F494151
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1464 | 391 | 2928 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300005546|Ga0070696_100000317|Ga0070696_10000031710 |
| Length | 333 |
| Sequence | LTDVRGHRVDNGAADENITQRVSTEGADLLTLAGVNDSNLLELSRLFGVKVSLRGEAMVISGASEFVQRATGVGRRMVEIARQRDELTPDDVLRLGDDPLADRDNGESPGDGVTRIALPGTRKVIQAKTNGQAEYLVKIAENDIVVGIGPAGTGKTYLAVAAAVDAFTKKRVRRIVLARPAVEAGENLGFLPGDMQAKVDPYLRPLYDALDDMMPFEKVQRALETRTIEVAPLAFMRGRTLNDAFVIVDEAQNATAMQMKMLLTRLGVNSRMVITGDKTQVDLPKGESGLTQVERLLPGIDGIAFQYFNETDVVRHRLVRDIIRAYESEEAKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 201 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 207 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 208 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 218 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 219 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 241 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 250 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 251 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 252 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 255 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 256 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 330 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 355 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 356 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 357 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 358 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 359 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 360 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 361 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 367 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 369 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 370 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.07 |
| Nodule | 0 |
| Rhizoplane | 4.03 |
| Rhizosphere | 95.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070696_100000317 | 3300005546 | Bacteria | 29318 |
| 2 | Ga0058863_11613365 | 3300004799 | Bacteria | 1749 |
| 3 | Ga0058863_11923594 | 3300004799 | Bacteria | 1081 |
| 4 | Ga0058862_10074850 | 3300004803 | Bacteria | 1310 |
| 5 | Ga0065715_10125066 | 3300005293 | Bacteria | 2139 |
| 6 | Ga0065715_10171985 | 3300005293 | Bacteria | 1540 |
| 7 | Ga0065715_10210423 | 3300005293 | Bacteria | 1317 |
| 8 | Ga0065707_10179456 | 3300005295 | Bacteria | 1428 |
| 9 | Ga0070658_10002410 | 3300005327 | Bacteria | 15652 |
| 10 | Ga0070658_10009372 | 3300005327 | Bacteria | 7866 |
| 11 | Ga0070658_10019543 | 3300005327 | Bacteria | 5424 |
| 12 | Ga0070658_10119251 | 3300005327 | Bacteria | 2191 |
| 13 | Ga0070658_10138528 | 3300005327 | Bacteria | 2032 |
| 14 | Ga0070658_10151769 | 3300005327 | Bacteria | 1940 |
| 15 | Ga0070676_10001069 | 3300005328 | Bacteria | 13653 |
| 16 | Ga0070676_10039372 | 3300005328 | Bacteria | 2734 |
| 17 | Ga0070676_10092138 | 3300005328 | Bacteria | 1858 |
| 18 | Ga0070683_100002655 | 3300005329 | Bacteria | 14296 |
| 19 | Ga0070683_100011177 | 3300005329 | Bacteria | 7745 |
| 20 | Ga0070683_100015270 | 3300005329 | Bacteria | 6743 |
| 21 | Ga0070683_100029316 | 3300005329 | Bacteria | 4981 |
| 22 | Ga0070683_100096198 | 3300005329 | Bacteria | 2785 |
| 23 | Ga0070683_100252130 | 3300005329 | Bacteria | 1679 |
| 24 | Ga0070683_100402232 | 3300005329 | Bacteria | 1306 |
| 25 | Ga0070690_100013146 | 3300005330 | Bacteria | 4885 |
| 26 | Ga0070690_100024816 | 3300005330 | Bacteria | 3690 |
| 27 | Ga0070690_100028256 | 3300005330 | Bacteria | 3473 |
| 28 | Ga0070690_100084348 | 3300005330 | Bacteria | 2083 |
| 29 | Ga0070670_100001025 | 3300005331 | Bacteria | 22087 |
| 30 | Ga0070670_100006438 | 3300005331 | Bacteria | 9940 |
| 31 | Ga0070670_100006705 | 3300005331 | Bacteria | 9757 |
| 32 | Ga0070670_100187744 | 3300005331 | Bacteria | 1795 |
| 33 | Ga0070677_10065616 | 3300005333 | Bacteria | 1511 |
| 34 | Ga0068869_100003272 | 3300005334 | Bacteria | 9890 |
| 35 | Ga0068869_100021978 | 3300005334 | Bacteria | 4391 |
| 36 | Ga0068869_100033554 | 3300005334 | Bacteria | 3624 |
| 37 | Ga0070680_100000152 | 3300005336 | Bacteria | 42779 |
| 38 | Ga0070680_100000886 | 3300005336 | Bacteria | 21194 |
| 39 | Ga0070680_100004530 | 3300005336 | Bacteria | 10465 |
| 40 | Ga0070680_100004938 | 3300005336 | Bacteria | 10041 |
| 41 | Ga0070680_100030842 | 3300005336 | Bacteria | 4307 |
| 42 | Ga0070680_100035601 | 3300005336 | Bacteria | 4020 |
| 43 | Ga0070680_100039564 | 3300005336 | Bacteria | 3816 |
| 44 | Ga0070680_100052859 | 3300005336 | Bacteria | 3315 |
| 45 | Ga0070680_100072152 | 3300005336 | Bacteria | 2838 |
| 46 | Ga0070680_100080018 | 3300005336 | Bacteria | 2694 |
| 47 | Ga0070680_100093716 | 3300005336 | Bacteria | 2488 |
| 48 | Ga0070680_100153002 | 3300005336 | Bacteria | 1937 |
| 49 | Ga0070682_100003997 | 3300005337 | Bacteria | 8192 |
| 50 | Ga0070682_100007320 | 3300005337 | Bacteria | 6225 |
| 51 | Ga0070682_100017197 | 3300005337 | Bacteria | 4213 |
| 52 | Ga0068868_100029687 | 3300005338 | Bacteria | 4189 |
| 53 | Ga0068868_100046330 | 3300005338 | Bacteria | 3403 |
| 54 | Ga0070660_100100684 | 3300005339 | Bacteria | 2289 |
| 55 | Ga0070660_100119932 | 3300005339 | Bacteria | 2098 |
| 56 | Ga0070660_100208789 | 3300005339 | Bacteria | 1585 |
| 57 | Ga0070689_100016644 | 3300005340 | Bacteria | 5382 |
| 58 | Ga0070689_100135420 | 3300005340 | Bacteria | 1978 |
| 59 | Ga0070689_100260200 | 3300005340 | Bacteria | 1434 |
| 60 | Ga0070691_10002555 | 3300005341 | Bacteria | 8115 |
| 61 | Ga0070691_10019303 | 3300005341 | Bacteria | 3144 |
| 62 | Ga0070687_100012322 | 3300005343 | Bacteria | 3773 |
| 63 | Ga0070687_100014623 | 3300005343 | Bacteria | 3529 |
| 64 | Ga0070687_100165301 | 3300005343 | Bacteria | 1312 |
| 65 | Ga0070661_100000555 | 3300005344 | Bacteria | 28645 |
| 66 | Ga0070661_100013380 | 3300005344 | Bacteria | 5758 |
| 67 | Ga0070661_100018782 | 3300005344 | Bacteria | 4920 |
| 68 | Ga0070661_100123730 | 3300005344 | Bacteria | 1939 |
| 69 | Ga0070692_10007973 | 3300005345 | Bacteria | 4698 |
| 70 | Ga0070692_10048202 | 3300005345 | Bacteria | 2206 |
| 71 | Ga0070692_10053898 | 3300005345 | Bacteria | 2099 |
| 72 | Ga0070692_10066924 | 3300005345 | Bacteria | 1905 |
| 73 | Ga0070668_100000088 | 3300005347 | Bacteria | 57110 |
| 74 | Ga0070668_100028995 | 3300005347 | Bacteria | 4202 |
| 75 | Ga0070668_100057181 | 3300005347 | Bacteria | 3014 |
| 76 | Ga0070668_100083335 | 3300005347 | Bacteria | 2510 |
| 77 | Ga0070668_100114398 | 3300005347 | Bacteria | 2150 |
| 78 | Ga0070668_100177320 | 3300005347 | Bacteria | 1739 |
| 79 | Ga0070669_100004309 | 3300005353 | Bacteria | 10287 |
| 80 | Ga0070669_100005368 | 3300005353 | Bacteria | 9247 |
| 81 | Ga0070669_100017493 | 3300005353 | Bacteria | 5113 |
| 82 | Ga0070669_100028355 | 3300005353 | Bacteria | 4032 |
| 83 | Ga0070669_100045624 | 3300005353 | Bacteria | 3194 |
| 84 | Ga0070675_100000328 | 3300005354 | Bacteria | 32107 |
| 85 | Ga0070675_100002562 | 3300005354 | Bacteria | 13607 |
| 86 | Ga0070675_100062482 | 3300005354 | Bacteria | 3077 |
| 87 | Ga0070675_100118846 | 3300005354 | Bacteria | 2244 |
| 88 | Ga0070675_100190756 | 3300005354 | Bacteria | 1775 |
| 89 | Ga0070675_100218278 | 3300005354 | Bacteria | 1660 |
| 90 | Ga0070671_100021339 | 3300005355 | Bacteria | 5290 |
| 91 | Ga0070671_100024452 | 3300005355 | Bacteria | 4945 |
| 92 | Ga0070671_100063276 | 3300005355 | Bacteria | 3081 |
| 93 | Ga0070671_100148877 | 3300005355 | Bacteria | 1976 |
| 94 | Ga0070674_100010741 | 3300005356 | Bacteria | 5552 |
| 95 | Ga0070674_100131764 | 3300005356 | Bacteria | 1865 |
| 96 | Ga0070674_100132554 | 3300005356 | Bacteria | 1860 |
| 97 | Ga0070674_100242032 | 3300005356 | Bacteria | 1413 |
| 98 | Ga0070673_100027745 | 3300005364 | Bacteria | 4200 |
| 99 | Ga0070673_100030061 | 3300005364 | Bacteria | 4059 |
| 100 | Ga0070673_100041619 | 3300005364 | Bacteria | 3536 |
| 101 | Ga0070673_100187543 | 3300005364 | Bacteria | 1774 |
| 102 | Ga0070688_100018644 | 3300005365 | Bacteria | 4008 |
| 103 | Ga0070688_100068534 | 3300005365 | Bacteria | 2262 |
| 104 | Ga0070659_100004735 | 3300005366 | Bacteria | 9720 |
| 105 | Ga0070659_100006879 | 3300005366 | Bacteria | 8236 |
| 106 | Ga0070659_100022459 | 3300005366 | Bacteria | 4817 |
| 107 | Ga0070659_100120479 | 3300005366 | Bacteria | 2124 |
| 108 | Ga0070659_100274042 | 3300005366 | Bacteria | 1402 |
| 109 | Ga0070659_100369874 | 3300005366 | Bacteria | 1206 |
| 110 | Ga0070667_100026870 | 3300005367 | Bacteria | 4790 |
| 111 | Ga0070667_100063795 | 3300005367 | Bacteria | 3123 |
| 112 | Ga0070667_100113059 | 3300005367 | Bacteria | 2356 |
| 113 | Ga0070667_100223573 | 3300005367 | Bacteria | 1676 |
| 114 | Ga0070703_10003216 | 3300005406 | Bacteria | 4661 |
| 115 | Ga0070703_10025184 | 3300005406 | Bacteria | 1763 |
| 116 | Ga0070709_10000468 | 3300005434 | Bacteria | 23965 |
| 117 | Ga0070709_10004856 | 3300005434 | Bacteria | 7270 |
| 118 | Ga0070709_10065735 | 3300005434 | Bacteria | 2323 |
| 119 | Ga0070714_100000878 | 3300005435 | Bacteria | 21352 |
| 120 | Ga0070714_100003440 | 3300005435 | Bacteria | 11794 |
| 121 | Ga0070714_100004574 | 3300005435 | Bacteria | 10435 |
| 122 | Ga0070714_100005291 | 3300005435 | Bacteria | 9836 |
| 123 | Ga0070714_100223639 | 3300005435 | Bacteria | 1731 |
| 124 | Ga0070713_100004689 | 3300005436 | Bacteria | 9232 |
| 125 | Ga0070701_10002215 | 3300005438 | Bacteria | 7431 |
| 126 | Ga0070701_10005194 | 3300005438 | Bacteria | 5353 |
| 127 | Ga0070711_100000106 | 3300005439 | Bacteria | 44087 |
| 128 | Ga0070711_100018042 | 3300005439 | Bacteria | 4502 |
| 129 | Ga0070711_100058475 | 3300005439 | Bacteria | 2673 |
| 130 | Ga0070711_100060818 | 3300005439 | Bacteria | 2627 |
| 131 | Ga0070705_100001229 | 3300005440 | Bacteria | 13860 |
| 132 | Ga0070705_100004234 | 3300005440 | Bacteria | 7002 |
| 133 | Ga0070705_100004882 | 3300005440 | Bacteria | 6530 |
| 134 | Ga0070705_100041548 | 3300005440 | Bacteria | 2623 |
| 135 | Ga0070705_100156067 | 3300005440 | Bacteria | 1520 |
| 136 | Ga0070694_100001804 | 3300005444 | Bacteria | 12675 |
| 137 | Ga0070694_100002816 | 3300005444 | Bacteria | 10321 |
| 138 | Ga0070694_100024506 | 3300005444 | Bacteria | 3894 |
| 139 | Ga0070694_100025286 | 3300005444 | Bacteria | 3841 |
| 140 | Ga0070694_100037396 | 3300005444 | Bacteria | 3219 |
| 141 | Ga0070694_100041223 | 3300005444 | Bacteria | 3079 |
| 142 | Ga0070694_100049747 | 3300005444 | Bacteria | 2823 |
| 143 | Ga0070694_100080357 | 3300005444 | Bacteria | 2265 |
| 144 | Ga0070708_100000070 | 3300005445 | Bacteria | 67477 |
| 145 | Ga0070708_100004270 | 3300005445 | Bacteria | 11231 |
| 146 | Ga0070708_100004497 | 3300005445 | Bacteria | 10969 |
| 147 | Ga0070708_100010495 | 3300005445 | Bacteria | 7509 |
| 148 | Ga0070708_100011885 | 3300005445 | Bacteria | 7089 |
| 149 | Ga0070708_100048072 | 3300005445 | Bacteria | 3770 |
| 150 | Ga0070708_100051729 | 3300005445 | Bacteria | 3640 |
| 151 | Ga0070708_100076038 | 3300005445 | Bacteria | 3032 |
| 152 | Ga0070708_100294665 | 3300005445 | Bacteria | 1527 |
| 153 | Ga0070663_100178772 | 3300005455 | Bacteria | 1644 |
| 154 | Ga0070678_100123855 | 3300005456 | Bacteria | 2043 |
| 155 | Ga0070678_100158857 | 3300005456 | Bacteria | 1829 |
| 156 | Ga0070678_100235270 | 3300005456 | Bacteria | 1529 |
| 157 | Ga0070662_100002729 | 3300005457 | Bacteria | 10902 |
| 158 | Ga0070662_100040602 | 3300005457 | Bacteria | 3314 |
| 159 | Ga0070662_100050122 | 3300005457 | Bacteria | 3012 |
| 160 | Ga0070662_100080800 | 3300005457 | Bacteria | 2421 |
| 161 | Ga0070662_100095795 | 3300005457 | Bacteria | 2238 |
| 162 | Ga0070662_100209292 | 3300005457 | Bacteria | 1551 |
| 163 | Ga0070662_100380569 | 3300005457 | Bacteria | 1162 |
| 164 | Ga0070681_10000687 | 3300005458 | Bacteria | 28037 |
| 165 | Ga0070681_10000828 | 3300005458 | Bacteria | 25847 |
| 166 | Ga0070681_10002894 | 3300005458 | Bacteria | 15865 |
| 167 | Ga0070681_10004863 | 3300005458 | Bacteria | 12885 |
| 168 | Ga0070681_10016300 | 3300005458 | Bacteria | 7414 |
| 169 | Ga0070681_10018968 | 3300005458 | Bacteria | 6885 |
| 170 | Ga0070681_10024729 | 3300005458 | Bacteria | 6042 |
| 171 | Ga0070681_10062448 | 3300005458 | Bacteria | 3699 |
| 172 | Ga0070681_10070720 | 3300005458 | Bacteria | 3454 |
| 173 | Ga0070681_10160414 | 3300005458 | Bacteria | 2172 |
| 174 | Ga0070681_10235006 | 3300005458 | Bacteria | 1747 |
| 175 | Ga0068867_100003262 | 3300005459 | Bacteria | 11431 |
| 176 | Ga0068867_100029692 | 3300005459 | Bacteria | 3940 |
| 177 | Ga0068867_100121175 | 3300005459 | Bacteria | 2022 |
| 178 | Ga0068867_100139266 | 3300005459 | Bacteria | 1895 |
| 179 | Ga0070685_10057967 | 3300005466 | Bacteria | 2256 |
| 180 | Ga0070685_10192296 | 3300005466 | Bacteria | 1321 |
| 181 | Ga0070706_100001388 | 3300005467 | Bacteria | 25672 |
| 182 | Ga0070706_100034447 | 3300005467 | Bacteria | 4678 |
| 183 | Ga0070706_100038625 | 3300005467 | Bacteria | 4406 |
| 184 | Ga0070706_100041249 | 3300005467 | Bacteria | 4261 |
| 185 | Ga0070706_100043850 | 3300005467 | Bacteria | 4132 |
| 186 | Ga0070706_100091223 | 3300005467 | Bacteria | 2826 |
| 187 | Ga0070706_100100227 | 3300005467 | Bacteria | 2691 |
| 188 | Ga0070706_100134024 | 3300005467 | Bacteria | 2312 |
| 189 | Ga0070706_100424654 | 3300005467 | Bacteria | 1237 |
| 190 | Ga0070707_100001831 | 3300005468 | Bacteria | 20420 |
| 191 | Ga0070707_100004854 | 3300005468 | Bacteria | 12600 |
| 192 | Ga0070707_100016176 | 3300005468 | Bacteria | 7000 |
| 193 | Ga0070707_100017971 | 3300005468 | Bacteria | 6650 |
| 194 | Ga0070707_100019833 | 3300005468 | Bacteria | 6338 |
| 195 | Ga0070707_100021571 | 3300005468 | Bacteria | 6089 |
| 196 | Ga0070707_100041321 | 3300005468 | Bacteria | 4413 |
| 197 | Ga0070707_100070532 | 3300005468 | Bacteria | 3366 |
| 198 | Ga0070707_100098677 | 3300005468 | Bacteria | 2829 |
| 199 | Ga0070707_100436629 | 3300005468 | Bacteria | 1270 |
| 200 | Ga0070698_100000109 | 3300005471 | Bacteria | 69210 |
| 201 | Ga0070698_100002614 | 3300005471 | Bacteria | 19841 |
| 202 | Ga0070698_100011076 | 3300005471 | Bacteria | 9583 |
| 203 | Ga0070698_100011389 | 3300005471 | Bacteria | 9436 |
| 204 | Ga0070698_100013629 | 3300005471 | Bacteria | 8606 |
| 205 | Ga0070698_100024231 | 3300005471 | Bacteria | 6332 |
| 206 | Ga0070698_100029252 | 3300005471 | Bacteria | 5718 |
| 207 | Ga0070698_100093517 | 3300005471 | Bacteria | 2986 |
| 208 | Ga0070698_100098417 | 3300005471 | Bacteria | 2899 |
| 209 | Ga0070698_100180777 | 3300005471 | Bacteria | 2048 |
| 210 | Ga0070699_100000091 | 3300005518 | Bacteria | 86800 |
| 211 | Ga0070699_100001290 | 3300005518 | Bacteria | 23120 |
| 212 | Ga0070699_100004566 | 3300005518 | Bacteria | 12261 |
| 213 | Ga0070699_100006637 | 3300005518 | Bacteria | 10062 |
| 214 | Ga0070699_100011321 | 3300005518 | Bacteria | 7705 |
| 215 | Ga0070699_100014131 | 3300005518 | Bacteria | 6869 |
| 216 | Ga0070699_100019989 | 3300005518 | Bacteria | 5771 |
| 217 | Ga0070699_100028904 | 3300005518 | Bacteria | 4779 |
| 218 | Ga0070699_100059529 | 3300005518 | Bacteria | 3309 |
| 219 | Ga0070699_100096483 | 3300005518 | Bacteria | 2589 |
| 220 | Ga0070699_100104185 | 3300005518 | Bacteria | 2488 |
| 221 | Ga0070699_100122878 | 3300005518 | Bacteria | 2284 |
| 222 | Ga0070699_100219618 | 3300005518 | Bacteria | 1694 |
| 223 | Ga0070699_100227032 | 3300005518 | Bacteria | 1665 |
| 224 | Ga0070699_100454068 | 3300005518 | Bacteria | 1162 |
| 225 | Ga0070679_100000443 | 3300005530 | Bacteria | 35227 |
| 226 | Ga0070679_100003946 | 3300005530 | Bacteria | 13654 |
| 227 | Ga0070679_100010155 | 3300005530 | Bacteria | 8925 |
| 228 | Ga0070679_100018907 | 3300005530 | Bacteria | 6691 |
| 229 | Ga0070679_100028602 | 3300005530 | Bacteria | 5496 |
| 230 | Ga0070679_100030974 | 3300005530 | Bacteria | 5284 |
| 231 | Ga0070679_100040136 | 3300005530 | Bacteria | 4656 |
| 232 | Ga0070679_100045265 | 3300005530 | Bacteria | 4385 |
| 233 | Ga0070679_100049987 | 3300005530 | Bacteria | 4164 |
| 234 | Ga0070679_100099123 | 3300005530 | Bacteria | 2901 |
| 235 | Ga0070679_100105650 | 3300005530 | Bacteria | 2802 |
| 236 | Ga0070679_100130360 | 3300005530 | Bacteria | 2496 |
| 237 | Ga0070679_100142918 | 3300005530 | Bacteria | 2372 |
| 238 | Ga0070679_100315920 | 3300005530 | Bacteria | 1512 |
| 239 | Ga0070684_100002554 | 3300005535 | Bacteria | 13445 |
| 240 | Ga0070684_100005481 | 3300005535 | Bacteria | 9723 |
| 241 | Ga0070684_100017764 | 3300005535 | Bacteria | 5846 |
| 242 | Ga0070684_100034489 | 3300005535 | Bacteria | 4327 |
| 243 | Ga0070684_100044061 | 3300005535 | Bacteria | 3857 |
| 244 | Ga0070684_100051427 | 3300005535 | Bacteria | 3579 |
| 245 | Ga0070684_100054192 | 3300005535 | Bacteria | 3494 |
| 246 | Ga0070684_100152944 | 3300005535 | Bacteria | 2091 |
| 247 | Ga0070684_100175731 | 3300005535 | Bacteria | 1946 |
| 248 | Ga0070684_100543332 | 3300005535 | Bacteria | 1078 |
| 249 | Ga0070697_100003922 | 3300005536 | Bacteria | 11429 |
| 250 | Ga0070697_100004414 | 3300005536 | Bacteria | 10802 |
| 251 | Ga0070697_100004575 | 3300005536 | Bacteria | 10624 |
| 252 | Ga0070697_100008439 | 3300005536 | Bacteria | 8039 |
| 253 | Ga0070697_100008663 | 3300005536 | Bacteria | 7943 |
| 254 | Ga0070697_100011976 | 3300005536 | Bacteria | 6789 |
| 255 | Ga0070697_100017195 | 3300005536 | Bacteria | 5686 |
| 256 | Ga0070697_100031239 | 3300005536 | Bacteria | 4282 |
| 257 | Ga0070697_100065842 | 3300005536 | Bacteria | 2962 |
| 258 | Ga0070697_100203013 | 3300005536 | Bacteria | 1685 |
| 259 | Ga0070697_100377816 | 3300005536 | Bacteria | 1227 |
| 260 | Ga0070697_100398648 | 3300005536 | Bacteria | 1194 |
| 261 | Ga0068853_100013245 | 3300005539 | Bacteria | 6731 |
| 262 | Ga0068853_100035769 | 3300005539 | Bacteria | 4220 |
| 263 | Ga0068853_100061189 | 3300005539 | Bacteria | 3256 |
| 264 | Ga0068853_100101499 | 3300005539 | Bacteria | 2544 |
| 265 | Ga0068853_100107663 | 3300005539 | Bacteria | 2472 |
| 266 | Ga0070672_100020937 | 3300005543 | Bacteria | 4779 |
| 267 | Ga0070672_100028075 | 3300005543 | Bacteria | 4205 |
| 268 | Ga0070672_100039619 | 3300005543 | Bacteria | 3611 |
| 269 | Ga0070672_100044873 | 3300005543 | Bacteria | 3416 |
| 270 | Ga0070672_100229243 | 3300005543 | Bacteria | 1560 |
| 271 | Ga0070672_100266460 | 3300005543 | Bacteria | 1446 |
| 272 | Ga0070672_100520383 | 3300005543 | Bacteria | 1030 |
| 273 | Ga0070686_100075921 | 3300005544 | Bacteria | 2212 |
| 274 | Ga0070686_100116573 | 3300005544 | Bacteria | 1828 |
| 275 | Ga0070695_100001357 | 3300005545 | Bacteria | 13567 |
| 276 | Ga0070695_100003221 | 3300005545 | Bacteria | 9526 |
| 277 | Ga0070695_100061283 | 3300005545 | Bacteria | 2441 |
| 278 | Ga0070695_100064463 | 3300005545 | Bacteria | 2384 |
| 279 | Ga0070695_100248108 | 3300005545 | Bacteria | 1294 |
| 280 | Ga0070696_100001642 | 3300005546 | Bacteria | 14675 |
| 281 | Ga0070696_100001747 | 3300005546 | Bacteria | 14253 |
| 282 | Ga0070696_100002480 | 3300005546 | Bacteria | 12229 |
| 283 | Ga0070696_100002806 | 3300005546 | Bacteria | 11567 |
| 284 | Ga0070696_100003579 | 3300005546 | Bacteria | 10350 |
| 285 | Ga0070696_100013854 | 3300005546 | Bacteria | 5413 |
| 286 | Ga0070696_100015640 | 3300005546 | Bacteria | 5098 |
| 287 | Ga0070696_100050330 | 3300005546 | Bacteria | 2896 |
| 288 | Ga0070696_100068067 | 3300005546 | Bacteria | 2499 |
| 289 | Ga0070696_100119506 | 3300005546 | Bacteria | 1906 |
| 290 | Ga0070696_100211549 | 3300005546 | Bacteria | 1451 |
| 291 | Ga0070693_100002712 | 3300005547 | Bacteria | 8139 |
| 292 | Ga0070693_100024732 | 3300005547 | Bacteria | 3224 |
| 293 | Ga0070665_100010586 | 3300005548 | Bacteria | 9338 |
| 294 | Ga0070704_100000390 | 3300005549 | Bacteria | 20114 |
| 295 | Ga0070704_100011539 | 3300005549 | Bacteria | 5420 |
| 296 | Ga0070704_100018243 | 3300005549 | Bacteria | 4481 |
| 297 | Ga0070704_100037225 | 3300005549 | Bacteria | 3322 |
| 298 | Ga0070704_100044111 | 3300005549 | Bacteria | 3096 |
| 299 | Ga0070704_100055681 | 3300005549 | Bacteria | 2805 |
| 300 | Ga0070704_100242323 | 3300005549 | Bacteria | 1476 |
| 301 | Ga0068855_100046695 | 3300005563 | Bacteria | 5118 |
| 302 | Ga0068855_100064329 | 3300005563 | Bacteria | 4278 |
| 303 | Ga0068855_100065622 | 3300005563 | Bacteria | 4232 |
| 304 | Ga0068855_100074497 | 3300005563 | Bacteria | 3942 |
| 305 | Ga0068855_100115999 | 3300005563 | Bacteria | 3069 |
| 306 | Ga0068855_100496168 | 3300005563 | Bacteria | 1327 |
| 307 | Ga0070664_100002134 | 3300005564 | Bacteria | 15844 |
| 308 | Ga0070664_100042116 | 3300005564 | Bacteria | 3855 |
| 309 | Ga0070664_100057446 | 3300005564 | Bacteria | 3308 |
| 310 | Ga0070664_100062616 | 3300005564 | Bacteria | 3172 |
| 311 | Ga0070664_100080556 | 3300005564 | Bacteria | 2805 |
| 312 | Ga0070664_100123605 | 3300005564 | Bacteria | 2268 |
| 313 | Ga0070664_100141850 | 3300005564 | Bacteria | 2116 |
| 314 | Ga0070664_100228373 | 3300005564 | Bacteria | 1668 |
| 315 | Ga0070664_100517087 | 3300005564 | Bacteria | 1101 |
| 316 | Ga0068857_100005765 | 3300005577 | Bacteria | 10587 |
| 317 | Ga0068857_100009491 | 3300005577 | Bacteria | 8450 |
| 318 | Ga0068857_100014469 | 3300005577 | Bacteria | 6883 |
| 319 | Ga0068857_100021305 | 3300005577 | Bacteria | 5706 |
| 320 | Ga0068857_100073283 | 3300005577 | Bacteria | 3051 |
| 321 | Ga0068857_100298562 | 3300005577 | Bacteria | 1485 |
| 322 | Ga0068854_100002669 | 3300005578 | Bacteria | 11059 |
| 323 | Ga0068854_100005444 | 3300005578 | Bacteria | 8038 |
| 324 | Ga0068854_100304321 | 3300005578 | Bacteria | 1291 |
| 325 | Ga0068854_100341113 | 3300005578 | Bacteria | 1224 |
| 326 | Ga0068856_100043500 | 3300005614 | Bacteria | 4419 |
| 327 | Ga0068856_100174247 | 3300005614 | Bacteria | 2164 |
| 328 | Ga0070702_100102677 | 3300005615 | Bacteria | 1757 |
| 329 | Ga0070702_100165314 | 3300005615 | Bacteria | 1434 |
| 330 | Ga0070702_100211475 | 3300005615 | Bacteria | 1291 |
| 331 | Ga0068852_100004225 | 3300005616 | Bacteria | 10138 |
| 332 | Ga0068852_100030810 | 3300005616 | Bacteria | 4420 |
| 333 | Ga0068852_100085610 | 3300005616 | Bacteria | 2808 |
| 334 | Ga0068852_100137693 | 3300005616 | Bacteria | 2255 |
| 335 | Ga0068859_100023845 | 3300005617 | Bacteria | 6142 |
| 336 | Ga0068859_100044907 | 3300005617 | Bacteria | 4439 |
| 337 | Ga0068859_100065663 | 3300005617 | Bacteria | 3662 |
| 338 | Ga0068859_100097008 | 3300005617 | Bacteria | 3001 |
| 339 | Ga0068859_100244257 | 3300005617 | Bacteria | 1885 |
| 340 | Ga0068859_100366039 | 3300005617 | Bacteria | 1537 |
| 341 | Ga0068864_100008318 | 3300005618 | Bacteria | 8558 |
| 342 | Ga0068864_100046006 | 3300005618 | Bacteria | 3744 |
| 343 | Ga0068864_100195762 | 3300005618 | Bacteria | 1854 |
| 344 | Ga0068864_100244664 | 3300005618 | Bacteria | 1663 |
| 345 | Ga0068866_10015087 | 3300005718 | Bacteria | 3427 |
| 346 | Ga0068861_100000232 | 3300005719 | Bacteria | 30370 |
| 347 | Ga0068861_100048396 | 3300005719 | Bacteria | 3214 |
| 348 | Ga0068861_100245889 | 3300005719 | Bacteria | 1524 |
| 349 | Ga0068870_10021110 | 3300005840 | Bacteria | 3182 |
| 350 | Ga0068870_10149111 | 3300005840 | Bacteria | 1376 |
| 351 | Ga0068863_100010547 | 3300005841 | Bacteria | 8971 |
| 352 | Ga0068863_100025110 | 3300005841 | Bacteria | 5683 |
| 353 | Ga0068863_100057210 | 3300005841 | Bacteria | 3691 |
| 354 | Ga0068858_100006089 | 3300005842 | Bacteria | 11768 |
| 355 | Ga0068858_100020276 | 3300005842 | Bacteria | 6217 |
| 356 | Ga0068860_100059679 | 3300005843 | Bacteria | 3626 |
| 357 | Ga0068860_100071997 | 3300005843 | Bacteria | 3284 |
| 358 | Ga0068860_100150247 | 3300005843 | Bacteria | 2243 |
| 359 | Ga0068862_100002069 | 3300005844 | Bacteria | 18108 |
| 360 | Ga0068862_100011123 | 3300005844 | Bacteria | 7430 |
| 361 | Ga0068862_100031129 | 3300005844 | Bacteria | 4501 |
| 362 | Ga0068862_100045625 | 3300005844 | Bacteria | 3739 |
| 363 | Ga0068862_100141767 | 3300005844 | Bacteria | 2134 |
| 364 | Ga0081455_10066286 | 3300005937 | Bacteria | 3016 |
| 365 | Ga0081455_10078672 | 3300005937 | Bacteria | 2709 |
| 366 | Ga0081539_10000103 | 3300005985 | Bacteria | 197839 |
| 367 | Ga0081539_10014467 | 3300005985 | Bacteria | 5832 |
| 368 | Ga0070717_10035604 | 3300006028 | Bacteria | 4032 |
| 369 | Ga0070716_100005697 | 3300006173 | Bacteria | 6049 |
| 370 | Ga0070716_100159979 | 3300006173 | Bacteria | 1458 |
| 371 | Ga0070712_100070343 | 3300006175 | Bacteria | 2500 |
| 372 | Ga0070712_100227287 | 3300006175 | Bacteria | 1480 |
| 373 | Ga0097621_100223741 | 3300006237 | Bacteria | 1641 |
| 374 | Ga0068871_100046727 | 3300006358 | Bacteria | 3488 |
| 375 | Ga0068871_100079935 | 3300006358 | Bacteria | 2706 |
| 376 | Ga0075428_100006240 | 3300006844 | Bacteria | 13255 |
| 377 | Ga0075428_100036169 | 3300006844 | Bacteria | 5440 |
| 378 | Ga0075428_100038265 | 3300006844 | Bacteria | 5278 |
| 379 | Ga0075428_100289374 | 3300006844 | Bacteria | 1762 |
| 380 | Ga0075428_100301665 | 3300006844 | Bacteria | 1722 |
| 381 | Ga0075430_100026935 | 3300006846 | Bacteria | 4889 |
| 382 | Ga0075430_100028403 | 3300006846 | Bacteria | 4753 |
| 383 | Ga0075431_100006384 | 3300006847 | Bacteria | 11704 |
| 384 | Ga0075431_100010914 | 3300006847 | Bacteria | 9139 |
| 385 | Ga0075431_100012188 | 3300006847 | Bacteria | 8676 |
| 386 | Ga0075431_100036869 | 3300006847 | Bacteria | 5038 |
| 387 | Ga0075431_100130630 | 3300006847 | Bacteria | 2591 |
| 388 | Ga0075433_10000226 | 3300006852 | Bacteria | 32302 |
| 389 | Ga0075433_10027154 | 3300006852 | Bacteria | 4853 |
| 390 | Ga0075433_10034435 | 3300006852 | Bacteria | 4350 |
| 391 | Ga0075433_10073280 | 3300006852 | Bacteria | 3011 |
| 392 | Ga0075433_10083859 | 3300006852 | Bacteria | 2813 |
| 393 | Ga0075433_10247934 | 3300006852 | Bacteria | 1580 |
| 394 | Ga0075433_10310334 | 3300006852 | Bacteria | 1396 |
| 395 | Ga0075434_100000723 | 3300006871 | Bacteria | 25875 |
| 396 | Ga0075434_100004748 | 3300006871 | Bacteria | 12295 |
| 397 | Ga0075434_100011395 | 3300006871 | Bacteria | 8387 |
| 398 | Ga0075434_100013916 | 3300006871 | Bacteria | 7674 |
| 399 | Ga0075434_100032355 | 3300006871 | Bacteria | 5158 |
| 400 | Ga0075434_100132014 | 3300006871 | Bacteria | 2517 |
| 401 | Ga0075429_100002036 | 3300006880 | Bacteria | 16825 |
| 402 | Ga0075429_100012920 | 3300006880 | Bacteria | 7244 |
| 403 | Ga0075429_100026135 | 3300006880 | Bacteria | 5068 |
| 404 | Ga0075429_100053736 | 3300006880 | Bacteria | 3504 |
| 405 | Ga0075429_100095024 | 3300006880 | Bacteria | 2599 |
| 406 | Ga0075429_100147985 | 3300006880 | Bacteria | 2056 |
| 407 | Ga0075429_100237465 | 3300006880 | Bacteria | 1596 |
| 408 | Ga0068865_100007779 | 3300006881 | Bacteria | 6609 |
| 409 | Ga0068865_100010159 | 3300006881 | Bacteria | 5851 |
| 410 | Ga0068865_100010998 | 3300006881 | Bacteria | 5648 |
| 411 | Ga0068865_100035616 | 3300006881 | Bacteria | 3349 |
| 412 | Ga0075436_100002070 | 3300006914 | Bacteria | 13843 |
| 413 | Ga0075436_100002833 | 3300006914 | Bacteria | 11873 |
| 414 | Ga0075436_100020329 | 3300006914 | Bacteria | 4557 |
| 415 | Ga0075436_100020492 | 3300006914 | Bacteria | 4538 |
| 416 | Ga0075436_100031013 | 3300006914 | Bacteria | 3679 |
| 417 | Ga0075436_100190519 | 3300006914 | Bacteria | 1451 |
| 418 | Ga0075436_100285816 | 3300006914 | Bacteria | 1180 |
| 419 | Ga0097620_100023845 | 3300006931 | Bacteria | 6142 |
| 420 | Ga0097620_100044906 | 3300006931 | Bacteria | 4439 |
| 421 | Ga0097620_100065668 | 3300006931 | Bacteria | 3662 |
| 422 | Ga0097620_100097003 | 3300006931 | Bacteria | 3001 |
| 423 | Ga0097620_100244256 | 3300006931 | Bacteria | 1885 |
| 424 | Ga0097620_100366081 | 3300006931 | Bacteria | 1537 |
| 425 | Ga0075435_100033106 | 3300007076 | Bacteria | 4085 |
| 426 | Ga0075435_100124023 | 3300007076 | Bacteria | 2157 |
| 427 | Ga0075435_100178598 | 3300007076 | Bacteria | 1794 |
| 428 | Ga0075435_100476766 | 3300007076 | Bacteria | 1077 |
| 429 | Ga0099794_10000041 | 3300007265 | Bacteria | 50642 |
| 430 | Ga0099794_10002901 | 3300007265 | Bacteria | 6445 |
| 431 | Ga0099794_10061899 | 3300007265 | Bacteria | 1819 |
| 432 | Ga0099794_10152790 | 3300007265 | Bacteria | 1172 |
| 433 | Ga0105240_10022751 | 3300009093 | Bacteria | 8303 |
| 434 | Ga0105240_10026683 | 3300009093 | Bacteria | 7578 |
| 435 | Ga0105240_10030258 | 3300009093 | Bacteria | 7038 |
| 436 | Ga0105240_10062666 | 3300009093 | Bacteria | 4628 |
| 437 | Ga0105240_10164862 | 3300009093 | Bacteria | 2629 |
| 438 | Ga0105240_10323005 | 3300009093 | Bacteria | 1758 |
| 439 | Ga0111539_10021889 | 3300009094 | Bacteria | 7860 |
| 440 | Ga0111539_10032525 | 3300009094 | Bacteria | 6333 |
| 441 | Ga0111539_10042199 | 3300009094 | Bacteria | 5481 |
| 442 | Ga0111539_10051533 | 3300009094 | Bacteria | 4901 |
| 443 | Ga0105245_10038166 | 3300009098 | Bacteria | 4273 |
| 444 | Ga0105245_10042591 | 3300009098 | Bacteria | 4051 |
| 445 | Ga0105245_10091566 | 3300009098 | Bacteria | 2799 |
| 446 | Ga0105245_10322920 | 3300009098 | Bacteria | 1521 |
| 447 | Ga0114129_10000482 | 3300009147 | Bacteria | 48090 |
| 448 | Ga0114129_10007380 | 3300009147 | Bacteria | 15651 |
| 449 | Ga0114129_10014906 | 3300009147 | Bacteria | 11074 |
| 450 | Ga0114129_10068850 | 3300009147 | Bacteria | 4933 |
| 451 | Ga0114129_10091011 | 3300009147 | Bacteria | 4228 |
| 452 | Ga0114129_10158085 | 3300009147 | Bacteria | 3098 |
| 453 | Ga0114129_10212754 | 3300009147 | Bacteria | 2613 |
| 454 | Ga0114129_10219170 | 3300009147 | Bacteria | 2568 |
| 455 | Ga0114129_10228830 | 3300009147 | Bacteria | 2505 |
| 456 | Ga0114129_10330892 | 3300009147 | Bacteria | 2023 |
| 457 | Ga0114129_10345550 | 3300009147 | Bacteria | 1972 |
| 458 | Ga0114129_10540071 | 3300009147 | Bacteria | 1517 |
| 459 | Ga0114129_10786781 | 3300009147 | Bacteria | 1215 |
| 460 | Ga0105241_10058318 | 3300009174 | Bacteria | 2965 |
| 461 | Ga0105241_10098937 | 3300009174 | Bacteria | 2315 |
| 462 | Ga0105241_10129516 | 3300009174 | Bacteria | 2041 |
| 463 | Ga0105242_10001589 | 3300009176 | Bacteria | 17858 |
| 464 | Ga0105242_10006083 | 3300009176 | Bacteria | 9307 |
| 465 | Ga0105242_10011676 | 3300009176 | Bacteria | 6758 |
| 466 | Ga0105248_10000977 | 3300009177 | Bacteria | 31755 |
| 467 | Ga0105248_10003124 | 3300009177 | Bacteria | 18328 |
| 468 | Ga0105248_10036018 | 3300009177 | Bacteria | 5535 |
| 469 | Ga0105248_10087258 | 3300009177 | Bacteria | 3511 |
| 470 | Ga0105248_10325282 | 3300009177 | Bacteria | 1732 |
| 471 | Ga0105238_10000007 | 3300009551 | Bacteria | 309725 |
| 472 | Ga0105238_10119760 | 3300009551 | Bacteria | 2612 |
| 473 | Ga0105249_10000078 | 3300009553 | Bacteria | 140030 |
| 474 | Ga0105249_10001142 | 3300009553 | Bacteria | 23486 |
| 475 | Ga0105249_10003811 | 3300009553 | Bacteria | 13018 |
| 476 | Ga0105249_10007349 | 3300009553 | Bacteria | 9603 |
| 477 | Ga0105249_10013047 | 3300009553 | Bacteria | 7334 |
| 478 | Ga0105249_10043169 | 3300009553 | Bacteria | 4102 |
| 479 | Ga0105239_10010617 | 3300010375 | Bacteria | 10302 |
| 480 | Ga0105239_10013408 | 3300010375 | Bacteria | 9107 |
| 481 | Ga0105239_10040907 | 3300010375 | Bacteria | 5079 |
| 482 | Ga0105246_10037375 | 3300011119 | Bacteria | 3259 |
| 483 | Ga0157373_10001188 | 3300013100 | Bacteria | 19929 |
| 484 | Ga0157373_10048475 | 3300013100 | Bacteria | 3028 |
| 485 | Ga0157373_10089526 | 3300013100 | Bacteria | 2168 |
| 486 | Ga0157373_10092492 | 3300013100 | Bacteria | 2130 |
| 487 | Ga0157373_10203380 | 3300013100 | Bacteria | 1396 |
| 488 | Ga0157371_10052735 | 3300013102 | Bacteria | 2888 |
| 489 | Ga0157371_10054753 | 3300013102 | Bacteria | 2832 |
| 490 | Ga0157371_10076645 | 3300013102 | Bacteria | 2368 |
| 491 | Ga0157370_10002250 | 3300013104 | Bacteria | 23451 |
| 492 | Ga0157370_10016352 | 3300013104 | Bacteria | 7513 |
| 493 | Ga0157370_10026600 | 3300013104 | Bacteria | 5710 |
| 494 | Ga0157370_10091054 | 3300013104 | Bacteria | 2864 |
| 495 | Ga0157370_10205130 | 3300013104 | Bacteria | 1828 |
| 496 | Ga0157369_10006892 | 3300013105 | Bacteria | 13111 |
| 497 | Ga0157369_10050847 | 3300013105 | Bacteria | 4486 |
| 498 | Ga0157369_10078170 | 3300013105 | Bacteria | 3545 |
| 499 | Ga0157369_10121427 | 3300013105 | Bacteria | 2772 |
| 500 | Ga0157369_10143481 | 3300013105 | Bacteria | 2526 |
| 501 | Ga0157374_10074796 | 3300013296 | Bacteria | 3200 |
| 502 | Ga0157374_10187416 | 3300013296 | Bacteria | 2023 |
| 503 | Ga0157374_10261198 | 3300013296 | Bacteria | 1705 |
| 504 | Ga0157378_10000460 | 3300013297 | Bacteria | 38850 |
| 505 | Ga0157378_10028113 | 3300013297 | Bacteria | 4960 |
| 506 | Ga0157378_10172947 | 3300013297 | Bacteria | 2027 |
| 507 | Ga0163162_10002411 | 3300013306 | Bacteria | 17589 |
| 508 | Ga0163162_10075177 | 3300013306 | Bacteria | 3438 |
| 509 | Ga0163162_10125473 | 3300013306 | Bacteria | 2673 |
| 510 | Ga0163162_10154470 | 3300013306 | Bacteria | 2414 |
| 511 | Ga0163162_10193472 | 3300013306 | Bacteria | 2162 |
| 512 | Ga0163162_10504766 | 3300013306 | Bacteria | 1340 |
| 513 | Ga0157372_10005848 | 3300013307 | Bacteria | 13101 |
| 514 | Ga0157372_10008921 | 3300013307 | Bacteria | 10653 |
| 515 | Ga0157372_10011199 | 3300013307 | Bacteria | 9541 |
| 516 | Ga0157372_10011305 | 3300013307 | Bacteria | 9497 |
| 517 | Ga0157372_10018234 | 3300013307 | Bacteria | 7545 |
| 518 | Ga0157372_10065515 | 3300013307 | Bacteria | 4079 |
| 519 | Ga0157372_10111598 | 3300013307 | Bacteria | 3133 |
| 520 | Ga0157372_10195027 | 3300013307 | Bacteria | 2346 |
| 521 | Ga0157372_10279397 | 3300013307 | Bacteria | 1941 |
| 522 | Ga0157372_10324820 | 3300013307 | Bacteria | 1792 |
| 523 | Ga0157372_10524279 | 3300013307 | Bacteria | 1381 |
| 524 | Ga0157375_10028212 | 3300013308 | Bacteria | 5258 |
| 525 | Ga0157375_10046809 | 3300013308 | Bacteria | 4220 |
| 526 | Ga0157375_10066297 | 3300013308 | Bacteria | 3603 |
| 527 | Ga0157375_10227516 | 3300013308 | Bacteria | 2024 |
| 528 | Ga0157375_10317799 | 3300013308 | Bacteria | 1722 |
| 529 | Ga0157375_10357016 | 3300013308 | Bacteria | 1627 |
| 530 | Ga0163163_10038659 | 3300014325 | Bacteria | 4652 |
| 531 | Ga0163163_10057510 | 3300014325 | Bacteria | 3846 |
| 532 | Ga0163163_10215945 | 3300014325 | Bacteria | 1967 |
| 533 | Ga0163163_10222601 | 3300014325 | Bacteria | 1936 |
| 534 | Ga0157380_10097607 | 3300014326 | Bacteria | 2439 |
| 535 | Ga0157380_10357008 | 3300014326 | Bacteria | 1370 |
| 536 | Ga0157377_10003523 | 3300014745 | Bacteria | 7086 |
| 537 | Ga0157379_10005920 | 3300014968 | Bacteria | 10529 |
| 538 | Ga0157376_10015363 | 3300014969 | Bacteria | 5782 |
| 539 | Ga0157376_10050068 | 3300014969 | Bacteria | 3464 |
| 540 | Ga0157376_10250247 | 3300014969 | Bacteria | 1655 |
| 541 | Ga0157376_10370887 | 3300014969 | Bacteria | 1376 |
| 542 | Ga0163161_10055588 | 3300017792 | Bacteria | 2874 |
| 543 | Ga0163161_10092369 | 3300017792 | Bacteria | 2241 |
| 544 | Ga0163161_10256440 | 3300017792 | Bacteria | 1364 |
| 545 | Ga0206356_10686293 | 3300020070 | Bacteria | 3447 |
| 546 | Ga0206354_11043160 | 3300020081 | Bacteria | 3215 |
| 547 | Ga0213876_10100162 | 3300021384 | Bacteria | 1536 |
| 548 | Ga0213875_10003244 | 3300021388 | Bacteria | 9330 |
| 549 | Ga0207697_10078783 | 3300025315 | Bacteria | 1387 |
| 550 | Ga0207653_10000037 | 3300025885 | Bacteria | 99765 |
| 551 | Ga0207653_10007039 | 3300025885 | Bacteria | 3511 |
| 552 | Ga0207682_10017990 | 3300025893 | Bacteria | 2759 |
| 553 | Ga0207682_10087006 | 3300025893 | Bacteria | 1349 |
| 554 | Ga0207642_10000684 | 3300025899 | Bacteria | 10439 |
| 555 | Ga0207642_10042071 | 3300025899 | Bacteria | 2005 |
| 556 | Ga0207688_10061651 | 3300025901 | Bacteria | 2114 |
| 557 | Ga0207680_10042801 | 3300025903 | Bacteria | 2652 |
| 558 | Ga0207647_10010471 | 3300025904 | Bacteria | 6550 |
| 559 | Ga0207699_10007060 | 3300025906 | Bacteria | 5474 |
| 560 | Ga0207699_10019989 | 3300025906 | Bacteria | 3581 |
| 561 | Ga0207699_10059131 | 3300025906 | Bacteria | 2296 |
| 562 | Ga0207699_10315829 | 3300025906 | Bacteria | 1095 |
| 563 | Ga0207645_10002892 | 3300025907 | Bacteria | 13281 |
| 564 | Ga0207645_10004847 | 3300025907 | Bacteria | 9877 |
| 565 | Ga0207645_10005647 | 3300025907 | Bacteria | 9039 |
| 566 | Ga0207645_10036027 | 3300025907 | Bacteria | 3176 |
| 567 | Ga0207645_10137566 | 3300025907 | Bacteria | 1591 |
| 568 | Ga0207643_10031640 | 3300025908 | Bacteria | 2951 |
| 569 | Ga0207643_10047789 | 3300025908 | Bacteria | 2423 |
| 570 | Ga0207705_10015677 | 3300025909 | Bacteria | 5442 |
| 571 | Ga0207705_10018615 | 3300025909 | Bacteria | 4965 |
| 572 | Ga0207705_10029915 | 3300025909 | Bacteria | 3884 |
| 573 | Ga0207705_10036540 | 3300025909 | Bacteria | 3515 |
| 574 | Ga0207705_10053823 | 3300025909 | Bacteria | 2900 |
| 575 | Ga0207684_10002946 | 3300025910 | Bacteria | 16860 |
| 576 | Ga0207684_10004712 | 3300025910 | Bacteria | 12791 |
| 577 | Ga0207684_10058258 | 3300025910 | Bacteria | 3277 |
| 578 | Ga0207684_10102868 | 3300025910 | Bacteria | 2442 |
| 579 | Ga0207684_10107252 | 3300025910 | Bacteria | 2390 |
| 580 | Ga0207684_10168869 | 3300025910 | Bacteria | 1885 |
| 581 | Ga0207654_10000405 | 3300025911 | Bacteria | 25039 |
| 582 | Ga0207654_10027981 | 3300025911 | Bacteria | 3069 |
| 583 | Ga0207654_10053394 | 3300025911 | Bacteria | 2332 |
| 584 | Ga0207654_10063551 | 3300025911 | Bacteria | 2167 |
| 585 | Ga0207654_10074715 | 3300025911 | Bacteria | 2023 |
| 586 | Ga0207707_10000485 | 3300025912 | Bacteria | 41294 |
| 587 | Ga0207707_10002384 | 3300025912 | Bacteria | 16938 |
| 588 | Ga0207707_10003274 | 3300025912 | Bacteria | 14387 |
| 589 | Ga0207707_10003323 | 3300025912 | Bacteria | 14288 |
| 590 | Ga0207707_10024667 | 3300025912 | Bacteria | 5263 |
| 591 | Ga0207707_10026242 | 3300025912 | Bacteria | 5093 |
| 592 | Ga0207707_10026472 | 3300025912 | Bacteria | 5069 |
| 593 | Ga0207707_10039734 | 3300025912 | Bacteria | 4112 |
| 594 | Ga0207707_10045217 | 3300025912 | Bacteria | 3837 |
| 595 | Ga0207707_10048264 | 3300025912 | Bacteria | 3708 |
| 596 | Ga0207707_10126952 | 3300025912 | Bacteria | 2231 |
| 597 | Ga0207707_10158819 | 3300025912 | Bacteria | 1977 |
| 598 | Ga0207707_10241244 | 3300025912 | Bacteria | 1571 |
| 599 | Ga0207695_10000824 | 3300025913 | Bacteria | 57448 |
| 600 | Ga0207695_10002609 | 3300025913 | Bacteria | 26412 |
| 601 | Ga0207695_10022198 | 3300025913 | Bacteria | 7217 |
| 602 | Ga0207695_10107870 | 3300025913 | Bacteria | 2770 |
| 603 | Ga0207671_10092027 | 3300025914 | Bacteria | 2286 |
| 604 | Ga0207693_10010681 | 3300025915 | Bacteria | 7453 |
| 605 | Ga0207693_10042228 | 3300025915 | Bacteria | 3590 |
| 606 | Ga0207693_10234453 | 3300025915 | Bacteria | 1441 |
| 607 | Ga0207663_10000086 | 3300025916 | Bacteria | 44126 |
| 608 | Ga0207663_10115754 | 3300025916 | Bacteria | 1827 |
| 609 | Ga0207660_10000035 | 3300025917 | Bacteria | 65610 |
| 610 | Ga0207660_10006296 | 3300025917 | Bacteria | 7698 |
| 611 | Ga0207660_10007581 | 3300025917 | Bacteria | 7023 |
| 612 | Ga0207660_10009333 | 3300025917 | Bacteria | 6350 |
| 613 | Ga0207660_10023410 | 3300025917 | Bacteria | 4171 |
| 614 | Ga0207660_10027246 | 3300025917 | Bacteria | 3897 |
| 615 | Ga0207660_10066551 | 3300025917 | Bacteria | 2607 |
| 616 | Ga0207660_10089981 | 3300025917 | Bacteria | 2273 |
| 617 | Ga0207660_10113576 | 3300025917 | Bacteria | 2042 |
| 618 | Ga0207660_10126494 | 3300025917 | Bacteria | 1941 |
| 619 | Ga0207660_10142869 | 3300025917 | Bacteria | 1831 |
| 620 | Ga0207660_10174662 | 3300025917 | Bacteria | 1665 |
| 621 | Ga0207660_10210764 | 3300025917 | Bacteria | 1521 |
| 622 | Ga0207662_10005756 | 3300025918 | Bacteria | 6633 |
| 623 | Ga0207662_10063035 | 3300025918 | Bacteria | 2229 |
| 624 | Ga0207662_10106890 | 3300025918 | Bacteria | 1741 |
| 625 | Ga0207657_10004320 | 3300025919 | Bacteria | 15059 |
| 626 | Ga0207657_10008543 | 3300025919 | Bacteria | 10382 |
| 627 | Ga0207657_10017905 | 3300025919 | Bacteria | 6778 |
| 628 | Ga0207657_10023091 | 3300025919 | Bacteria | 5800 |
| 629 | Ga0207657_10050505 | 3300025919 | Bacteria | 3620 |
| 630 | Ga0207657_10371924 | 3300025919 | Bacteria | 1126 |
| 631 | Ga0207649_10000422 | 3300025920 | Bacteria | 31054 |
| 632 | Ga0207649_10009822 | 3300025920 | Bacteria | 5244 |
| 633 | Ga0207649_10013088 | 3300025920 | Bacteria | 4626 |
| 634 | Ga0207649_10014915 | 3300025920 | Bacteria | 4360 |
| 635 | Ga0207652_10000609 | 3300025921 | Bacteria | 35652 |
| 636 | Ga0207652_10001738 | 3300025921 | Bacteria | 19002 |
| 637 | Ga0207652_10003988 | 3300025921 | Bacteria | 12063 |
| 638 | Ga0207652_10023620 | 3300025921 | Bacteria | 5095 |
| 639 | Ga0207652_10035781 | 3300025921 | Bacteria | 4194 |
| 640 | Ga0207652_10044607 | 3300025921 | Bacteria | 3778 |
| 641 | Ga0207652_10046587 | 3300025921 | Bacteria | 3700 |
| 642 | Ga0207652_10049770 | 3300025921 | Bacteria | 3588 |
| 643 | Ga0207652_10093481 | 3300025921 | Bacteria | 2646 |
| 644 | Ga0207652_10113107 | 3300025921 | Bacteria | 2409 |
| 645 | Ga0207652_10119150 | 3300025921 | Bacteria | 2347 |
| 646 | Ga0207652_10147589 | 3300025921 | Bacteria | 2105 |
| 647 | Ga0207652_10205776 | 3300025921 | Bacteria | 1771 |
| 648 | Ga0207652_10208663 | 3300025921 | Bacteria | 1758 |
| 649 | Ga0207652_10408343 | 3300025921 | Bacteria | 1225 |
| 650 | Ga0207646_10002881 | 3300025922 | Bacteria | 19958 |
| 651 | Ga0207646_10008799 | 3300025922 | Bacteria | 10074 |
| 652 | Ga0207646_10012044 | 3300025922 | Bacteria | 8330 |
| 653 | Ga0207646_10035407 | 3300025922 | Bacteria | 4509 |
| 654 | Ga0207646_10068609 | 3300025922 | Bacteria | 3167 |
| 655 | Ga0207646_10269466 | 3300025922 | Bacteria | 1539 |
| 656 | Ga0207681_10000537 | 3300025923 | Bacteria | 26181 |
| 657 | Ga0207681_10009827 | 3300025923 | Bacteria | 5850 |
| 658 | Ga0207681_10013509 | 3300025923 | Bacteria | 5056 |
| 659 | Ga0207681_10022498 | 3300025923 | Bacteria | 4021 |
| 660 | Ga0207694_10000007 | 3300025924 | Bacteria | 595422 |
| 661 | Ga0207694_10024190 | 3300025924 | Bacteria | 4611 |
| 662 | Ga0207650_10027143 | 3300025925 | Bacteria | 4095 |
| 663 | Ga0207650_10027664 | 3300025925 | Bacteria | 4060 |
| 664 | Ga0207650_10036278 | 3300025925 | Bacteria | 3586 |
| 665 | Ga0207659_10037058 | 3300025926 | Bacteria | 3383 |
| 666 | Ga0207659_10040111 | 3300025926 | Bacteria | 3271 |
| 667 | Ga0207659_10049707 | 3300025926 | Bacteria | 2975 |
| 668 | Ga0207659_10075629 | 3300025926 | Bacteria | 2472 |
| 669 | Ga0207659_10085950 | 3300025926 | Bacteria | 2338 |
| 670 | Ga0207659_10153841 | 3300025926 | Bacteria | 1798 |
| 671 | Ga0207687_10061485 | 3300025927 | Bacteria | 2652 |
| 672 | Ga0207664_10007042 | 3300025929 | Bacteria | 7791 |
| 673 | Ga0207664_10022408 | 3300025929 | Bacteria | 4716 |
| 674 | Ga0207664_10160503 | 3300025929 | Bacteria | 1917 |
| 675 | Ga0207644_10009253 | 3300025931 | Bacteria | 6463 |
| 676 | Ga0207644_10102521 | 3300025931 | Bacteria | 2152 |
| 677 | Ga0207690_10031285 | 3300025932 | Bacteria | 3403 |
| 678 | Ga0207690_10056130 | 3300025932 | Bacteria | 2655 |
| 679 | Ga0207690_10153660 | 3300025932 | Bacteria | 1708 |
| 680 | Ga0207690_10226554 | 3300025932 | Bacteria | 1433 |
| 681 | Ga0207706_10000055 | 3300025933 | Bacteria | 114144 |
| 682 | Ga0207706_10000116 | 3300025933 | Bacteria | 85356 |
| 683 | Ga0207706_10004147 | 3300025933 | Bacteria | 13662 |
| 684 | Ga0207706_10005574 | 3300025933 | Bacteria | 11731 |
| 685 | Ga0207706_10029722 | 3300025933 | Bacteria | 4877 |
| 686 | Ga0207706_10067044 | 3300025933 | Bacteria | 3158 |
| 687 | Ga0207706_10134032 | 3300025933 | Bacteria | 2179 |
| 688 | Ga0207706_10170997 | 3300025933 | Bacteria | 1909 |
| 689 | Ga0207686_10000621 | 3300025934 | Bacteria | 22058 |
| 690 | Ga0207686_10036441 | 3300025934 | Bacteria | 2962 |
| 691 | Ga0207686_10067885 | 3300025934 | Bacteria | 2282 |
| 692 | Ga0207686_10098938 | 3300025934 | Bacteria | 1943 |
| 693 | Ga0207709_10001211 | 3300025935 | Bacteria | 18545 |
| 694 | Ga0207709_10167078 | 3300025935 | Bacteria | 1541 |
| 695 | Ga0207709_10207934 | 3300025935 | Bacteria | 1402 |
| 696 | Ga0207670_10036402 | 3300025936 | Bacteria | 3200 |
| 697 | Ga0207670_10272360 | 3300025936 | Bacteria | 1316 |
| 698 | Ga0207669_10005007 | 3300025937 | Bacteria | 5892 |
| 699 | Ga0207669_10055517 | 3300025937 | Bacteria | 2399 |
| 700 | Ga0207669_10070325 | 3300025937 | Bacteria | 2194 |
| 701 | Ga0207669_10114956 | 3300025937 | Bacteria | 1813 |
| 702 | Ga0207704_10002778 | 3300025938 | Bacteria | 7899 |
| 703 | Ga0207704_10010731 | 3300025938 | Bacteria | 4482 |
| 704 | Ga0207704_10054867 | 3300025938 | Bacteria | 2432 |
| 705 | Ga0207665_10024529 | 3300025939 | Bacteria | 3977 |
| 706 | Ga0207691_10000129 | 3300025940 | Bacteria | 69176 |
| 707 | Ga0207691_10004042 | 3300025940 | Bacteria | 14222 |
| 708 | Ga0207691_10027758 | 3300025940 | Bacteria | 5305 |
| 709 | Ga0207691_10037433 | 3300025940 | Bacteria | 4493 |
| 710 | Ga0207691_10037824 | 3300025940 | Bacteria | 4467 |
| 711 | Ga0207691_10061175 | 3300025940 | Bacteria | 3421 |
| 712 | Ga0207691_10103722 | 3300025940 | Bacteria | 2535 |
| 713 | Ga0207691_10104846 | 3300025940 | Bacteria | 2519 |
| 714 | Ga0207691_10106620 | 3300025940 | Bacteria | 2495 |
| 715 | Ga0207691_10202398 | 3300025940 | Bacteria | 1727 |
| 716 | Ga0207711_10001868 | 3300025941 | Bacteria | 19198 |
| 717 | Ga0207711_10024068 | 3300025941 | Bacteria | 5097 |
| 718 | Ga0207711_10047223 | 3300025941 | Bacteria | 3680 |
| 719 | Ga0207711_10068303 | 3300025941 | Bacteria | 3078 |
| 720 | Ga0207711_10121032 | 3300025941 | Bacteria | 2336 |
| 721 | Ga0207689_10003669 | 3300025942 | Bacteria | 13999 |
| 722 | Ga0207689_10031774 | 3300025942 | Bacteria | 4391 |
| 723 | Ga0207689_10043643 | 3300025942 | Bacteria | 3706 |
| 724 | Ga0207689_10134896 | 3300025942 | Bacteria | 2033 |
| 725 | Ga0207661_10004017 | 3300025944 | Bacteria | 10287 |
| 726 | Ga0207661_10005197 | 3300025944 | Bacteria | 9151 |
| 727 | Ga0207661_10007276 | 3300025944 | Bacteria | 7876 |
| 728 | Ga0207661_10015415 | 3300025944 | Bacteria | 5623 |
| 729 | Ga0207661_10020678 | 3300025944 | Bacteria | 4924 |
| 730 | Ga0207661_10026394 | 3300025944 | Bacteria | 4426 |
| 731 | Ga0207661_10175794 | 3300025944 | Bacteria | 1866 |
| 732 | Ga0207661_10234972 | 3300025944 | Bacteria | 1625 |
| 733 | Ga0207679_10000382 | 3300025945 | Bacteria | 31883 |
| 734 | Ga0207679_10001463 | 3300025945 | Bacteria | 14789 |
| 735 | Ga0207679_10011578 | 3300025945 | Bacteria | 5722 |
| 736 | Ga0207679_10050243 | 3300025945 | Bacteria | 3045 |
| 737 | Ga0207679_10056727 | 3300025945 | Bacteria | 2893 |
| 738 | Ga0207679_10087046 | 3300025945 | Bacteria | 2404 |
| 739 | Ga0207679_10129486 | 3300025945 | Bacteria | 2022 |
| 740 | Ga0207679_10196192 | 3300025945 | Bacteria | 1683 |
| 741 | Ga0207679_10211673 | 3300025945 | Bacteria | 1626 |
| 742 | Ga0207679_10278175 | 3300025945 | Bacteria | 1434 |
| 743 | Ga0207667_10001972 | 3300025949 | Bacteria | 25704 |
| 744 | Ga0207667_10026735 | 3300025949 | Bacteria | 6297 |
| 745 | Ga0207667_10112701 | 3300025949 | Bacteria | 2805 |
| 746 | Ga0207667_10159242 | 3300025949 | Bacteria | 2323 |
| 747 | Ga0207667_10302464 | 3300025949 | Bacteria | 1634 |
| 748 | Ga0207651_10034842 | 3300025960 | Bacteria | 3265 |
| 749 | Ga0207651_10080830 | 3300025960 | Bacteria | 2341 |
| 750 | Ga0207651_10161516 | 3300025960 | Bacteria | 1757 |
| 751 | Ga0207651_10235608 | 3300025960 | Bacteria | 1489 |
| 752 | Ga0207651_10247154 | 3300025960 | Bacteria | 1457 |
| 753 | Ga0207712_10000568 | 3300025961 | Bacteria | 29835 |
| 754 | Ga0207712_10000920 | 3300025961 | Bacteria | 21293 |
| 755 | Ga0207712_10001023 | 3300025961 | Bacteria | 19837 |
| 756 | Ga0207712_10003424 | 3300025961 | Bacteria | 10027 |
| 757 | Ga0207712_10016554 | 3300025961 | Bacteria | 4777 |
| 758 | Ga0207712_10071192 | 3300025961 | Bacteria | 2500 |
| 759 | Ga0207668_10019781 | 3300025972 | Bacteria | 4263 |
| 760 | Ga0207668_10032208 | 3300025972 | Bacteria | 3461 |
| 761 | Ga0207668_10067976 | 3300025972 | Bacteria | 2531 |
| 762 | Ga0207668_10103554 | 3300025972 | Bacteria | 2120 |
| 763 | Ga0207668_10165909 | 3300025972 | Bacteria | 1726 |
| 764 | Ga0207640_10000266 | 3300025981 | Bacteria | 35167 |
| 765 | Ga0207658_10036784 | 3300025986 | Bacteria | 3512 |
| 766 | Ga0207658_10107644 | 3300025986 | Bacteria | 2197 |
| 767 | Ga0207658_10167698 | 3300025986 | Bacteria | 1806 |
| 768 | Ga0207658_10199911 | 3300025986 | Bacteria | 1668 |
| 769 | Ga0207658_10414093 | 3300025986 | Bacteria | 1187 |
| 770 | Ga0207677_10056609 | 3300026023 | Bacteria | 2687 |
| 771 | Ga0207703_10063190 | 3300026035 | Bacteria | 3035 |
| 772 | Ga0207703_10318713 | 3300026035 | Bacteria | 1423 |
| 773 | Ga0207639_10042397 | 3300026041 | Bacteria | 3410 |
| 774 | Ga0207639_10046480 | 3300026041 | Bacteria | 3276 |
| 775 | Ga0207639_10051298 | 3300026041 | Bacteria | 3137 |
| 776 | Ga0207639_10118134 | 3300026041 | Bacteria | 2174 |
| 777 | Ga0207678_10000997 | 3300026067 | Bacteria | 25795 |
| 778 | Ga0207678_10322975 | 3300026067 | Bacteria | 1328 |
| 779 | Ga0207708_10017949 | 3300026075 | Bacteria | 5323 |
| 780 | Ga0207708_10024447 | 3300026075 | Bacteria | 4569 |
| 781 | Ga0207708_10040758 | 3300026075 | Bacteria | 3541 |
| 782 | Ga0207702_10012826 | 3300026078 | Bacteria | 6972 |
| 783 | Ga0207702_10177516 | 3300026078 | Bacteria | 1958 |
| 784 | Ga0207702_10563192 | 3300026078 | Bacteria | 1115 |
| 785 | Ga0207641_10007222 | 3300026088 | Bacteria | 9257 |
| 786 | Ga0207641_10023120 | 3300026088 | Bacteria | 5122 |
| 787 | Ga0207648_10000168 | 3300026089 | Bacteria | 67700 |
| 788 | Ga0207648_10019374 | 3300026089 | Bacteria | 6142 |
| 789 | Ga0207648_10034353 | 3300026089 | Bacteria | 4470 |
| 790 | Ga0207648_10089068 | 3300026089 | Bacteria | 2695 |
| 791 | Ga0207648_10107066 | 3300026089 | Bacteria | 2454 |
| 792 | Ga0207648_10110611 | 3300026089 | Bacteria | 2412 |
| 793 | Ga0207648_10277181 | 3300026089 | Bacteria | 1499 |
| 794 | Ga0207676_10003052 | 3300026095 | Bacteria | 11949 |
| 795 | Ga0207676_10010017 | 3300026095 | Bacteria | 6745 |
| 796 | Ga0207676_10027749 | 3300026095 | Bacteria | 4221 |
| 797 | Ga0207676_10072208 | 3300026095 | Bacteria | 2773 |
| 798 | Ga0207676_10109037 | 3300026095 | Bacteria | 2313 |
| 799 | Ga0207676_10142137 | 3300026095 | Bacteria | 2056 |
| 800 | Ga0207676_10328035 | 3300026095 | Bacteria | 1407 |
| 801 | Ga0207674_10000096 | 3300026116 | Bacteria | 98870 |
| 802 | Ga0207674_10001035 | 3300026116 | Bacteria | 36267 |
| 803 | Ga0207674_10002037 | 3300026116 | Bacteria | 25651 |
| 804 | Ga0207674_10026295 | 3300026116 | Bacteria | 6186 |
| 805 | Ga0207674_10162407 | 3300026116 | Bacteria | 2188 |
| 806 | Ga0207674_10260232 | 3300026116 | Bacteria | 1682 |
| 807 | Ga0207675_100000073 | 3300026118 | Bacteria | 76959 |
| 808 | Ga0207675_100082219 | 3300026118 | Bacteria | 3020 |
| 809 | Ga0207675_100127371 | 3300026118 | Bacteria | 2413 |
| 810 | Ga0207675_100223187 | 3300026118 | Bacteria | 1816 |
| 811 | Ga0207675_100248533 | 3300026118 | Bacteria | 1721 |
| 812 | Ga0207675_100279281 | 3300026118 | Bacteria | 1622 |
| 813 | Ga0207675_100306757 | 3300026118 | Bacteria | 1547 |
| 814 | Ga0207683_10009858 | 3300026121 | Bacteria | 8148 |
| 815 | Ga0207683_10064189 | 3300026121 | Bacteria | 3236 |
| 816 | Ga0207698_10004945 | 3300026142 | Bacteria | 8168 |
| 817 | Ga0207698_10009882 | 3300026142 | Bacteria | 6102 |
| 818 | Ga0207698_10263876 | 3300026142 | Bacteria | 1583 |
| 819 | Ga0207698_10328043 | 3300026142 | Bacteria | 1436 |
| 820 | Ga0209996_1004696 | 3300027395 | Bacteria | 1742 |
| 821 | Ga0209995_1009876 | 3300027471 | Bacteria | 1546 |
| 822 | Ga0209968_1001462 | 3300027526 | Bacteria | 3587 |
| 823 | Ga0209999_1002452 | 3300027543 | Bacteria | 3278 |
| 824 | Ga0209999_1002844 | 3300027543 | Bacteria | 3068 |
| 825 | Ga0209588_1000994 | 3300027671 | Bacteria | 7282 |
| 826 | Ga0209588_1001408 | 3300027671 | Bacteria | 6269 |
| 827 | Ga0209971_1028568 | 3300027682 | Bacteria | 1335 |
| 828 | Ga0209998_10002222 | 3300027717 | Bacteria | 4497 |
| 829 | Ga0209998_10008358 | 3300027717 | Bacteria | 2144 |
| 830 | Ga0209974_10041763 | 3300027876 | Bacteria | 1527 |
| 831 | Ga0207428_10041933 | 3300027907 | Bacteria | 3703 |
| 832 | Ga0268265_10001598 | 3300028380 | Bacteria | 18718 |
| 833 | Ga0268265_10014095 | 3300028380 | Bacteria | 5448 |
| 834 | Ga0268265_10037581 | 3300028380 | Bacteria | 3555 |
| 835 | Ga0268265_10069091 | 3300028380 | Bacteria | 2742 |
| 836 | Ga0268265_10207097 | 3300028380 | Bacteria | 1706 |
| 837 | Ga0268264_10011258 | 3300028381 | Bacteria | 7392 |
| 838 | Ga0268264_10015480 | 3300028381 | Bacteria | 6252 |
| 839 | Ga0268264_10067016 | 3300028381 | Bacteria | 3029 |
| 840 | Ga0265332_10033758 | 3300031238 | Bacteria | 2226 |
| 841 | Ga0265332_10043995 | 3300031238 | Bacteria | 1927 |
| 842 | Ga0307408_100002866 | 3300031548 | Bacteria | 11950 |
| 843 | Ga0307408_100013069 | 3300031548 | Bacteria | 5510 |
| 844 | Ga0307408_100042568 | 3300031548 | Bacteria | 3227 |
| 845 | Ga0307408_100079342 | 3300031548 | Bacteria | 2449 |
| 846 | Ga0307408_100085978 | 3300031548 | Bacteria | 2363 |
| 847 | Ga0307408_100096700 | 3300031548 | Bacteria | 2241 |
| 848 | Ga0307408_100111705 | 3300031548 | Bacteria | 2100 |
| 849 | Ga0307408_100119478 | 3300031548 | Bacteria | 2039 |
| 850 | Ga0307408_100185856 | 3300031548 | Bacteria | 1670 |
| 851 | Ga0307408_100216672 | 3300031548 | Bacteria | 1560 |
| 852 | Ga0307408_100392721 | 3300031548 | Bacteria | 1189 |
| 853 | Ga0316575_10000708 | 3300031665 | Bacteria | 9970 |
| 854 | Ga0316579_10017603 | 3300031691 | Bacteria | 3135 |
| 855 | Ga0316579_10026974 | 3300031691 | Bacteria | 2605 |
| 856 | Ga0265314_10023982 | 3300031711 | Bacteria | 4636 |
| 857 | Ga0316576_10002854 | 3300031727 | Bacteria | 9961 |
| 858 | Ga0316576_10025589 | 3300031727 | Bacteria | 4134 |
| 859 | Ga0316576_10027763 | 3300031727 | Bacteria | 3980 |
| 860 | Ga0316576_10073020 | 3300031727 | Bacteria | 2534 |
| 861 | Ga0316576_10085709 | 3300031727 | Bacteria | 2341 |
| 862 | Ga0316576_10092063 | 3300031727 | Bacteria | 2259 |
| 863 | Ga0316578_10000354 | 3300031728 | Bacteria | 14516 |
| 864 | Ga0316578_10008357 | 3300031728 | Bacteria | 5263 |
| 865 | Ga0316578_10031288 | 3300031728 | Bacteria | 3031 |
| 866 | Ga0316578_10077790 | 3300031728 | Bacteria | 1970 |
| 867 | Ga0316578_10084370 | 3300031728 | Bacteria | 1892 |
| 868 | Ga0307405_10000394 | 3300031731 | Bacteria | 16368 |
| 869 | Ga0307405_10002899 | 3300031731 | Bacteria | 7722 |
| 870 | Ga0307405_10022437 | 3300031731 | Bacteria | 3569 |
| 871 | Ga0307405_10028888 | 3300031731 | Bacteria | 3235 |
| 872 | Ga0307405_10043695 | 3300031731 | Bacteria | 2736 |
| 873 | Ga0307405_10175055 | 3300031731 | Bacteria | 1535 |
| 874 | Ga0307405_10193380 | 3300031731 | Bacteria | 1471 |
| 875 | Ga0307405_10363667 | 3300031731 | Bacteria | 1120 |
| 876 | Ga0307405_10365559 | 3300031731 | Bacteria | 1118 |
| 877 | Ga0316577_10001110 | 3300031733 | Bacteria | 12260 |
| 878 | Ga0316577_10016655 | 3300031733 | Bacteria | 4055 |
| 879 | Ga0316577_10040812 | 3300031733 | Bacteria | 2595 |
| 880 | Ga0316577_10051699 | 3300031733 | Bacteria | 2292 |
| 881 | Ga0307413_10002977 | 3300031824 | Bacteria | 7015 |
| 882 | Ga0307413_10005323 | 3300031824 | Bacteria | 5729 |
| 883 | Ga0307413_10013697 | 3300031824 | Bacteria | 4089 |
| 884 | Ga0307413_10015127 | 3300031824 | Bacteria | 3945 |
| 885 | Ga0307413_10016161 | 3300031824 | Bacteria | 3845 |
| 886 | Ga0307413_10018129 | 3300031824 | Bacteria | 3685 |
| 887 | Ga0307413_10028408 | 3300031824 | Bacteria | 3115 |
| 888 | Ga0307413_10110760 | 3300031824 | Bacteria | 1837 |
| 889 | Ga0307410_10000662 | 3300031852 | Bacteria | 14250 |
| 890 | Ga0307410_10001342 | 3300031852 | Bacteria | 11027 |
| 891 | Ga0307410_10004088 | 3300031852 | Bacteria | 7470 |
| 892 | Ga0307410_10027491 | 3300031852 | Bacteria | 3596 |
| 893 | Ga0307410_10041722 | 3300031852 | Bacteria | 3027 |
| 894 | Ga0307410_10064132 | 3300031852 | Bacteria | 2523 |
| 895 | Ga0307410_10092857 | 3300031852 | Bacteria | 2146 |
| 896 | Ga0307410_10093376 | 3300031852 | Bacteria | 2141 |
| 897 | Ga0307410_10110446 | 3300031852 | Bacteria | 1989 |
| 898 | Ga0307406_10002048 | 3300031901 | Bacteria | 11012 |
| 899 | Ga0307406_10010808 | 3300031901 | Bacteria | 5158 |
| 900 | Ga0307406_10019353 | 3300031901 | Bacteria | 3994 |
| 901 | Ga0307406_10023303 | 3300031901 | Bacteria | 3682 |
| 902 | Ga0307406_10026506 | 3300031901 | Bacteria | 3482 |
| 903 | Ga0307406_10040948 | 3300031901 | Bacteria | 2884 |
| 904 | Ga0307406_10066795 | 3300031901 | Bacteria | 2342 |
| 905 | Ga0307406_10187265 | 3300031901 | Bacteria | 1512 |
| 906 | Ga0307407_10000456 | 3300031903 | Bacteria | 12509 |
| 907 | Ga0307407_10003422 | 3300031903 | Bacteria | 6502 |
| 908 | Ga0307407_10019065 | 3300031903 | Bacteria | 3486 |
| 909 | Ga0307407_10025433 | 3300031903 | Bacteria | 3120 |
| 910 | Ga0307407_10053209 | 3300031903 | Bacteria | 2328 |
| 911 | Ga0307407_10062166 | 3300031903 | Bacteria | 2186 |
| 912 | Ga0307407_10068995 | 3300031903 | Bacteria | 2096 |
| 913 | Ga0307407_10074410 | 3300031903 | Bacteria | 2032 |
| 914 | Ga0307407_10149679 | 3300031903 | Bacteria | 1515 |
| 915 | Ga0307407_10177229 | 3300031903 | Bacteria | 1409 |
| 916 | Ga0307412_10005958 | 3300031911 | Bacteria | 6870 |
| 917 | Ga0307412_10017562 | 3300031911 | Bacteria | 4284 |
| 918 | Ga0307412_10029024 | 3300031911 | Bacteria | 3468 |
| 919 | Ga0307412_10054625 | 3300031911 | Bacteria | 2652 |
| 920 | Ga0307412_10212241 | 3300031911 | Bacteria | 1478 |
| 921 | Ga0307412_10212677 | 3300031911 | Bacteria | 1477 |
| 922 | Ga0307412_10217832 | 3300031911 | Bacteria | 1461 |
| 923 | Ga0307409_100000213 | 3300031995 | Bacteria | 23199 |
| 924 | Ga0307409_100004409 | 3300031995 | Bacteria | 7903 |
| 925 | Ga0307409_100008013 | 3300031995 | Bacteria | 6368 |
| 926 | Ga0307409_100012191 | 3300031995 | Bacteria | 5466 |
| 927 | Ga0307409_100015997 | 3300031995 | Bacteria | 4947 |
| 928 | Ga0307409_100025397 | 3300031995 | Bacteria | 4155 |
| 929 | Ga0307409_100026045 | 3300031995 | Bacteria | 4117 |
| 930 | Ga0307409_100028466 | 3300031995 | Bacteria | 3981 |
| 931 | Ga0307409_100069080 | 3300031995 | Bacteria | 2797 |
| 932 | Ga0307409_100080899 | 3300031995 | Bacteria | 2624 |
| 933 | Ga0307409_100105235 | 3300031995 | Bacteria | 2352 |
| 934 | Ga0307409_100114970 | 3300031995 | Bacteria | 2265 |
| 935 | Ga0307409_100125882 | 3300031995 | Bacteria | 2179 |
| 936 | Ga0307409_100128290 | 3300031995 | Bacteria | 2162 |
| 937 | Ga0307409_100223129 | 3300031995 | Bacteria | 1703 |
| 938 | Ga0307409_100228793 | 3300031995 | Bacteria | 1684 |
| 939 | Ga0307416_100000358 | 3300032002 | Bacteria | 23736 |
| 940 | Ga0307416_100004593 | 3300032002 | Bacteria | 8352 |
| 941 | Ga0307416_100008017 | 3300032002 | Bacteria | 6766 |
| 942 | Ga0307416_100010738 | 3300032002 | Bacteria | 6067 |
| 943 | Ga0307416_100011581 | 3300032002 | Bacteria | 5891 |
| 944 | Ga0307416_100015995 | 3300032002 | Bacteria | 5199 |
| 945 | Ga0307416_100073603 | 3300032002 | Bacteria | 2849 |
| 946 | Ga0307416_100099971 | 3300032002 | Bacteria | 2521 |
| 947 | Ga0307416_100106534 | 3300032002 | Bacteria | 2457 |
| 948 | Ga0307416_100191027 | 3300032002 | Bacteria | 1931 |
| 949 | Ga0307416_100226508 | 3300032002 | Bacteria | 1798 |
| 950 | Ga0307416_100561961 | 3300032002 | Bacteria | 1216 |
| 951 | Ga0307414_10001787 | 3300032004 | Bacteria | 11127 |
| 952 | Ga0307414_10024780 | 3300032004 | Bacteria | 3831 |
| 953 | Ga0307414_10027258 | 3300032004 | Bacteria | 3690 |
| 954 | Ga0307414_10036290 | 3300032004 | Bacteria | 3290 |
| 955 | Ga0307414_10059013 | 3300032004 | Bacteria | 2707 |
| 956 | Ga0307414_10089645 | 3300032004 | Bacteria | 2280 |
| 957 | Ga0307414_10131238 | 3300032004 | Bacteria | 1945 |
| 958 | Ga0307414_10137084 | 3300032004 | Bacteria | 1910 |
| 959 | Ga0307414_10139893 | 3300032004 | Bacteria | 1893 |
| 960 | Ga0307414_10199547 | 3300032004 | Bacteria | 1626 |
| 961 | Ga0307414_10238778 | 3300032004 | Bacteria | 1503 |
| 962 | Ga0307411_10001361 | 3300032005 | Bacteria | 9888 |
| 963 | Ga0307411_10006797 | 3300032005 | Bacteria | 5758 |
| 964 | Ga0307411_10017585 | 3300032005 | Bacteria | 4079 |
| 965 | Ga0307411_10021736 | 3300032005 | Bacteria | 3761 |
| 966 | Ga0307411_10044613 | 3300032005 | Bacteria | 2846 |
| 967 | Ga0307411_10049317 | 3300032005 | Bacteria | 2735 |
| 968 | Ga0307411_10060202 | 3300032005 | Bacteria | 2520 |
| 969 | Ga0307411_10140107 | 3300032005 | Bacteria | 1782 |
| 970 | Ga0307411_10263390 | 3300032005 | Bacteria | 1362 |
| 971 | Ga0307415_100005406 | 3300032126 | Bacteria | 6780 |
| 972 | Ga0307415_100009214 | 3300032126 | Bacteria | 5517 |
| 973 | Ga0307415_100014499 | 3300032126 | Bacteria | 4637 |
| 974 | Ga0307415_100020478 | 3300032126 | Bacteria | 4039 |
| 975 | Ga0307415_100021732 | 3300032126 | Bacteria | 3950 |
| 976 | Ga0307415_100037278 | 3300032126 | Bacteria | 3193 |
| 977 | Ga0307415_100128242 | 3300032126 | Bacteria | 1915 |
| 978 | Ga0307415_100133336 | 3300032126 | Bacteria | 1884 |
| 979 | Ga0307415_100191733 | 3300032126 | Bacteria | 1613 |
| 980 | Ga0307415_100258977 | 3300032126 | Bacteria | 1418 |
| 981 | Ga0316583_10000577 | 3300032133 | Bacteria | 11091 |
| 982 | Ga0316580_10013751 | 3300032139 | Bacteria | 2466 |
| 983 | Ga0373950_0006063 | 3300034818 | Bacteria | 1828 |
| 984 | Ga0373959_0000432 | 3300034820 | Bacteria | 8015 |
| 985 | Ga0373959_0004785 | 3300034820 | Bacteria | 2197 |
| 986 | Ga0373938_0017699 | 3300034957 | Bacteria | 1406 |
| 987 | Ga0373926_0019552 | 3300035083 | Bacteria | 2335 |
| 988 | Ga0373934_0000319 | 3300035086 | Bacteria | 16910 |
| 989 | Ga0373934_0002820 | 3300035086 | Bacteria | 6367 |
| 990 | Ga0373934_0009088 | 3300035086 | Bacteria | 3717 |
| 991 | Ga0373940_0008027 | 3300035088 | Bacteria | 2407 |
| 992 | Ga0373944_0022241 | 3300035089 | Bacteria | 1841 |
| 993 | Ga0373944_0052869 | 3300035089 | Bacteria | 1284 |
| 994 | Ga0373953_0023613 | 3300035117 | Bacteria | 2329 |
| 995 | Ga0373954_0003610 | 3300035118 | Bacteria | 6583 |
| 996 | Ga0373956_0011441 | 3300035119 | Bacteria | 3657 |
| 997 | Ga0373957_0053860 | 3300035120 | Bacteria | 1544 |
| 998 | Ga0373957_0121286 | 3300035120 | Bacteria | 1058 |
| 999 | Ga0373943_0000549 | 3300035170 | Bacteria | 16230 |
| 1000 | Ga0373943_0044911 | 3300035170 | Bacteria | 2151 |
| 1001 | Ga0373955_0000540 | 3300035172 | Bacteria | 16052 |
| 1002 | Ga0373955_0003972 | 3300035172 | Bacteria | 6529 |
| 1003 | Ga0373955_0011027 | 3300035172 | Bacteria | 4291 |
| 1004 | Ga0316574_0015867 | 3300035398 | Bacteria | 4377 |
| 1005 | Ga0316574_0025290 | 3300035398 | Bacteria | 3562 |
| 1006 | Ga0316574_0055042 | 3300035398 | Bacteria | 2486 |
| 1007 | Ga0373924_0091374 | 3300035410 | Bacteria | 1302 |
| 1008 | Ga0373924_0132030 | 3300035410 | Bacteria | 1087 |
| 1009 | Ga0373931_0011137 | 3300035691 | Bacteria | 4339 |
| 1010 | Ga0373931_0019052 | 3300035691 | Bacteria | 3420 |
| 1011 | Ga0373935_0004661 | 3300035692 | Bacteria | 8061 |
| 1012 | Ga0373927_0007244 | 3300035695 | Bacteria | 7525 |
| 1013 | Ga0373927_0076400 | 3300035695 | Bacteria | 2169 |
| 1014 | Ga0373933_0000499 | 3300035724 | Bacteria | 24433 |
| 1015 | Ga0373933_0006055 | 3300035724 | Bacteria | 6581 |
| 1016 | Ga0373947_0000580 | 3300035725 | Bacteria | 21452 |
| 1017 | Ga0373937_0001442 | 3300036401 | Bacteria | 19885 |
| 1018 | Ga0373937_0001736 | 3300036401 | Bacteria | 18330 |
| 1019 | Ga0373937_0034278 | 3300036401 | Bacteria | 4618 |
| 1020 | Ga0373937_0046957 | 3300036401 | Bacteria | 3950 |
| 1021 | Ga0373937_0063692 | 3300036401 | Bacteria | 3391 |
| 1022 | Ga0373937_0127509 | 3300036401 | Bacteria | 2375 |
| 1023 | Ga0316582_0072461 | 3300036647 | Bacteria | 2233 |
| 1024 | Ga0316582_0129643 | 3300036647 | Bacteria | 1693 |
| 1025 | Ga0316584_0004901 | 3300036712 | Bacteria | 8905 |
| 1026 | Ga0316584_0038181 | 3300036712 | Bacteria | 3571 |
| 1027 | Ga0316584_0209713 | 3300036712 | Bacteria | 1434 |
| 1028 | Ga0373925_0001431 | 3300037068 | Bacteria | 20677 |
| 1029 | Ga0373925_0072484 | 3300037068 | Bacteria | 2606 |
| 1030 | Ga0373925_0164240 | 3300037068 | Bacteria | 1750 |
| 1031 | Ga0373925_0287715 | 3300037068 | Bacteria | 1325 |
| 1032 | Ga0395899_0032220 | 3300037312 | Bacteria | 3938 |
| 1033 | Ga0395905_0046569 | 3300037471 | Bacteria | 4067 |
| 1034 | Ga0316581_0010550 | 3300037588 | Bacteria | 2565 |
| 1035 | Ga0436364_1446815 | 3300037853 | Bacteria | 11657 |
| 1036 | Ga0395901_0049273 | 3300038443 | Bacteria | 4376 |
| 1037 | Ga0395901_0078322 | 3300038443 | Bacteria | 3451 |
| 1038 | Ga0436365_0332204 | 3300039437 | Bacteria | 2683 |
| 1039 | Ga0439439_0007066 | 3300041406 | Bacteria | 2617 |
| 1040 | Ga0439457_022918 | 3300042014 | Bacteria | 1382 |
| 1041 | Ga0439462_0036350 | 3300042015 | Bacteria | 1311 |
| 1042 | Ga0450923_004990 | 3300042125 | Bacteria | 2118 |
| 1043 | Ga0451577_0000016 | 3300042876 | Bacteria | 531002 |
| 1044 | Ga0451577_0012754 | 3300042876 | Bacteria | 7883 |
| 1045 | Ga0451577_0164655 | 3300042876 | Bacteria | 1998 |
| 1046 | Ga0453683_0020096 | 3300044673 | Bacteria | 4269 |
| 1047 | Ga0453683_0049913 | 3300044673 | Bacteria | 2622 |
| 1048 | Ga0453683_0052131 | 3300044673 | Bacteria | 2562 |
| 1049 | Ga0453683_0102734 | 3300044673 | Bacteria | 1795 |
| 1050 | Ga0466965_0089429 | 3300044683 | Bacteria | 1565 |
| 1051 | Ga0466966_0036039 | 3300044684 | Bacteria | 3195 |
| 1052 | Ga0466961_0021024 | 3300044693 | Bacteria | 4199 |
| 1053 | Ga0453684_0000368 | 3300044712 | Bacteria | 185018 |
| 1054 | Ga0453684_0019321 | 3300044712 | Bacteria | 10381 |
| 1055 | Ga0453684_0270060 | 3300044712 | Bacteria | 1944 |
| 1056 | Ga0466957_0206407 | 3300044842 | Bacteria | 1292 |
| 1057 | Ga0466960_0192540 | 3300044901 | Bacteria | 1110 |
| 1058 | Ga0451576_0010003 | 3300045051 | Bacteria | 10931 |
| 1059 | Ga0451576_0018465 | 3300045051 | Bacteria | 7645 |
| 1060 | Ga0451576_0021204 | 3300045051 | Bacteria | 7063 |
| 1061 | Ga0451576_0033329 | 3300045051 | Bacteria | 5474 |
| 1062 | Ga0451576_0057044 | 3300045051 | Bacteria | 4083 |
| 1063 | Ga0451576_0076832 | 3300045051 | Bacteria | 3475 |
| 1064 | Ga0451576_0082509 | 3300045051 | Bacteria | 3343 |
| 1065 | Ga0451576_0293603 | 3300045051 | Bacteria | 1699 |
| 1066 | Ga0466958_0173464 | 3300045836 | Bacteria | 1366 |
| 1067 | Ga0466967_0080800 | 3300045976 | Bacteria | 2935 |
| 1068 | Ga0466967_0101799 | 3300045976 | Bacteria | 2626 |
| 1069 | Ga0466967_0103174 | 3300045976 | Bacteria | 2610 |
| 1070 | Ga0466967_0318726 | 3300045976 | Bacteria | 1499 |
| 1071 | Ga0495592_0009404 | 3300046454 | Bacteria | 7351 |
| 1072 | Ga0495603_0005008 | 3300046455 | Bacteria | 7925 |
| 1073 | Ga0495603_0011722 | 3300046455 | Bacteria | 5307 |
| 1074 | Ga0495603_0033808 | 3300046455 | Bacteria | 3076 |
| 1075 | Ga0495629_0070215 | 3300046459 | Bacteria | 2444 |
| 1076 | Ga0495629_0101203 | 3300046459 | Bacteria | 2011 |
| 1077 | Ga0495641_0025177 | 3300046461 | Bacteria | 2923 |
| 1078 | Ga0495651_0001411 | 3300046462 | Bacteria | 18653 |
| 1079 | Ga0495651_0009551 | 3300046462 | Bacteria | 7453 |
| 1080 | Ga0495651_0036788 | 3300046462 | Bacteria | 3811 |
| 1081 | Ga0495653_0008915 | 3300046463 | Bacteria | 8202 |
| 1082 | Ga0495653_0018299 | 3300046463 | Bacteria | 5693 |
| 1083 | Ga0495653_0065451 | 3300046463 | Bacteria | 2736 |
| 1084 | Ga0495580_0003447 | 3300046472 | Bacteria | 13470 |
| 1085 | Ga0495580_0073719 | 3300046472 | Bacteria | 2383 |
| 1086 | Ga0495580_0160105 | 3300046472 | Bacteria | 1558 |
| 1087 | Ga0495580_0242135 | 3300046472 | Bacteria | 1236 |
| 1088 | Ga0495582_0008456 | 3300046473 | Bacteria | 5679 |
| 1089 | Ga0495582_0100710 | 3300046473 | Bacteria | 1617 |
| 1090 | Ga0495639_0001681 | 3300046475 | Bacteria | 9825 |
| 1091 | Ga0495639_0005477 | 3300046475 | Bacteria | 5466 |
| 1092 | Ga0495664_0002618 | 3300046477 | Bacteria | 9679 |
| 1093 | Ga0495664_0005946 | 3300046477 | Bacteria | 6720 |
| 1094 | Ga0495664_0059152 | 3300046477 | Bacteria | 2281 |
| 1095 | Ga0495664_0173936 | 3300046477 | Bacteria | 1306 |
| 1096 | Ga0495594_0002309 | 3300046499 | Bacteria | 9931 |
| 1097 | Ga0495594_0008467 | 3300046499 | Bacteria | 5301 |
| 1098 | Ga0495608_0006333 | 3300046511 | Bacteria | 8395 |
| 1099 | Ga0495608_0019948 | 3300046511 | Bacteria | 4610 |
| 1100 | Ga0495608_0051142 | 3300046511 | Bacteria | 2739 |
| 1101 | Ga0495618_0019976 | 3300046514 | Bacteria | 4123 |
| 1102 | Ga0495618_0150938 | 3300046514 | Bacteria | 1484 |
| 1103 | Ga0495628_0006895 | 3300046516 | Bacteria | 9872 |
| 1104 | Ga0495628_0017832 | 3300046516 | Bacteria | 5893 |
| 1105 | Ga0495628_0038526 | 3300046516 | Bacteria | 3826 |
| 1106 | Ga0495628_0110015 | 3300046516 | Bacteria | 2120 |
| 1107 | Ga0495630_0005984 | 3300046517 | Bacteria | 8598 |
| 1108 | Ga0495630_0009425 | 3300046517 | Bacteria | 7019 |
| 1109 | Ga0495630_0010790 | 3300046517 | Bacteria | 6595 |
| 1110 | Ga0495630_0034688 | 3300046517 | Bacteria | 3768 |
| 1111 | Ga0495630_0174674 | 3300046517 | Bacteria | 1637 |
| 1112 | Ga0495630_0177150 | 3300046517 | Bacteria | 1625 |
| 1113 | Ga0495630_0180801 | 3300046517 | Bacteria | 1608 |
| 1114 | Ga0495643_0000008 | 3300046522 | Bacteria | 367010 |
| 1115 | Ga0495663_0056074 | 3300046525 | Bacteria | 1230 |
| 1116 | Ga0495666_0003940 | 3300046526 | Bacteria | 7504 |
| 1117 | Ga0495666_0010349 | 3300046526 | Bacteria | 4649 |
| 1118 | Ga0495642_0079883 | 3300046528 | Bacteria | 1376 |
| 1119 | Ga0495652_0000859 | 3300046529 | Bacteria | 35014 |
| 1120 | Ga0495652_0001382 | 3300046529 | Bacteria | 26986 |
| 1121 | Ga0495652_0015457 | 3300046529 | Bacteria | 6835 |
| 1122 | Ga0495652_0027043 | 3300046529 | Bacteria | 5059 |
| 1123 | Ga0495652_0233608 | 3300046529 | Bacteria | 1373 |
| 1124 | Ga0495665_0000677 | 3300046531 | Bacteria | 17457 |
| 1125 | Ga0495665_0018268 | 3300046531 | Bacteria | 3768 |
| 1126 | Ga0495665_0042870 | 3300046531 | Bacteria | 2407 |
| 1127 | Ga0495640_0009684 | 3300046533 | Bacteria | 7492 |
| 1128 | Ga0495640_0014353 | 3300046533 | Bacteria | 5998 |
| 1129 | Ga0495640_0072628 | 3300046533 | Bacteria | 2305 |
| 1130 | Ga0495640_0081970 | 3300046533 | Bacteria | 2144 |
| 1131 | Ga0495586_0001306 | 3300046535 | Bacteria | 13889 |
| 1132 | Ga0495586_0071020 | 3300046535 | Bacteria | 1902 |
| 1133 | Ga0495586_0113348 | 3300046535 | Bacteria | 1510 |
| 1134 | Ga0495587_0000360 | 3300046536 | Bacteria | 32695 |
| 1135 | Ga0495587_0001414 | 3300046536 | Bacteria | 15949 |
| 1136 | Ga0495587_0004216 | 3300046536 | Bacteria | 9515 |
| 1137 | Ga0495587_0031682 | 3300046536 | Bacteria | 3200 |
| 1138 | Ga0495587_0215635 | 3300046536 | Bacteria | 1083 |
| 1139 | Ga0495645_0001196 | 3300046543 | Bacteria | 17732 |
| 1140 | Ga0495645_0001984 | 3300046543 | Bacteria | 13903 |
| 1141 | Ga0495645_0017482 | 3300046543 | Bacteria | 5138 |
| 1142 | Ga0495645_0177035 | 3300046543 | Bacteria | 1464 |
| 1143 | Ga0495667_0004915 | 3300046559 | Bacteria | 9039 |
| 1144 | Ga0495667_0013907 | 3300046559 | Bacteria | 5434 |
| 1145 | Ga0495667_0092353 | 3300046559 | Bacteria | 1960 |
| 1146 | Ga0495634_0006940 | 3300046642 | Bacteria | 8553 |
| 1147 | Ga0495634_0028041 | 3300046642 | Bacteria | 3912 |
| 1148 | Ga0495634_0226603 | 3300046642 | Bacteria | 1151 |
| 1149 | Ga0495635_0000299 | 3300046663 | Bacteria | 31934 |
| 1150 | Ga0495635_0005634 | 3300046663 | Bacteria | 8726 |
| 1151 | Ga0495635_0126716 | 3300046663 | Bacteria | 1741 |
| 1152 | Ga0495659_0004294 | 3300046664 | Bacteria | 4491 |
| 1153 | Ga0495588_0000514 | 3300046674 | Bacteria | 18704 |
| 1154 | Ga0495657_0003790 | 3300046675 | Bacteria | 12230 |
| 1155 | Ga0495657_0023341 | 3300046675 | Bacteria | 4421 |
| 1156 | Ga0495599_0000395 | 3300046678 | Bacteria | 24958 |
| 1157 | Ga0495599_0195546 | 3300046678 | Bacteria | 1243 |
| 1158 | Ga0495623_0002015 | 3300046679 | Bacteria | 13636 |
| 1159 | Ga0495623_0008673 | 3300046679 | Bacteria | 6602 |
| 1160 | Ga0495623_0035931 | 3300046679 | Bacteria | 3175 |
| 1161 | Ga0495623_0051600 | 3300046679 | Bacteria | 2601 |
| 1162 | Ga0495623_0052477 | 3300046679 | Bacteria | 2576 |
| 1163 | Ga0495646_0002501 | 3300046680 | Bacteria | 11286 |
| 1164 | Ga0495646_0022846 | 3300046680 | Bacteria | 3940 |
| 1165 | Ga0495647_0003603 | 3300046681 | Bacteria | 4968 |
| 1166 | Ga0495658_0001660 | 3300046683 | Bacteria | 11572 |
| 1167 | Ga0495658_0007314 | 3300046683 | Bacteria | 5458 |
| 1168 | Ga0495658_0063924 | 3300046683 | Bacteria | 2119 |
| 1169 | Ga0495613_0020546 | 3300046689 | Bacteria | 4922 |
| 1170 | Ga0495613_0028351 | 3300046689 | Bacteria | 4163 |
| 1171 | Ga0495613_0039747 | 3300046689 | Bacteria | 3487 |
| 1172 | Ga0495613_0047188 | 3300046689 | Bacteria | 3182 |
| 1173 | Ga0495624_0114461 | 3300046690 | Bacteria | 1658 |
| 1174 | Ga0495600_0000095 | 3300046809 | Bacteria | 48392 |
| 1175 | Ga0495600_0006625 | 3300046809 | Bacteria | 7056 |
| 1176 | Ga0495600_0083341 | 3300046809 | Bacteria | 2087 |
| 1177 | Ga0495581_0000585 | 3300047315 | Bacteria | 19041 |
| 1178 | Ga0495581_0022877 | 3300047315 | Bacteria | 3620 |
| 1179 | Ga0495581_0058709 | 3300047315 | Bacteria | 2222 |
| 1180 | Ga0495604_0003090 | 3300047317 | Bacteria | 13320 |
| 1181 | Ga0495604_0006235 | 3300047317 | Bacteria | 9461 |
| 1182 | Ga0495604_0112329 | 3300047317 | Bacteria | 1985 |
| 1183 | Ga0495604_0116233 | 3300047317 | Bacteria | 1943 |
| 1184 | Ga0495604_0258970 | 3300047317 | Bacteria | 1183 |
| 1185 | Ga0495674_0000884 | 3300047319 | Bacteria | 28750 |
| 1186 | Ga0495674_0003021 | 3300047319 | Bacteria | 16377 |
| 1187 | Ga0495674_0013476 | 3300047319 | Bacteria | 7688 |
| 1188 | Ga0495672_0007178 | 3300047320 | Bacteria | 8423 |
| 1189 | Ga0495676_0074643 | 3300047321 | Bacteria | 2596 |
| 1190 | Ga0495676_0134295 | 3300047321 | Bacteria | 1782 |
| 1191 | Ga0495680_0002867 | 3300047322 | Bacteria | 17322 |
| 1192 | Ga0495680_0074369 | 3300047322 | Bacteria | 2580 |
| 1193 | Ga0495675_0031956 | 3300047444 | Bacteria | 3361 |
| 1194 | Ga0495684_0000800 | 3300047471 | Bacteria | 25586 |
| 1195 | Ga0495684_0023090 | 3300047471 | Bacteria | 4784 |
| 1196 | Ga0495684_0031147 | 3300047471 | Bacteria | 4094 |
| 1197 | Ga0495684_0128965 | 3300047471 | Bacteria | 1901 |
| 1198 | Ga0495684_0145926 | 3300047471 | Bacteria | 1772 |
| 1199 | Ga0495684_0182833 | 3300047471 | Bacteria | 1553 |
| 1200 | Ga0495593_0000691 | 3300047673 | Bacteria | 19474 |
| 1201 | Ga0495593_0061810 | 3300047673 | Bacteria | 1959 |
| 1202 | Ga0495593_0107661 | 3300047673 | Bacteria | 1425 |
| 1203 | Ga0495602_0016778 | 3300048088 | Bacteria | 7353 |
| 1204 | Ga0495602_0022463 | 3300048088 | Bacteria | 6174 |
| 1205 | Ga0495602_0025919 | 3300048088 | Bacteria | 5666 |
| 1206 | Ga0495614_0028389 | 3300048089 | Bacteria | 2410 |
| 1207 | Ga0496100_0175879 | 3300048903 | Bacteria | 1545 |
| 1208 | Ga0496101_0062284 | 3300048904 | Bacteria | 2712 |
| 1209 | Ga0496101_0183323 | 3300048904 | Bacteria | 1613 |
| 1210 | Ga0496102_0026559 | 3300048905 | Bacteria | 5166 |
| 1211 | Ga0496102_0032086 | 3300048905 | Bacteria | 4718 |
| 1212 | Ga0496102_0191323 | 3300048905 | Bacteria | 1928 |
| 1213 | Ga0496103_0063986 | 3300048906 | Bacteria | 2292 |
| 1214 | Ga0496104_0007186 | 3300048907 | Bacteria | 9819 |
| 1215 | Ga0496104_0014815 | 3300048907 | Bacteria | 7047 |
| 1216 | Ga0496104_0015208 | 3300048907 | Bacteria | 6967 |
| 1217 | Ga0496104_0031225 | 3300048907 | Bacteria | 4953 |
| 1218 | Ga0496104_0226698 | 3300048907 | Bacteria | 1781 |
| 1219 | Ga0496106_0007036 | 3300048909 | Bacteria | 8310 |
| 1220 | Ga0496106_0008502 | 3300048909 | Bacteria | 7593 |
| 1221 | Ga0496106_0027185 | 3300048909 | Bacteria | 4261 |
| 1222 | Ga0496106_0126654 | 3300048909 | Bacteria | 2000 |
| 1223 | Ga0496107_0181561 | 3300048910 | Bacteria | 1562 |
| 1224 | Ga0496107_0222767 | 3300048910 | Bacteria | 1403 |
| 1225 | Ga0496108_0002484 | 3300048911 | Bacteria | 14756 |
| 1226 | Ga0496108_0003517 | 3300048911 | Bacteria | 12554 |
| 1227 | Ga0496108_0045652 | 3300048911 | Bacteria | 3659 |
| 1228 | Ga0496108_0052468 | 3300048911 | Bacteria | 3417 |
| 1229 | Ga0496108_0055904 | 3300048911 | Bacteria | 3315 |
| 1230 | Ga0496108_0301029 | 3300048911 | Bacteria | 1397 |
| 1231 | Ga0496109_0006923 | 3300048912 | Bacteria | 9567 |
| 1232 | Ga0496109_0009441 | 3300048912 | Bacteria | 8315 |
| 1233 | Ga0496109_0010400 | 3300048912 | Bacteria | 7946 |
| 1234 | Ga0496109_0020450 | 3300048912 | Bacteria | 5846 |
| 1235 | Ga0496109_0055601 | 3300048912 | Bacteria | 3611 |
| 1236 | Ga0496109_0278818 | 3300048912 | Bacteria | 1575 |
| 1237 | Ga0496109_0375321 | 3300048912 | Bacteria | 1343 |
| 1238 | Ga0496110_0003462 | 3300048913 | Bacteria | 12098 |
| 1239 | Ga0496110_0013692 | 3300048913 | Bacteria | 6719 |
| 1240 | Ga0496110_0026688 | 3300048913 | Bacteria | 4945 |
| 1241 | Ga0496110_0070616 | 3300048913 | Bacteria | 3095 |
| 1242 | Ga0496111_0001937 | 3300048914 | Bacteria | 12257 |
| 1243 | Ga0496111_0027365 | 3300048914 | Bacteria | 4033 |
| 1244 | Ga0496111_0048983 | 3300048914 | Bacteria | 3046 |
| 1245 | Ga0496111_0074027 | 3300048914 | Bacteria | 2480 |
| 1246 | Ga0496112_0001295 | 3300048915 | Bacteria | 18997 |
| 1247 | Ga0496112_0004030 | 3300048915 | Bacteria | 12322 |
| 1248 | Ga0496112_0007049 | 3300048915 | Bacteria | 9930 |
| 1249 | Ga0496112_0008621 | 3300048915 | Bacteria | 9140 |
| 1250 | Ga0496112_0016302 | 3300048915 | Bacteria | 6957 |
| 1251 | Ga0496112_0215159 | 3300048915 | Bacteria | 1878 |
| 1252 | Ga0496112_0404950 | 3300048915 | Bacteria | 1304 |
| 1253 | Ga0496112_0418259 | 3300048915 | Bacteria | 1279 |
| 1254 | Ga0496113_0001773 | 3300048916 | Bacteria | 12240 |
| 1255 | Ga0496113_0012438 | 3300048916 | Bacteria | 5718 |
| 1256 | Ga0496113_0014172 | 3300048916 | Bacteria | 5430 |
| 1257 | Ga0496113_0014813 | 3300048916 | Bacteria | 5335 |
| 1258 | Ga0496113_0050110 | 3300048916 | Bacteria | 3112 |
| 1259 | Ga0496113_0053486 | 3300048916 | Bacteria | 3019 |
| 1260 | Ga0496113_0081721 | 3300048916 | Bacteria | 2477 |
| 1261 | Ga0496114_0010054 | 3300048917 | Bacteria | 7522 |
| 1262 | Ga0496114_0163530 | 3300048917 | Bacteria | 1937 |
| 1263 | Ga0496115_0002487 | 3300048918 | Bacteria | 13251 |
| 1264 | Ga0496115_0056554 | 3300048918 | Bacteria | 3153 |
| 1265 | Ga0496115_0059488 | 3300048918 | Bacteria | 3077 |
| 1266 | Ga0501292_009824 | 3300049515 | Bacteria | 1425 |
| 1267 | Ga0501296_009783 | 3300049519 | Bacteria | 1128 |
| 1268 | Ga0501033_0006099 | 3300049570 | Bacteria | 9454 |
| 1269 | Ga0501033_0061122 | 3300049570 | Bacteria | 2777 |
| 1270 | Ga0501033_0188783 | 3300049570 | Bacteria | 1475 |
| 1271 | Ga0501034_0001591 | 3300049571 | Bacteria | 29545 |
| 1272 | Ga0501034_0009383 | 3300049571 | Bacteria | 10249 |
| 1273 | Ga0501034_0108455 | 3300049571 | Bacteria | 2768 |
| 1274 | Ga0501034_0136902 | 3300049571 | Bacteria | 2430 |
| 1275 | Ga0501036_0026600 | 3300049572 | Bacteria | 4886 |
| 1276 | Ga0501036_0034603 | 3300049572 | Bacteria | 4274 |
| 1277 | Ga0501036_0309770 | 3300049572 | Bacteria | 1320 |
| 1278 | Ga0501037_0171495 | 3300049573 | Bacteria | 1542 |
| 1279 | Ga0501038_0129645 | 3300049574 | Bacteria | 2072 |
| 1280 | Ga0501040_0222378 | 3300049576 | Bacteria | 1343 |
| 1281 | Ga0501040_0258731 | 3300049576 | Bacteria | 1242 |
| 1282 | Ga0501040_0322298 | 3300049576 | Bacteria | 1105 |
| 1283 | Ga0501041_0028688 | 3300049577 | Bacteria | 3357 |
| 1284 | Ga0501042_0039683 | 3300049578 | Bacteria | 3347 |
| 1285 | Ga0501042_0042703 | 3300049578 | Bacteria | 3228 |
| 1286 | Ga0501043_0007990 | 3300049579 | Bacteria | 8354 |
| 1287 | Ga0501043_0069132 | 3300049579 | Bacteria | 2774 |
| 1288 | Ga0501043_0099438 | 3300049579 | Bacteria | 2287 |
| 1289 | Ga0501046_0007943 | 3300049580 | Bacteria | 9284 |
| 1290 | Ga0501046_0067271 | 3300049580 | Bacteria | 2790 |
| 1291 | Ga0501047_0000515 | 3300049581 | Bacteria | 41775 |
| 1292 | Ga0501047_0016410 | 3300049581 | Bacteria | 7069 |
| 1293 | Ga0501047_0079575 | 3300049581 | Bacteria | 3151 |
| 1294 | Ga0501047_0097487 | 3300049581 | Bacteria | 2818 |
| 1295 | Ga0501047_0102535 | 3300049581 | Bacteria | 2741 |
| 1296 | Ga0501048_0134461 | 3300049582 | Bacteria | 1747 |
| 1297 | Ga0501048_0169929 | 3300049582 | Bacteria | 1544 |
| 1298 | Ga0501067_0000204 | 3300049583 | Bacteria | 33233 |
| 1299 | Ga0501067_0000816 | 3300049583 | Bacteria | 16794 |
| 1300 | Ga0501067_0008563 | 3300049583 | Bacteria | 5675 |
| 1301 | Ga0501067_0016663 | 3300049583 | Bacteria | 4061 |
| 1302 | Ga0501068_0000153 | 3300049584 | Bacteria | 31864 |
| 1303 | Ga0501068_0000377 | 3300049584 | Bacteria | 22422 |
| 1304 | Ga0501069_0000130 | 3300049585 | Bacteria | 32714 |
| 1305 | Ga0501069_0000606 | 3300049585 | Bacteria | 16586 |
| 1306 | Ga0501069_0043927 | 3300049585 | Bacteria | 2474 |
| 1307 | Ga0501070_0000331 | 3300049586 | Bacteria | 42978 |
| 1308 | Ga0501070_0004826 | 3300049586 | Bacteria | 11522 |
| 1309 | Ga0501070_0012137 | 3300049586 | Bacteria | 7270 |
| 1310 | Ga0501070_0019568 | 3300049586 | Bacteria | 5676 |
| 1311 | Ga0501070_0078417 | 3300049586 | Bacteria | 2734 |
| 1312 | Ga0501070_0081869 | 3300049586 | Bacteria | 2671 |
| 1313 | Ga0501071_0000065 | 3300049587 | Bacteria | 37104 |
| 1314 | Ga0501071_0000163 | 3300049587 | Bacteria | 28577 |
| 1315 | Ga0501071_0020734 | 3300049587 | Bacteria | 4571 |
| 1316 | Ga0501072_0000039 | 3300049588 | Bacteria | 113463 |
| 1317 | Ga0501072_0059713 | 3300049588 | Bacteria | 3007 |
| 1318 | Ga0501072_0064012 | 3300049588 | Bacteria | 2900 |
| 1319 | Ga0501072_0103665 | 3300049588 | Bacteria | 2261 |
| 1320 | Ga0501072_0130710 | 3300049588 | Bacteria | 2001 |
| 1321 | Ga0501073_0002482 | 3300049589 | Bacteria | 13768 |
| 1322 | Ga0501073_0005706 | 3300049589 | Bacteria | 9311 |
| 1323 | Ga0501074_0000020 | 3300049590 | Bacteria | 71979 |
| 1324 | Ga0501074_0037827 | 3300049590 | Bacteria | 3497 |
| 1325 | Ga0501074_0176802 | 3300049590 | Bacteria | 1523 |
| 1326 | Ga0501075_0011148 | 3300049591 | Bacteria | 6353 |
| 1327 | Ga0501075_0076628 | 3300049591 | Bacteria | 2530 |
| 1328 | Ga0501076_0000656 | 3300049592 | Bacteria | 22184 |
| 1329 | Ga0501076_0124814 | 3300049592 | Bacteria | 2086 |
| 1330 | Ga0501076_0126895 | 3300049592 | Bacteria | 2068 |
| 1331 | Ga0501077_0000584 | 3300049593 | Bacteria | 22057 |
| 1332 | Ga0501077_0022217 | 3300049593 | Bacteria | 4019 |
| 1333 | Ga0501077_0025134 | 3300049593 | Bacteria | 3783 |
| 1334 | Ga0501209_027971 | 3300049656 | Bacteria | 1405 |
| 1335 | Ga0501217_017324 | 3300049661 | Bacteria | 1660 |
| 1336 | Ga0501235_011480 | 3300049669 | Bacteria | 1944 |
| 1337 | Ga0501247_006688 | 3300049677 | Bacteria | 1310 |
| 1338 | Ga0501249_024021 | 3300049679 | Bacteria | 1341 |
| 1339 | Ga0501258_003658 | 3300049687 | Bacteria | 1419 |
| 1340 | Ga0501260_004254 | 3300049689 | Bacteria | 1317 |
| 1341 | Ga0501234_014834 | 3300049707 | Bacteria | 1225 |
| 1342 | Ga0501079_0011332 | 3300049741 | Bacteria | 6802 |
| 1343 | Ga0501079_0024042 | 3300049741 | Bacteria | 4674 |
| 1344 | Ga0501079_0046920 | 3300049741 | Bacteria | 3333 |
| 1345 | Ga0501079_0091002 | 3300049741 | Bacteria | 2364 |
| 1346 | Ga0501079_0094709 | 3300049741 | Bacteria | 2314 |
| 1347 | Ga0501079_0112485 | 3300049741 | Bacteria | 2116 |
| 1348 | Ga0501079_0120979 | 3300049741 | Bacteria | 2036 |
| 1349 | Ga0501080_0001007 | 3300049742 | Bacteria | 23154 |
| 1350 | Ga0501080_0002521 | 3300049742 | Bacteria | 16053 |
| 1351 | Ga0501080_0008610 | 3300049742 | Bacteria | 9259 |
| 1352 | Ga0501080_0009635 | 3300049742 | Bacteria | 8818 |
| 1353 | Ga0501080_0020039 | 3300049742 | Bacteria | 6188 |
| 1354 | Ga0501080_0102202 | 3300049742 | Bacteria | 2659 |
| 1355 | Ga0501080_0191329 | 3300049742 | Bacteria | 1880 |
| 1356 | Ga0501081_0004523 | 3300049743 | Bacteria | 8930 |
| 1357 | Ga0501081_0015593 | 3300049743 | Bacteria | 5016 |
| 1358 | Ga0501081_0195974 | 3300049743 | Bacteria | 1464 |
| 1359 | Ga0501081_0267315 | 3300049743 | Bacteria | 1250 |
| 1360 | Ga0501083_0000754 | 3300049744 | Bacteria | 21131 |
| 1361 | Ga0501083_0007655 | 3300049744 | Bacteria | 7657 |
| 1362 | Ga0501083_0137852 | 3300049744 | Bacteria | 1598 |
| 1363 | Ga0501267_004597 | 3300049764 | Bacteria | 1288 |
| 1364 | Ga0501268_003932 | 3300049765 | Bacteria | 2068 |
| 1365 | Ga0501268_010508 | 3300049765 | Bacteria | 1443 |
| 1366 | Ga0501270_007815 | 3300049767 | Bacteria | 1336 |
| 1367 | Ga0501271_004589 | 3300049768 | Bacteria | 1316 |
| 1368 | Ga0501272_002149 | 3300049769 | Bacteria | 1940 |
| 1369 | Ga0501035_0001214 | 3300049822 | Bacteria | 26839 |
| 1370 | Ga0501035_0020222 | 3300049822 | Bacteria | 6114 |
| 1371 | Ga0501035_0167922 | 3300049822 | Bacteria | 1897 |
| 1372 | Ga0501044_0004710 | 3300049823 | Bacteria | 15252 |
| 1373 | Ga0501044_0009533 | 3300049823 | Bacteria | 10572 |
| 1374 | Ga0501044_0221917 | 3300049823 | Bacteria | 1841 |
| 1375 | Ga0501045_0014042 | 3300049824 | Bacteria | 5669 |
| 1376 | Ga0501045_0028578 | 3300049824 | Bacteria | 4024 |
| 1377 | Ga0501045_0033379 | 3300049824 | Bacteria | 3731 |
| 1378 | Ga0501204_005429 | 3300049850 | Bacteria | 1398 |
| 1379 | nmdc:mga05p37_120863_c1 | 3300050507 | Bacteria | 3218 |
| 1380 | nmdc:mga05p37_137117_c2 | 3300050507 | Bacteria | 2026 |
| 1381 | nmdc:mga05p37_197175_c1 | 3300050507 | Bacteria | 2070 |
| 1382 | nmdc:mga05p37_25871_c1 | 3300050507 | Bacteria | 7135 |
| 1383 | nmdc:mga05p37_37646_c1 | 3300050507 | Bacteria | 5932 |
| 1384 | nmdc:mga05p37_6407_c1 | 3300050507 | Bacteria | 13871 |
| 1385 | nmdc:mga05p37_74137_c1 | 3300050507 | Bacteria | 4189 |
| 1386 | nmdc:mga05p37_758310_c1 | 3300050507 | Bacteria | 1068 |
| 1387 | nmdc:mga09592_21870_c1 | 3300050508 | Bacteria | 5274 |
| 1388 | nmdc:mga09592_341309_c1 | 3300050508 | Bacteria | 1297 |
| 1389 | nmdc:mga09592_69425_c1 | 3300050508 | Bacteria | 2989 |
| 1390 | nmdc:mga0qj67_14072_c1 | 3300050509 | Bacteria | 6041 |
| 1391 | nmdc:mga0qj67_14910_c2 | 3300050509 | Bacteria | 2734 |
| 1392 | nmdc:mga0qj67_159321_c1 | 3300050509 | Bacteria | 1832 |
| 1393 | nmdc:mga0qj67_23863_c1 | 3300050509 | Bacteria | 4710 |
| 1394 | nmdc:mga0qj67_41649_c1 | 3300050509 | Bacteria | 3613 |
| 1395 | nmdc:mga06r32_20282_c1 | 3300050510 | Bacteria | 6116 |
| 1396 | nmdc:mga06r32_240900_c1 | 3300050510 | Bacteria | 1796 |
| 1397 | nmdc:mga06r32_326373_c1 | 3300050510 | Bacteria | 1520 |
| 1398 | nmdc:mga06r32_330283_c1 | 3300050510 | Bacteria | 1510 |
| 1399 | nmdc:mga06r32_40334_c1 | 3300050510 | Bacteria | 4431 |
| 1400 | nmdc:mga06r32_43325_c1 | 3300050510 | Bacteria | 4282 |
| 1401 | nmdc:mga06r32_83624_c1 | 3300050510 | Bacteria | 3110 |
| 1402 | nmdc:mga06r32_89950_c1 | 3300050510 | Bacteria | 2998 |
| 1403 | nmdc:mga08y16_12861_c1 | 3300050511 | Bacteria | 8801 |
| 1404 | nmdc:mga08y16_149074_c1 | 3300050511 | Bacteria | 2432 |
| 1405 | nmdc:mga08y16_183850_c1 | 3300050511 | Bacteria | 2169 |
| 1406 | nmdc:mga08y16_49788_c1 | 3300050511 | Bacteria | 4384 |
| 1407 | nmdc:mga0n895_10574_c1 | 3300050512 | Bacteria | 8166 |
| 1408 | nmdc:mga0n895_13501_c1 | 3300050512 | Bacteria | 7372 |
| 1409 | nmdc:mga0n895_170412_c1 | 3300050512 | Bacteria | 2209 |
| 1410 | nmdc:mga0n895_22962_c1 | 3300050512 | Bacteria | 5855 |
| 1411 | nmdc:mga0n895_2759_c1 | 3300050512 | Bacteria | 13874 |
| 1412 | nmdc:mga0n895_29621_c1 | 3300050512 | Bacteria | 5224 |
| 1413 | nmdc:mga0n895_361213_c1 | 3300050512 | Bacteria | 1470 |
| 1414 | nmdc:mga0n895_458261_c1 | 3300050512 | Bacteria | 1287 |
| 1415 | nmdc:mga0n895_521_c1 | 3300050512 | Bacteria | 26191 |
| 1416 | nmdc:mga0n895_709573_c1 | 3300050512 | Bacteria | 1001 |
| 1417 | nmdc:mga0n895_97650_c1 | 3300050512 | Bacteria | 2943 |
| 1418 | nmdc:mga0rr50_130186_c1 | 3300050513 | Bacteria | 2014 |
| 1419 | nmdc:mga0rr50_21705_c1 | 3300050513 | Bacteria | 4389 |
| 1420 | nmdc:mga0rr50_4014_c1 | 3300050513 | Bacteria | 8583 |
| 1421 | nmdc:mga0rr50_439846_c1 | 3300050513 | Bacteria | 1104 |
| 1422 | nmdc:mga0rr50_62691_c1 | 3300050513 | Bacteria | 2806 |
| 1423 | nmdc:mga0rr50_86667_c1 | 3300050513 | Bacteria | 2430 |
| 1424 | nmdc:mga0rr50_97572_c1 | 3300050513 | Bacteria | 2302 |
| 1425 | nmdc:mga08x19_125216_c1 | 3300050514 | Bacteria | 1725 |
| 1426 | nmdc:mga08x19_13213_c1 | 3300050514 | Bacteria | 4986 |
| 1427 | nmdc:mga08x19_13241_c1 | 3300050514 | Bacteria | 4981 |
| 1428 | nmdc:mga08x19_148599_c1 | 3300050514 | Bacteria | 1586 |
| 1429 | nmdc:mga08x19_20252_c1 | 3300050514 | Bacteria | 4096 |
| 1430 | nmdc:mga08x19_29183_c1 | 3300050514 | Bacteria | 3459 |
| 1431 | nmdc:mga08x19_3422_c1 | 3300050514 | Bacteria | 9465 |
| 1432 | nmdc:mga08x19_44018_c1 | 3300050514 | Bacteria | 2849 |
| 1433 | nmdc:mga08x19_65482_c1 | 3300050514 | Bacteria | 2360 |
| 1434 | nmdc:mga0a205_10092_c1 | 3300050515 | Bacteria | 8666 |
| 1435 | nmdc:mga0a205_111028_c1 | 3300050515 | Bacteria | 2640 |
| 1436 | nmdc:mga0a205_20579_c1 | 3300050515 | Bacteria | 6228 |
| 1437 | nmdc:mga0a205_28153_c1 | 3300050515 | Bacteria | 5371 |
| 1438 | nmdc:mga0a205_34279_c1 | 3300050515 | Bacteria | 4871 |
| 1439 | nmdc:mga0a205_356_c1 | 3300050515 | Bacteria | 34589 |
| 1440 | nmdc:mga0a205_44203_c1 | 3300050515 | Bacteria | 4293 |
| 1441 | nmdc:mga0a205_45064_c1 | 3300050515 | Bacteria | 4253 |
| 1442 | nmdc:mga0a205_49624_c1 | 3300050515 | Bacteria | 4052 |
| 1443 | nmdc:mga0a205_74322_c1 | 3300050515 | Bacteria | 3284 |
| 1444 | nmdc:mga0a205_99168_c1 | 3300050515 | Bacteria | 2811 |
| 1445 | Ga0495601_0008664 | 3300053077 | Bacteria | 6004 |
| 1446 | Ga0495612_0005568 | 3300053078 | Bacteria | 5209 |
| 1447 | Ga0495612_0008212 | 3300053078 | Bacteria | 4241 |
| 1448 | Ga0495595_0004978 | 3300053084 | Bacteria | 5363 |
| 1449 | Ga0495619_0005859 | 3300053085 | Bacteria | 7786 |
| 1450 | Ga0495619_0217895 | 3300053085 | Bacteria | 1322 |
| 1451 | Ga0495619_0244994 | 3300053085 | Bacteria | 1242 |
| 1452 | Ga0500628_016637 | 3300053129 | Bacteria | 1424 |
| 1453 | Ga0501084_0001120 | 3300054114 | Bacteria | 20911 |
| 1454 | Ga0501084_0008248 | 3300054114 | Bacteria | 8593 |
| 1455 | Ga0501084_0008981 | 3300054114 | Bacteria | 8265 |
| 1456 | Ga0501084_0170970 | 3300054114 | Bacteria | 1834 |
| 1457 | Ga0501084_0177275 | 3300054114 | Bacteria | 1799 |
| 1458 | Ga0590071_004391 | 3300059421 | Bacteria | 3427 |
| 1459 | Ga0590071_011035 | 3300059421 | Bacteria | 2113 |
| 1460 | Ga0501082_0000246 | 3300060353 | Bacteria | 47507 |
| 1461 | Ga0501082_0018479 | 3300060353 | Bacteria | 6005 |
| 1462 | Ga0501082_0044061 | 3300060353 | Bacteria | 3849 |
| 1463 | Ga0501082_0083606 | 3300060353 | Bacteria | 2754 |
| 1464 | Ga0501082_0110123 | 3300060353 | Bacteria | 2384 |
| 1465 | Ga0070696_100000317 | |||
| 1466 | Ga0058863_11613365 | |||
| 1467 | Ga0058863_11923594 | |||
| 1468 | Ga0058862_10074850 | |||
| 1469 | Ga0065715_10125066 | |||
| 1470 | Ga0065715_10171985 | |||
| 1471 | Ga0065715_10210423 | |||
| 1472 | Ga0065707_10179456 | |||
| 1473 | Ga0070658_10002410 | |||
| 1474 | Ga0070658_10009372 | |||
| 1475 | Ga0070658_10019543 | |||
| 1476 | Ga0070658_10119251 | |||
| 1477 | Ga0070658_10138528 | |||
| 1478 | Ga0070658_10151769 | |||
| 1479 | Ga0070676_10001069 | |||
| 1480 | Ga0070676_10039372 | |||
| 1481 | Ga0070676_10092138 | |||
| 1482 | Ga0070683_100002655 | |||
| 1483 | Ga0070683_100011177 | |||
| 1484 | Ga0070683_100015270 | |||
| 1485 | Ga0070683_100029316 | |||
| 1486 | Ga0070683_100096198 | |||
| 1487 | Ga0070683_100252130 | |||
| 1488 | Ga0070683_100402232 | |||
| 1489 | Ga0070690_100013146 | |||
| 1490 | Ga0070690_100024816 | |||
| 1491 | Ga0070690_100028256 | |||
| 1492 | Ga0070690_100084348 | |||
| 1493 | Ga0070670_100001025 | |||
| 1494 | Ga0070670_100006438 | |||
| 1495 | Ga0070670_100006705 | |||
| 1496 | Ga0070670_100187744 | |||
| 1497 | Ga0070677_10065616 | |||
| 1498 | Ga0068869_100003272 | |||
| 1499 | Ga0068869_100021978 | |||
| 1500 | Ga0068869_100033554 | |||
| 1501 | Ga0070680_100000152 | |||
| 1502 | Ga0070680_100000886 | |||
| 1503 | Ga0070680_100004530 | |||
| 1504 | Ga0070680_100004938 | |||
| 1505 | Ga0070680_100030842 | |||
| 1506 | Ga0070680_100035601 | |||
| 1507 | Ga0070680_100039564 | |||
| 1508 | Ga0070680_100052859 | |||
| 1509 | Ga0070680_100072152 | |||
| 1510 | Ga0070680_100080018 | |||
| 1511 | Ga0070680_100093716 | |||
| 1512 | Ga0070680_100153002 | |||
| 1513 | Ga0070682_100003997 | |||
| 1514 | Ga0070682_100007320 | |||
| 1515 | Ga0070682_100017197 | |||
| 1516 | Ga0068868_100029687 | |||
| 1517 | Ga0068868_100046330 | |||
| 1518 | Ga0070660_100100684 | |||
| 1519 | Ga0070660_100119932 | |||
| 1520 | Ga0070660_100208789 | |||
| 1521 | Ga0070689_100016644 | |||
| 1522 | Ga0070689_100135420 | |||
| 1523 | Ga0070689_100260200 | |||
| 1524 | Ga0070691_10002555 | |||
| 1525 | Ga0070691_10019303 | |||
| 1526 | Ga0070687_100012322 | |||
| 1527 | Ga0070687_100014623 | |||
| 1528 | Ga0070687_100165301 | |||
| 1529 | Ga0070661_100000555 | |||
| 1530 | Ga0070661_100013380 | |||
| 1531 | Ga0070661_100018782 | |||
| 1532 | Ga0070661_100123730 | |||
| 1533 | Ga0070692_10007973 | |||
| 1534 | Ga0070692_10048202 | |||
| 1535 | Ga0070692_10053898 | |||
| 1536 | Ga0070692_10066924 | |||
| 1537 | Ga0070668_100000088 | |||
| 1538 | Ga0070668_100028995 | |||
| 1539 | Ga0070668_100057181 | |||
| 1540 | Ga0070668_100083335 | |||
| 1541 | Ga0070668_100114398 | |||
| 1542 | Ga0070668_100177320 | |||
| 1543 | Ga0070669_100004309 | |||
| 1544 | Ga0070669_100005368 | |||
| 1545 | Ga0070669_100017493 | |||
| 1546 | Ga0070669_100028355 | |||
| 1547 | Ga0070669_100045624 | |||
| 1548 | Ga0070675_100000328 | |||
| 1549 | Ga0070675_100002562 | |||
| 1550 | Ga0070675_100062482 | |||
| 1551 | Ga0070675_100118846 | |||
| 1552 | Ga0070675_100190756 | |||
| 1553 | Ga0070675_100218278 | |||
| 1554 | Ga0070671_100021339 | |||
| 1555 | Ga0070671_100024452 | |||
| 1556 | Ga0070671_100063276 | |||
| 1557 | Ga0070671_100148877 | |||
| 1558 | Ga0070674_100010741 | |||
| 1559 | Ga0070674_100131764 | |||
| 1560 | Ga0070674_100132554 | |||
| 1561 | Ga0070674_100242032 | |||
| 1562 | Ga0070673_100027745 | |||
| 1563 | Ga0070673_100030061 | |||
| 1564 | Ga0070673_100041619 | |||
| 1565 | Ga0070673_100187543 | |||
| 1566 | Ga0070688_100018644 | |||
| 1567 | Ga0070688_100068534 | |||
| 1568 | Ga0070659_100004735 | |||
| 1569 | Ga0070659_100006879 | |||
| 1570 | Ga0070659_100022459 | |||
| 1571 | Ga0070659_100120479 | |||
| 1572 | Ga0070659_100274042 | |||
| 1573 | Ga0070659_100369874 | |||
| 1574 | Ga0070667_100026870 | |||
| 1575 | Ga0070667_100063795 | |||
| 1576 | Ga0070667_100113059 | |||
| 1577 | Ga0070667_100223573 | |||
| 1578 | Ga0070703_10003216 | |||
| 1579 | Ga0070703_10025184 | |||
| 1580 | Ga0070709_10000468 | |||
| 1581 | Ga0070709_10004856 | |||
| 1582 | Ga0070709_10065735 | |||
| 1583 | Ga0070714_100000878 | |||
| 1584 | Ga0070714_100003440 | |||
| 1585 | Ga0070714_100004574 | |||
| 1586 | Ga0070714_100005291 | |||
| 1587 | Ga0070714_100223639 | |||
| 1588 | Ga0070713_100004689 | |||
| 1589 | Ga0070701_10002215 | |||
| 1590 | Ga0070701_10005194 | |||
| 1591 | Ga0070711_100000106 | |||
| 1592 | Ga0070711_100018042 | |||
| 1593 | Ga0070711_100058475 | |||
| 1594 | Ga0070711_100060818 | |||
| 1595 | Ga0070705_100001229 | |||
| 1596 | Ga0070705_100004234 | |||
| 1597 | Ga0070705_100004882 | |||
| 1598 | Ga0070705_100041548 | |||
| 1599 | Ga0070705_100156067 | |||
| 1600 | Ga0070694_100001804 | |||
| 1601 | Ga0070694_100002816 | |||
| 1602 | Ga0070694_100024506 | |||
| 1603 | Ga0070694_100025286 | |||
| 1604 | Ga0070694_100037396 | |||
| 1605 | Ga0070694_100041223 | |||
| 1606 | Ga0070694_100049747 | |||
| 1607 | Ga0070694_100080357 | |||
| 1608 | Ga0070708_100000070 | |||
| 1609 | Ga0070708_100004270 | |||
| 1610 | Ga0070708_100004497 | |||
| 1611 | Ga0070708_100010495 | |||
| 1612 | Ga0070708_100011885 | |||
| 1613 | Ga0070708_100048072 | |||
| 1614 | Ga0070708_100051729 | |||
| 1615 | Ga0070708_100076038 | |||
| 1616 | Ga0070708_100294665 | |||
| 1617 | Ga0070663_100178772 | |||
| 1618 | Ga0070678_100123855 | |||
| 1619 | Ga0070678_100158857 | |||
| 1620 | Ga0070678_100235270 | |||
| 1621 | Ga0070662_100002729 | |||
| 1622 | Ga0070662_100040602 | |||
| 1623 | Ga0070662_100050122 | |||
| 1624 | Ga0070662_100080800 | |||
| 1625 | Ga0070662_100095795 | |||
| 1626 | Ga0070662_100209292 | |||
| 1627 | Ga0070662_100380569 | |||
| 1628 | Ga0070681_10000687 | |||
| 1629 | Ga0070681_10000828 | |||
| 1630 | Ga0070681_10002894 | |||
| 1631 | Ga0070681_10004863 | |||
| 1632 | Ga0070681_10016300 | |||
| 1633 | Ga0070681_10018968 | |||
| 1634 | Ga0070681_10024729 | |||
| 1635 | Ga0070681_10062448 | |||
| 1636 | Ga0070681_10070720 | |||
| 1637 | Ga0070681_10160414 | |||
| 1638 | Ga0070681_10235006 | |||
| 1639 | Ga0068867_100003262 | |||
| 1640 | Ga0068867_100029692 | |||
| 1641 | Ga0068867_100121175 | |||
| 1642 | Ga0068867_100139266 | |||
| 1643 | Ga0070685_10057967 | |||
| 1644 | Ga0070685_10192296 | |||
| 1645 | Ga0070706_100001388 | |||
| 1646 | Ga0070706_100034447 | |||
| 1647 | Ga0070706_100038625 | |||
| 1648 | Ga0070706_100041249 | |||
| 1649 | Ga0070706_100043850 | |||
| 1650 | Ga0070706_100091223 | |||
| 1651 | Ga0070706_100100227 | |||
| 1652 | Ga0070706_100134024 | |||
| 1653 | Ga0070706_100424654 | |||
| 1654 | Ga0070707_100001831 | |||
| 1655 | Ga0070707_100004854 | |||
| 1656 | Ga0070707_100016176 | |||
| 1657 | Ga0070707_100017971 | |||
| 1658 | Ga0070707_100019833 | |||
| 1659 | Ga0070707_100021571 | |||
| 1660 | Ga0070707_100041321 | |||
| 1661 | Ga0070707_100070532 | |||
| 1662 | Ga0070707_100098677 | |||
| 1663 | Ga0070707_100436629 | |||
| 1664 | Ga0070698_100000109 | |||
| 1665 | Ga0070698_100002614 | |||
| 1666 | Ga0070698_100011076 | |||
| 1667 | Ga0070698_100011389 | |||
| 1668 | Ga0070698_100013629 | |||
| 1669 | Ga0070698_100024231 | |||
| 1670 | Ga0070698_100029252 | |||
| 1671 | Ga0070698_100093517 | |||
| 1672 | Ga0070698_100098417 | |||
| 1673 | Ga0070698_100180777 | |||
| 1674 | Ga0070699_100000091 | |||
| 1675 | Ga0070699_100001290 | |||
| 1676 | Ga0070699_100004566 | |||
| 1677 | Ga0070699_100006637 | |||
| 1678 | Ga0070699_100011321 | |||
| 1679 | Ga0070699_100014131 | |||
| 1680 | Ga0070699_100019989 | |||
| 1681 | Ga0070699_100028904 | |||
| 1682 | Ga0070699_100059529 | |||
| 1683 | Ga0070699_100096483 | |||
| 1684 | Ga0070699_100104185 | |||
| 1685 | Ga0070699_100122878 | |||
| 1686 | Ga0070699_100219618 | |||
| 1687 | Ga0070699_100227032 | |||
| 1688 | Ga0070699_100454068 | |||
| 1689 | Ga0070679_100000443 | |||
| 1690 | Ga0070679_100003946 | |||
| 1691 | Ga0070679_100010155 | |||
| 1692 | Ga0070679_100018907 | |||
| 1693 | Ga0070679_100028602 | |||
| 1694 | Ga0070679_100030974 | |||
| 1695 | Ga0070679_100040136 | |||
| 1696 | Ga0070679_100045265 | |||
| 1697 | Ga0070679_100049987 | |||
| 1698 | Ga0070679_100099123 | |||
| 1699 | Ga0070679_100105650 | |||
| 1700 | Ga0070679_100130360 | |||
| 1701 | Ga0070679_100142918 | |||
| 1702 | Ga0070679_100315920 | |||
| 1703 | Ga0070684_100002554 | |||
| 1704 | Ga0070684_100005481 | |||
| 1705 | Ga0070684_100017764 | |||
| 1706 | Ga0070684_100034489 | |||
| 1707 | Ga0070684_100044061 | |||
| 1708 | Ga0070684_100051427 | |||
| 1709 | Ga0070684_100054192 | |||
| 1710 | Ga0070684_100152944 | |||
| 1711 | Ga0070684_100175731 | |||
| 1712 | Ga0070684_100543332 | |||
| 1713 | Ga0070697_100003922 | |||
| 1714 | Ga0070697_100004414 | |||
| 1715 | Ga0070697_100004575 | |||
| 1716 | Ga0070697_100008439 | |||
| 1717 | Ga0070697_100008663 | |||
| 1718 | Ga0070697_100011976 | |||
| 1719 | Ga0070697_100017195 | |||
| 1720 | Ga0070697_100031239 | |||
| 1721 | Ga0070697_100065842 | |||
| 1722 | Ga0070697_100203013 | |||
| 1723 | Ga0070697_100377816 | |||
| 1724 | Ga0070697_100398648 | |||
| 1725 | Ga0068853_100013245 | |||
| 1726 | Ga0068853_100035769 | |||
| 1727 | Ga0068853_100061189 | |||
| 1728 | Ga0068853_100101499 | |||
| 1729 | Ga0068853_100107663 | |||
| 1730 | Ga0070672_100020937 | |||
| 1731 | Ga0070672_100028075 | |||
| 1732 | Ga0070672_100039619 | |||
| 1733 | Ga0070672_100044873 | |||
| 1734 | Ga0070672_100229243 | |||
| 1735 | Ga0070672_100266460 | |||
| 1736 | Ga0070672_100520383 | |||
| 1737 | Ga0070686_100075921 | |||
| 1738 | Ga0070686_100116573 | |||
| 1739 | Ga0070695_100001357 | |||
| 1740 | Ga0070695_100003221 | |||
| 1741 | Ga0070695_100061283 | |||
| 1742 | Ga0070695_100064463 | |||
| 1743 | Ga0070695_100248108 | |||
| 1744 | Ga0070696_100001642 | |||
| 1745 | Ga0070696_100001747 | |||
| 1746 | Ga0070696_100002480 | |||
| 1747 | Ga0070696_100002806 | |||
| 1748 | Ga0070696_100003579 | |||
| 1749 | Ga0070696_100013854 | |||
| 1750 | Ga0070696_100015640 | |||
| 1751 | Ga0070696_100050330 | |||
| 1752 | Ga0070696_100068067 | |||
| 1753 | Ga0070696_100119506 | |||
| 1754 | Ga0070696_100211549 | |||
| 1755 | Ga0070693_100002712 | |||
| 1756 | Ga0070693_100024732 | |||
| 1757 | Ga0070665_100010586 | |||
| 1758 | Ga0070704_100000390 | |||
| 1759 | Ga0070704_100011539 | |||
| 1760 | Ga0070704_100018243 | |||
| 1761 | Ga0070704_100037225 | |||
| 1762 | Ga0070704_100044111 | |||
| 1763 | Ga0070704_100055681 | |||
| 1764 | Ga0070704_100242323 | |||
| 1765 | Ga0068855_100046695 | |||
| 1766 | Ga0068855_100064329 | |||
| 1767 | Ga0068855_100065622 | |||
| 1768 | Ga0068855_100074497 | |||
| 1769 | Ga0068855_100115999 | |||
| 1770 | Ga0068855_100496168 | |||
| 1771 | Ga0070664_100002134 | |||
| 1772 | Ga0070664_100042116 | |||
| 1773 | Ga0070664_100057446 | |||
| 1774 | Ga0070664_100062616 | |||
| 1775 | Ga0070664_100080556 | |||
| 1776 | Ga0070664_100123605 | |||
| 1777 | Ga0070664_100141850 | |||
| 1778 | Ga0070664_100228373 | |||
| 1779 | Ga0070664_100517087 | |||
| 1780 | Ga0068857_100005765 | |||
| 1781 | Ga0068857_100009491 | |||
| 1782 | Ga0068857_100014469 | |||
| 1783 | Ga0068857_100021305 | |||
| 1784 | Ga0068857_100073283 | |||
| 1785 | Ga0068857_100298562 | |||
| 1786 | Ga0068854_100002669 | |||
| 1787 | Ga0068854_100005444 | |||
| 1788 | Ga0068854_100304321 | |||
| 1789 | Ga0068854_100341113 | |||
| 1790 | Ga0068856_100043500 | |||
| 1791 | Ga0068856_100174247 | |||
| 1792 | Ga0070702_100102677 | |||
| 1793 | Ga0070702_100165314 | |||
| 1794 | Ga0070702_100211475 | |||
| 1795 | Ga0068852_100004225 | |||
| 1796 | Ga0068852_100030810 | |||
| 1797 | Ga0068852_100085610 | |||
| 1798 | Ga0068852_100137693 | |||
| 1799 | Ga0068859_100023845 | |||
| 1800 | Ga0068859_100044907 | |||
| 1801 | Ga0068859_100065663 | |||
| 1802 | Ga0068859_100097008 | |||
| 1803 | Ga0068859_100244257 | |||
| 1804 | Ga0068859_100366039 | |||
| 1805 | Ga0068864_100008318 | |||
| 1806 | Ga0068864_100046006 | |||
| 1807 | Ga0068864_100195762 | |||
| 1808 | Ga0068864_100244664 | |||
| 1809 | Ga0068866_10015087 | |||
| 1810 | Ga0068861_100000232 | |||
| 1811 | Ga0068861_100048396 | |||
| 1812 | Ga0068861_100245889 | |||
| 1813 | Ga0068870_10021110 | |||
| 1814 | Ga0068870_10149111 | |||
| 1815 | Ga0068863_100010547 | |||
| 1816 | Ga0068863_100025110 | |||
| 1817 | Ga0068863_100057210 | |||
| 1818 | Ga0068858_100006089 | |||
| 1819 | Ga0068858_100020276 | |||
| 1820 | Ga0068860_100059679 | |||
| 1821 | Ga0068860_100071997 | |||
| 1822 | Ga0068860_100150247 | |||
| 1823 | Ga0068862_100002069 | |||
| 1824 | Ga0068862_100011123 | |||
| 1825 | Ga0068862_100031129 | |||
| 1826 | Ga0068862_100045625 | |||
| 1827 | Ga0068862_100141767 | |||
| 1828 | Ga0081455_10066286 | |||
| 1829 | Ga0081455_10078672 | |||
| 1830 | Ga0081539_10000103 | |||
| 1831 | Ga0081539_10014467 | |||
| 1832 | Ga0070717_10035604 | |||
| 1833 | Ga0070716_100005697 | |||
| 1834 | Ga0070716_100159979 | |||
| 1835 | Ga0070712_100070343 | |||
| 1836 | Ga0070712_100227287 | |||
| 1837 | Ga0097621_100223741 | |||
| 1838 | Ga0068871_100046727 | |||
| 1839 | Ga0068871_100079935 | |||
| 1840 | Ga0075428_100006240 | |||
| 1841 | Ga0075428_100036169 | |||
| 1842 | Ga0075428_100038265 | |||
| 1843 | Ga0075428_100289374 | |||
| 1844 | Ga0075428_100301665 | |||
| 1845 | Ga0075430_100026935 | |||
| 1846 | Ga0075430_100028403 | |||
| 1847 | Ga0075431_100006384 | |||
| 1848 | Ga0075431_100010914 | |||
| 1849 | Ga0075431_100012188 | |||
| 1850 | Ga0075431_100036869 | |||
| 1851 | Ga0075431_100130630 | |||
| 1852 | Ga0075433_10000226 | |||
| 1853 | Ga0075433_10027154 | |||
| 1854 | Ga0075433_10034435 | |||
| 1855 | Ga0075433_10073280 | |||
| 1856 | Ga0075433_10083859 | |||
| 1857 | Ga0075433_10247934 | |||
| 1858 | Ga0075433_10310334 | |||
| 1859 | Ga0075434_100000723 | |||
| 1860 | Ga0075434_100004748 | |||
| 1861 | Ga0075434_100011395 | |||
| 1862 | Ga0075434_100013916 | |||
| 1863 | Ga0075434_100032355 | |||
| 1864 | Ga0075434_100132014 | |||
| 1865 | Ga0075429_100002036 | |||
| 1866 | Ga0075429_100012920 | |||
| 1867 | Ga0075429_100026135 | |||
| 1868 | Ga0075429_100053736 | |||
| 1869 | Ga0075429_100095024 | |||
| 1870 | Ga0075429_100147985 | |||
| 1871 | Ga0075429_100237465 | |||
| 1872 | Ga0068865_100007779 | |||
| 1873 | Ga0068865_100010159 | |||
| 1874 | Ga0068865_100010998 | |||
| 1875 | Ga0068865_100035616 | |||
| 1876 | Ga0075436_100002070 | |||
| 1877 | Ga0075436_100002833 | |||
| 1878 | Ga0075436_100020329 | |||
| 1879 | Ga0075436_100020492 | |||
| 1880 | Ga0075436_100031013 | |||
| 1881 | Ga0075436_100190519 | |||
| 1882 | Ga0075436_100285816 | |||
| 1883 | Ga0097620_100023845 | |||
| 1884 | Ga0097620_100044906 | |||
| 1885 | Ga0097620_100065668 | |||
| 1886 | Ga0097620_100097003 | |||
| 1887 | Ga0097620_100244256 | |||
| 1888 | Ga0097620_100366081 | |||
| 1889 | Ga0075435_100033106 | |||
| 1890 | Ga0075435_100124023 | |||
| 1891 | Ga0075435_100178598 | |||
| 1892 | Ga0075435_100476766 | |||
| 1893 | Ga0099794_10000041 | |||
| 1894 | Ga0099794_10002901 | |||
| 1895 | Ga0099794_10061899 | |||
| 1896 | Ga0099794_10152790 | |||
| 1897 | Ga0105240_10022751 | |||
| 1898 | Ga0105240_10026683 | |||
| 1899 | Ga0105240_10030258 | |||
| 1900 | Ga0105240_10062666 | |||
| 1901 | Ga0105240_10164862 | |||
| 1902 | Ga0105240_10323005 | |||
| 1903 | Ga0111539_10021889 | |||
| 1904 | Ga0111539_10032525 | |||
| 1905 | Ga0111539_10042199 | |||
| 1906 | Ga0111539_10051533 | |||
| 1907 | Ga0105245_10038166 | |||
| 1908 | Ga0105245_10042591 | |||
| 1909 | Ga0105245_10091566 | |||
| 1910 | Ga0105245_10322920 | |||
| 1911 | Ga0114129_10000482 | |||
| 1912 | Ga0114129_10007380 | |||
| 1913 | Ga0114129_10014906 | |||
| 1914 | Ga0114129_10068850 | |||
| 1915 | Ga0114129_10091011 | |||
| 1916 | Ga0114129_10158085 | |||
| 1917 | Ga0114129_10212754 | |||
| 1918 | Ga0114129_10219170 | |||
| 1919 | Ga0114129_10228830 | |||
| 1920 | Ga0114129_10330892 | |||
| 1921 | Ga0114129_10345550 | |||
| 1922 | Ga0114129_10540071 | |||
| 1923 | Ga0114129_10786781 | |||
| 1924 | Ga0105241_10058318 | |||
| 1925 | Ga0105241_10098937 | |||
| 1926 | Ga0105241_10129516 | |||
| 1927 | Ga0105242_10001589 | |||
| 1928 | Ga0105242_10006083 | |||
| 1929 | Ga0105242_10011676 | |||
| 1930 | Ga0105248_10000977 | |||
| 1931 | Ga0105248_10003124 | |||
| 1932 | Ga0105248_10036018 | |||
| 1933 | Ga0105248_10087258 | |||
| 1934 | Ga0105248_10325282 | |||
| 1935 | Ga0105238_10000007 | |||
| 1936 | Ga0105238_10119760 | |||
| 1937 | Ga0105249_10000078 | |||
| 1938 | Ga0105249_10001142 | |||
| 1939 | Ga0105249_10003811 | |||
| 1940 | Ga0105249_10007349 | |||
| 1941 | Ga0105249_10013047 | |||
| 1942 | Ga0105249_10043169 | |||
| 1943 | Ga0105239_10010617 | |||
| 1944 | Ga0105239_10013408 | |||
| 1945 | Ga0105239_10040907 | |||
| 1946 | Ga0105246_10037375 | |||
| 1947 | Ga0157373_10001188 | |||
| 1948 | Ga0157373_10048475 | |||
| 1949 | Ga0157373_10089526 | |||
| 1950 | Ga0157373_10092492 | |||
| 1951 | Ga0157373_10203380 | |||
| 1952 | Ga0157371_10052735 | |||
| 1953 | Ga0157371_10054753 | |||
| 1954 | Ga0157371_10076645 | |||
| 1955 | Ga0157370_10002250 | |||
| 1956 | Ga0157370_10016352 | |||
| 1957 | Ga0157370_10026600 | |||
| 1958 | Ga0157370_10091054 | |||
| 1959 | Ga0157370_10205130 | |||
| 1960 | Ga0157369_10006892 | |||
| 1961 | Ga0157369_10050847 | |||
| 1962 | Ga0157369_10078170 | |||
| 1963 | Ga0157369_10121427 | |||
| 1964 | Ga0157369_10143481 | |||
| 1965 | Ga0157374_10074796 | |||
| 1966 | Ga0157374_10187416 | |||
| 1967 | Ga0157374_10261198 | |||
| 1968 | Ga0157378_10000460 | |||
| 1969 | Ga0157378_10028113 | |||
| 1970 | Ga0157378_10172947 | |||
| 1971 | Ga0163162_10002411 | |||
| 1972 | Ga0163162_10075177 | |||
| 1973 | Ga0163162_10125473 | |||
| 1974 | Ga0163162_10154470 | |||
| 1975 | Ga0163162_10193472 | |||
| 1976 | Ga0163162_10504766 | |||
| 1977 | Ga0157372_10005848 | |||
| 1978 | Ga0157372_10008921 | |||
| 1979 | Ga0157372_10011199 | |||
| 1980 | Ga0157372_10011305 | |||
| 1981 | Ga0157372_10018234 | |||
| 1982 | Ga0157372_10065515 | |||
| 1983 | Ga0157372_10111598 | |||
| 1984 | Ga0157372_10195027 | |||
| 1985 | Ga0157372_10279397 | |||
| 1986 | Ga0157372_10324820 | |||
| 1987 | Ga0157372_10524279 | |||
| 1988 | Ga0157375_10028212 | |||
| 1989 | Ga0157375_10046809 | |||
| 1990 | Ga0157375_10066297 | |||
| 1991 | Ga0157375_10227516 | |||
| 1992 | Ga0157375_10317799 | |||
| 1993 | Ga0157375_10357016 | |||
| 1994 | Ga0163163_10038659 | |||
| 1995 | Ga0163163_10057510 | |||
| 1996 | Ga0163163_10215945 | |||
| 1997 | Ga0163163_10222601 | |||
| 1998 | Ga0157380_10097607 | |||
| 1999 | Ga0157380_10357008 | |||
| 2000 | Ga0157377_10003523 | |||
| 2001 | Ga0157379_10005920 | |||
| 2002 | Ga0157376_10015363 | |||
| 2003 | Ga0157376_10050068 | |||
| 2004 | Ga0157376_10250247 | |||
| 2005 | Ga0157376_10370887 | |||
| 2006 | Ga0163161_10055588 | |||
| 2007 | Ga0163161_10092369 | |||
| 2008 | Ga0163161_10256440 | |||
| 2009 | Ga0206356_10686293 | |||
| 2010 | Ga0206354_11043160 | |||
| 2011 | Ga0213876_10100162 | |||
| 2012 | Ga0213875_10003244 | |||
| 2013 | Ga0207697_10078783 | |||
| 2014 | Ga0207653_10000037 | |||
| 2015 | Ga0207653_10007039 | |||
| 2016 | Ga0207682_10017990 | |||
| 2017 | Ga0207682_10087006 | |||
| 2018 | Ga0207642_10000684 | |||
| 2019 | Ga0207642_10042071 | |||
| 2020 | Ga0207688_10061651 | |||
| 2021 | Ga0207680_10042801 | |||
| 2022 | Ga0207647_10010471 | |||
| 2023 | Ga0207699_10007060 | |||
| 2024 | Ga0207699_10019989 | |||
| 2025 | Ga0207699_10059131 | |||
| 2026 | Ga0207699_10315829 | |||
| 2027 | Ga0207645_10002892 | |||
| 2028 | Ga0207645_10004847 | |||
| 2029 | Ga0207645_10005647 | |||
| 2030 | Ga0207645_10036027 | |||
| 2031 | Ga0207645_10137566 | |||
| 2032 | Ga0207643_10031640 | |||
| 2033 | Ga0207643_10047789 | |||
| 2034 | Ga0207705_10015677 | |||
| 2035 | Ga0207705_10018615 | |||
| 2036 | Ga0207705_10029915 | |||
| 2037 | Ga0207705_10036540 | |||
| 2038 | Ga0207705_10053823 | |||
| 2039 | Ga0207684_10002946 | |||
| 2040 | Ga0207684_10004712 | |||
| 2041 | Ga0207684_10058258 | |||
| 2042 | Ga0207684_10102868 | |||
| 2043 | Ga0207684_10107252 | |||
| 2044 | Ga0207684_10168869 | |||
| 2045 | Ga0207654_10000405 | |||
| 2046 | Ga0207654_10027981 | |||
| 2047 | Ga0207654_10053394 | |||
| 2048 | Ga0207654_10063551 | |||
| 2049 | Ga0207654_10074715 | |||
| 2050 | Ga0207707_10000485 | |||
| 2051 | Ga0207707_10002384 | |||
| 2052 | Ga0207707_10003274 | |||
| 2053 | Ga0207707_10003323 | |||
| 2054 | Ga0207707_10024667 | |||
| 2055 | Ga0207707_10026242 | |||
| 2056 | Ga0207707_10026472 | |||
| 2057 | Ga0207707_10039734 | |||
| 2058 | Ga0207707_10045217 | |||
| 2059 | Ga0207707_10048264 | |||
| 2060 | Ga0207707_10126952 | |||
| 2061 | Ga0207707_10158819 | |||
| 2062 | Ga0207707_10241244 | |||
| 2063 | Ga0207695_10000824 | |||
| 2064 | Ga0207695_10002609 | |||
| 2065 | Ga0207695_10022198 | |||
| 2066 | Ga0207695_10107870 | |||
| 2067 | Ga0207671_10092027 | |||
| 2068 | Ga0207693_10010681 | |||
| 2069 | Ga0207693_10042228 | |||
| 2070 | Ga0207693_10234453 | |||
| 2071 | Ga0207663_10000086 | |||
| 2072 | Ga0207663_10115754 | |||
| 2073 | Ga0207660_10000035 | |||
| 2074 | Ga0207660_10006296 | |||
| 2075 | Ga0207660_10007581 | |||
| 2076 | Ga0207660_10009333 | |||
| 2077 | Ga0207660_10023410 | |||
| 2078 | Ga0207660_10027246 | |||
| 2079 | Ga0207660_10066551 | |||
| 2080 | Ga0207660_10089981 | |||
| 2081 | Ga0207660_10113576 | |||
| 2082 | Ga0207660_10126494 | |||
| 2083 | Ga0207660_10142869 | |||
| 2084 | Ga0207660_10174662 | |||
| 2085 | Ga0207660_10210764 | |||
| 2086 | Ga0207662_10005756 | |||
| 2087 | Ga0207662_10063035 | |||
| 2088 | Ga0207662_10106890 | |||
| 2089 | Ga0207657_10004320 | |||
| 2090 | Ga0207657_10008543 | |||
| 2091 | Ga0207657_10017905 | |||
| 2092 | Ga0207657_10023091 | |||
| 2093 | Ga0207657_10050505 | |||
| 2094 | Ga0207657_10371924 | |||
| 2095 | Ga0207649_10000422 | |||
| 2096 | Ga0207649_10009822 | |||
| 2097 | Ga0207649_10013088 | |||
| 2098 | Ga0207649_10014915 | |||
| 2099 | Ga0207652_10000609 | |||
| 2100 | Ga0207652_10001738 | |||
| 2101 | Ga0207652_10003988 | |||
| 2102 | Ga0207652_10023620 | |||
| 2103 | Ga0207652_10035781 | |||
| 2104 | Ga0207652_10044607 | |||
| 2105 | Ga0207652_10046587 | |||
| 2106 | Ga0207652_10049770 | |||
| 2107 | Ga0207652_10093481 | |||
| 2108 | Ga0207652_10113107 | |||
| 2109 | Ga0207652_10119150 | |||
| 2110 | Ga0207652_10147589 | |||
| 2111 | Ga0207652_10205776 | |||
| 2112 | Ga0207652_10208663 | |||
| 2113 | Ga0207652_10408343 | |||
| 2114 | Ga0207646_10002881 | |||
| 2115 | Ga0207646_10008799 | |||
| 2116 | Ga0207646_10012044 | |||
| 2117 | Ga0207646_10035407 | |||
| 2118 | Ga0207646_10068609 | |||
| 2119 | Ga0207646_10269466 | |||
| 2120 | Ga0207681_10000537 | |||
| 2121 | Ga0207681_10009827 | |||
| 2122 | Ga0207681_10013509 | |||
| 2123 | Ga0207681_10022498 | |||
| 2124 | Ga0207694_10000007 | |||
| 2125 | Ga0207694_10024190 | |||
| 2126 | Ga0207650_10027143 | |||
| 2127 | Ga0207650_10027664 | |||
| 2128 | Ga0207650_10036278 | |||
| 2129 | Ga0207659_10037058 | |||
| 2130 | Ga0207659_10040111 | |||
| 2131 | Ga0207659_10049707 | |||
| 2132 | Ga0207659_10075629 | |||
| 2133 | Ga0207659_10085950 | |||
| 2134 | Ga0207659_10153841 | |||
| 2135 | Ga0207687_10061485 | |||
| 2136 | Ga0207664_10007042 | |||
| 2137 | Ga0207664_10022408 | |||
| 2138 | Ga0207664_10160503 | |||
| 2139 | Ga0207644_10009253 | |||
| 2140 | Ga0207644_10102521 | |||
| 2141 | Ga0207690_10031285 | |||
| 2142 | Ga0207690_10056130 | |||
| 2143 | Ga0207690_10153660 | |||
| 2144 | Ga0207690_10226554 | |||
| 2145 | Ga0207706_10000055 | |||
| 2146 | Ga0207706_10000116 | |||
| 2147 | Ga0207706_10004147 | |||
| 2148 | Ga0207706_10005574 | |||
| 2149 | Ga0207706_10029722 | |||
| 2150 | Ga0207706_10067044 | |||
| 2151 | Ga0207706_10134032 | |||
| 2152 | Ga0207706_10170997 | |||
| 2153 | Ga0207686_10000621 | |||
| 2154 | Ga0207686_10036441 | |||
| 2155 | Ga0207686_10067885 | |||
| 2156 | Ga0207686_10098938 | |||
| 2157 | Ga0207709_10001211 | |||
| 2158 | Ga0207709_10167078 | |||
| 2159 | Ga0207709_10207934 | |||
| 2160 | Ga0207670_10036402 | |||
| 2161 | Ga0207670_10272360 | |||
| 2162 | Ga0207669_10005007 | |||
| 2163 | Ga0207669_10055517 | |||
| 2164 | Ga0207669_10070325 | |||
| 2165 | Ga0207669_10114956 | |||
| 2166 | Ga0207704_10002778 | |||
| 2167 | Ga0207704_10010731 | |||
| 2168 | Ga0207704_10054867 | |||
| 2169 | Ga0207665_10024529 | |||
| 2170 | Ga0207691_10000129 | |||
| 2171 | Ga0207691_10004042 | |||
| 2172 | Ga0207691_10027758 | |||
| 2173 | Ga0207691_10037433 | |||
| 2174 | Ga0207691_10037824 | |||
| 2175 | Ga0207691_10061175 | |||
| 2176 | Ga0207691_10103722 | |||
| 2177 | Ga0207691_10104846 | |||
| 2178 | Ga0207691_10106620 | |||
| 2179 | Ga0207691_10202398 | |||
| 2180 | Ga0207711_10001868 | |||
| 2181 | Ga0207711_10024068 | |||
| 2182 | Ga0207711_10047223 | |||
| 2183 | Ga0207711_10068303 | |||
| 2184 | Ga0207711_10121032 | |||
| 2185 | Ga0207689_10003669 | |||
| 2186 | Ga0207689_10031774 | |||
| 2187 | Ga0207689_10043643 | |||
| 2188 | Ga0207689_10134896 | |||
| 2189 | Ga0207661_10004017 | |||
| 2190 | Ga0207661_10005197 | |||
| 2191 | Ga0207661_10007276 | |||
| 2192 | Ga0207661_10015415 | |||
| 2193 | Ga0207661_10020678 | |||
| 2194 | Ga0207661_10026394 | |||
| 2195 | Ga0207661_10175794 | |||
| 2196 | Ga0207661_10234972 | |||
| 2197 | Ga0207679_10000382 | |||
| 2198 | Ga0207679_10001463 | |||
| 2199 | Ga0207679_10011578 | |||
| 2200 | Ga0207679_10050243 | |||
| 2201 | Ga0207679_10056727 | |||
| 2202 | Ga0207679_10087046 | |||
| 2203 | Ga0207679_10129486 | |||
| 2204 | Ga0207679_10196192 | |||
| 2205 | Ga0207679_10211673 | |||
| 2206 | Ga0207679_10278175 | |||
| 2207 | Ga0207667_10001972 | |||
| 2208 | Ga0207667_10026735 | |||
| 2209 | Ga0207667_10112701 | |||
| 2210 | Ga0207667_10159242 | |||
| 2211 | Ga0207667_10302464 | |||
| 2212 | Ga0207651_10034842 | |||
| 2213 | Ga0207651_10080830 | |||
| 2214 | Ga0207651_10161516 | |||
| 2215 | Ga0207651_10235608 | |||
| 2216 | Ga0207651_10247154 | |||
| 2217 | Ga0207712_10000568 | |||
| 2218 | Ga0207712_10000920 | |||
| 2219 | Ga0207712_10001023 | |||
| 2220 | Ga0207712_10003424 | |||
| 2221 | Ga0207712_10016554 | |||
| 2222 | Ga0207712_10071192 | |||
| 2223 | Ga0207668_10019781 | |||
| 2224 | Ga0207668_10032208 | |||
| 2225 | Ga0207668_10067976 | |||
| 2226 | Ga0207668_10103554 | |||
| 2227 | Ga0207668_10165909 | |||
| 2228 | Ga0207640_10000266 | |||
| 2229 | Ga0207658_10036784 | |||
| 2230 | Ga0207658_10107644 | |||
| 2231 | Ga0207658_10167698 | |||
| 2232 | Ga0207658_10199911 | |||
| 2233 | Ga0207658_10414093 | |||
| 2234 | Ga0207677_10056609 | |||
| 2235 | Ga0207703_10063190 | |||
| 2236 | Ga0207703_10318713 | |||
| 2237 | Ga0207639_10042397 | |||
| 2238 | Ga0207639_10046480 | |||
| 2239 | Ga0207639_10051298 | |||
| 2240 | Ga0207639_10118134 | |||
| 2241 | Ga0207678_10000997 | |||
| 2242 | Ga0207678_10322975 | |||
| 2243 | Ga0207708_10017949 | |||
| 2244 | Ga0207708_10024447 | |||
| 2245 | Ga0207708_10040758 | |||
| 2246 | Ga0207702_10012826 | |||
| 2247 | Ga0207702_10177516 | |||
| 2248 | Ga0207702_10563192 | |||
| 2249 | Ga0207641_10007222 | |||
| 2250 | Ga0207641_10023120 | |||
| 2251 | Ga0207648_10000168 | |||
| 2252 | Ga0207648_10019374 | |||
| 2253 | Ga0207648_10034353 | |||
| 2254 | Ga0207648_10089068 | |||
| 2255 | Ga0207648_10107066 | |||
| 2256 | Ga0207648_10110611 | |||
| 2257 | Ga0207648_10277181 | |||
| 2258 | Ga0207676_10003052 | |||
| 2259 | Ga0207676_10010017 | |||
| 2260 | Ga0207676_10027749 | |||
| 2261 | Ga0207676_10072208 | |||
| 2262 | Ga0207676_10109037 | |||
| 2263 | Ga0207676_10142137 | |||
| 2264 | Ga0207676_10328035 | |||
| 2265 | Ga0207674_10000096 | |||
| 2266 | Ga0207674_10001035 | |||
| 2267 | Ga0207674_10002037 | |||
| 2268 | Ga0207674_10026295 | |||
| 2269 | Ga0207674_10162407 | |||
| 2270 | Ga0207674_10260232 | |||
| 2271 | Ga0207675_100000073 | |||
| 2272 | Ga0207675_100082219 | |||
| 2273 | Ga0207675_100127371 | |||
| 2274 | Ga0207675_100223187 | |||
| 2275 | Ga0207675_100248533 | |||
| 2276 | Ga0207675_100279281 | |||
| 2277 | Ga0207675_100306757 | |||
| 2278 | Ga0207683_10009858 | |||
| 2279 | Ga0207683_10064189 | |||
| 2280 | Ga0207698_10004945 | |||
| 2281 | Ga0207698_10009882 | |||
| 2282 | Ga0207698_10263876 | |||
| 2283 | Ga0207698_10328043 | |||
| 2284 | Ga0209996_1004696 | |||
| 2285 | Ga0209995_1009876 | |||
| 2286 | Ga0209968_1001462 | |||
| 2287 | Ga0209999_1002452 | |||
| 2288 | Ga0209999_1002844 | |||
| 2289 | Ga0209588_1000994 | |||
| 2290 | Ga0209588_1001408 | |||
| 2291 | Ga0209971_1028568 | |||
| 2292 | Ga0209998_10002222 | |||
| 2293 | Ga0209998_10008358 | |||
| 2294 | Ga0209974_10041763 | |||
| 2295 | Ga0207428_10041933 | |||
| 2296 | Ga0268265_10001598 | |||
| 2297 | Ga0268265_10014095 | |||
| 2298 | Ga0268265_10037581 | |||
| 2299 | Ga0268265_10069091 | |||
| 2300 | Ga0268265_10207097 | |||
| 2301 | Ga0268264_10011258 | |||
| 2302 | Ga0268264_10015480 | |||
| 2303 | Ga0268264_10067016 | |||
| 2304 | Ga0265332_10033758 | |||
| 2305 | Ga0265332_10043995 | |||
| 2306 | Ga0307408_100002866 | |||
| 2307 | Ga0307408_100013069 | |||
| 2308 | Ga0307408_100042568 | |||
| 2309 | Ga0307408_100079342 | |||
| 2310 | Ga0307408_100085978 | |||
| 2311 | Ga0307408_100096700 | |||
| 2312 | Ga0307408_100111705 | |||
| 2313 | Ga0307408_100119478 | |||
| 2314 | Ga0307408_100185856 | |||
| 2315 | Ga0307408_100216672 | |||
| 2316 | Ga0307408_100392721 | |||
| 2317 | Ga0316575_10000708 | |||
| 2318 | Ga0316579_10017603 | |||
| 2319 | Ga0316579_10026974 | |||
| 2320 | Ga0265314_10023982 | |||
| 2321 | Ga0316576_10002854 | |||
| 2322 | Ga0316576_10025589 | |||
| 2323 | Ga0316576_10027763 | |||
| 2324 | Ga0316576_10073020 | |||
| 2325 | Ga0316576_10085709 | |||
| 2326 | Ga0316576_10092063 | |||
| 2327 | Ga0316578_10000354 | |||
| 2328 | Ga0316578_10008357 | |||
| 2329 | Ga0316578_10031288 | |||
| 2330 | Ga0316578_10077790 | |||
| 2331 | Ga0316578_10084370 | |||
| 2332 | Ga0307405_10000394 | |||
| 2333 | Ga0307405_10002899 | |||
| 2334 | Ga0307405_10022437 | |||
| 2335 | Ga0307405_10028888 | |||
| 2336 | Ga0307405_10043695 | |||
| 2337 | Ga0307405_10175055 | |||
| 2338 | Ga0307405_10193380 | |||
| 2339 | Ga0307405_10363667 | |||
| 2340 | Ga0307405_10365559 | |||
| 2341 | Ga0316577_10001110 | |||
| 2342 | Ga0316577_10016655 | |||
| 2343 | Ga0316577_10040812 | |||
| 2344 | Ga0316577_10051699 | |||
| 2345 | Ga0307413_10002977 | |||
| 2346 | Ga0307413_10005323 | |||
| 2347 | Ga0307413_10013697 | |||
| 2348 | Ga0307413_10015127 | |||
| 2349 | Ga0307413_10016161 | |||
| 2350 | Ga0307413_10018129 | |||
| 2351 | Ga0307413_10028408 | |||
| 2352 | Ga0307413_10110760 | |||
| 2353 | Ga0307410_10000662 | |||
| 2354 | Ga0307410_10001342 | |||
| 2355 | Ga0307410_10004088 | |||
| 2356 | Ga0307410_10027491 | |||
| 2357 | Ga0307410_10041722 | |||
| 2358 | Ga0307410_10064132 | |||
| 2359 | Ga0307410_10092857 | |||
| 2360 | Ga0307410_10093376 | |||
| 2361 | Ga0307410_10110446 | |||
| 2362 | Ga0307406_10002048 | |||
| 2363 | Ga0307406_10010808 | |||
| 2364 | Ga0307406_10019353 | |||
| 2365 | Ga0307406_10023303 | |||
| 2366 | Ga0307406_10026506 | |||
| 2367 | Ga0307406_10040948 | |||
| 2368 | Ga0307406_10066795 | |||
| 2369 | Ga0307406_10187265 | |||
| 2370 | Ga0307407_10000456 | |||
| 2371 | Ga0307407_10003422 | |||
| 2372 | Ga0307407_10019065 | |||
| 2373 | Ga0307407_10025433 | |||
| 2374 | Ga0307407_10053209 | |||
| 2375 | Ga0307407_10062166 | |||
| 2376 | Ga0307407_10068995 | |||
| 2377 | Ga0307407_10074410 | |||
| 2378 | Ga0307407_10149679 | |||
| 2379 | Ga0307407_10177229 | |||
| 2380 | Ga0307412_10005958 | |||
| 2381 | Ga0307412_10017562 | |||
| 2382 | Ga0307412_10029024 | |||
| 2383 | Ga0307412_10054625 | |||
| 2384 | Ga0307412_10212241 | |||
| 2385 | Ga0307412_10212677 | |||
| 2386 | Ga0307412_10217832 | |||
| 2387 | Ga0307409_100000213 | |||
| 2388 | Ga0307409_100004409 | |||
| 2389 | Ga0307409_100008013 | |||
| 2390 | Ga0307409_100012191 | |||
| 2391 | Ga0307409_100015997 | |||
| 2392 | Ga0307409_100025397 | |||
| 2393 | Ga0307409_100026045 | |||
| 2394 | Ga0307409_100028466 | |||
| 2395 | Ga0307409_100069080 | |||
| 2396 | Ga0307409_100080899 | |||
| 2397 | Ga0307409_100105235 | |||
| 2398 | Ga0307409_100114970 | |||
| 2399 | Ga0307409_100125882 | |||
| 2400 | Ga0307409_100128290 | |||
| 2401 | Ga0307409_100223129 | |||
| 2402 | Ga0307409_100228793 | |||
| 2403 | Ga0307416_100000358 | |||
| 2404 | Ga0307416_100004593 | |||
| 2405 | Ga0307416_100008017 | |||
| 2406 | Ga0307416_100010738 | |||
| 2407 | Ga0307416_100011581 | |||
| 2408 | Ga0307416_100015995 | |||
| 2409 | Ga0307416_100073603 | |||
| 2410 | Ga0307416_100099971 | |||
| 2411 | Ga0307416_100106534 | |||
| 2412 | Ga0307416_100191027 | |||
| 2413 | Ga0307416_100226508 | |||
| 2414 | Ga0307416_100561961 | |||
| 2415 | Ga0307414_10001787 | |||
| 2416 | Ga0307414_10024780 | |||
| 2417 | Ga0307414_10027258 | |||
| 2418 | Ga0307414_10036290 | |||
| 2419 | Ga0307414_10059013 | |||
| 2420 | Ga0307414_10089645 | |||
| 2421 | Ga0307414_10131238 | |||
| 2422 | Ga0307414_10137084 | |||
| 2423 | Ga0307414_10139893 | |||
| 2424 | Ga0307414_10199547 | |||
| 2425 | Ga0307414_10238778 | |||
| 2426 | Ga0307411_10001361 | |||
| 2427 | Ga0307411_10006797 | |||
| 2428 | Ga0307411_10017585 | |||
| 2429 | Ga0307411_10021736 | |||
| 2430 | Ga0307411_10044613 | |||
| 2431 | Ga0307411_10049317 | |||
| 2432 | Ga0307411_10060202 | |||
| 2433 | Ga0307411_10140107 | |||
| 2434 | Ga0307411_10263390 | |||
| 2435 | Ga0307415_100005406 | |||
| 2436 | Ga0307415_100009214 | |||
| 2437 | Ga0307415_100014499 | |||
| 2438 | Ga0307415_100020478 | |||
| 2439 | Ga0307415_100021732 | |||
| 2440 | Ga0307415_100037278 | |||
| 2441 | Ga0307415_100128242 | |||
| 2442 | Ga0307415_100133336 | |||
| 2443 | Ga0307415_100191733 | |||
| 2444 | Ga0307415_100258977 | |||
| 2445 | Ga0316583_10000577 | |||
| 2446 | Ga0316580_10013751 | |||
| 2447 | Ga0373950_0006063 | |||
| 2448 | Ga0373959_0000432 | |||
| 2449 | Ga0373959_0004785 | |||
| 2450 | Ga0373938_0017699 | |||
| 2451 | Ga0373926_0019552 | |||
| 2452 | Ga0373934_0000319 | |||
| 2453 | Ga0373934_0002820 | |||
| 2454 | Ga0373934_0009088 | |||
| 2455 | Ga0373940_0008027 | |||
| 2456 | Ga0373944_0022241 | |||
| 2457 | Ga0373944_0052869 | |||
| 2458 | Ga0373953_0023613 | |||
| 2459 | Ga0373954_0003610 | |||
| 2460 | Ga0373956_0011441 | |||
| 2461 | Ga0373957_0053860 | |||
| 2462 | Ga0373957_0121286 | |||
| 2463 | Ga0373943_0000549 | |||
| 2464 | Ga0373943_0044911 | |||
| 2465 | Ga0373955_0000540 | |||
| 2466 | Ga0373955_0003972 | |||
| 2467 | Ga0373955_0011027 | |||
| 2468 | Ga0316574_0015867 | |||
| 2469 | Ga0316574_0025290 | |||
| 2470 | Ga0316574_0055042 | |||
| 2471 | Ga0373924_0091374 | |||
| 2472 | Ga0373924_0132030 | |||
| 2473 | Ga0373931_0011137 | |||
| 2474 | Ga0373931_0019052 | |||
| 2475 | Ga0373935_0004661 | |||
| 2476 | Ga0373927_0007244 | |||
| 2477 | Ga0373927_0076400 | |||
| 2478 | Ga0373933_0000499 | |||
| 2479 | Ga0373933_0006055 | |||
| 2480 | Ga0373947_0000580 | |||
| 2481 | Ga0373937_0001442 | |||
| 2482 | Ga0373937_0001736 | |||
| 2483 | Ga0373937_0034278 | |||
| 2484 | Ga0373937_0046957 | |||
| 2485 | Ga0373937_0063692 | |||
| 2486 | Ga0373937_0127509 | |||
| 2487 | Ga0316582_0072461 | |||
| 2488 | Ga0316582_0129643 | |||
| 2489 | Ga0316584_0004901 | |||
| 2490 | Ga0316584_0038181 | |||
| 2491 | Ga0316584_0209713 | |||
| 2492 | Ga0373925_0001431 | |||
| 2493 | Ga0373925_0072484 | |||
| 2494 | Ga0373925_0164240 | |||
| 2495 | Ga0373925_0287715 | |||
| 2496 | Ga0395899_0032220 | |||
| 2497 | Ga0395905_0046569 | |||
| 2498 | Ga0316581_0010550 | |||
| 2499 | Ga0436364_1446815 | |||
| 2500 | Ga0395901_0049273 | |||
| 2501 | Ga0395901_0078322 | |||
| 2502 | Ga0436365_0332204 | |||
| 2503 | Ga0439439_0007066 | |||
| 2504 | Ga0439457_022918 | |||
| 2505 | Ga0439462_0036350 | |||
| 2506 | Ga0450923_004990 | |||
| 2507 | Ga0451577_0000016 | |||
| 2508 | Ga0451577_0012754 | |||
| 2509 | Ga0451577_0164655 | |||
| 2510 | Ga0453683_0020096 | |||
| 2511 | Ga0453683_0049913 | |||
| 2512 | Ga0453683_0052131 | |||
| 2513 | Ga0453683_0102734 | |||
| 2514 | Ga0466965_0089429 | |||
| 2515 | Ga0466966_0036039 | |||
| 2516 | Ga0466961_0021024 | |||
| 2517 | Ga0453684_0000368 | |||
| 2518 | Ga0453684_0019321 | |||
| 2519 | Ga0453684_0270060 | |||
| 2520 | Ga0466957_0206407 | |||
| 2521 | Ga0466960_0192540 | |||
| 2522 | Ga0451576_0010003 | |||
| 2523 | Ga0451576_0018465 | |||
| 2524 | Ga0451576_0021204 | |||
| 2525 | Ga0451576_0033329 | |||
| 2526 | Ga0451576_0057044 | |||
| 2527 | Ga0451576_0076832 | |||
| 2528 | Ga0451576_0082509 | |||
| 2529 | Ga0451576_0293603 | |||
| 2530 | Ga0466958_0173464 | |||
| 2531 | Ga0466967_0080800 | |||
| 2532 | Ga0466967_0101799 | |||
| 2533 | Ga0466967_0103174 | |||
| 2534 | Ga0466967_0318726 | |||
| 2535 | Ga0495592_0009404 | |||
| 2536 | Ga0495603_0005008 | |||
| 2537 | Ga0495603_0011722 | |||
| 2538 | Ga0495603_0033808 | |||
| 2539 | Ga0495629_0070215 | |||
| 2540 | Ga0495629_0101203 | |||
| 2541 | Ga0495641_0025177 | |||
| 2542 | Ga0495651_0001411 | |||
| 2543 | Ga0495651_0009551 | |||
| 2544 | Ga0495651_0036788 | |||
| 2545 | Ga0495653_0008915 | |||
| 2546 | Ga0495653_0018299 | |||
| 2547 | Ga0495653_0065451 | |||
| 2548 | Ga0495580_0003447 | |||
| 2549 | Ga0495580_0073719 | |||
| 2550 | Ga0495580_0160105 | |||
| 2551 | Ga0495580_0242135 | |||
| 2552 | Ga0495582_0008456 | |||
| 2553 | Ga0495582_0100710 | |||
| 2554 | Ga0495639_0001681 | |||
| 2555 | Ga0495639_0005477 | |||
| 2556 | Ga0495664_0002618 | |||
| 2557 | Ga0495664_0005946 | |||
| 2558 | Ga0495664_0059152 | |||
| 2559 | Ga0495664_0173936 | |||
| 2560 | Ga0495594_0002309 | |||
| 2561 | Ga0495594_0008467 | |||
| 2562 | Ga0495608_0006333 | |||
| 2563 | Ga0495608_0019948 | |||
| 2564 | Ga0495608_0051142 | |||
| 2565 | Ga0495618_0019976 | |||
| 2566 | Ga0495618_0150938 | |||
| 2567 | Ga0495628_0006895 | |||
| 2568 | Ga0495628_0017832 | |||
| 2569 | Ga0495628_0038526 | |||
| 2570 | Ga0495628_0110015 | |||
| 2571 | Ga0495630_0005984 | |||
| 2572 | Ga0495630_0009425 | |||
| 2573 | Ga0495630_0010790 | |||
| 2574 | Ga0495630_0034688 | |||
| 2575 | Ga0495630_0174674 | |||
| 2576 | Ga0495630_0177150 | |||
| 2577 | Ga0495630_0180801 | |||
| 2578 | Ga0495643_0000008 | |||
| 2579 | Ga0495663_0056074 | |||
| 2580 | Ga0495666_0003940 | |||
| 2581 | Ga0495666_0010349 | |||
| 2582 | Ga0495642_0079883 | |||
| 2583 | Ga0495652_0000859 | |||
| 2584 | Ga0495652_0001382 | |||
| 2585 | Ga0495652_0015457 | |||
| 2586 | Ga0495652_0027043 | |||
| 2587 | Ga0495652_0233608 | |||
| 2588 | Ga0495665_0000677 | |||
| 2589 | Ga0495665_0018268 | |||
| 2590 | Ga0495665_0042870 | |||
| 2591 | Ga0495640_0009684 | |||
| 2592 | Ga0495640_0014353 | |||
| 2593 | Ga0495640_0072628 | |||
| 2594 | Ga0495640_0081970 | |||
| 2595 | Ga0495586_0001306 | |||
| 2596 | Ga0495586_0071020 | |||
| 2597 | Ga0495586_0113348 | |||
| 2598 | Ga0495587_0000360 | |||
| 2599 | Ga0495587_0001414 | |||
| 2600 | Ga0495587_0004216 | |||
| 2601 | Ga0495587_0031682 | |||
| 2602 | Ga0495587_0215635 | |||
| 2603 | Ga0495645_0001196 | |||
| 2604 | Ga0495645_0001984 | |||
| 2605 | Ga0495645_0017482 | |||
| 2606 | Ga0495645_0177035 | |||
| 2607 | Ga0495667_0004915 | |||
| 2608 | Ga0495667_0013907 | |||
| 2609 | Ga0495667_0092353 | |||
| 2610 | Ga0495634_0006940 | |||
| 2611 | Ga0495634_0028041 | |||
| 2612 | Ga0495634_0226603 | |||
| 2613 | Ga0495635_0000299 | |||
| 2614 | Ga0495635_0005634 | |||
| 2615 | Ga0495635_0126716 | |||
| 2616 | Ga0495659_0004294 | |||
| 2617 | Ga0495588_0000514 | |||
| 2618 | Ga0495657_0003790 | |||
| 2619 | Ga0495657_0023341 | |||
| 2620 | Ga0495599_0000395 | |||
| 2621 | Ga0495599_0195546 | |||
| 2622 | Ga0495623_0002015 | |||
| 2623 | Ga0495623_0008673 | |||
| 2624 | Ga0495623_0035931 | |||
| 2625 | Ga0495623_0051600 | |||
| 2626 | Ga0495623_0052477 | |||
| 2627 | Ga0495646_0002501 | |||
| 2628 | Ga0495646_0022846 | |||
| 2629 | Ga0495647_0003603 | |||
| 2630 | Ga0495658_0001660 | |||
| 2631 | Ga0495658_0007314 | |||
| 2632 | Ga0495658_0063924 | |||
| 2633 | Ga0495613_0020546 | |||
| 2634 | Ga0495613_0028351 | |||
| 2635 | Ga0495613_0039747 | |||
| 2636 | Ga0495613_0047188 | |||
| 2637 | Ga0495624_0114461 | |||
| 2638 | Ga0495600_0000095 | |||
| 2639 | Ga0495600_0006625 | |||
| 2640 | Ga0495600_0083341 | |||
| 2641 | Ga0495581_0000585 | |||
| 2642 | Ga0495581_0022877 | |||
| 2643 | Ga0495581_0058709 | |||
| 2644 | Ga0495604_0003090 | |||
| 2645 | Ga0495604_0006235 | |||
| 2646 | Ga0495604_0112329 | |||
| 2647 | Ga0495604_0116233 | |||
| 2648 | Ga0495604_0258970 | |||
| 2649 | Ga0495674_0000884 | |||
| 2650 | Ga0495674_0003021 | |||
| 2651 | Ga0495674_0013476 | |||
| 2652 | Ga0495672_0007178 | |||
| 2653 | Ga0495676_0074643 | |||
| 2654 | Ga0495676_0134295 | |||
| 2655 | Ga0495680_0002867 | |||
| 2656 | Ga0495680_0074369 | |||
| 2657 | Ga0495675_0031956 | |||
| 2658 | Ga0495684_0000800 | |||
| 2659 | Ga0495684_0023090 | |||
| 2660 | Ga0495684_0031147 | |||
| 2661 | Ga0495684_0128965 | |||
| 2662 | Ga0495684_0145926 | |||
| 2663 | Ga0495684_0182833 | |||
| 2664 | Ga0495593_0000691 | |||
| 2665 | Ga0495593_0061810 | |||
| 2666 | Ga0495593_0107661 | |||
| 2667 | Ga0495602_0016778 | |||
| 2668 | Ga0495602_0022463 | |||
| 2669 | Ga0495602_0025919 | |||
| 2670 | Ga0495614_0028389 | |||
| 2671 | Ga0496100_0175879 | |||
| 2672 | Ga0496101_0062284 | |||
| 2673 | Ga0496101_0183323 | |||
| 2674 | Ga0496102_0026559 | |||
| 2675 | Ga0496102_0032086 | |||
| 2676 | Ga0496102_0191323 | |||
| 2677 | Ga0496103_0063986 | |||
| 2678 | Ga0496104_0007186 | |||
| 2679 | Ga0496104_0014815 | |||
| 2680 | Ga0496104_0015208 | |||
| 2681 | Ga0496104_0031225 | |||
| 2682 | Ga0496104_0226698 | |||
| 2683 | Ga0496106_0007036 | |||
| 2684 | Ga0496106_0008502 | |||
| 2685 | Ga0496106_0027185 | |||
| 2686 | Ga0496106_0126654 | |||
| 2687 | Ga0496107_0181561 | |||
| 2688 | Ga0496107_0222767 | |||
| 2689 | Ga0496108_0002484 | |||
| 2690 | Ga0496108_0003517 | |||
| 2691 | Ga0496108_0045652 | |||
| 2692 | Ga0496108_0052468 | |||
| 2693 | Ga0496108_0055904 | |||
| 2694 | Ga0496108_0301029 | |||
| 2695 | Ga0496109_0006923 | |||
| 2696 | Ga0496109_0009441 | |||
| 2697 | Ga0496109_0010400 | |||
| 2698 | Ga0496109_0020450 | |||
| 2699 | Ga0496109_0055601 | |||
| 2700 | Ga0496109_0278818 | |||
| 2701 | Ga0496109_0375321 | |||
| 2702 | Ga0496110_0003462 | |||
| 2703 | Ga0496110_0013692 | |||
| 2704 | Ga0496110_0026688 | |||
| 2705 | Ga0496110_0070616 | |||
| 2706 | Ga0496111_0001937 | |||
| 2707 | Ga0496111_0027365 | |||
| 2708 | Ga0496111_0048983 | |||
| 2709 | Ga0496111_0074027 | |||
| 2710 | Ga0496112_0001295 | |||
| 2711 | Ga0496112_0004030 | |||
| 2712 | Ga0496112_0007049 | |||
| 2713 | Ga0496112_0008621 | |||
| 2714 | Ga0496112_0016302 | |||
| 2715 | Ga0496112_0215159 | |||
| 2716 | Ga0496112_0404950 | |||
| 2717 | Ga0496112_0418259 | |||
| 2718 | Ga0496113_0001773 | |||
| 2719 | Ga0496113_0012438 | |||
| 2720 | Ga0496113_0014172 | |||
| 2721 | Ga0496113_0014813 | |||
| 2722 | Ga0496113_0050110 | |||
| 2723 | Ga0496113_0053486 | |||
| 2724 | Ga0496113_0081721 | |||
| 2725 | Ga0496114_0010054 | |||
| 2726 | Ga0496114_0163530 | |||
| 2727 | Ga0496115_0002487 | |||
| 2728 | Ga0496115_0056554 | |||
| 2729 | Ga0496115_0059488 | |||
| 2730 | Ga0501292_009824 | |||
| 2731 | Ga0501296_009783 | |||
| 2732 | Ga0501033_0006099 | |||
| 2733 | Ga0501033_0061122 | |||
| 2734 | Ga0501033_0188783 | |||
| 2735 | Ga0501034_0001591 | |||
| 2736 | Ga0501034_0009383 | |||
| 2737 | Ga0501034_0108455 | |||
| 2738 | Ga0501034_0136902 | |||
| 2739 | Ga0501036_0026600 | |||
| 2740 | Ga0501036_0034603 | |||
| 2741 | Ga0501036_0309770 | |||
| 2742 | Ga0501037_0171495 | |||
| 2743 | Ga0501038_0129645 | |||
| 2744 | Ga0501040_0222378 | |||
| 2745 | Ga0501040_0258731 | |||
| 2746 | Ga0501040_0322298 | |||
| 2747 | Ga0501041_0028688 | |||
| 2748 | Ga0501042_0039683 | |||
| 2749 | Ga0501042_0042703 | |||
| 2750 | Ga0501043_0007990 | |||
| 2751 | Ga0501043_0069132 | |||
| 2752 | Ga0501043_0099438 | |||
| 2753 | Ga0501046_0007943 | |||
| 2754 | Ga0501046_0067271 | |||
| 2755 | Ga0501047_0000515 | |||
| 2756 | Ga0501047_0016410 | |||
| 2757 | Ga0501047_0079575 | |||
| 2758 | Ga0501047_0097487 | |||
| 2759 | Ga0501047_0102535 | |||
| 2760 | Ga0501048_0134461 | |||
| 2761 | Ga0501048_0169929 | |||
| 2762 | Ga0501067_0000204 | |||
| 2763 | Ga0501067_0000816 | |||
| 2764 | Ga0501067_0008563 | |||
| 2765 | Ga0501067_0016663 | |||
| 2766 | Ga0501068_0000153 | |||
| 2767 | Ga0501068_0000377 | |||
| 2768 | Ga0501069_0000130 | |||
| 2769 | Ga0501069_0000606 | |||
| 2770 | Ga0501069_0043927 | |||
| 2771 | Ga0501070_0000331 | |||
| 2772 | Ga0501070_0004826 | |||
| 2773 | Ga0501070_0012137 | |||
| 2774 | Ga0501070_0019568 | |||
| 2775 | Ga0501070_0078417 | |||
| 2776 | Ga0501070_0081869 | |||
| 2777 | Ga0501071_0000065 | |||
| 2778 | Ga0501071_0000163 | |||
| 2779 | Ga0501071_0020734 | |||
| 2780 | Ga0501072_0000039 | |||
| 2781 | Ga0501072_0059713 | |||
| 2782 | Ga0501072_0064012 | |||
| 2783 | Ga0501072_0103665 | |||
| 2784 | Ga0501072_0130710 | |||
| 2785 | Ga0501073_0002482 | |||
| 2786 | Ga0501073_0005706 | |||
| 2787 | Ga0501074_0000020 | |||
| 2788 | Ga0501074_0037827 | |||
| 2789 | Ga0501074_0176802 | |||
| 2790 | Ga0501075_0011148 | |||
| 2791 | Ga0501075_0076628 | |||
| 2792 | Ga0501076_0000656 | |||
| 2793 | Ga0501076_0124814 | |||
| 2794 | Ga0501076_0126895 | |||
| 2795 | Ga0501077_0000584 | |||
| 2796 | Ga0501077_0022217 | |||
| 2797 | Ga0501077_0025134 | |||
| 2798 | Ga0501209_027971 | |||
| 2799 | Ga0501217_017324 | |||
| 2800 | Ga0501235_011480 | |||
| 2801 | Ga0501247_006688 | |||
| 2802 | Ga0501249_024021 | |||
| 2803 | Ga0501258_003658 | |||
| 2804 | Ga0501260_004254 | |||
| 2805 | Ga0501234_014834 | |||
| 2806 | Ga0501079_0011332 | |||
| 2807 | Ga0501079_0024042 | |||
| 2808 | Ga0501079_0046920 | |||
| 2809 | Ga0501079_0091002 | |||
| 2810 | Ga0501079_0094709 | |||
| 2811 | Ga0501079_0112485 | |||
| 2812 | Ga0501079_0120979 | |||
| 2813 | Ga0501080_0001007 | |||
| 2814 | Ga0501080_0002521 | |||
| 2815 | Ga0501080_0008610 | |||
| 2816 | Ga0501080_0009635 | |||
| 2817 | Ga0501080_0020039 | |||
| 2818 | Ga0501080_0102202 | |||
| 2819 | Ga0501080_0191329 | |||
| 2820 | Ga0501081_0004523 | |||
| 2821 | Ga0501081_0015593 | |||
| 2822 | Ga0501081_0195974 | |||
| 2823 | Ga0501081_0267315 | |||
| 2824 | Ga0501083_0000754 | |||
| 2825 | Ga0501083_0007655 | |||
| 2826 | Ga0501083_0137852 | |||
| 2827 | Ga0501267_004597 | |||
| 2828 | Ga0501268_003932 | |||
| 2829 | Ga0501268_010508 | |||
| 2830 | Ga0501270_007815 | |||
| 2831 | Ga0501271_004589 | |||
| 2832 | Ga0501272_002149 | |||
| 2833 | Ga0501035_0001214 | |||
| 2834 | Ga0501035_0020222 | |||
| 2835 | Ga0501035_0167922 | |||
| 2836 | Ga0501044_0004710 | |||
| 2837 | Ga0501044_0009533 | |||
| 2838 | Ga0501044_0221917 | |||
| 2839 | Ga0501045_0014042 | |||
| 2840 | Ga0501045_0028578 | |||
| 2841 | Ga0501045_0033379 | |||
| 2842 | Ga0501204_005429 | |||
| 2843 | nmdc:mga05p37_120863_c1 | |||
| 2844 | nmdc:mga05p37_137117_c2 | |||
| 2845 | nmdc:mga05p37_197175_c1 | |||
| 2846 | nmdc:mga05p37_25871_c1 | |||
| 2847 | nmdc:mga05p37_37646_c1 | |||
| 2848 | nmdc:mga05p37_6407_c1 | |||
| 2849 | nmdc:mga05p37_74137_c1 | |||
| 2850 | nmdc:mga05p37_758310_c1 | |||
| 2851 | nmdc:mga09592_21870_c1 | |||
| 2852 | nmdc:mga09592_341309_c1 | |||
| 2853 | nmdc:mga09592_69425_c1 | |||
| 2854 | nmdc:mga0qj67_14072_c1 | |||
| 2855 | nmdc:mga0qj67_14910_c2 | |||
| 2856 | nmdc:mga0qj67_159321_c1 | |||
| 2857 | nmdc:mga0qj67_23863_c1 | |||
| 2858 | nmdc:mga0qj67_41649_c1 | |||
| 2859 | nmdc:mga06r32_20282_c1 | |||
| 2860 | nmdc:mga06r32_240900_c1 | |||
| 2861 | nmdc:mga06r32_326373_c1 | |||
| 2862 | nmdc:mga06r32_330283_c1 | |||
| 2863 | nmdc:mga06r32_40334_c1 | |||
| 2864 | nmdc:mga06r32_43325_c1 | |||
| 2865 | nmdc:mga06r32_83624_c1 | |||
| 2866 | nmdc:mga06r32_89950_c1 | |||
| 2867 | nmdc:mga08y16_12861_c1 | |||
| 2868 | nmdc:mga08y16_149074_c1 | |||
| 2869 | nmdc:mga08y16_183850_c1 | |||
| 2870 | nmdc:mga08y16_49788_c1 | |||
| 2871 | nmdc:mga0n895_10574_c1 | |||
| 2872 | nmdc:mga0n895_13501_c1 | |||
| 2873 | nmdc:mga0n895_170412_c1 | |||
| 2874 | nmdc:mga0n895_22962_c1 | |||
| 2875 | nmdc:mga0n895_2759_c1 | |||
| 2876 | nmdc:mga0n895_29621_c1 | |||
| 2877 | nmdc:mga0n895_361213_c1 | |||
| 2878 | nmdc:mga0n895_458261_c1 | |||
| 2879 | nmdc:mga0n895_521_c1 | |||
| 2880 | nmdc:mga0n895_709573_c1 | |||
| 2881 | nmdc:mga0n895_97650_c1 | |||
| 2882 | nmdc:mga0rr50_130186_c1 | |||
| 2883 | nmdc:mga0rr50_21705_c1 | |||
| 2884 | nmdc:mga0rr50_4014_c1 | |||
| 2885 | nmdc:mga0rr50_439846_c1 | |||
| 2886 | nmdc:mga0rr50_62691_c1 | |||
| 2887 | nmdc:mga0rr50_86667_c1 | |||
| 2888 | nmdc:mga0rr50_97572_c1 | |||
| 2889 | nmdc:mga08x19_125216_c1 | |||
| 2890 | nmdc:mga08x19_13213_c1 | |||
| 2891 | nmdc:mga08x19_13241_c1 | |||
| 2892 | nmdc:mga08x19_148599_c1 | |||
| 2893 | nmdc:mga08x19_20252_c1 | |||
| 2894 | nmdc:mga08x19_29183_c1 | |||
| 2895 | nmdc:mga08x19_3422_c1 | |||
| 2896 | nmdc:mga08x19_44018_c1 | |||
| 2897 | nmdc:mga08x19_65482_c1 | |||
| 2898 | nmdc:mga0a205_10092_c1 | |||
| 2899 | nmdc:mga0a205_111028_c1 | |||
| 2900 | nmdc:mga0a205_20579_c1 | |||
| 2901 | nmdc:mga0a205_28153_c1 | |||
| 2902 | nmdc:mga0a205_34279_c1 | |||
| 2903 | nmdc:mga0a205_356_c1 | |||
| 2904 | nmdc:mga0a205_44203_c1 | |||
| 2905 | nmdc:mga0a205_45064_c1 | |||
| 2906 | nmdc:mga0a205_49624_c1 | |||
| 2907 | nmdc:mga0a205_74322_c1 | |||
| 2908 | nmdc:mga0a205_99168_c1 | |||
| 2909 | Ga0495601_0008664 | |||
| 2910 | Ga0495612_0005568 | |||
| 2911 | Ga0495612_0008212 | |||
| 2912 | Ga0495595_0004978 | |||
| 2913 | Ga0495619_0005859 | |||
| 2914 | Ga0495619_0217895 | |||
| 2915 | Ga0495619_0244994 | |||
| 2916 | Ga0500628_016637 | |||
| 2917 | Ga0501084_0001120 | |||
| 2918 | Ga0501084_0008248 | |||
| 2919 | Ga0501084_0008981 | |||
| 2920 | Ga0501084_0170970 | |||
| 2921 | Ga0501084_0177275 | |||
| 2922 | Ga0590071_004391 | |||
| 2923 | Ga0590071_011035 | |||
| 2924 | Ga0501082_0000246 | |||
| 2925 | Ga0501082_0018479 | |||
| 2926 | Ga0501082_0044061 | |||
| 2927 | Ga0501082_0083606 | |||
| 2928 | Ga0501082_0110123 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3b85-assembly1.cif.gz_B | crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum | 0.9127 | 105 | 307 |
| 3b85-assembly1.cif.gz_A | crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum | 0.9035 | 105 | 307 |
| 3b85-assembly1.cif.gz_B | crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum | 0.8987 | 105 | 307 |
| 3b85-assembly1.cif.gz_A | crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum | 0.8896 | 105 | 307 |
| 6y2d-assembly1.cif.gz_A | crystal structure of the second kh domain of fubp1 | 0.8844 | 4 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9K1_146_354_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.927 | 105 | 307 | 3.40.50.300 |
| af_Q2FY01_105_312_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9269 | 101 | 307 | 3.40.50.300 |
| af_Q2FY01_105_312_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9183 | 101 | 307 | 3.40.50.300 |
| 3b85B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9046 | 105 | 307 | 3.40.50.300 |
| af_P0A9K1_146_354_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8973 | 105 | 307 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9FHA8-F1-model_v4 | PhoH family protein | 0.9639 | 4 | 86 |
GO:0003723
|
| AF-A0A7V9QPA3-F1-model_v4 | Uncharacterized protein | 0.9607 | 1 | 71 |
GO:0003723
|
| AF-A0A3D4F6P0-F1-model_v4 | deleted | 0.9601 | 181 | 312 |
|
| AF-A0A3D1GVM9-F1-model_v4 | PhoH-like protein | 0.9593 | 174 | 309 |
GO:0005524
GO:0005829 |
| AF-A0A849GTX8-F1-model_v4 | PhoH-like protein | 0.9589 | 173 | 310 |
GO:0005524
GO:0005829 |