 5846
1235 Ga0496109_0055601 3300048912 Bacteria 3611
1236 Ga0496109_0278818 3300048912 Bacteria 1575
1237 Ga0496109_0375321 3300048912 Bacteria 1343
1238 Ga0496110_0003462 3300048913 Bacteria 12098
1239 Ga0496110_0013692 3300048913 Bacteria 6719
1240 Ga0496110_0026688 3300048913 Bacteria 4945
1241 Ga0496110_0070616 3300048913 Bacteria 3095
1242 Ga0496111_0001937 3300048914 Bacteria 12257
1243 Ga0496111_0027365 3300048914 Bacteria 4033
1244 Ga0496111_0048983 3300048914 Bacteria 3046
1245 Ga0496111_0074027 3300048914 Bacteria 2480
1246 Ga0496112_0001295 3300048915 Bacteria 18997
1247 Ga0496112_0004030 3300048915 Bacteria 12322
1248 Ga0496112_0007049 3300048915 Bacteria 9930
1249 Ga0496112_0008621 3300048915 Bacteria 9140
1250 Ga0496112_0016302 3300048915 Bacteria 6957
1251 Ga0496112_0215159 3300048915 Bacteria 1878
1252 Ga0496112_0404950 3300048915 Bacteria 1304
1253 Ga0496112_0418259 3300048915 Bacteria 1279
1254 Ga0496113_0001773 3300048916 Bacteria 12240
1255 Ga0496113_0012438 3300048916 Bacteria 5718
1256 Ga0496113_0014172 3300048916 Bacteria 5430
1257 Ga0496113_0014813 3300048916 Bacteria 5335
1258 Ga0496113_0050110 3300048916 Bacteria 3112
1259 Ga0496113_0053486 3300048916 Bacteria 3019
1260 Ga0496113_0081721 3300048916 Bacteria 2477
1261 Ga0496114_0010054 3300048917 Bacteria 7522
1262 Ga0496114_0163530 3300048917 Bacteria 1937
1263 Ga0496115_0002487 3300048918 Bacteria 13251
1264 Ga0496115_0056554 3300048918 Bacteria 3153
1265 Ga0496115_0059488 3300048918 Bacteria 3077
1266 Ga0501292_009824 3300049515 Bacteria 1425
1267 Ga0501296_009783 3300049519 Bacteria 1128
1268 Ga0501033_0006099 3300049570 Bacteria 9454
1269 Ga0501033_0061122 3300049570 Bacteria 2777
1270 Ga0501033_0188783 3300049570 Bacteria 1475
1271 Ga0501034_0001591 3300049571 Bacteria 29545
1272 Ga0501034_0009383 3300049571 Bacteria 10249
1273 Ga0501034_0108455 3300049571 Bacteria 2768
1274 Ga0501034_0136902 3300049571 Bacteria 2430
1275 Ga0501036_0026600 3300049572 Bacteria 4886
1276 Ga0501036_0034603 3300049572 Bacteria 4274
1277 Ga0501036_0309770 3300049572 Bacteria 1320
1278 Ga0501037_0171495 3300049573 Bacteria 1542
1279 Ga0501038_0129645 3300049574 Bacteria 2072
1280 Ga0501040_0222378 3300049576 Bacteria 1343
1281 Ga0501040_0258731 3300049576 Bacteria 1242
1282 Ga0501040_0322298 3300049576 Bacteria 1105
1283 Ga0501041_0028688 3300049577 Bacteria 3357
1284 Ga0501042_0039683 3300049578 Bacteria 3347
1285 Ga0501042_0042703 3300049578 Bacteria 3228
1286 Ga0501043_0007990 3300049579 Bacteria 8354
1287 Ga0501043_0069132 3300049579 Bacteria 2774
1288 Ga0501043_0099438 3300049579 Bacteria 2287
1289 Ga0501046_0007943 3300049580 Bacteria 9284
1290 Ga0501046_0067271 3300049580 Bacteria 2790
1291 Ga0501047_0000515 3300049581 Bacteria 41775
1292 Ga0501047_0016410 3300049581 Bacteria 7069
1293 Ga0501047_0079575 3300049581 Bacteria 3151
1294 Ga0501047_0097487 3300049581 Bacteria 2818
1295 Ga0501047_0102535 3300049581 Bacteria 2741
1296 Ga0501048_0134461 3300049582 Bacteria 1747
1297 Ga0501048_0169929 3300049582 Bacteria 1544
1298 Ga0501067_0000204 3300049583 Bacteria 33233
1299 Ga0501067_0000816 3300049583 Bacteria 16794
1300 Ga0501067_0008563 3300049583 Bacteria 5675
1301 Ga0501067_0016663 3300049583 Bacteria 4061
1302 Ga0501068_0000153 3300049584 Bacteria 31864
1303 Ga0501068_0000377 3300049584 Bacteria 22422
1304 Ga0501069_0000130 3300049585 Bacteria 32714
1305 Ga0501069_0000606 3300049585 Bacteria 16586
1306 Ga0501069_0043927 3300049585 Bacteria 2474
1307 Ga0501070_0000331 3300049586 Bacteria 42978
1308 Ga0501070_0004826 3300049586 Bacteria 11522
1309 Ga0501070_0012137 3300049586 Bacteria 7270
1310 Ga0501070_0019568 3300049586 Bacteria 5676
1311 Ga0501070_0078417 3300049586 Bacteria 2734
1312 Ga0501070_0081869 3300049586 Bacteria 2671
1313 Ga0501071_0000065 3300049587 Bacteria 37104
1314 Ga0501071_0000163 3300049587 Bacteria 28577
1315 Ga0501071_0020734 3300049587 Bacteria 4571
1316 Ga0501072_0000039 3300049588 Bacteria 113463
1317 Ga0501072_0059713 3300049588 Bacteria 3007
1318 Ga0501072_0064012 3300049588 Bacteria 2900
1319 Ga0501072_0103665 3300049588 Bacteria 2261
1320 Ga0501072_0130710 3300049588 Bacteria 2001
1321 Ga0501073_0002482 3300049589 Bacteria 13768
1322 Ga0501073_0005706 3300049589 Bacteria 9311
1323 Ga0501074_0000020 3300049590 Bacteria 71979
1324 Ga0501074_0037827 3300049590 Bacteria 3497
1325 Ga0501074_0176802 3300049590 Bacteria 1523
1326 Ga0501075_0011148 3300049591 Bacteria 6353
1327 Ga0501075_0076628 3300049591 Bacteria 2530
1328 Ga0501076_0000656 3300049592 Bacteria 22184
1329 Ga0501076_0124814 3300049592 Bacteria 2086
1330 Ga0501076_0126895 3300049592 Bacteria 2068
1331 Ga0501077_0000584 3300049593 Bacteria 22057
1332 Ga0501077_0022217 3300049593 Bacteria 4019
1333 Ga0501077_0025134 3300049593 Bacteria 3783
1334 Ga0501209_027971 3300049656 Bacteria 1405
1335 Ga0501217_017324 3300049661 Bacteria 1660
1336 Ga0501235_011480 3300049669 Bacteria 1944
1337 Ga0501247_006688 3300049677 Bacteria 1310
1338 Ga0501249_024021 3300049679 Bacteria 1341
1339 Ga0501258_003658 3300049687 Bacteria 1419
1340 Ga0501260_004254 3300049689 Bacteria 1317
1341 Ga0501234_014834 3300049707 Bacteria 1225
1342 Ga0501079_0011332 3300049741 Bacteria 6802
1343 Ga0501079_0024042 3300049741 Bacteria 4674
1344 Ga0501079_0046920 3300049741 Bacteria 3333
1345 Ga0501079_0091002 3300049741 Bacteria 2364
1346 Ga0501079_0094709 3300049741 Bacteria 2314
1347 Ga0501079_0112485 3300049741 Bacteria 2116
1348 Ga0501079_0120979 3300049741 Bacteria 2036
1349 Ga0501080_0001007 3300049742 Bacteria 23154
1350 Ga0501080_0002521 3300049742 Bacteria 16053
1351 Ga0501080_0008610 3300049742 Bacteria 9259
1352 Ga0501080_0009635 3300049742 Bacteria 8818
1353 Ga0501080_0020039 3300049742 Bacteria 6188
1354 Ga0501080_0102202 3300049742 Bacteria 2659
1355 Ga0501080_0191329 3300049742 Bacteria 1880
1356 Ga0501081_0004523 3300049743 Bacteria 8930
1357 Ga0501081_0015593 3300049743 Bacteria 5016
1358 Ga0501081_0195974 3300049743 Bacteria 1464
1359 Ga0501081_0267315 3300049743 Bacteria 1250
1360 Ga0501083_0000754 3300049744 Bacteria 21131
1361 Ga0501083_0007655 3300049744 Bacteria 7657
1362 Ga0501083_0137852 3300049744 Bacteria 1598
1363 Ga0501267_004597 3300049764 Bacteria 1288
1364 Ga0501268_003932 3300049765 Bacteria 2068
1365 Ga0501268_010508 3300049765 Bacteria 1443
1366 Ga0501270_007815 3300049767 Bacteria 1336
1367 Ga0501271_004589 3300049768 Bacteria 1316
1368 Ga0501272_002149 3300049769 Bacteria 1940
1369 Ga0501035_0001214 3300049822 Bacteria 26839
1370 Ga0501035_0020222 3300049822 Bacteria 6114
1371 Ga0501035_0167922 3300049822 Bacteria 1897
1372 Ga0501044_0004710 3300049823 Bacteria 15252
1373 Ga0501044_0009533 3300049823 Bacteria 10572
1374 Ga0501044_0221917 3300049823 Bacteria 1841
1375 Ga0501045_0014042 3300049824 Bacteria 5669
1376 Ga0501045_0028578 3300049824 Bacteria 4024
1377 Ga0501045_0033379 3300049824 Bacteria 3731
1378 Ga0501204_005429 3300049850 Bacteria 1398
1379 nmdc:mga05p37_120863_c1 3300050507 Bacteria 3218
1380 nmdc:mga05p37_137117_c2 3300050507 Bacteria 2026
1381 nmdc:mga05p37_197175_c1 3300050507 Bacteria 2070
1382 nmdc:mga05p37_25871_c1 3300050507 Bacteria 7135
1383 nmdc:mga05p37_37646_c1 3300050507 Bacteria 5932
1384 nmdc:mga05p37_6407_c1 3300050507 Bacteria 13871
1385 nmdc:mga05p37_74137_c1 3300050507 Bacteria 4189
1386 nmdc:mga05p37_758310_c1 3300050507 Bacteria 1068
1387 nmdc:mga09592_21870_c1 3300050508 Bacteria 5274
1388 nmdc:mga09592_341309_c1 3300050508 Bacteria 1297
1389 nmdc:mga09592_69425_c1 3300050508 Bacteria 2989
1390 nmdc:mga0qj67_14072_c1 3300050509 Bacteria 6041
1391 nmdc:mga0qj67_14910_c2 3300050509 Bacteria 2734
1392 nmdc:mga0qj67_159321_c1 3300050509 Bacteria 1832
1393 nmdc:mga0qj67_23863_c1 3300050509 Bacteria 4710
1394 nmdc:mga0qj67_41649_c1 3300050509 Bacteria 3613
1395 nmdc:mga06r32_20282_c1 3300050510 Bacteria 6116
1396 nmdc:mga06r32_240900_c1 3300050510 Bacteria 1796
1397 nmdc:mga06r32_326373_c1 3300050510 Bacteria 1520
1398 nmdc:mga06r32_330283_c1 3300050510 Bacteria 1510
1399 nmdc:mga06r32_40334_c1 3300050510 Bacteria 4431
1400 nmdc:mga06r32_43325_c1 3300050510 Bacteria 4282
1401 nmdc:mga06r32_83624_c1 3300050510 Bacteria 3110
1402 nmdc:mga06r32_89950_c1 3300050510 Bacteria 2998
1403 nmdc:mga08y16_12861_c1 3300050511 Bacteria 8801
1404 nmdc:mga08y16_149074_c1 3300050511 Bacteria 2432
1405 nmdc:mga08y16_183850_c1 3300050511 Bacteria 2169
1406 nmdc:mga08y16_49788_c1 3300050511 Bacteria 4384
1407 nmdc:mga0n895_10574_c1 3300050512 Bacteria 8166
1408 nmdc:mga0n895_13501_c1 3300050512 Bacteria 7372
1409 nmdc:mga0n895_170412_c1 3300050512 Bacteria 2209
1410 nmdc:mga0n895_22962_c1 3300050512 Bacteria 5855
1411 nmdc:mga0n895_2759_c1 3300050512 Bacteria 13874
1412 nmdc:mga0n895_29621_c1 3300050512 Bacteria 5224
1413 nmdc:mga0n895_361213_c1 3300050512 Bacteria 1470
1414 nmdc:mga0n895_458261_c1 3300050512 Bacteria 1287
1415 nmdc:mga0n895_521_c1 3300050512 Bacteria 26191
1416 nmdc:mga0n895_709573_c1 3300050512 Bacteria 1001
1417 nmdc:mga0n895_97650_c1 3300050512 Bacteria 2943
1418 nmdc:mga0rr50_130186_c1 3300050513 Bacteria 2014
1419 nmdc:mga0rr50_21705_c1 3300050513 Bacteria 4389
1420 nmdc:mga0rr50_4014_c1 3300050513 Bacteria 8583
1421 nmdc:mga0rr50_439846_c1 3300050513 Bacteria 1104
1422 nmdc:mga0rr50_62691_c1 3300050513 Bacteria 2806
1423 nmdc:mga0rr50_86667_c1 3300050513 Bacteria 2430
1424 nmdc:mga0rr50_97572_c1 3300050513 Bacteria 2302
1425 nmdc:mga08x19_125216_c1 3300050514 Bacteria 1725
1426 nmdc:mga08x19_13213_c1 3300050514 Bacteria 4986
1427 nmdc:mga08x19_13241_c1 3300050514 Bacteria 4981
1428 nmdc:mga08x19_148599_c1 3300050514 Bacteria 1586
1429 nmdc:mga08x19_20252_c1 3300050514 Bacteria 4096
1430 nmdc:mga08x19_29183_c1 3300050514 Bacteria 3459
1431 nmdc:mga08x19_3422_c1 3300050514 Bacteria 9465
1432 nmdc:mga08x19_44018_c1 3300050514 Bacteria 2849
1433 nmdc:mga08x19_65482_c1 3300050514 Bacteria 2360
1434 nmdc:mga0a205_10092_c1 3300050515 Bacteria 8666
1435 nmdc:mga0a205_111028_c1 3300050515 Bacteria 2640
1436 nmdc:mga0a205_20579_c1 3300050515 Bacteria 6228
1437 nmdc:mga0a205_28153_c1 3300050515 Bacteria 5371
1438 nmdc:mga0a205_34279_c1 3300050515 Bacteria 4871
1439 nmdc:mga0a205_356_c1 3300050515 Bacteria 34589
1440 nmdc:mga0a205_44203_c1 3300050515 Bacteria 4293
1441 nmdc:mga0a205_45064_c1 3300050515 Bacteria 4253
1442 nmdc:mga0a205_49624_c1 3300050515 Bacteria 4052
1443 nmdc:mga0a205_74322_c1 3300050515 Bacteria 3284
1444 nmdc:mga0a205_99168_c1 3300050515 Bacteria 2811
1445 Ga0495601_0008664 3300053077 Bacteria 6004
1446 Ga0495612_0005568 3300053078 Bacteria 5209
1447 Ga0495612_0008212 3300053078 Bacteria 4241
1448 Ga0495595_0004978 3300053084 Bacteria 5363
1449 Ga0495619_0005859 3300053085 Bacteria 7786
1450 Ga0495619_0217895 3300053085 Bacteria 1322
1451 Ga0495619_0244994 3300053085 Bacteria 1242
1452 Ga0500628_016637 3300053129 Bacteria 1424
1453 Ga0501084_0001120 3300054114 Bacteria 20911
1454 Ga0501084_0008248 3300054114 Bacteria 8593
1455 Ga0501084_0008981 3300054114 Bacteria 8265
1456 Ga0501084_0170970 3300054114 Bacteria 1834
1457 Ga0501084_0177275 3300054114 Bacteria 1799
1458 Ga0590071_004391 3300059421 Bacteria 3427
1459 Ga0590071_011035 3300059421 Bacteria 2113
1460 Ga0501082_0000246 3300060353 Bacteria 47507
1461 Ga0501082_0018479 3300060353 Bacteria 6005
1462 Ga0501082_0044061 3300060353 Bacteria 3849
1463 Ga0501082_0083606 3300060353 Bacteria 2754
1464 Ga0501082_0110123 3300060353 Bacteria 2384
1465 Ga0070696_100000317
1466 Ga0058863_11613365
1467 Ga0058863_11923594
1468 Ga0058862_10074850
1469 Ga0065715_10125066
1470 Ga0065715_10171985
1471 Ga0065715_10210423
1472 Ga0065707_10179456
1473 Ga0070658_10002410
1474 Ga0070658_10009372
1475 Ga0070658_10019543
1476 Ga0070658_10119251
1477 Ga0070658_10138528
1478 Ga0070658_10151769
1479 Ga0070676_10001069
1480 Ga0070676_10039372
1481 Ga0070676_10092138
1482 Ga0070683_100002655
1483 Ga0070683_100011177
1484 Ga0070683_100015270
1485 Ga0070683_100029316
1486 Ga0070683_100096198
1487 Ga0070683_100252130
1488 Ga0070683_100402232
1489 Ga0070690_100013146
1490 Ga0070690_100024816
1491 Ga0070690_100028256
1492 Ga0070690_100084348
1493 Ga0070670_100001025
1494 Ga0070670_100006438
1495 Ga0070670_100006705
1496 Ga0070670_100187744
1497 Ga0070677_10065616
1498 Ga0068869_100003272
1499 Ga0068869_100021978
1500 Ga0068869_100033554
1501 Ga0070680_100000152
1502 Ga0070680_100000886
1503 Ga0070680_100004530
1504 Ga0070680_100004938
1505 Ga0070680_100030842
1506 Ga0070680_100035601
1507 Ga0070680_100039564
1508 Ga0070680_100052859
1509 Ga0070680_100072152
1510 Ga0070680_100080018
1511 Ga0070680_100093716
1512 Ga0070680_100153002
1513 Ga0070682_100003997
1514 Ga0070682_100007320
1515 Ga0070682_100017197
1516 Ga0068868_100029687
1517 Ga0068868_100046330
1518 Ga0070660_100100684
1519 Ga0070660_100119932
1520 Ga0070660_100208789
1521 Ga0070689_100016644
1522 Ga0070689_100135420
1523 Ga0070689_100260200
1524 Ga0070691_10002555
1525 Ga0070691_10019303
1526 Ga0070687_100012322
1527 Ga0070687_100014623
1528 Ga0070687_100165301
1529 Ga0070661_100000555
1530 Ga0070661_100013380
1531 Ga0070661_100018782
1532 Ga0070661_100123730
1533 Ga0070692_10007973
1534 Ga0070692_10048202
1535 Ga0070692_10053898
1536 Ga0070692_10066924
1537 Ga0070668_100000088
1538 Ga0070668_100028995
1539 Ga0070668_100057181
1540 Ga0070668_100083335
1541 Ga0070668_100114398
1542 Ga0070668_100177320
1543 Ga0070669_100004309
1544 Ga0070669_100005368
1545 Ga0070669_100017493
1546 Ga0070669_100028355
1547 Ga0070669_100045624
1548 Ga0070675_100000328
1549 Ga0070675_100002562
1550 Ga0070675_100062482
1551 Ga0070675_100118846
1552 Ga0070675_100190756
1553 Ga0070675_100218278
1554 Ga0070671_100021339
1555 Ga0070671_100024452
1556 Ga0070671_100063276
1557 Ga0070671_100148877
1558 Ga0070674_100010741
1559 Ga0070674_100131764
1560 Ga0070674_100132554
1561 Ga0070674_100242032
1562 Ga0070673_100027745
1563 Ga0070673_100030061
1564 Ga0070673_100041619
1565 Ga0070673_100187543
1566 Ga0070688_100018644
1567 Ga0070688_100068534
1568 Ga0070659_100004735
1569 Ga0070659_100006879
1570 Ga0070659_100022459
1571 Ga0070659_100120479
1572 Ga0070659_100274042
1573 Ga0070659_100369874
1574 Ga0070667_100026870
1575 Ga0070667_100063795
1576 Ga0070667_100113059
1577 Ga0070667_100223573
1578 Ga0070703_10003216
1579 Ga0070703_10025184
1580 Ga0070709_10000468
1581 Ga0070709_10004856
1582 Ga0070709_10065735
1583 Ga0070714_100000878
1584 Ga0070714_100003440
1585 Ga0070714_100004574
1586 Ga0070714_100005291
1587 Ga0070714_100223639
1588 Ga0070713_100004689
1589 Ga0070701_10002215
1590 Ga0070701_10005194
1591 Ga0070711_100000106
1592 Ga0070711_100018042
1593 Ga0070711_100058475
1594 Ga0070711_100060818
1595 Ga0070705_100001229
1596 Ga0070705_100004234
1597 Ga0070705_100004882
1598 Ga0070705_100041548
1599 Ga0070705_100156067
1600 Ga0070694_100001804
1601 Ga0070694_100002816
1602 Ga0070694_100024506
1603 Ga0070694_100025286
1604 Ga0070694_100037396
1605 Ga0070694_100041223
1606 Ga0070694_100049747
1607 Ga0070694_100080357
1608 Ga0070708_100000070
1609 Ga0070708_100004270
1610 Ga0070708_100004497
1611 Ga0070708_100010495
1612 Ga0070708_100011885
1613 Ga0070708_100048072
1614 Ga0070708_100051729
1615 Ga0070708_100076038
1616 Ga0070708_100294665
1617 Ga0070663_100178772
1618 Ga0070678_100123855
1619 Ga0070678_100158857
1620 Ga0070678_100235270
1621 Ga0070662_100002729
1622 Ga0070662_100040602
1623 Ga0070662_100050122
1624 Ga0070662_100080800
1625 Ga0070662_100095795
1626 Ga0070662_100209292
1627 Ga0070662_100380569
1628 Ga0070681_10000687
1629 Ga0070681_10000828
1630 Ga0070681_10002894
1631 Ga0070681_10004863
1632 Ga0070681_10016300
1633 Ga0070681_10018968
1634 Ga0070681_10024729
1635 Ga0070681_10062448
1636 Ga0070681_10070720
1637 Ga0070681_10160414
1638 Ga0070681_10235006
1639 Ga0068867_100003262
1640 Ga0068867_100029692
1641 Ga0068867_100121175
1642 Ga0068867_100139266
1643 Ga0070685_10057967
1644 Ga0070685_10192296
1645 Ga0070706_100001388
1646 Ga0070706_100034447
1647 Ga0070706_100038625
1648 Ga0070706_100041249
1649 Ga0070706_100043850
1650 Ga0070706_100091223
1651 Ga0070706_100100227
1652 Ga0070706_100134024
1653 Ga0070706_100424654
1654 Ga0070707_100001831
1655 Ga0070707_100004854
1656 Ga0070707_100016176
1657 Ga0070707_100017971
1658 Ga0070707_100019833
1659 Ga0070707_100021571
1660 Ga0070707_100041321
1661 Ga0070707_100070532
1662 Ga0070707_100098677
1663 Ga0070707_100436629
1664 Ga0070698_100000109
1665 Ga0070698_100002614
1666 Ga0070698_100011076
1667 Ga0070698_100011389
1668 Ga0070698_100013629
1669 Ga0070698_100024231
1670 Ga0070698_100029252
1671 Ga0070698_100093517
1672 Ga0070698_100098417
1673 Ga0070698_100180777
1674 Ga0070699_100000091
1675 Ga0070699_100001290
1676 Ga0070699_100004566
1677 Ga0070699_100006637
1678 Ga0070699_100011321
1679 Ga0070699_100014131
1680 Ga0070699_100019989
1681 Ga0070699_100028904
1682 Ga0070699_100059529
1683 Ga0070699_100096483
1684 Ga0070699_100104185
1685 Ga0070699_100122878
1686 Ga0070699_100219618
1687 Ga0070699_100227032
1688 Ga0070699_100454068
1689 Ga0070679_100000443
1690 Ga0070679_100003946
1691 Ga0070679_100010155
1692 Ga0070679_100018907
1693 Ga0070679_100028602
1694 Ga0070679_100030974
1695 Ga0070679_100040136
1696 Ga0070679_100045265
1697 Ga0070679_100049987
1698 Ga0070679_100099123
1699 Ga0070679_100105650
1700 Ga0070679_100130360
1701 Ga0070679_100142918
1702 Ga0070679_100315920
1703 Ga0070684_100002554
1704 Ga0070684_100005481
1705 Ga0070684_100017764
1706 Ga0070684_100034489
1707 Ga0070684_100044061
1708 Ga0070684_100051427
1709 Ga0070684_100054192
1710 Ga0070684_100152944
1711 Ga0070684_100175731
1712 Ga0070684_100543332
1713 Ga0070697_100003922
1714 Ga0070697_100004414
1715 Ga0070697_100004575
1716 Ga0070697_100008439
1717 Ga0070697_100008663
1718 Ga0070697_100011976
1719 Ga0070697_100017195
1720 Ga0070697_100031239
1721 Ga0070697_100065842
1722 Ga0070697_100203013
1723 Ga0070697_100377816
1724 Ga0070697_100398648
1725 Ga0068853_100013245
1726 Ga0068853_100035769
1727 Ga0068853_100061189
1728 Ga0068853_100101499
1729 Ga0068853_100107663
1730 Ga0070672_100020937
1731 Ga0070672_100028075
1732 Ga0070672_100039619
1733 Ga0070672_100044873
1734 Ga0070672_100229243
1735 Ga0070672_100266460
1736 Ga0070672_100520383
1737 Ga0070686_100075921
1738 Ga0070686_100116573
1739 Ga0070695_100001357
1740 Ga0070695_100003221
1741 Ga0070695_100061283
1742 Ga0070695_100064463
1743 Ga0070695_100248108
1744 Ga0070696_100001642
1745 Ga0070696_100001747
1746 Ga0070696_100002480
1747 Ga0070696_100002806
1748 Ga0070696_100003579
1749 Ga0070696_100013854
1750 Ga0070696_100015640
1751 Ga0070696_100050330
1752 Ga0070696_100068067
1753 Ga0070696_100119506
1754 Ga0070696_100211549
1755 Ga0070693_100002712
1756 Ga0070693_100024732
1757 Ga0070665_100010586
1758 Ga0070704_100000390
1759 Ga0070704_100011539
1760 Ga0070704_100018243
1761 Ga0070704_100037225
1762 Ga0070704_100044111
1763 Ga0070704_100055681
1764 Ga0070704_100242323
1765 Ga0068855_100046695
1766 Ga0068855_100064329
1767 Ga0068855_100065622
1768 Ga0068855_100074497
1769 Ga0068855_100115999
1770 Ga0068855_100496168
1771 Ga0070664_100002134
1772 Ga0070664_100042116
1773 Ga0070664_100057446
1774 Ga0070664_100062616
1775 Ga0070664_100080556
1776 Ga0070664_100123605
1777 Ga0070664_100141850
1778 Ga0070664_100228373
1779 Ga0070664_100517087
1780 Ga0068857_100005765
1781 Ga0068857_100009491
1782 Ga0068857_100014469
1783 Ga0068857_100021305
1784 Ga0068857_100073283
1785 Ga0068857_100298562
1786 Ga0068854_100002669
1787 Ga0068854_100005444
1788 Ga0068854_100304321
1789 Ga0068854_100341113
1790 Ga0068856_100043500
1791 Ga0068856_100174247
1792 Ga0070702_100102677
1793 Ga0070702_100165314
1794 Ga0070702_100211475
1795 Ga0068852_100004225
1796 Ga0068852_100030810
1797 Ga0068852_100085610
1798 Ga0068852_100137693
1799 Ga0068859_100023845
1800 Ga0068859_100044907
1801 Ga0068859_100065663
1802 Ga0068859_100097008
1803 Ga0068859_100244257
1804 Ga0068859_100366039
1805 Ga0068864_100008318
1806 Ga0068864_100046006
1807 Ga0068864_100195762
1808 Ga0068864_100244664
1809 Ga0068866_10015087
1810 Ga0068861_100000232
1811 Ga0068861_100048396
1812 Ga0068861_100245889
1813 Ga0068870_10021110
1814 Ga0068870_10149111
1815 Ga0068863_100010547
1816 Ga0068863_100025110
1817 Ga0068863_100057210
1818 Ga0068858_100006089
1819 Ga0068858_100020276
1820 Ga0068860_100059679
1821 Ga0068860_100071997
1822 Ga0068860_100150247
1823 Ga0068862_100002069
1824 Ga0068862_100011123
1825 Ga0068862_100031129
1826 Ga0068862_100045625
1827 Ga0068862_100141767
1828 Ga0081455_10066286
1829 Ga0081455_10078672
1830 Ga0081539_10000103
1831 Ga0081539_10014467
1832 Ga0070717_10035604
1833 Ga0070716_100005697
1834 Ga0070716_100159979
1835 Ga0070712_100070343
1836 Ga0070712_100227287
1837 Ga0097621_100223741
1838 Ga0068871_100046727
1839 Ga0068871_100079935
1840 Ga0075428_100006240
1841 Ga0075428_100036169
1842 Ga0075428_100038265
1843 Ga0075428_100289374
1844 Ga0075428_100301665
1845 Ga0075430_100026935
1846 Ga0075430_100028403
1847 Ga0075431_100006384
1848 Ga0075431_100010914
1849 Ga0075431_100012188
1850 Ga0075431_100036869
1851 Ga0075431_100130630
1852 Ga0075433_10000226
1853 Ga0075433_10027154
1854 Ga0075433_10034435
1855 Ga0075433_10073280
1856 Ga0075433_10083859
1857 Ga0075433_10247934
1858 Ga0075433_10310334
1859 Ga0075434_100000723
1860 Ga0075434_100004748
1861 Ga0075434_100011395
1862 Ga0075434_100013916
1863 Ga0075434_100032355
1864 Ga0075434_100132014
1865 Ga0075429_100002036
1866 Ga0075429_100012920
1867 Ga0075429_100026135
1868 Ga0075429_100053736
1869 Ga0075429_100095024
1870 Ga0075429_100147985
1871 Ga0075429_100237465
1872 Ga0068865_100007779
1873 Ga0068865_100010159
1874 Ga0068865_100010998
1875 Ga0068865_100035616
1876 Ga0075436_100002070
1877 Ga0075436_100002833
1878 Ga0075436_100020329
1879 Ga0075436_100020492
1880 Ga0075436_100031013
1881 Ga0075436_100190519
1882 Ga0075436_100285816
1883 Ga0097620_100023845
1884 Ga0097620_100044906
1885 Ga0097620_100065668
1886 Ga0097620_100097003
1887 Ga0097620_100244256
1888 Ga0097620_100366081
1889 Ga0075435_100033106
1890 Ga0075435_100124023
1891 Ga0075435_100178598
1892 Ga0075435_100476766
1893 Ga0099794_10000041
1894 Ga0099794_10002901
1895 Ga0099794_10061899
1896 Ga0099794_10152790
1897 Ga0105240_10022751
1898 Ga0105240_10026683
1899 Ga0105240_10030258
1900 Ga0105240_10062666
1901 Ga0105240_10164862
1902 Ga0105240_10323005
1903 Ga0111539_10021889
1904 Ga0111539_10032525
1905 Ga0111539_10042199
1906 Ga0111539_10051533
1907 Ga0105245_10038166
1908 Ga0105245_10042591
1909 Ga0105245_10091566
1910 Ga0105245_10322920
1911 Ga0114129_10000482
1912 Ga0114129_10007380
1913 Ga0114129_10014906
1914 Ga0114129_10068850
1915 Ga0114129_10091011
1916 Ga0114129_10158085
1917 Ga0114129_10212754
1918 Ga0114129_10219170
1919 Ga0114129_10228830
1920 Ga0114129_10330892
1921 Ga0114129_10345550
1922 Ga0114129_10540071
1923 Ga0114129_10786781
1924 Ga0105241_10058318
1925 Ga0105241_10098937
1926 Ga0105241_10129516
1927 Ga0105242_10001589
1928 Ga0105242_10006083
1929 Ga0105242_10011676
1930 Ga0105248_10000977
1931 Ga0105248_10003124
1932 Ga0105248_10036018
1933 Ga0105248_10087258
1934 Ga0105248_10325282
1935 Ga0105238_10000007
1936 Ga0105238_10119760
1937 Ga0105249_10000078
1938 Ga0105249_10001142
1939 Ga0105249_10003811
1940 Ga0105249_10007349
1941 Ga0105249_10013047
1942 Ga0105249_10043169
1943 Ga0105239_10010617
1944 Ga0105239_10013408
1945 Ga0105239_10040907
1946 Ga0105246_10037375
1947 Ga0157373_10001188
1948 Ga0157373_10048475
1949 Ga0157373_10089526
1950 Ga0157373_10092492
1951 Ga0157373_10203380
1952 Ga0157371_10052735
1953 Ga0157371_10054753
1954 Ga0157371_10076645
1955 Ga0157370_10002250
1956 Ga0157370_10016352
1957 Ga0157370_10026600
1958 Ga0157370_10091054
1959 Ga0157370_10205130
1960 Ga0157369_10006892
1961 Ga0157369_10050847
1962 Ga0157369_10078170
1963 Ga0157369_10121427
1964 Ga0157369_10143481
1965 Ga0157374_10074796
1966 Ga0157374_10187416
1967 Ga0157374_10261198
1968 Ga0157378_10000460
1969 Ga0157378_10028113
1970 Ga0157378_10172947
1971 Ga0163162_10002411
1972 Ga0163162_10075177
1973 Ga0163162_10125473
1974 Ga0163162_10154470
1975 Ga0163162_10193472
1976 Ga0163162_10504766
1977 Ga0157372_10005848
1978 Ga0157372_10008921
1979 Ga0157372_10011199
1980 Ga0157372_10011305
1981 Ga0157372_10018234
1982 Ga0157372_10065515
1983 Ga0157372_10111598
1984 Ga0157372_10195027
1985 Ga0157372_10279397
1986 Ga0157372_10324820
1987 Ga0157372_10524279
1988 Ga0157375_10028212
1989 Ga0157375_10046809
1990 Ga0157375_10066297
1991 Ga0157375_10227516
1992 Ga0157375_10317799
1993 Ga0157375_10357016
1994 Ga0163163_10038659
1995 Ga0163163_10057510
1996 Ga0163163_10215945
1997 Ga0163163_10222601
1998 Ga0157380_10097607
1999 Ga0157380_10357008
2000 Ga0157377_10003523
2001 Ga0157379_10005920
2002 Ga0157376_10015363
2003 Ga0157376_10050068
2004 Ga0157376_10250247
2005 Ga0157376_10370887
2006 Ga0163161_10055588
2007 Ga0163161_10092369
2008 Ga0163161_10256440
2009 Ga0206356_10686293
2010 Ga0206354_11043160
2011 Ga0213876_10100162
2012 Ga0213875_10003244
2013 Ga0207697_10078783
2014 Ga0207653_10000037
2015 Ga0207653_10007039
2016 Ga0207682_10017990
2017 Ga0207682_10087006
2018 Ga0207642_10000684
2019 Ga0207642_10042071
2020 Ga0207688_10061651
2021 Ga0207680_10042801
2022 Ga0207647_10010471
2023 Ga0207699_10007060
2024 Ga0207699_10019989
2025 Ga0207699_10059131
2026 Ga0207699_10315829
2027 Ga0207645_10002892
2028 Ga0207645_10004847
2029 Ga0207645_10005647
2030 Ga0207645_10036027
2031 Ga0207645_10137566
2032 Ga0207643_10031640
2033 Ga0207643_10047789
2034 Ga0207705_10015677
2035 Ga0207705_10018615
2036 Ga0207705_10029915
2037 Ga0207705_10036540
2038 Ga0207705_10053823
2039 Ga0207684_10002946
2040 Ga0207684_10004712
2041 Ga0207684_10058258
2042 Ga0207684_10102868
2043 Ga0207684_10107252
2044 Ga0207684_10168869
2045 Ga0207654_10000405
2046 Ga0207654_10027981
2047 Ga0207654_10053394
2048 Ga0207654_10063551
2049 Ga0207654_10074715
2050 Ga0207707_10000485
2051 Ga0207707_10002384
2052 Ga0207707_10003274
2053 Ga0207707_10003323
2054 Ga0207707_10024667
2055 Ga0207707_10026242
2056 Ga0207707_10026472
2057 Ga0207707_10039734
2058 Ga0207707_10045217
2059 Ga0207707_10048264
2060 Ga0207707_10126952
2061 Ga0207707_10158819
2062 Ga0207707_10241244
2063 Ga0207695_10000824
2064 Ga0207695_10002609
2065 Ga0207695_10022198
2066 Ga0207695_10107870
2067 Ga0207671_10092027
2068 Ga0207693_10010681
2069 Ga0207693_10042228
2070 Ga0207693_10234453
2071 Ga0207663_10000086
2072 Ga0207663_10115754
2073 Ga0207660_10000035
2074 Ga0207660_10006296
2075 Ga0207660_10007581
2076 Ga0207660_10009333
2077 Ga0207660_10023410
2078 Ga0207660_10027246
2079 Ga0207660_10066551
2080 Ga0207660_10089981
2081 Ga0207660_10113576
2082 Ga0207660_10126494
2083 Ga0207660_10142869
2084 Ga0207660_10174662
2085 Ga0207660_10210764
2086 Ga0207662_10005756
2087 Ga0207662_10063035
2088 Ga0207662_10106890
2089 Ga0207657_10004320
2090 Ga0207657_10008543
2091 Ga0207657_10017905
2092 Ga0207657_10023091
2093 Ga0207657_10050505
2094 Ga0207657_10371924
2095 Ga0207649_10000422
2096 Ga0207649_10009822
2097 Ga0207649_10013088
2098 Ga0207649_10014915
2099 Ga0207652_10000609
2100 Ga0207652_10001738
2101 Ga0207652_10003988
2102 Ga0207652_10023620
2103 Ga0207652_10035781
2104 Ga0207652_10044607
2105 Ga0207652_10046587
2106 Ga0207652_10049770
2107 Ga0207652_10093481
2108 Ga0207652_10113107
2109 Ga0207652_10119150
2110 Ga0207652_10147589
2111 Ga0207652_10205776
2112 Ga0207652_10208663
2113 Ga0207652_10408343
2114 Ga0207646_10002881
2115 Ga0207646_10008799
2116 Ga0207646_10012044
2117 Ga0207646_10035407
2118 Ga0207646_10068609
2119 Ga0207646_10269466
2120 Ga0207681_10000537
2121 Ga0207681_10009827
2122 Ga0207681_10013509
2123 Ga0207681_10022498
2124 Ga0207694_10000007
2125 Ga0207694_10024190
2126 Ga0207650_10027143
2127 Ga0207650_10027664
2128 Ga0207650_10036278
2129 Ga0207659_10037058
2130 Ga0207659_10040111
2131 Ga0207659_10049707
2132 Ga0207659_10075629
2133 Ga0207659_10085950
2134 Ga0207659_10153841
2135 Ga0207687_10061485
2136 Ga0207664_10007042
2137 Ga0207664_10022408
2138 Ga0207664_10160503
2139 Ga0207644_10009253
2140 Ga0207644_10102521
2141 Ga0207690_10031285
2142 Ga0207690_10056130
2143 Ga0207690_10153660
2144 Ga0207690_10226554
2145 Ga0207706_10000055
2146 Ga0207706_10000116
2147 Ga0207706_10004147
2148 Ga0207706_10005574
2149 Ga0207706_10029722
2150 Ga0207706_10067044
2151 Ga0207706_10134032
2152 Ga0207706_10170997
2153 Ga0207686_10000621
2154 Ga0207686_10036441
2155 Ga0207686_10067885
2156 Ga0207686_10098938
2157 Ga0207709_10001211
2158 Ga0207709_10167078
2159 Ga0207709_10207934
2160 Ga0207670_10036402
2161 Ga0207670_10272360
2162 Ga0207669_10005007
2163 Ga0207669_10055517
2164 Ga0207669_10070325
2165 Ga0207669_10114956
2166 Ga0207704_10002778
2167 Ga0207704_10010731
2168 Ga0207704_10054867
2169 Ga0207665_10024529
2170 Ga0207691_10000129
2171 Ga0207691_10004042
2172 Ga0207691_10027758
2173 Ga0207691_10037433
2174 Ga0207691_10037824
2175 Ga0207691_10061175
2176 Ga0207691_10103722
2177 Ga0207691_10104846
2178 Ga0207691_10106620
2179 Ga0207691_10202398
2180 Ga0207711_10001868
2181 Ga0207711_10024068
2182 Ga0207711_10047223
2183 Ga0207711_10068303
2184 Ga0207711_10121032
2185 Ga0207689_10003669
2186 Ga0207689_10031774
2187 Ga0207689_10043643
2188 Ga0207689_10134896
2189 Ga0207661_10004017
2190 Ga0207661_10005197
2191 Ga0207661_10007276
2192 Ga0207661_10015415
2193 Ga0207661_10020678
2194 Ga0207661_10026394
2195 Ga0207661_10175794
2196 Ga0207661_10234972
2197 Ga0207679_10000382
2198 Ga0207679_10001463
2199 Ga0207679_10011578
2200 Ga0207679_10050243
2201 Ga0207679_10056727
2202 Ga0207679_10087046
2203 Ga0207679_10129486
2204 Ga0207679_10196192
2205 Ga0207679_10211673
2206 Ga0207679_10278175
2207 Ga0207667_10001972
2208 Ga0207667_10026735
2209 Ga0207667_10112701
2210 Ga0207667_10159242
2211 Ga0207667_10302464
2212 Ga0207651_10034842
2213 Ga0207651_10080830
2214 Ga0207651_10161516
2215 Ga0207651_10235608
2216 Ga0207651_10247154
2217 Ga0207712_10000568
2218 Ga0207712_10000920
2219 Ga0207712_10001023
2220 Ga0207712_10003424
2221 Ga0207712_10016554
2222 Ga0207712_10071192
2223 Ga0207668_10019781
2224 Ga0207668_10032208
2225 Ga0207668_10067976
2226 Ga0207668_10103554
2227 Ga0207668_10165909
2228 Ga0207640_10000266
2229 Ga0207658_10036784
2230 Ga0207658_10107644
2231 Ga0207658_10167698
2232 Ga0207658_10199911
2233 Ga0207658_10414093
2234 Ga0207677_10056609
2235 Ga0207703_10063190
2236 Ga0207703_10318713
2237 Ga0207639_10042397
2238 Ga0207639_10046480
2239 Ga0207639_10051298
2240 Ga0207639_10118134
2241 Ga0207678_10000997
2242 Ga0207678_10322975
2243 Ga0207708_10017949
2244 Ga0207708_10024447
2245 Ga0207708_10040758
2246 Ga0207702_10012826
2247 Ga0207702_10177516
2248 Ga0207702_10563192
2249 Ga0207641_10007222
2250 Ga0207641_10023120
2251 Ga0207648_10000168
2252 Ga0207648_10019374
2253 Ga0207648_10034353
2254 Ga0207648_10089068
2255 Ga0207648_10107066
2256 Ga0207648_10110611
2257 Ga0207648_10277181
2258 Ga0207676_10003052
2259 Ga0207676_10010017
2260 Ga0207676_10027749
2261 Ga0207676_10072208
2262 Ga0207676_10109037
2263 Ga0207676_10142137
2264 Ga0207676_10328035
2265 Ga0207674_10000096
2266 Ga0207674_10001035
2267 Ga0207674_10002037
2268 Ga0207674_10026295
2269 Ga0207674_10162407
2270 Ga0207674_10260232
2271 Ga0207675_100000073
2272 Ga0207675_100082219
2273 Ga0207675_100127371
2274 Ga0207675_100223187
2275 Ga0207675_100248533
2276 Ga0207675_100279281
2277 Ga0207675_100306757
2278 Ga0207683_10009858
2279 Ga0207683_10064189
2280 Ga0207698_10004945
2281 Ga0207698_10009882
2282 Ga0207698_10263876
2283 Ga0207698_10328043
2284 Ga0209996_1004696
2285 Ga0209995_1009876
2286 Ga0209968_1001462
2287 Ga0209999_1002452
2288 Ga0209999_1002844
2289 Ga0209588_1000994
2290 Ga0209588_1001408
2291 Ga0209971_1028568
2292 Ga0209998_10002222
2293 Ga0209998_10008358
2294 Ga0209974_10041763
2295 Ga0207428_10041933
2296 Ga0268265_10001598
2297 Ga0268265_10014095
2298 Ga0268265_10037581
2299 Ga0268265_10069091
2300 Ga0268265_10207097
2301 Ga0268264_10011258
2302 Ga0268264_10015480
2303 Ga0268264_10067016
2304 Ga0265332_10033758
2305 Ga0265332_10043995
2306 Ga0307408_100002866
2307 Ga0307408_100013069
2308 Ga0307408_100042568
2309 Ga0307408_100079342
2310 Ga0307408_100085978
2311 Ga0307408_100096700
2312 Ga0307408_100111705
2313 Ga0307408_100119478
2314 Ga0307408_100185856
2315 Ga0307408_100216672
2316 Ga0307408_100392721
2317 Ga0316575_10000708
2318 Ga0316579_10017603
2319 Ga0316579_10026974
2320 Ga0265314_10023982
2321 Ga0316576_10002854
2322 Ga0316576_10025589
2323 Ga0316576_10027763
2324 Ga0316576_10073020
2325 Ga0316576_10085709
2326 Ga0316576_10092063
2327 Ga0316578_10000354
2328 Ga0316578_10008357
2329 Ga0316578_10031288
2330 Ga0316578_10077790
2331 Ga0316578_10084370
2332 Ga0307405_10000394
2333 Ga0307405_10002899
2334 Ga0307405_10022437
2335 Ga0307405_10028888
2336 Ga0307405_10043695
2337 Ga0307405_10175055
2338 Ga0307405_10193380
2339 Ga0307405_10363667
2340 Ga0307405_10365559
2341 Ga0316577_10001110
2342 Ga0316577_10016655
2343 Ga0316577_10040812
2344 Ga0316577_10051699
2345 Ga0307413_10002977
2346 Ga0307413_10005323
2347 Ga0307413_10013697
2348 Ga0307413_10015127
2349 Ga0307413_10016161
2350 Ga0307413_10018129
2351 Ga0307413_10028408
2352 Ga0307413_10110760
2353 Ga0307410_10000662
2354 Ga0307410_10001342
2355 Ga0307410_10004088
2356 Ga0307410_10027491
2357 Ga0307410_10041722
2358 Ga0307410_10064132
2359 Ga0307410_10092857
2360 Ga0307410_10093376
2361 Ga0307410_10110446
2362 Ga0307406_10002048
2363 Ga0307406_10010808
2364 Ga0307406_10019353
2365 Ga0307406_10023303
2366 Ga0307406_10026506
2367 Ga0307406_10040948
2368 Ga0307406_10066795
2369 Ga0307406_10187265
2370 Ga0307407_10000456
2371 Ga0307407_10003422
2372 Ga0307407_10019065
2373 Ga0307407_10025433
2374 Ga0307407_10053209
2375 Ga0307407_10062166
2376 Ga0307407_10068995
2377 Ga0307407_10074410
2378 Ga0307407_10149679
2379 Ga0307407_10177229
2380 Ga0307412_10005958
2381 Ga0307412_10017562
2382 Ga0307412_10029024
2383 Ga0307412_10054625
2384 Ga0307412_10212241
2385 Ga0307412_10212677
2386 Ga0307412_10217832
2387 Ga0307409_100000213
2388 Ga0307409_100004409
2389 Ga0307409_100008013
2390 Ga0307409_100012191
2391 Ga0307409_100015997
2392 Ga0307409_100025397
2393 Ga0307409_100026045
2394 Ga0307409_100028466
2395 Ga0307409_100069080
2396 Ga0307409_100080899
2397 Ga0307409_100105235
2398 Ga0307409_100114970
2399 Ga0307409_100125882
2400 Ga0307409_100128290
2401 Ga0307409_100223129
2402 Ga0307409_100228793
2403 Ga0307416_100000358
2404 Ga0307416_100004593
2405 Ga0307416_100008017
2406 Ga0307416_100010738
2407 Ga0307416_100011581
2408 Ga0307416_100015995
2409 Ga0307416_100073603
2410 Ga0307416_100099971
2411 Ga0307416_100106534
2412 Ga0307416_100191027
2413 Ga0307416_100226508
2414 Ga0307416_100561961
2415 Ga0307414_10001787
2416 Ga0307414_10024780
2417 Ga0307414_10027258
2418 Ga0307414_10036290
2419 Ga0307414_10059013
2420 Ga0307414_10089645
2421 Ga0307414_10131238
2422 Ga0307414_10137084
2423 Ga0307414_10139893
2424 Ga0307414_10199547
2425 Ga0307414_10238778
2426 Ga0307411_10001361
2427 Ga0307411_10006797
2428 Ga0307411_10017585
2429 Ga0307411_10021736
2430 Ga0307411_10044613
2431 Ga0307411_10049317
2432 Ga0307411_10060202
2433 Ga0307411_10140107
2434 Ga0307411_10263390
2435 Ga0307415_100005406
2436 Ga0307415_100009214
2437 Ga0307415_100014499
2438 Ga0307415_100020478
2439 Ga0307415_100021732
2440 Ga0307415_100037278
2441 Ga0307415_100128242
2442 Ga0307415_100133336
2443 Ga0307415_100191733
2444 Ga0307415_100258977
2445 Ga0316583_10000577
2446 Ga0316580_10013751
2447 Ga0373950_0006063
2448 Ga0373959_0000432
2449 Ga0373959_0004785
2450 Ga0373938_0017699
2451 Ga0373926_0019552
2452 Ga0373934_0000319
2453 Ga0373934_0002820
2454 Ga0373934_0009088
2455 Ga0373940_0008027
2456 Ga0373944_0022241
2457 Ga0373944_0052869
2458 Ga0373953_0023613
2459 Ga0373954_0003610
2460 Ga0373956_0011441
2461 Ga0373957_0053860
2462 Ga0373957_0121286
2463 Ga0373943_0000549
2464 Ga0373943_0044911
2465 Ga0373955_0000540
2466 Ga0373955_0003972
2467 Ga0373955_0011027
2468 Ga0316574_0015867
2469 Ga0316574_0025290
2470 Ga0316574_0055042
2471 Ga0373924_0091374
2472 Ga0373924_0132030
2473 Ga0373931_0011137
2474 Ga0373931_0019052
2475 Ga0373935_0004661
2476 Ga0373927_0007244
2477 Ga0373927_0076400
2478 Ga0373933_0000499
2479 Ga0373933_0006055
2480 Ga0373947_0000580
2481 Ga0373937_0001442
2482 Ga0373937_0001736
2483 Ga0373937_0034278
2484 Ga0373937_0046957
2485 Ga0373937_0063692
2486 Ga0373937_0127509
2487 Ga0316582_0072461
2488 Ga0316582_0129643
2489 Ga0316584_0004901
2490 Ga0316584_0038181
2491 Ga0316584_0209713
2492 Ga0373925_0001431
2493 Ga0373925_0072484
2494 Ga0373925_0164240
2495 Ga0373925_0287715
2496 Ga0395899_0032220
2497 Ga0395905_0046569
2498 Ga0316581_0010550
2499 Ga0436364_1446815
2500 Ga0395901_0049273
2501 Ga0395901_0078322
2502 Ga0436365_0332204
2503 Ga0439439_0007066
2504 Ga0439457_022918
2505 Ga0439462_0036350
2506 Ga0450923_004990
2507 Ga0451577_0000016
2508 Ga0451577_0012754
2509 Ga0451577_0164655
2510 Ga0453683_0020096
2511 Ga0453683_0049913
2512 Ga0453683_0052131
2513 Ga0453683_0102734
2514 Ga0466965_0089429
2515 Ga0466966_0036039
2516 Ga0466961_0021024
2517 Ga0453684_0000368
2518 Ga0453684_0019321
2519 Ga0453684_0270060
2520 Ga0466957_0206407
2521 Ga0466960_0192540
2522 Ga0451576_0010003
2523 Ga0451576_0018465
2524 Ga0451576_0021204
2525 Ga0451576_0033329
2526 Ga0451576_0057044
2527 Ga0451576_0076832
2528 Ga0451576_0082509
2529 Ga0451576_0293603
2530 Ga0466958_0173464
2531 Ga0466967_0080800
2532 Ga0466967_0101799
2533 Ga0466967_0103174
2534 Ga0466967_0318726
2535 Ga0495592_0009404
2536 Ga0495603_0005008
2537 Ga0495603_0011722
2538 Ga0495603_0033808
2539 Ga0495629_0070215
2540 Ga0495629_0101203
2541 Ga0495641_0025177
2542 Ga0495651_0001411
2543 Ga0495651_0009551
2544 Ga0495651_0036788
2545 Ga0495653_0008915
2546 Ga0495653_0018299
2547 Ga0495653_0065451
2548 Ga0495580_0003447
2549 Ga0495580_0073719
2550 Ga0495580_0160105
2551 Ga0495580_0242135
2552 Ga0495582_0008456
2553 Ga0495582_0100710
2554 Ga0495639_0001681
2555 Ga0495639_0005477
2556 Ga0495664_0002618
2557 Ga0495664_0005946
2558 Ga0495664_0059152
2559 Ga0495664_0173936
2560 Ga0495594_0002309
2561 Ga0495594_0008467
2562 Ga0495608_0006333
2563 Ga0495608_0019948
2564 Ga0495608_0051142
2565 Ga0495618_0019976
2566 Ga0495618_0150938
2567 Ga0495628_0006895
2568 Ga0495628_0017832
2569 Ga0495628_0038526
2570 Ga0495628_0110015
2571 Ga0495630_0005984
2572 Ga0495630_0009425
2573 Ga0495630_0010790
2574 Ga0495630_0034688
2575 Ga0495630_0174674
2576 Ga0495630_0177150
2577 Ga0495630_0180801
2578 Ga0495643_0000008
2579 Ga0495663_0056074
2580 Ga0495666_0003940
2581 Ga0495666_0010349
2582 Ga0495642_0079883
2583 Ga0495652_0000859
2584 Ga0495652_0001382
2585 Ga0495652_0015457
2586 Ga0495652_0027043
2587 Ga0495652_0233608
2588 Ga0495665_0000677
2589 Ga0495665_0018268
2590 Ga0495665_0042870
2591 Ga0495640_0009684
2592 Ga0495640_0014353
2593 Ga0495640_0072628
2594 Ga0495640_0081970
2595 Ga0495586_0001306
2596 Ga0495586_0071020
2597 Ga0495586_0113348
2598 Ga0495587_0000360
2599 Ga0495587_0001414
2600 Ga0495587_0004216
2601 Ga0495587_0031682
2602 Ga0495587_0215635
2603 Ga0495645_0001196
2604 Ga0495645_0001984
2605 Ga0495645_0017482
2606 Ga0495645_0177035
2607 Ga0495667_0004915
2608 Ga0495667_0013907
2609 Ga0495667_0092353
2610 Ga0495634_0006940
2611 Ga0495634_0028041
2612 Ga0495634_0226603
2613 Ga0495635_0000299
2614 Ga0495635_0005634
2615 Ga0495635_0126716
2616 Ga0495659_0004294
2617 Ga0495588_0000514
2618 Ga0495657_0003790
2619 Ga0495657_0023341
2620 Ga0495599_0000395
2621 Ga0495599_0195546
2622 Ga0495623_0002015
2623 Ga0495623_0008673
2624 Ga0495623_0035931
2625 Ga0495623_0051600
2626 Ga0495623_0052477
2627 Ga0495646_0002501
2628 Ga0495646_0022846
2629 Ga0495647_0003603
2630 Ga0495658_0001660
2631 Ga0495658_0007314
2632 Ga0495658_0063924
2633 Ga0495613_0020546
2634 Ga0495613_0028351
2635 Ga0495613_0039747
2636 Ga0495613_0047188
2637 Ga0495624_0114461
2638 Ga0495600_0000095
2639 Ga0495600_0006625
2640 Ga0495600_0083341
2641 Ga0495581_0000585
2642 Ga0495581_0022877
2643 Ga0495581_0058709
2644 Ga0495604_0003090
2645 Ga0495604_0006235
2646 Ga0495604_0112329
2647 Ga0495604_0116233
2648 Ga0495604_0258970
2649 Ga0495674_0000884
2650 Ga0495674_0003021
2651 Ga0495674_0013476
2652 Ga0495672_0007178
2653 Ga0495676_0074643
2654 Ga0495676_0134295
2655 Ga0495680_0002867
2656 Ga0495680_0074369
2657 Ga0495675_0031956
2658 Ga0495684_0000800
2659 Ga0495684_0023090
2660 Ga0495684_0031147
2661 Ga0495684_0128965
2662 Ga0495684_0145926
2663 Ga0495684_0182833
2664 Ga0495593_0000691
2665 Ga0495593_0061810
2666 Ga0495593_0107661
2667 Ga0495602_0016778
2668 Ga0495602_0022463
2669 Ga0495602_0025919
2670 Ga0495614_0028389
2671 Ga0496100_0175879
2672 Ga0496101_0062284
2673 Ga0496101_0183323
2674 Ga0496102_0026559
2675 Ga0496102_0032086
2676 Ga0496102_0191323
2677 Ga0496103_0063986
2678 Ga0496104_0007186
2679 Ga0496104_0014815
2680 Ga0496104_0015208
2681 Ga0496104_0031225
2682 Ga0496104_0226698
2683 Ga0496106_0007036
2684 Ga0496106_0008502
2685 Ga0496106_0027185
2686 Ga0496106_0126654
2687 Ga0496107_0181561
2688 Ga0496107_0222767
2689 Ga0496108_0002484
2690 Ga0496108_0003517
2691 Ga0496108_0045652
2692 Ga0496108_0052468
2693 Ga0496108_0055904
2694 Ga0496108_0301029
2695 Ga0496109_0006923
2696 Ga0496109_0009441
2697 Ga0496109_0010400
2698 Ga0496109_0020450
2699 Ga0496109_0055601
2700 Ga0496109_0278818
2701 Ga0496109_0375321
2702 Ga0496110_0003462
2703 Ga0496110_0013692
2704 Ga0496110_0026688
2705 Ga0496110_0070616
2706 Ga0496111_0001937
2707 Ga0496111_0027365
2708 Ga0496111_0048983
2709 Ga0496111_0074027
2710 Ga0496112_0001295
2711 Ga0496112_0004030
2712 Ga0496112_0007049
2713 Ga0496112_0008621
2714 Ga0496112_0016302
2715 Ga0496112_0215159
2716 Ga0496112_0404950
2717 Ga0496112_0418259
2718 Ga0496113_0001773
2719 Ga0496113_0012438
2720 Ga0496113_0014172
2721 Ga0496113_0014813
2722 Ga0496113_0050110
2723 Ga0496113_0053486
2724 Ga0496113_0081721
2725 Ga0496114_0010054
2726 Ga0496114_0163530
2727 Ga0496115_0002487
2728 Ga0496115_0056554
2729 Ga0496115_0059488
2730 Ga0501292_009824
2731 Ga0501296_009783
2732 Ga0501033_0006099
2733 Ga0501033_0061122
2734 Ga0501033_0188783
2735 Ga0501034_0001591
2736 Ga0501034_0009383
2737 Ga0501034_0108455
2738 Ga0501034_0136902
2739 Ga0501036_0026600
2740 Ga0501036_0034603
2741 Ga0501036_0309770
2742 Ga0501037_0171495
2743 Ga0501038_0129645
2744 Ga0501040_0222378
2745 Ga0501040_0258731
2746 Ga0501040_0322298
2747 Ga0501041_0028688
2748 Ga0501042_0039683
2749 Ga0501042_0042703
2750 Ga0501043_0007990
2751 Ga0501043_0069132
2752 Ga0501043_0099438
2753 Ga0501046_0007943
2754 Ga0501046_0067271
2755 Ga0501047_0000515
2756 Ga0501047_0016410
2757 Ga0501047_0079575
2758 Ga0501047_0097487
2759 Ga0501047_0102535
2760 Ga0501048_0134461
2761 Ga0501048_0169929
2762 Ga0501067_0000204
2763 Ga0501067_0000816
2764 Ga0501067_0008563
2765 Ga0501067_0016663
2766 Ga0501068_0000153
2767 Ga0501068_0000377
2768 Ga0501069_0000130
2769 Ga0501069_0000606
2770 Ga0501069_0043927
2771 Ga0501070_0000331
2772 Ga0501070_0004826
2773 Ga0501070_0012137
2774 Ga0501070_0019568
2775 Ga0501070_0078417
2776 Ga0501070_0081869
2777 Ga0501071_0000065
2778 Ga0501071_0000163
2779 Ga0501071_0020734
2780 Ga0501072_0000039
2781 Ga0501072_0059713
2782 Ga0501072_0064012
2783 Ga0501072_0103665
2784 Ga0501072_0130710
2785 Ga0501073_0002482
2786 Ga0501073_0005706
2787 Ga0501074_0000020
2788 Ga0501074_0037827
2789 Ga0501074_0176802
2790 Ga0501075_0011148
2791 Ga0501075_0076628
2792 Ga0501076_0000656
2793 Ga0501076_0124814
2794 Ga0501076_0126895
2795 Ga0501077_0000584
2796 Ga0501077_0022217
2797 Ga0501077_0025134
2798 Ga0501209_027971
2799 Ga0501217_017324
2800 Ga0501235_011480
2801 Ga0501247_006688
2802 Ga0501249_024021
2803 Ga0501258_003658
2804 Ga0501260_004254
2805 Ga0501234_014834
2806 Ga0501079_0011332
2807 Ga0501079_0024042
2808 Ga0501079_0046920
2809 Ga0501079_0091002
2810 Ga0501079_0094709
2811 Ga0501079_0112485
2812 Ga0501079_0120979
2813 Ga0501080_0001007
2814 Ga0501080_0002521
2815 Ga0501080_0008610
2816 Ga0501080_0009635
2817 Ga0501080_0020039
2818 Ga0501080_0102202
2819 Ga0501080_0191329
2820 Ga0501081_0004523
2821 Ga0501081_0015593
2822 Ga0501081_0195974
2823 Ga0501081_0267315
2824 Ga0501083_0000754
2825 Ga0501083_0007655
2826 Ga0501083_0137852
2827 Ga0501267_004597
2828 Ga0501268_003932
2829 Ga0501268_010508
2830 Ga0501270_007815
2831 Ga0501271_004589
2832 Ga0501272_002149
2833 Ga0501035_0001214
2834 Ga0501035_0020222
2835 Ga0501035_0167922
2836 Ga0501044_0004710
2837 Ga0501044_0009533
2838 Ga0501044_0221917
2839 Ga0501045_0014042
2840 Ga0501045_0028578
2841 Ga0501045_0033379
2842 Ga0501204_005429
2843 nmdc:mga05p37_120863_c1
2844 nmdc:mga05p37_137117_c2
2845 nmdc:mga05p37_197175_c1
2846 nmdc:mga05p37_25871_c1
2847 nmdc:mga05p37_37646_c1
2848 nmdc:mga05p37_6407_c1
2849 nmdc:mga05p37_74137_c1
2850 nmdc:mga05p37_758310_c1
2851 nmdc:mga09592_21870_c1
2852 nmdc:mga09592_341309_c1
2853 nmdc:mga09592_69425_c1
2854 nmdc:mga0qj67_14072_c1
2855 nmdc:mga0qj67_14910_c2
2856 nmdc:mga0qj67_159321_c1
2857 nmdc:mga0qj67_23863_c1
2858 nmdc:mga0qj67_41649_c1
2859 nmdc:mga06r32_20282_c1
2860 nmdc:mga06r32_240900_c1
2861 nmdc:mga06r32_326373_c1
2862 nmdc:mga06r32_330283_c1
2863 nmdc:mga06r32_40334_c1
2864 nmdc:mga06r32_43325_c1
2865 nmdc:mga06r32_83624_c1
2866 nmdc:mga06r32_89950_c1
2867 nmdc:mga08y16_12861_c1
2868 nmdc:mga08y16_149074_c1
2869 nmdc:mga08y16_183850_c1
2870 nmdc:mga08y16_49788_c1
2871 nmdc:mga0n895_10574_c1
2872 nmdc:mga0n895_13501_c1
2873 nmdc:mga0n895_170412_c1
2874 nmdc:mga0n895_22962_c1
2875 nmdc:mga0n895_2759_c1
2876 nmdc:mga0n895_29621_c1
2877 nmdc:mga0n895_361213_c1
2878 nmdc:mga0n895_458261_c1
2879 nmdc:mga0n895_521_c1
2880 nmdc:mga0n895_709573_c1
2881 nmdc:mga0n895_97650_c1
2882 nmdc:mga0rr50_130186_c1
2883 nmdc:mga0rr50_21705_c1
2884 nmdc:mga0rr50_4014_c1
2885 nmdc:mga0rr50_439846_c1
2886 nmdc:mga0rr50_62691_c1
2887 nmdc:mga0rr50_86667_c1
2888 nmdc:mga0rr50_97572_c1
2889 nmdc:mga08x19_125216_c1
2890 nmdc:mga08x19_13213_c1
2891 nmdc:mga08x19_13241_c1
2892 nmdc:mga08x19_148599_c1
2893 nmdc:mga08x19_20252_c1
2894 nmdc:mga08x19_29183_c1
2895 nmdc:mga08x19_3422_c1
2896 nmdc:mga08x19_44018_c1
2897 nmdc:mga08x19_65482_c1
2898 nmdc:mga0a205_10092_c1
2899 nmdc:mga0a205_111028_c1
2900 nmdc:mga0a205_20579_c1
2901 nmdc:mga0a205_28153_c1
2902 nmdc:mga0a205_34279_c1
2903 nmdc:mga0a205_356_c1
2904 nmdc:mga0a205_44203_c1
2905 nmdc:mga0a205_45064_c1
2906 nmdc:mga0a205_49624_c1
2907 nmdc:mga0a205_74322_c1
2908 nmdc:mga0a205_99168_c1
2909 Ga0495601_0008664
2910 Ga0495612_0005568
2911 Ga0495612_0008212
2912 Ga0495595_0004978
2913 Ga0495619_0005859
2914 Ga0495619_0217895
2915 Ga0495619_0244994
2916 Ga0500628_016637
2917 Ga0501084_0001120
2918 Ga0501084_0008248
2919 Ga0501084_0008981
2920 Ga0501084_0170970
2921 Ga0501084_0177275
2922 Ga0590071_004391
2923 Ga0590071_011035
2924 Ga0501082_0000246
2925 Ga0501082_0018479
2926 Ga0501082_0044061
2927 Ga0501082_0083606
2928 Ga0501082_0110123

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02562

PhoH

PhoH-like protein

124

327

0.99

PF13604

AAA_30

AAA domain

127

292

0.79

PF13245

AAA_19

AAA domain

132

284

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b85-assembly1.cif.gz_B crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.9127 105 307
3b85-assembly1.cif.gz_A crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.9035 105 307
3b85-assembly1.cif.gz_B crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.8987 105 307
3b85-assembly1.cif.gz_A crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.8896 105 307
6y2d-assembly1.cif.gz_A crystal structure of the second kh domain of fubp1 0.8844 4 66
ID Description Score Start End Superfamily
af_P0A9K1_146_354_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.927 105 307 3.40.50.300
af_Q2FY01_105_312_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9269 101 307 3.40.50.300
af_Q2FY01_105_312_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9183 101 307 3.40.50.300
3b85B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9046 105 307 3.40.50.300
af_P0A9K1_146_354_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8973 105 307 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9FHA8-F1-model_v4 PhoH family protein 0.9639 4 86 GO:0003723
AF-A0A7V9QPA3-F1-model_v4 Uncharacterized protein 0.9607 1 71 GO:0003723
AF-A0A3D4F6P0-F1-model_v4 deleted 0.9601 181 312
AF-A0A3D1GVM9-F1-model_v4 PhoH-like protein 0.9593 174 309 GO:0005524
GO:0005829
AF-A0A849GTX8-F1-model_v4 PhoH-like protein 0.9589 173 310 GO:0005524
GO:0005829

Map