F494153

General Info

Members Datasets Scaffolds Average Seq Length
1464 508 2928 415

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10013627|Ga0105250_100136273
Length 486
Sequence MTRKPLDLGGIDAGHAGFSGDHADDLIIWVSAVVAARRPHRYVYAPFQAGARGFRAGRLLAPFGAHGNVMARLVMKFGGTSVADLDRIRNVARHVKREVDAGYDVVVVVSAMAGVTNQLVEWCRQAAMLHDAREYDAVVATGEQVTAGLLALVLEGMGVNARSWQGWQLPILTDNAHASARILNVNGTELIKRFKEHGQVAVIAGFQGMHGDTGRVTTLGRGGSDTSAVAIASAIGAERCDIYTDVDGVYTTDPRVVPQAHRMDKIAYEEMLEFASLGAKVMQVRSVELGMVHNVRIFVRSSFDKPEDIDPKKPPSGTLICDEGDIVEQQVVTGIAFSKDEAQISIRRVQDKPGVAAAIFGPLADNNVNVDMIVQNVSADGATTDLTFTVPSADYERARMTLDKAKGAIGYERLDGATDVAKVSVIGIGMRSHAGVAAKAFKALSGQKINILAITTSEIKFSVLIKAAQTDLAVRTLHTLYGLDRP

Samples

Sample ID Description Type Environment
1 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
161 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
162 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
163 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
233 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
243 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
252 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
253 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
254 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
255 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
256 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
257 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
258 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
261 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
262 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
263 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
264 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
265 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
266 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
267 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
268 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
269 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
270 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
271 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
272 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
273 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
276 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
277 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
278 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
279 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
280 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
281 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
282 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
283 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
284 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
285 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
286 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
287 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
288 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
289 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
290 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
291 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
292 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
293 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
294 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
295 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
299 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
300 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
301 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
302 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
303 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
308 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
309 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
310 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
311 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
312 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
313 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
314 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
315 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
316 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
317 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
318 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
319 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
320 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
321 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
322 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
323 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
324 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
325 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
326 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
327 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
328 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
329 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
330 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
331 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
332 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
333 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
336 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
337 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
338 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
339 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
342 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
343 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
344 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
345 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
346 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
347 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
348 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
349 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
354 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
355 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
356 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
357 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
358 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
359 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
360 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
361 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
362 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
363 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
364 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
365 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
366 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
367 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
368 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
369 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
370 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
371 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
372 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
373 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
374 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
377 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
382 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
385 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
386 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
387 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
388 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
389 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
393 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
398 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
399 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
400 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
401 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
402 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
403 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
404 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
423 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
424 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
425 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
426 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
427 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
428 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
429 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
443 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
444 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
445 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
446 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
447 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
450 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
451 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
452 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
453 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
454 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
459 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
460 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
461 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
462 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
463 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
464 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
465 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
466 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
467 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
468 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
469 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
470 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
471 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
472 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
473 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
479 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
480 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
481 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
482 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
483 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
484 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
485 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
486 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
487 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
488 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
489 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
490 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
491 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
492 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
493 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
494 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
495 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
496 2643221651 Afipia sp. Root123D2 Isolate Unclassified
497 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
498 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
499 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
500 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
501 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
502 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
503 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
504 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
505 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
506 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
507 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
508 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.07
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0.2
Rhizoplane 6.35
Rhizosphere 88.46
Stem 0
Stem Tuber 0.07
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105250_10013627 3300009092 Bacteria 3349
2 2214745200 2209111006 Bacteria 16385
3 ARcpr5oldR_c000003 3300000041 Bacteria 66110
4 ARSoilYngRDRAFT_c00037 3300000042 Bacteria 21051
5 ARcpr5yngRDRAFT_c000010 3300000043 Bacteria 36497
6 ARSoilOldRDRAFT_c000045 3300000044 Bacteria 25938
7 ARCol0yngRDRAFT_1000086 3300000652 Bacteria 17270
8 JGI24741J21665_1005824 3300001915 Bacteria 2530
9 JGI24741J21665_1006916 3300001915 Bacteria 2238
10 JGI24746J21847_1000225 3300001977 Bacteria 7752
11 JGI24740J21852_10018132 3300001979 Bacteria 2505
12 JGI24740J21852_10032414 3300001979 Bacteria 1671
13 JGI24739J22299_10000887 3300001989 Bacteria 11064
14 JGI24739J22299_10002234 3300001989 Bacteria 7439
15 JGI24739J22299_10007003 3300001989 Bacteria 4246
16 JGI24737J22298_10000286 3300001990 Bacteria 16793
17 JGI24737J22298_10018510 3300001990 Bacteria 2235
18 JGI24737J22298_10023419 3300001990 Bacteria 1959
19 JGI24743J22301_10001925 3300001991 Bacteria 3016
20 JGI24743J22301_10004783 3300001991 Bacteria 2225
21 JGI24735J21928_10001811 3300002067 Bacteria 7508
22 JGI24735J21928_10002726 3300002067 Bacteria 6093
23 JGI24750J21931_1000044 3300002070 Bacteria 16702
24 JGI24750J21931_1001976 3300002070 Bacteria 2504
25 JGI24748J21848_1003070 3300002074 Bacteria 1903
26 JGI24738J21930_10000666 3300002075 Bacteria 9974
27 JGI24738J21930_10003659 3300002075 Bacteria 3851
28 JGI24749J21850_1002556 3300002076 Bacteria 2555
29 JGI24744J21845_10001499 3300002077 Bacteria 4642
30 JGI24744J21845_10008784 3300002077 Bacteria 2076
31 JGI24035J26624_1000205 3300002126 Bacteria 5357
32 JGI24034J26672_10000348 3300002239 Bacteria 6015
33 JGI24742J22300_10000091 3300002244 Bacteria 13233
34 JGI24751J29686_10009779 3300002459 Bacteria 1975
35 JGI25406J46586_10033627 3300003203 Bacteria 1891
36 JGI25404J52841_10005123 3300003659 Bacteria 2699
37 Ga0055530_10006443 3300003791 Bacteria 5242
38 Ga0065716_1001671 3300005277 Bacteria 4329
39 Ga0065712_10001083 3300005290 Bacteria 9078
40 Ga0065712_10016249 3300005290 Bacteria 1799
41 Ga0065712_10081197 3300005290 Bacteria 3029
42 Ga0065715_10089726 3300005293 Bacteria 8711
43 Ga0070658_10000264 3300005327 Bacteria 46199
44 Ga0070658_10002220 3300005327 Bacteria 16299
45 Ga0070658_10008993 3300005327 Bacteria 8030
46 Ga0070658_10010453 3300005327 Bacteria 7444
47 Ga0070658_10022506 3300005327 Bacteria 5058
48 Ga0070658_10049510 3300005327 Bacteria 3404
49 Ga0070658_10124174 3300005327 Bacteria 2147
50 Ga0070658_10126593 3300005327 Bacteria 2127
51 Ga0070676_10000186 3300005328 Bacteria 25797
52 Ga0070676_10025905 3300005328 Bacteria 3318
53 Ga0070676_10102088 3300005328 Bacteria 1773
54 Ga0070683_100000064 3300005329 Bacteria 76343
55 Ga0070683_100037722 3300005329 Bacteria 4424
56 Ga0070683_100096585 3300005329 Bacteria 2779
57 Ga0070683_100231247 3300005329 Bacteria 1758
58 Ga0070690_100055973 3300005330 Bacteria 2527
59 Ga0070690_100078858 3300005330 Bacteria 2152
60 Ga0070670_100002541 3300005331 Bacteria 15048
61 Ga0070670_100006533 3300005331 Bacteria 9875
62 Ga0070670_100007186 3300005331 Bacteria 9432
63 Ga0070670_100011611 3300005331 Bacteria 7529
64 Ga0070670_100024387 3300005331 Bacteria 5201
65 Ga0070670_100036861 3300005331 Bacteria 4207
66 Ga0070670_100062640 3300005331 Bacteria 3193
67 Ga0070670_100187930 3300005331 Bacteria 1794
68 Ga0070677_10000050 3300005333 Bacteria 37198
69 Ga0070677_10027622 3300005333 Bacteria 2138
70 Ga0068869_100000191 3300005334 Bacteria 31688
71 Ga0068869_100027748 3300005334 Bacteria 3950
72 Ga0068869_100149583 3300005334 Bacteria 1810
73 Ga0070666_10022428 3300005335 Bacteria 4099
74 Ga0070666_10056441 3300005335 Bacteria 2652
75 Ga0070666_10059573 3300005335 Bacteria 2582
76 Ga0070680_100007728 3300005336 Bacteria 8193
77 Ga0070680_100066516 3300005336 Bacteria 2955
78 Ga0070680_100142711 3300005336 Bacteria 2008
79 Ga0070680_100196106 3300005336 Bacteria 1702
80 Ga0070682_100001714 3300005337 Bacteria 12197
81 Ga0070682_100035477 3300005337 Bacteria 3045
82 Ga0070682_100069856 3300005337 Bacteria 2243
83 Ga0070682_100096978 3300005337 Bacteria 1939
84 Ga0068868_100000233 3300005338 Bacteria 37955
85 Ga0068868_100032246 3300005338 Bacteria 4029
86 Ga0070660_100000091 3300005339 Bacteria 54397
87 Ga0070660_100004304 3300005339 Bacteria 9834
88 Ga0070660_100005461 3300005339 Bacteria 8800
89 Ga0070660_100064748 3300005339 Bacteria 2844
90 Ga0070660_100117995 3300005339 Bacteria 2116
91 Ga0070660_100119041 3300005339 Bacteria 2106
92 Ga0070660_100165159 3300005339 Bacteria 1786
93 Ga0070689_100006518 3300005340 Bacteria 8093
94 Ga0070689_100113223 3300005340 Bacteria 2160
95 Ga0070691_10006662 3300005341 Bacteria 5287
96 Ga0070691_10022854 3300005341 Bacteria 2903
97 Ga0070691_10037130 3300005341 Bacteria 2298
98 Ga0070687_100000337 3300005343 Bacteria 15983
99 Ga0070687_100010015 3300005343 Bacteria 4080
100 Ga0070687_100050606 3300005343 Bacteria 2146
101 Ga0070687_100134806 3300005343 Bacteria 1430
102 Ga0070661_100000188 3300005344 Bacteria 51025
103 Ga0070661_100006306 3300005344 Bacteria 8181
104 Ga0070661_100018063 3300005344 Bacteria 5011
105 Ga0070661_100057653 3300005344 Bacteria 2846
106 Ga0070661_100085828 3300005344 Bacteria 2326
107 Ga0070661_100087437 3300005344 Bacteria 2305
108 Ga0070661_100160492 3300005344 Bacteria 1702
109 Ga0070692_10050483 3300005345 Bacteria 2160
110 Ga0070692_10056796 3300005345 Bacteria 2050
111 Ga0070692_10069571 3300005345 Bacteria 1872
112 Ga0070668_100000409 3300005347 Bacteria 28506
113 Ga0070669_100000523 3300005353 Bacteria 28564
114 Ga0070669_100062266 3300005353 Bacteria 2743
115 Ga0070675_100000034 3300005354 Bacteria 87135
116 Ga0070675_100002418 3300005354 Bacteria 13921
117 Ga0070675_100016370 3300005354 Bacteria 5885
118 Ga0070675_100092638 3300005354 Bacteria 2533
119 Ga0070671_100000111 3300005355 Bacteria 52298
120 Ga0070671_100001584 3300005355 Bacteria 17103
121 Ga0070671_100010789 3300005355 Bacteria 7331
122 Ga0070671_100011792 3300005355 Bacteria 7031
123 Ga0070671_100018174 3300005355 Bacteria 5708
124 Ga0070671_100019157 3300005355 Bacteria 5567
125 Ga0070671_100045533 3300005355 Bacteria 3647
126 Ga0070671_100083737 3300005355 Bacteria 2667
127 Ga0070671_100116863 3300005355 Bacteria 2243
128 Ga0070674_100003026 3300005356 Bacteria 9349
129 Ga0070674_100035850 3300005356 Bacteria 3325
130 Ga0070674_100063764 3300005356 Bacteria 2580
131 Ga0070673_100001357 3300005364 Bacteria 14305
132 Ga0070673_100008515 3300005364 Bacteria 6823
133 Ga0070673_100153387 3300005364 Bacteria 1953
134 Ga0070673_100169148 3300005364 Bacteria 1864
135 Ga0070688_100000401 3300005365 Bacteria 21994
136 Ga0070688_100052107 3300005365 Bacteria 2555
137 Ga0070688_100054570 3300005365 Bacteria 2503
138 Ga0070688_100071567 3300005365 Bacteria 2220
139 Ga0070659_100002194 3300005366 Bacteria 13899
140 Ga0070659_100005493 3300005366 Bacteria 9108
141 Ga0070659_100114249 3300005366 Bacteria 2181
142 Ga0070659_100117346 3300005366 Bacteria 2152
143 Ga0070659_100132646 3300005366 Bacteria 2024
144 Ga0070659_100139737 3300005366 Bacteria 1972
145 Ga0070659_100187150 3300005366 Bacteria 1701
146 Ga0070659_100192052 3300005366 Bacteria 1679
147 Ga0070659_100263079 3300005366 Bacteria 1431
148 Ga0070667_100005633 3300005367 Bacteria 10458
149 Ga0070667_100010235 3300005367 Bacteria 7748
150 Ga0070667_100015164 3300005367 Bacteria 6365
151 Ga0070667_100016010 3300005367 Bacteria 6204
152 Ga0070667_100058925 3300005367 Bacteria 3247
153 Ga0070667_100186025 3300005367 Bacteria 1838
154 Ga0070667_100253537 3300005367 Bacteria 1574
155 Ga0070709_10028699 3300005434 Bacteria 3321
156 Ga0070709_10035379 3300005434 Bacteria 3035
157 Ga0070714_100011938 3300005435 Bacteria 6910
158 Ga0070714_100022892 3300005435 Bacteria 5127
159 Ga0070714_100050119 3300005435 Bacteria 3555
160 Ga0070714_100087174 3300005435 Bacteria 2730
161 Ga0070714_100238776 3300005435 Bacteria 1677
162 Ga0070713_100007751 3300005436 Bacteria 7560
163 Ga0070713_100010936 3300005436 Bacteria 6581
164 Ga0070713_100063116 3300005436 Bacteria 3104
165 Ga0070713_100067951 3300005436 Bacteria 3002
166 Ga0070710_10008568 3300005437 Bacteria 4978
167 Ga0070710_10010806 3300005437 Bacteria 4490
168 Ga0070710_10021500 3300005437 Bacteria 3364
169 Ga0070710_10022840 3300005437 Bacteria 3279
170 Ga0070701_10000524 3300005438 Bacteria 13233
171 Ga0070701_10019632 3300005438 Bacteria 3195
172 Ga0070711_100011116 3300005439 Bacteria 5585
173 Ga0070711_100015201 3300005439 Bacteria 4868
174 Ga0070711_100023573 3300005439 Bacteria 4005
175 Ga0070705_100000252 3300005440 Bacteria 31840
176 Ga0070700_100000657 3300005441 Bacteria 17071
177 Ga0070700_100006474 3300005441 Bacteria 6269
178 Ga0070694_100021318 3300005444 Bacteria 4139
179 Ga0070694_100089908 3300005444 Bacteria 2152
180 Ga0070708_100112727 3300005445 Bacteria 2501
181 Ga0070663_100004855 3300005455 Bacteria 7931
182 Ga0070663_100015911 3300005455 Bacteria 4870
183 Ga0070663_100028662 3300005455 Bacteria 3794
184 Ga0070663_100085590 3300005455 Bacteria 2326
185 Ga0070663_100121253 3300005455 Bacteria 1975
186 Ga0070663_100131583 3300005455 Bacteria 1900
187 Ga0070663_100191807 3300005455 Bacteria 1590
188 Ga0070678_100001414 3300005456 Bacteria 12797
189 Ga0070678_100010734 3300005456 Bacteria 5611
190 Ga0070678_100011766 3300005456 Bacteria 5411
191 Ga0070662_100001002 3300005457 Bacteria 17247
192 Ga0070662_100017420 3300005457 Bacteria 4844
193 Ga0070662_100064810 3300005457 Bacteria 2676
194 Ga0070662_100069580 3300005457 Bacteria 2591
195 Ga0070662_100076669 3300005457 Bacteria 2479
196 Ga0070681_10047969 3300005458 Bacteria 4268
197 Ga0070681_10052703 3300005458 Bacteria 4058
198 Ga0070681_10071322 3300005458 Bacteria 3438
199 Ga0070681_10072311 3300005458 Bacteria 3411
200 Ga0070681_10082351 3300005458 Bacteria 3173
201 Ga0070681_10123273 3300005458 Bacteria 2524
202 Ga0068867_100001011 3300005459 Bacteria 19191
203 Ga0068867_100083074 3300005459 Bacteria 2417
204 Ga0070685_10002699 3300005466 Bacteria 9088
205 Ga0070685_10065248 3300005466 Bacteria 2142
206 Ga0070707_100043599 3300005468 Bacteria 4293
207 Ga0070699_100014320 3300005518 Bacteria 6819
208 Ga0070679_100004731 3300005530 Bacteria 12558
209 Ga0070679_100016615 3300005530 Bacteria 7107
210 Ga0070679_100034565 3300005530 Bacteria 5010
211 Ga0070679_100036926 3300005530 Bacteria 4850
212 Ga0070679_100150520 3300005530 Bacteria 2304
213 Ga0070679_100261883 3300005530 Bacteria 1684
214 Ga0070684_100000275 3300005535 Bacteria 35701
215 Ga0070684_100031635 3300005535 Bacteria 4506
216 Ga0070684_100061891 3300005535 Bacteria 3277
217 Ga0070684_100123682 3300005535 Bacteria 2328
218 Ga0070684_100134572 3300005535 Bacteria 2232
219 Ga0070697_100137122 3300005536 Bacteria 2055
220 Ga0068853_100002273 3300005539 Bacteria 14352
221 Ga0068853_100017670 3300005539 Bacteria 5886
222 Ga0068853_100083372 3300005539 Bacteria 2801
223 Ga0068853_100160014 3300005539 Bacteria 2031
224 Ga0068853_100251885 3300005539 Bacteria 1620
225 Ga0070672_100000008 3300005543 Bacteria 91782
226 Ga0070672_100013010 3300005543 Bacteria 5865
227 Ga0070672_100027974 3300005543 Bacteria 4212
228 Ga0070672_100028466 3300005543 Bacteria 4180
229 Ga0070672_100094811 3300005543 Bacteria 2413
230 Ga0070686_100062116 3300005544 Bacteria 2416
231 Ga0070686_100080097 3300005544 Bacteria 2160
232 Ga0070695_100063612 3300005545 Bacteria 2398
233 Ga0070696_100017449 3300005546 Bacteria 4844
234 Ga0070696_100056926 3300005546 Bacteria 2728
235 Ga0070696_100070532 3300005546 Bacteria 2458
236 Ga0070696_100250150 3300005546 Bacteria 1340
237 Ga0070693_100007754 3300005547 Bacteria 5264
238 Ga0070693_100008375 3300005547 Bacteria 5095
239 Ga0070665_100043426 3300005548 Bacteria 4518
240 Ga0070704_100001016 3300005549 Bacteria 14398
241 Ga0070704_100091417 3300005549 Bacteria 2269
242 Ga0068855_100000129 3300005563 Bacteria 96519
243 Ga0068855_100007455 3300005563 Bacteria 13251
244 Ga0068855_100033428 3300005563 Bacteria 6137
245 Ga0068855_100034657 3300005563 Bacteria 6016
246 Ga0068855_100055594 3300005563 Bacteria 4648
247 Ga0068855_100058535 3300005563 Bacteria 4512
248 Ga0068855_100187219 3300005563 Bacteria 2337
249 Ga0068855_100217650 3300005563 Bacteria 2143
250 Ga0070664_100000419 3300005564 Bacteria 31758
251 Ga0070664_100005421 3300005564 Bacteria 10239
252 Ga0070664_100017741 3300005564 Bacteria 5847
253 Ga0070664_100036462 3300005564 Bacteria 4131
254 Ga0070664_100048170 3300005564 Bacteria 3601
255 Ga0070664_100232242 3300005564 Bacteria 1654
256 Ga0068857_100002666 3300005577 Bacteria 14652
257 Ga0068857_100009744 3300005577 Bacteria 8343
258 Ga0068857_100012690 3300005577 Bacteria 7343
259 Ga0068857_100244218 3300005577 Bacteria 1644
260 Ga0068854_100001824 3300005578 Bacteria 12963
261 Ga0068854_100037514 3300005578 Bacteria 3402
262 Ga0068856_100000963 3300005614 Bacteria 30708
263 Ga0070702_100003016 3300005615 Bacteria 7444
264 Ga0070702_100008357 3300005615 Bacteria 5009
265 Ga0068852_100001994 3300005616 Bacteria 13910
266 Ga0068852_100015664 3300005616 Bacteria 5889
267 Ga0068852_100039158 3300005616 Bacteria 3989
268 Ga0068852_100044588 3300005616 Bacteria 3767
269 Ga0068852_100090988 3300005616 Bacteria 2730
270 Ga0068852_100179374 3300005616 Bacteria 1991
271 Ga0068859_100000088 3300005617 Bacteria 84390
272 Ga0068859_100107572 3300005617 Bacteria 2849
273 Ga0068859_100132405 3300005617 Bacteria 2565
274 Ga0068859_100209476 3300005617 Bacteria 2035
275 Ga0068859_100311275 3300005617 Bacteria 1668
276 Ga0068859_100397254 3300005617 Bacteria 1474
277 Ga0068864_100000136 3300005618 Bacteria 70797
278 Ga0068864_100001346 3300005618 Bacteria 20428
279 Ga0068864_100003805 3300005618 Bacteria 12441
280 Ga0068864_100019015 3300005618 Bacteria 5742
281 Ga0068866_10000291 3300005718 Bacteria 23901
282 Ga0068861_100001924 3300005719 Bacteria 13364
283 Ga0068861_100116771 3300005719 Bacteria 2146
284 Ga0068851_10049564 3300005834 Bacteria 2130
285 Ga0068870_10000005 3300005840 Bacteria 79445
286 Ga0068863_100000384 3300005841 Bacteria 44825
287 Ga0068863_100000608 3300005841 Bacteria 36316
288 Ga0068863_100024134 3300005841 Bacteria 5802
289 Ga0068863_100074646 3300005841 Bacteria 3208
290 Ga0068863_100107829 3300005841 Bacteria 2650
291 Ga0068863_100271166 3300005841 Bacteria 1643
292 Ga0068858_100000063 3300005842 Bacteria 111811
293 Ga0068858_100011061 3300005842 Bacteria 8532
294 Ga0068858_100021963 3300005842 Bacteria 5960
295 Ga0068858_100026552 3300005842 Bacteria 5379
296 Ga0068858_100149146 3300005842 Bacteria 2198
297 Ga0068858_100244735 3300005842 Bacteria 1702
298 Ga0068860_100001183 3300005843 Bacteria 28556
299 Ga0068860_100022772 3300005843 Bacteria 6058
300 Ga0068860_100034044 3300005843 Bacteria 4886
301 Ga0068860_100067885 3300005843 Bacteria 3387
302 Ga0068860_100079433 3300005843 Bacteria 3119
303 Ga0068860_100080163 3300005843 Bacteria 3105
304 Ga0068860_100113496 3300005843 Bacteria 2591
305 Ga0068860_100198147 3300005843 Bacteria 1945
306 Ga0068860_100237878 3300005843 Bacteria 1771
307 Ga0068862_100007190 3300005844 Bacteria 9245
308 Ga0068862_100010432 3300005844 Bacteria 7672
309 Ga0068862_100011427 3300005844 Bacteria 7328
310 Ga0068862_100017057 3300005844 Bacteria 6042
311 Ga0068862_100024857 3300005844 Bacteria 5026
312 Ga0068862_100079551 3300005844 Bacteria 2841
313 Ga0081455_10000002 3300005937 Bacteria 460472
314 Ga0081455_10000329 3300005937 Bacteria 62107
315 Ga0081455_10015834 3300005937 Bacteria 7303
316 Ga0081538_10002523 3300005981 Bacteria 17830
317 Ga0081538_10021900 3300005981 Bacteria 4647
318 Ga0081540_1001201 3300005983 Bacteria 22688
319 Ga0081540_1009095 3300005983 Bacteria 6860
320 Ga0081540_1010246 3300005983 Bacteria 6365
321 Ga0081539_10000522 3300005985 Bacteria 79973
322 Ga0070717_10001785 3300006028 Bacteria 14994
323 Ga0075365_10013799 3300006038 Bacteria 4847
324 Ga0075365_10024810 3300006038 Bacteria 3789
325 Ga0075368_10000129 3300006042 Bacteria 20027
326 Ga0075363_100002771 3300006048 Bacteria 7269
327 Ga0075363_100004616 3300006048 Bacteria 6051
328 Ga0075432_10013821 3300006058 Bacteria 2746
329 Ga0070715_10005920 3300006163 Bacteria 4120
330 Ga0070715_10009052 3300006163 Bacteria 3495
331 Ga0070715_10025330 3300006163 Bacteria 2348
332 Ga0070716_100000730 3300006173 Bacteria 14019
333 Ga0070716_100012351 3300006173 Bacteria 4327
334 Ga0070716_100044410 3300006173 Bacteria 2489
335 Ga0070712_100000963 3300006175 Bacteria 17331
336 Ga0070712_100041974 3300006175 Bacteria 3144
337 Ga0070712_100048764 3300006175 Bacteria 2937
338 Ga0070712_100153292 3300006175 Bacteria 1771
339 Ga0075362_10013349 3300006177 Bacteria 3288
340 Ga0075367_10002669 3300006178 Bacteria 8224
341 Ga0075367_10014764 3300006178 Bacteria 4230
342 Ga0075427_10000026 3300006194 Bacteria 9852
343 Ga0075366_10089288 3300006195 Bacteria 1846
344 Ga0097621_100000006 3300006237 Bacteria 134536
345 Ga0097621_100008279 3300006237 Bacteria 7484
346 Ga0097621_100182116 3300006237 Bacteria 1815
347 Ga0068871_100000022 3300006358 Bacteria 82775
348 Ga0068871_100030110 3300006358 Bacteria 4271
349 Ga0068871_100200826 3300006358 Bacteria 1721
350 Ga0075428_100003527 3300006844 Bacteria 17133
351 Ga0075428_100009313 3300006844 Bacteria 10891
352 Ga0075428_100055661 3300006844 Bacteria 4334
353 Ga0075430_100001061 3300006846 Bacteria 21766
354 Ga0075430_100005415 3300006846 Bacteria 10781
355 Ga0075430_100034066 3300006846 Bacteria 4322
356 Ga0075430_100069113 3300006846 Bacteria 2963
357 Ga0075431_100000856 3300006847 Bacteria 26728
358 Ga0075431_100035384 3300006847 Bacteria 5142
359 Ga0075433_10003278 3300006852 Bacteria 12496
360 Ga0075433_10028588 3300006852 Bacteria 4741
361 Ga0075434_100000346 3300006871 Bacteria 33425
362 Ga0075434_100017393 3300006871 Bacteria 6926
363 Ga0075434_100035969 3300006871 Bacteria 4897
364 Ga0075434_100171152 3300006871 Bacteria 2192
365 Ga0075429_100001137 3300006880 Bacteria 21442
366 Ga0075429_100007463 3300006880 Bacteria 9488
367 Ga0075429_100022293 3300006880 Bacteria 5493
368 Ga0068865_100000196 3300006881 Bacteria 33650
369 Ga0068865_100133796 3300006881 Bacteria 1860
370 Ga0097620_100000088 3300006931 Bacteria 84390
371 Ga0097620_100107561 3300006931 Bacteria 2849
372 Ga0097620_100132405 3300006931 Bacteria 2565
373 Ga0097620_100209474 3300006931 Bacteria 2035
374 Ga0097620_100311247 3300006931 Bacteria 1668
375 Ga0097620_100397247 3300006931 Bacteria 1474
376 Ga0075435_100003799 3300007076 Bacteria 10296
377 Ga0075435_100019065 3300007076 Bacteria 5230
378 Ga0075435_100038442 3300007076 Bacteria 3815
379 Ga0099795_10033014 3300007788 Bacteria 1794
380 Ga0099795_10048007 3300007788 Bacteria 1544
381 Ga0105251_10034057 3300009011 Bacteria 2524
382 Ga0105240_10021899 3300009093 Bacteria 8490
383 Ga0105240_10068944 3300009093 Bacteria 4379
384 Ga0105240_10190806 3300009093 Bacteria 2410
385 Ga0105240_10380728 3300009093 Bacteria 1594
386 Ga0111539_10000817 3300009094 Bacteria 40427
387 Ga0111539_10001765 3300009094 Bacteria 28723
388 Ga0111539_10001792 3300009094 Bacteria 28559
389 Ga0111539_10016539 3300009094 Bacteria 9143
390 Ga0111539_10289486 3300009094 Bacteria 1906
391 Ga0105245_10006255 3300009098 Bacteria 10475
392 Ga0105245_10051976 3300009098 Bacteria 3674
393 Ga0105245_10053755 3300009098 Bacteria 3615
394 Ga0105245_10160885 3300009098 Bacteria 2130
395 Ga0105247_10004177 3300009101 Bacteria 9267
396 Ga0105247_10014764 3300009101 Bacteria 4682
397 Ga0105247_10113196 3300009101 Bacteria 1749
398 Ga0114129_10001060 3300009147 Bacteria 36097
399 Ga0114129_10003956 3300009147 Bacteria 20922
400 Ga0114129_10021909 3300009147 Bacteria 9069
401 Ga0114129_10024577 3300009147 Bacteria 8536
402 Ga0105243_10003212 3300009148 Bacteria 13374
403 Ga0105241_10002185 3300009174 Bacteria 14733
404 Ga0105241_10022254 3300009174 Bacteria 4693
405 Ga0105241_10044485 3300009174 Bacteria 3365
406 Ga0105242_10002746 3300009176 Bacteria 13773
407 Ga0105242_10023628 3300009176 Bacteria 4845
408 Ga0105248_10000169 3300009177 Bacteria 75948
409 Ga0105248_10005067 3300009177 Bacteria 14550
410 Ga0105248_10006401 3300009177 Bacteria 12919
411 Ga0105248_10020884 3300009177 Bacteria 7257
412 Ga0105248_10021626 3300009177 Bacteria 7124
413 Ga0105248_10214425 3300009177 Bacteria 2169
414 Ga0105237_10085695 3300009545 Bacteria 3140
415 Ga0105237_10096569 3300009545 Bacteria 2945
416 Ga0105238_10004728 3300009551 Bacteria 13465
417 Ga0105238_10038260 3300009551 Bacteria 4871
418 Ga0105249_10003096 3300009553 Bacteria 14360
419 Ga0105249_10039603 3300009553 Bacteria 4279
420 Ga0105249_10139808 3300009553 Bacteria 2321
421 Ga0105239_10001436 3300010375 Bacteria 31755
422 Ga0105239_10021456 3300010375 Bacteria 7121
423 Ga0105239_10025721 3300010375 Bacteria 6482
424 Ga0105239_10079131 3300010375 Bacteria 3617
425 Ga0105246_10001322 3300011119 Bacteria 14587
426 Ga0105246_10056113 3300011119 Bacteria 2721
427 Ga0105246_10122645 3300011119 Bacteria 1928
428 Ga0157373_10014713 3300013100 Bacteria 5732
429 Ga0157373_10062685 3300013100 Bacteria 2633
430 Ga0157371_10005808 3300013102 Bacteria 10326
431 Ga0157371_10011416 3300013102 Bacteria 6846
432 Ga0157371_10031596 3300013102 Bacteria 3815
433 Ga0157371_10035537 3300013102 Bacteria 3570
434 Ga0157371_10036397 3300013102 Bacteria 3525
435 Ga0157371_10123912 3300013102 Bacteria 1838
436 Ga0157371_10202790 3300013102 Bacteria 1422
437 Ga0157371_10211537 3300013102 Bacteria 1392
438 Ga0157370_10021346 3300013104 Bacteria 6452
439 Ga0157370_10040486 3300013104 Bacteria 4499
440 Ga0157369_10042326 3300013105 Bacteria 4969
441 Ga0157369_10088883 3300013105 Bacteria 3298
442 Ga0157374_10023096 3300013296 Bacteria 5557
443 Ga0157374_10059192 3300013296 Bacteria 3581
444 Ga0157378_10004038 3300013297 Bacteria 12960
445 Ga0157378_10050000 3300013297 Bacteria 3720
446 Ga0163162_10002546 3300013306 Bacteria 17252
447 Ga0163162_10039471 3300013306 Bacteria 4718
448 Ga0163162_10041821 3300013306 Bacteria 4585
449 Ga0163162_10370488 3300013306 Bacteria 1565
450 Ga0157372_10029143 3300013307 Bacteria 6025
451 Ga0157372_10066996 3300013307 Bacteria 4034
452 Ga0157372_10068034 3300013307 Bacteria 4004
453 Ga0157372_10243052 3300013307 Bacteria 2089
454 Ga0157372_10336092 3300013307 Bacteria 1759
455 Ga0157375_10056614 3300013308 Bacteria 3872
456 Ga0157375_10161948 3300013308 Bacteria 2380
457 Ga0163163_10000170 3300014325 Bacteria 68377
458 Ga0163163_10001683 3300014325 Bacteria 18663
459 Ga0163163_10066801 3300014325 Bacteria 3573
460 Ga0163163_10122875 3300014325 Bacteria 2631
461 Ga0163163_10188748 3300014325 Bacteria 2109
462 Ga0157380_10067347 3300014326 Bacteria 2883
463 Ga0157377_10000127 3300014745 Bacteria 49198
464 Ga0157379_10008840 3300014968 Bacteria 8784
465 Ga0157379_10008961 3300014968 Bacteria 8721
466 Ga0157379_10013169 3300014968 Bacteria 7241
467 Ga0157379_10054179 3300014968 Bacteria 3584
468 Ga0157376_10000126 3300014969 Bacteria 52844
469 Ga0157376_10011024 3300014969 Bacteria 6643
470 Ga0163161_10000562 3300017792 Bacteria 29937
471 Ga0163161_10049148 3300017792 Bacteria 3047
472 Ga0213874_10001300 3300021377 Bacteria 5163
473 Ga0213876_10054320 3300021384 Bacteria 2115
474 Ga0228598_1000321 3300024227 Bacteria 9375
475 Ga0207666_1002396 3300025271 Bacteria 2260
476 Ga0207673_1000208 3300025290 Bacteria 5916
477 Ga0209050_1000262 3300025298 Bacteria 112798
478 Ga0207697_10029097 3300025315 Bacteria 2260
479 Ga0207653_10009245 3300025885 Bacteria 3070
480 Ga0207682_10000001 3300025893 Bacteria 152713
481 Ga0207682_10001899 3300025893 Bacteria 9485
482 Ga0207692_10034318 3300025898 Bacteria 2455
483 Ga0207692_10041374 3300025898 Bacteria 2281
484 Ga0207642_10001429 3300025899 Bacteria 7409
485 Ga0207710_10000895 3300025900 Bacteria 15956
486 Ga0207710_10005202 3300025900 Bacteria 5624
487 Ga0207688_10001997 3300025901 Bacteria 10941
488 Ga0207688_10008183 3300025901 Bacteria 5683
489 Ga0207688_10053713 3300025901 Bacteria 2260
490 Ga0207680_10007725 3300025903 Bacteria 5257
491 Ga0207647_10000627 3300025904 Bacteria 27507
492 Ga0207647_10002335 3300025904 Bacteria 14419
493 Ga0207647_10004040 3300025904 Bacteria 10933
494 Ga0207647_10006288 3300025904 Bacteria 8647
495 Ga0207647_10097072 3300025904 Bacteria 1753
496 Ga0207647_10120962 3300025904 Bacteria 1544
497 Ga0207699_10044303 3300025906 Bacteria 2590
498 Ga0207699_10045606 3300025906 Bacteria 2560
499 Ga0207645_10000276 3300025907 Bacteria 42632
500 Ga0207645_10005447 3300025907 Bacteria 9222
501 Ga0207645_10020893 3300025907 Bacteria 4277
502 Ga0207643_10000041 3300025908 Bacteria 85133
503 Ga0207643_10000613 3300025908 Bacteria 22494
504 Ga0207643_10117178 3300025908 Bacteria 1574
505 Ga0207705_10000091 3300025909 Bacteria 110768
506 Ga0207705_10009087 3300025909 Bacteria 7244
507 Ga0207705_10018644 3300025909 Bacteria 4962
508 Ga0207705_10029024 3300025909 Bacteria 3945
509 Ga0207705_10035312 3300025909 Bacteria 3576
510 Ga0207705_10037339 3300025909 Bacteria 3476
511 Ga0207705_10044392 3300025909 Bacteria 3194
512 Ga0207705_10049030 3300025909 Bacteria 3039
513 Ga0207705_10069088 3300025909 Bacteria 2558
514 Ga0207654_10003566 3300025911 Bacteria 7872
515 Ga0207654_10028711 3300025911 Bacteria 3035
516 Ga0207707_10005534 3300025912 Bacteria 11046
517 Ga0207707_10017298 3300025912 Bacteria 6284
518 Ga0207707_10041404 3300025912 Bacteria 4023
519 Ga0207707_10059659 3300025912 Bacteria 3319
520 Ga0207707_10185051 3300025912 Bacteria 1818
521 Ga0207707_10205317 3300025912 Bacteria 1717
522 Ga0207695_10043579 3300025913 Bacteria 4782
523 Ga0207671_10013164 3300025914 Bacteria 6606
524 Ga0207671_10054159 3300025914 Bacteria 2973
525 Ga0207693_10004802 3300025915 Bacteria 11369
526 Ga0207693_10005773 3300025915 Bacteria 10265
527 Ga0207693_10012871 3300025915 Bacteria 6750
528 Ga0207693_10052850 3300025915 Bacteria 3187
529 Ga0207693_10054500 3300025915 Bacteria 3136
530 Ga0207693_10093817 3300025915 Bacteria 2352
531 Ga0207663_10004685 3300025916 Bacteria 6826
532 Ga0207663_10018835 3300025916 Bacteria 3877
533 Ga0207663_10036004 3300025916 Bacteria 2974
534 Ga0207660_10000006 3300025917 Bacteria 106298
535 Ga0207660_10000864 3300025917 Bacteria 20005
536 Ga0207660_10006249 3300025917 Bacteria 7734
537 Ga0207660_10043755 3300025917 Bacteria 3147
538 Ga0207660_10237190 3300025917 Bacteria 1436
539 Ga0207662_10000207 3300025918 Bacteria 27378
540 Ga0207662_10003504 3300025918 Bacteria 8083
541 Ga0207662_10011850 3300025918 Bacteria 4847
542 Ga0207662_10024769 3300025918 Bacteria 3454
543 Ga0207662_10110690 3300025918 Bacteria 1712
544 Ga0207657_10000092 3300025919 Bacteria 85665
545 Ga0207657_10000252 3300025919 Bacteria 57036
546 Ga0207657_10001742 3300025919 Bacteria 23458
547 Ga0207657_10002395 3300025919 Bacteria 20270
548 Ga0207657_10004547 3300025919 Bacteria 14659
549 Ga0207657_10004799 3300025919 Bacteria 14261
550 Ga0207657_10015568 3300025919 Bacteria 7362
551 Ga0207657_10018720 3300025919 Bacteria 6600
552 Ga0207657_10019350 3300025919 Bacteria 6469
553 Ga0207657_10019526 3300025919 Bacteria 6433
554 Ga0207657_10019679 3300025919 Bacteria 6401
555 Ga0207657_10024115 3300025919 Bacteria 5648
556 Ga0207657_10040408 3300025919 Bacteria 4133
557 Ga0207657_10054523 3300025919 Bacteria 3457
558 Ga0207657_10164423 3300025919 Bacteria 1801
559 Ga0207649_10000049 3300025920 Bacteria 109723
560 Ga0207649_10114529 3300025920 Bacteria 1807
561 Ga0207652_10000300 3300025921 Bacteria 51095
562 Ga0207652_10015009 3300025921 Bacteria 6284
563 Ga0207652_10017153 3300025921 Bacteria 5922
564 Ga0207652_10070600 3300025921 Bacteria 3033
565 Ga0207652_10085936 3300025921 Bacteria 2757
566 Ga0207652_10114203 3300025921 Bacteria 2398
567 Ga0207681_10000024 3300025923 Bacteria 206607
568 Ga0207681_10018745 3300025923 Bacteria 4364
569 Ga0207694_10001718 3300025924 Bacteria 18345
570 Ga0207694_10007596 3300025924 Bacteria 8220
571 Ga0207650_10000990 3300025925 Bacteria 21364
572 Ga0207650_10005202 3300025925 Bacteria 8873
573 Ga0207650_10007269 3300025925 Bacteria 7540
574 Ga0207650_10019900 3300025925 Bacteria 4724
575 Ga0207650_10044215 3300025925 Bacteria 3272
576 Ga0207659_10000042 3300025926 Bacteria 90881
577 Ga0207659_10000885 3300025926 Bacteria 17789
578 Ga0207659_10024411 3300025926 Bacteria 4050
579 Ga0207659_10033789 3300025926 Bacteria 3523
580 Ga0207659_10245158 3300025926 Bacteria 1451
581 Ga0207687_10003253 3300025927 Bacteria 11003
582 Ga0207687_10124486 3300025927 Bacteria 1933
583 Ga0207700_10001840 3300025928 Bacteria 12027
584 Ga0207700_10142645 3300025928 Bacteria 1970
585 Ga0207664_10035347 3300025929 Bacteria 3855
586 Ga0207664_10042440 3300025929 Bacteria 3550
587 Ga0207664_10051499 3300025929 Bacteria 3251
588 Ga0207664_10171022 3300025929 Bacteria 1860
589 Ga0207644_10000041 3300025931 Bacteria 114951
590 Ga0207644_10001327 3300025931 Bacteria 15896
591 Ga0207644_10005264 3300025931 Bacteria 8445
592 Ga0207644_10015084 3300025931 Bacteria 5184
593 Ga0207644_10048211 3300025931 Bacteria 3044
594 Ga0207644_10057501 3300025931 Bacteria 2808
595 Ga0207644_10120300 3300025931 Bacteria 1998
596 Ga0207690_10000137 3300025932 Bacteria 59768
597 Ga0207690_10000709 3300025932 Bacteria 21444
598 Ga0207690_10002665 3300025932 Bacteria 10761
599 Ga0207690_10015489 3300025932 Bacteria 4622
600 Ga0207690_10031479 3300025932 Bacteria 3395
601 Ga0207690_10042617 3300025932 Bacteria 2982
602 Ga0207690_10054048 3300025932 Bacteria 2698
603 Ga0207690_10136594 3300025932 Bacteria 1801
604 Ga0207690_10148699 3300025932 Bacteria 1734
605 Ga0207706_10000568 3300025933 Bacteria 39206
606 Ga0207706_10000746 3300025933 Bacteria 33880
607 Ga0207706_10004407 3300025933 Bacteria 13227
608 Ga0207706_10010385 3300025933 Bacteria 8503
609 Ga0207706_10011126 3300025933 Bacteria 8200
610 Ga0207706_10015457 3300025933 Bacteria 6895
611 Ga0207706_10024460 3300025933 Bacteria 5415
612 Ga0207706_10027262 3300025933 Bacteria 5109
613 Ga0207706_10065107 3300025933 Bacteria 3209
614 Ga0207706_10131449 3300025933 Bacteria 2202
615 Ga0207706_10281828 3300025933 Bacteria 1449
616 Ga0207686_10000571 3300025934 Bacteria 23350
617 Ga0207686_10056004 3300025934 Bacteria 2476
618 Ga0207709_10000220 3300025935 Bacteria 72291
619 Ga0207709_10010336 3300025935 Bacteria 5140
620 Ga0207709_10089212 3300025935 Bacteria 2010
621 Ga0207709_10201888 3300025935 Bacteria 1421
622 Ga0207670_10000323 3300025936 Bacteria 28564
623 Ga0207669_10000005 3300025937 Bacteria 185218
624 Ga0207669_10004706 3300025937 Bacteria 6039
625 Ga0207669_10007517 3300025937 Bacteria 5045
626 Ga0207669_10008276 3300025937 Bacteria 4873
627 Ga0207704_10000060 3300025938 Bacteria 76535
628 Ga0207665_10000117 3300025939 Bacteria 52204
629 Ga0207665_10000210 3300025939 Bacteria 39483
630 Ga0207691_10005532 3300025940 Bacteria 12201
631 Ga0207691_10006907 3300025940 Bacteria 10948
632 Ga0207691_10017079 3300025940 Bacteria 6884
633 Ga0207691_10037116 3300025940 Bacteria 4513
634 Ga0207691_10077281 3300025940 Bacteria 2999
635 Ga0207691_10129432 3300025940 Bacteria 2231
636 Ga0207691_10129978 3300025940 Bacteria 2225
637 Ga0207711_10000039 3300025941 Bacteria 162974
638 Ga0207711_10001557 3300025941 Bacteria 21221
639 Ga0207711_10014181 3300025941 Bacteria 6620
640 Ga0207711_10015227 3300025941 Bacteria 6384
641 Ga0207711_10022126 3300025941 Bacteria 5314
642 Ga0207711_10031874 3300025941 Bacteria 4453
643 Ga0207711_10063794 3300025941 Bacteria 3181
644 Ga0207711_10070811 3300025941 Bacteria 3025
645 Ga0207689_10000053 3300025942 Bacteria 88245
646 Ga0207689_10007517 3300025942 Bacteria 9554
647 Ga0207689_10009414 3300025942 Bacteria 8439
648 Ga0207689_10027153 3300025942 Bacteria 4793
649 Ga0207689_10052697 3300025942 Bacteria 3352
650 Ga0207661_10000036 3300025944 Bacteria 149720
651 Ga0207661_10019697 3300025944 Bacteria 5036
652 Ga0207679_10000060 3300025945 Bacteria 100711
653 Ga0207679_10002925 3300025945 Bacteria 10572
654 Ga0207679_10010577 3300025945 Bacteria 5946
655 Ga0207679_10026824 3300025945 Bacteria 3976
656 Ga0207679_10081322 3300025945 Bacteria 2477
657 Ga0207679_10106286 3300025945 Bacteria 2206
658 Ga0207679_10139096 3300025945 Bacteria 1960
659 Ga0207667_10000303 3300025949 Bacteria 68209
660 Ga0207667_10197000 3300025949 Bacteria 2067
661 Ga0207667_10198839 3300025949 Bacteria 2056
662 Ga0207651_10000014 3300025960 Bacteria 166931
663 Ga0207651_10224986 3300025960 Bacteria 1519
664 Ga0207712_10000134 3300025961 Bacteria 78054
665 Ga0207712_10000195 3300025961 Bacteria 62560
666 Ga0207712_10116473 3300025961 Bacteria 2014
667 Ga0207668_10000350 3300025972 Bacteria 29956
668 Ga0207668_10075099 3300025972 Bacteria 2429
669 Ga0207668_10114395 3300025972 Bacteria 2031
670 Ga0207668_10132031 3300025972 Bacteria 1908
671 Ga0207668_10137641 3300025972 Bacteria 1873
672 Ga0207640_10001960 3300025981 Bacteria 11088
673 Ga0207640_10026231 3300025981 Bacteria 3535
674 Ga0207658_10001042 3300025986 Bacteria 22510
675 Ga0207658_10001227 3300025986 Bacteria 20271
676 Ga0207658_10003771 3300025986 Bacteria 10675
677 Ga0207658_10017582 3300025986 Bacteria 4930
678 Ga0207658_10071331 3300025986 Bacteria 2630
679 Ga0207658_10072259 3300025986 Bacteria 2615
680 Ga0207658_10257038 3300025986 Bacteria 1487
681 Ga0207658_10268364 3300025986 Bacteria 1457
682 Ga0207677_10003136 3300026023 Bacteria 8720
683 Ga0207677_10003572 3300026023 Bacteria 8236
684 Ga0207703_10000327 3300026035 Bacteria 51797
685 Ga0207703_10032671 3300026035 Bacteria 4119
686 Ga0207703_10250734 3300026035 Bacteria 1595
687 Ga0207703_10302439 3300026035 Bacteria 1459
688 Ga0207639_10000835 3300026041 Bacteria 20893
689 Ga0207639_10001105 3300026041 Bacteria 18312
690 Ga0207639_10048488 3300026041 Bacteria 3215
691 Ga0207639_10093241 3300026041 Bacteria 2414
692 Ga0207678_10000892 3300026067 Bacteria 27377
693 Ga0207678_10001535 3300026067 Bacteria 21206
694 Ga0207678_10001718 3300026067 Bacteria 20053
695 Ga0207678_10003104 3300026067 Bacteria 15046
696 Ga0207678_10011286 3300026067 Bacteria 7843
697 Ga0207678_10026959 3300026067 Bacteria 5011
698 Ga0207678_10034704 3300026067 Bacteria 4393
699 Ga0207678_10041314 3300026067 Bacteria 3998
700 Ga0207678_10047163 3300026067 Bacteria 3727
701 Ga0207678_10099602 3300026067 Bacteria 2482
702 Ga0207678_10160785 3300026067 Bacteria 1918
703 Ga0207678_10161923 3300026067 Bacteria 1911
704 Ga0207708_10001777 3300026075 Bacteria 15902
705 Ga0207708_10101112 3300026075 Bacteria 2231
706 Ga0207708_10101648 3300026075 Bacteria 2225
707 Ga0207702_10011181 3300026078 Bacteria 7486
708 Ga0207702_10091065 3300026078 Bacteria 2669
709 Ga0207641_10000138 3300026088 Bacteria 106531
710 Ga0207641_10000664 3300026088 Bacteria 37481
711 Ga0207641_10009374 3300026088 Bacteria 8069
712 Ga0207641_10054912 3300026088 Bacteria 3382
713 Ga0207641_10142163 3300026088 Bacteria 2166
714 Ga0207648_10004308 3300026089 Bacteria 14655
715 Ga0207648_10017594 3300026089 Bacteria 6493
716 Ga0207648_10063136 3300026089 Bacteria 3229
717 Ga0207676_10000358 3300026095 Bacteria 38949
718 Ga0207676_10000983 3300026095 Bacteria 21929
719 Ga0207676_10005202 3300026095 Bacteria 9209
720 Ga0207676_10016480 3300026095 Bacteria 5351
721 Ga0207674_10000185 3300026116 Bacteria 76519
722 Ga0207674_10000314 3300026116 Bacteria 61753
723 Ga0207674_10002181 3300026116 Bacteria 24762
724 Ga0207674_10002696 3300026116 Bacteria 22163
725 Ga0207674_10024950 3300026116 Bacteria 6381
726 Ga0207674_10044244 3300026116 Bacteria 4585
727 Ga0207675_100002850 3300026118 Bacteria 17017
728 Ga0207675_100018253 3300026118 Bacteria 6540
729 Ga0207675_100154693 3300026118 Bacteria 2185
730 Ga0207675_100162829 3300026118 Bacteria 2129
731 Ga0207683_10000001 3300026121 Bacteria 352047
732 Ga0207683_10027328 3300026121 Bacteria 4930
733 Ga0207683_10038667 3300026121 Bacteria 4161
734 Ga0207683_10127233 3300026121 Bacteria 2290
735 Ga0207698_10000857 3300026142 Bacteria 17683
736 Ga0207698_10044221 3300026142 Bacteria 3344
737 Ga0207698_10084683 3300026142 Bacteria 2571
738 Ga0207698_10162661 3300026142 Bacteria 1954
739 Ga0207698_10220339 3300026142 Bacteria 1714
740 Ga0209179_1005986 3300027512 Bacteria 1934
741 Ga0209966_1000701 3300027695 Bacteria 7232
742 Ga0209813_10000184 3300027866 Bacteria 19954
743 Ga0209974_10006072 3300027876 Bacteria 4228
744 Ga0207428_10000316 3300027907 Bacteria 63363
745 Ga0207428_10000897 3300027907 Bacteria 33272
746 Ga0207428_10000923 3300027907 Bacteria 32854
747 Ga0268266_10016735 3300028379 Bacteria 6270
748 Ga0268266_10019041 3300028379 Bacteria 5847
749 Ga0268266_10028106 3300028379 Bacteria 4782
750 Ga0268266_10028711 3300028379 Bacteria 4728
751 Ga0268265_10002015 3300028380 Bacteria 15954
752 Ga0268265_10006389 3300028380 Bacteria 7988
753 Ga0268265_10007116 3300028380 Bacteria 7552
754 Ga0268265_10010473 3300028380 Bacteria 6263
755 Ga0268265_10019093 3300028380 Bacteria 4758
756 Ga0268265_10036082 3300028380 Bacteria 3619
757 Ga0268265_10073525 3300028380 Bacteria 2670
758 Ga0268265_10108458 3300028380 Bacteria 2260
759 Ga0268265_10115467 3300028380 Bacteria 2200
760 Ga0268264_10000976 3300028381 Bacteria 29278
761 Ga0268264_10002587 3300028381 Bacteria 15829
762 Ga0268264_10003561 3300028381 Bacteria 13410
763 Ga0268264_10010537 3300028381 Bacteria 7644
764 Ga0268264_10048516 3300028381 Bacteria 3532
765 Ga0268264_10118751 3300028381 Bacteria 2327
766 Ga0268264_10123474 3300028381 Bacteria 2285
767 Ga0268264_10184721 3300028381 Bacteria 1896
768 Ga0265318_10022180 3300028577 Bacteria 2541
769 Ga0265338_10014430 3300028800 Bacteria 8794
770 Ga0265760_10023408 3300031090 Bacteria 1795
771 Ga0265330_10021930 3300031235 Bacteria 2910
772 Ga0265332_10035887 3300031238 Bacteria 2153
773 Ga0265332_10066004 3300031238 Bacteria 1545
774 Ga0265328_10011073 3300031239 Bacteria 3613
775 Ga0265325_10000097 3300031241 Bacteria 61606
776 Ga0265325_10003705 3300031241 Bacteria 9887
777 Ga0265325_10009260 3300031241 Bacteria 5757
778 Ga0265325_10009896 3300031241 Bacteria 5548
779 Ga0265325_10050320 3300031241 Bacteria 2146
780 Ga0265340_10010971 3300031247 Bacteria 4832
781 Ga0265339_10000091 3300031249 Bacteria 75937
782 Ga0265339_10007468 3300031249 Bacteria 7064
783 Ga0265339_10013800 3300031249 Bacteria 4889
784 Ga0265331_10023779 3300031250 Bacteria 3108
785 Ga0265316_10008071 3300031344 Bacteria 9820
786 Ga0265316_10023549 3300031344 Bacteria 5171
787 Ga0307513_10200910 3300031456 Bacteria 1834
788 Ga0307408_100020885 3300031548 Bacteria 4425
789 Ga0307408_100036610 3300031548 Bacteria 3451
790 Ga0307408_100038872 3300031548 Bacteria 3359
791 Ga0307408_100175266 3300031548 Bacteria 1715
792 Ga0265313_10000260 3300031595 Bacteria 57581
793 Ga0265313_10004440 3300031595 Bacteria 10791
794 Ga0265313_10006139 3300031595 Bacteria 8626
795 Ga0265313_10009745 3300031595 Bacteria 6191
796 Ga0265313_10017993 3300031595 Bacteria 3987
797 Ga0265313_10026282 3300031595 Bacteria 3069
798 Ga0265313_10063235 3300031595 Bacteria 1726
799 Ga0316579_10007010 3300031691 Bacteria 4633
800 Ga0265314_10001493 3300031711 Bacteria 25971
801 Ga0265314_10029986 3300031711 Bacteria 4032
802 Ga0265314_10034505 3300031711 Bacteria 3698
803 Ga0265342_10035680 3300031712 Bacteria 3042
804 Ga0265342_10065731 3300031712 Bacteria 2125
805 Ga0265342_10075153 3300031712 Bacteria 1961
806 Ga0307405_10019312 3300031731 Bacteria 3782
807 Ga0307405_10099604 3300031731 Bacteria 1945
808 Ga0307413_10004947 3300031824 Bacteria 5873
809 Ga0307413_10005807 3300031824 Bacteria 5558
810 Ga0307413_10041306 3300031824 Bacteria 2699
811 Ga0307410_10000196 3300031852 Bacteria 22538
812 Ga0307410_10006424 3300031852 Bacteria 6340
813 Ga0307410_10008268 3300031852 Bacteria 5760
814 Ga0307410_10067718 3300031852 Bacteria 2463
815 Ga0307410_10078392 3300031852 Bacteria 2312
816 Ga0307410_10107900 3300031852 Bacteria 2009
817 Ga0307406_10006125 3300031901 Bacteria 6610
818 Ga0307406_10082294 3300031901 Bacteria 2143
819 Ga0307407_10002297 3300031903 Bacteria 7419
820 Ga0307407_10005484 3300031903 Bacteria 5510
821 Ga0307407_10027269 3300031903 Bacteria 3036
822 Ga0307412_10018182 3300031911 Bacteria 4224
823 Ga0307412_10082897 3300031911 Bacteria 2221
824 Ga0307412_10095467 3300031911 Bacteria 2090
825 Ga0307412_10117210 3300031911 Bacteria 1911
826 Ga0307412_10178438 3300031911 Bacteria 1595
827 Ga0307409_100000135 3300031995 Bacteria 27853
828 Ga0307409_100003671 3300031995 Bacteria 8404
829 Ga0307409_100023312 3300031995 Bacteria 4286
830 Ga0307409_100031858 3300031995 Bacteria 3813
831 Ga0307409_100122463 3300031995 Bacteria 2205
832 Ga0307416_100004600 3300032002 Bacteria 8347
833 Ga0307416_100030220 3300032002 Bacteria 4062
834 Ga0307416_100036347 3300032002 Bacteria 3776
835 Ga0307416_100063662 3300032002 Bacteria 3021
836 Ga0307416_100167519 3300032002 Bacteria 2040
837 Ga0307414_10008740 3300032004 Bacteria 5772
838 Ga0307414_10031793 3300032004 Bacteria 3466
839 Ga0307414_10044294 3300032004 Bacteria 3037
840 Ga0307414_10080811 3300032004 Bacteria 2378
841 Ga0307414_10091118 3300032004 Bacteria 2265
842 Ga0307414_10116781 3300032004 Bacteria 2043
843 Ga0307414_10219992 3300032004 Bacteria 1558
844 Ga0307414_10230655 3300032004 Bacteria 1526
845 Ga0307411_10001690 3300032005 Bacteria 9252
846 Ga0307411_10002367 3300032005 Bacteria 8292
847 Ga0307411_10008891 3300032005 Bacteria 5239
848 Ga0307411_10022155 3300032005 Bacteria 3734
849 Ga0307411_10042276 3300032005 Bacteria 2906
850 Ga0307411_10046202 3300032005 Bacteria 2805
851 Ga0307411_10047788 3300032005 Bacteria 2768
852 Ga0307411_10068032 3300032005 Bacteria 2399
853 Ga0307411_10104022 3300032005 Bacteria 2015
854 Ga0307415_100031263 3300032126 Bacteria 3427
855 Ga0307415_100059518 3300032126 Bacteria 2635
856 Ga0307415_100148538 3300032126 Bacteria 1800
857 Ga0307415_100226374 3300032126 Bacteria 1503
858 Ga0316583_10000081 3300032133 Bacteria 20405
859 Ga0373930_0000006 3300034816 Bacteria 23914
860 Ga0373958_0000694 3300034819 Bacteria 4267
861 Ga0373958_0001103 3300034819 Bacteria 3564
862 Ga0373959_0005640 3300034820 Bacteria 2056
863 Ga0373938_0000479 3300034957 Bacteria 6462
864 Ga0373938_0001513 3300034957 Bacteria 3730
865 Ga0373926_0007041 3300035083 Bacteria 3740
866 Ga0373928_0003420 3300035084 Bacteria 3021
867 Ga0373928_0004315 3300035084 Bacteria 2713
868 Ga0373929_0000474 3300035085 Bacteria 7702
869 Ga0373934_0003474 3300035086 Bacteria 5783
870 Ga0373934_0047832 3300035086 Bacteria 1693
871 Ga0373940_0000343 3300035088 Bacteria 6919
872 Ga0373940_0008788 3300035088 Bacteria 2329
873 Ga0373944_0002019 3300035089 Bacteria 5143
874 Ga0373944_0002875 3300035089 Bacteria 4412
875 Ga0373944_0003428 3300035089 Bacteria 4090
876 Ga0373944_0024959 3300035089 Bacteria 1756
877 Ga0373951_0000313 3300035091 Bacteria 15313
878 Ga0373952_0000218 3300035092 Bacteria 9116
879 Ga0373952_0000939 3300035092 Bacteria 5291
880 Ga0373923_0018708 3300035111 Bacteria 2671
881 Ga0373932_0002670 3300035112 Bacteria 4437
882 Ga0373932_0003226 3300035112 Bacteria 3956
883 Ga0373932_0017848 3300035112 Bacteria 1828
884 Ga0373936_0045373 3300035113 Bacteria 1770
885 Ga0373939_0000569 3300035114 Bacteria 9219
886 Ga0373939_0005627 3300035114 Bacteria 2986
887 Ga0373941_0001350 3300035115 Bacteria 5161
888 Ga0373941_0025498 3300035115 Bacteria 1708
889 Ga0373941_0031985 3300035115 Bacteria 1572
890 Ga0373945_0004285 3300035116 Bacteria 4527
891 Ga0373945_0012804 3300035116 Bacteria 2791
892 Ga0373953_0006282 3300035117 Bacteria 3906
893 Ga0373954_0013421 3300035118 Bacteria 3651
894 Ga0373954_0016582 3300035118 Bacteria 3300
895 Ga0373954_0036014 3300035118 Bacteria 2296
896 Ga0373956_0006720 3300035119 Bacteria 4612
897 Ga0373956_0037549 3300035119 Bacteria 2141
898 Ga0373956_0040827 3300035119 Bacteria 2059
899 Ga0373957_0013818 3300035120 Bacteria 2748
900 Ga0373960_0000093 3300035121 Bacteria 13747
901 Ga0373943_0000567 3300035170 Bacteria 16034
902 Ga0373943_0012619 3300035170 Bacteria 3808
903 Ga0373946_0002942 3300035171 Bacteria 6038
904 Ga0373946_0008443 3300035171 Bacteria 3778
905 Ga0373946_0023518 3300035171 Bacteria 2408
906 Ga0373946_0063818 3300035171 Bacteria 1574
907 Ga0373955_0000962 3300035172 Bacteria 12266
908 Ga0373955_0001391 3300035172 Bacteria 10289
909 Ga0373955_0025552 3300035172 Bacteria 3034
910 Ga0373955_0043621 3300035172 Bacteria 2413
911 Ga0373942_0000292 3300035207 Bacteria 13607
912 Ga0373942_0010958 3300035207 Bacteria 2141
913 Ga0373961_0001147 3300035241 Bacteria 8298
914 Ga0373961_0010379 3300035241 Bacteria 2294
915 Ga0373962_0000301 3300035242 Bacteria 10672
916 Ga0373962_0001628 3300035242 Bacteria 5333
917 Ga0373962_0011123 3300035242 Bacteria 2252
918 Ga0373931_0000086 3300035691 Bacteria 43093
919 Ga0373931_0003593 3300035691 Bacteria 6996
920 Ga0373935_0031599 3300035692 Bacteria 3287
921 Ga0373935_0057184 3300035692 Bacteria 2488
922 Ga0373935_0065204 3300035692 Bacteria 2336
923 Ga0373935_0067547 3300035692 Bacteria 2298
924 Ga0373927_0005131 3300035695 Bacteria 9063
925 Ga0373927_0034920 3300035695 Bacteria 3270
926 Ga0373927_0059331 3300035695 Bacteria 2474
927 Ga0373927_0071753 3300035695 Bacteria 2241
928 Ga0373927_0114791 3300035695 Bacteria 1755
929 Ga0373933_0009812 3300035724 Bacteria 5238
930 Ga0373933_0017845 3300035724 Bacteria 3984
931 Ga0373933_0028060 3300035724 Bacteria 3245
932 Ga0373947_0009204 3300035725 Bacteria 5675
933 Ga0373947_0014769 3300035725 Bacteria 4480
934 Ga0373947_0021695 3300035725 Bacteria 3719
935 Ga0373937_0004313 3300036401 Bacteria 12059
936 Ga0373937_0004822 3300036401 Bacteria 11465
937 Ga0373937_0013053 3300036401 Bacteria 7316
938 Ga0373937_0023035 3300036401 Bacteria 5602
939 Ga0373937_0031048 3300036401 Bacteria 4838
940 Ga0373937_0117379 3300036401 Bacteria 2478
941 Ga0316582_0080845 3300036647 Bacteria 2122
942 Ga0373925_0003922 3300037068 Bacteria 11355
943 Ga0373925_0015075 3300037068 Bacteria 5586
944 Ga0373925_0023858 3300037068 Bacteria 4462
945 Ga0395899_0000132 3300037312 Bacteria 115455
946 Ga0395899_0025245 3300037312 Bacteria 4486
947 Ga0395900_0000477 3300037418 Bacteria 56791
948 Ga0395900_0000997 3300037418 Bacteria 36770
949 Ga0395900_0001169 3300037418 Bacteria 32753
950 Ga0395900_0003479 3300037418 Bacteria 16993
951 Ga0395900_0016968 3300037418 Bacteria 7431
952 Ga0395900_0078138 3300037418 Bacteria 3400
953 Ga0395900_0085220 3300037418 Bacteria 3247
954 Ga0395900_0091734 3300037418 Bacteria 3121
955 Ga0395898_0015973 3300037466 Bacteria 7691
956 Ga0395898_0017326 3300037466 Bacteria 7360
957 Ga0395898_0028510 3300037466 Bacteria 5594
958 Ga0395898_0061634 3300037466 Bacteria 3644
959 Ga0395898_0067555 3300037466 Bacteria 3461
960 Ga0395898_0117554 3300037466 Bacteria 2547
961 Ga0395898_0121892 3300037466 Bacteria 2498
962 Ga0395905_0000818 3300037471 Bacteria 40874
963 Ga0395905_0001164 3300037471 Bacteria 32823
964 Ga0395905_0002761 3300037471 Bacteria 19234
965 Ga0395905_0010864 3300037471 Bacteria 8818
966 Ga0395905_0021647 3300037471 Bacteria 6082
967 Ga0395905_0043421 3300037471 Bacteria 4218
968 Ga0395905_0053027 3300037471 Bacteria 3797
969 Ga0395905_0068826 3300037471 Bacteria 3315
970 Ga0436364_0319726 3300037853 Bacteria 1794
971 Ga0395901_0000208 3300038443 Bacteria 73874
972 Ga0395901_0000589 3300038443 Bacteria 42319
973 Ga0395901_0002866 3300038443 Bacteria 17413
974 Ga0395901_0007227 3300038443 Bacteria 11200
975 Ga0395901_0087854 3300038443 Bacteria 3250
976 Ga0395901_0114738 3300038443 Bacteria 2829
977 Ga0395901_0197617 3300038443 Bacteria 2108
978 Ga0395901_0295086 3300038443 Bacteria 1681
979 Ga0395901_0368745 3300038443 Bacteria 1479
980 Ga0436365_0414414 3300039437 Bacteria 44510
981 Ga0436365_0458815 3300039437 Bacteria 12358
982 Ga0436360_0251329 3300039438 Bacteria 2226
983 Ga0436361_0896735 3300039447 Bacteria 20111
984 Ga0439445_0002205 3300042004 Bacteria 4320
985 Ga0439448_0020086 3300042005 Bacteria 2064
986 Ga0439432_008816 3300042006 Bacteria 3528
987 Ga0439432_023841 3300042006 Bacteria 2013
988 Ga0439452_023708 3300042010 Bacteria 1577
989 Ga0439455_0025551 3300042012 Bacteria 1436
990 Ga0439462_0031594 3300042015 Bacteria 1403
991 Ga0450905_003094 3300042142 Bacteria 2173
992 Ga0450889_000019 3300042144 Bacteria 13862
993 Ga0439435_0000116 3300042436 Bacteria 10320
994 Ga0451577_0012529 3300042876 Bacteria 7962
995 Ga0466972_0068169 3300044658 Bacteria 1699
996 Ga0466966_0167740 3300044684 Bacteria 1335
997 Ga0466963_0003406 3300044694 Bacteria 9099
998 Ga0466963_0015451 3300044694 Bacteria 4728
999 Ga0466963_0042944 3300044694 Bacteria 2970
1000 Ga0466963_0155714 3300044694 Bacteria 1588
1001 Ga0453684_0082525 3300044712 Bacteria 4004
1002 Ga0466959_0059587 3300045049 Bacteria 2780
1003 Ga0451576_0027924 3300045051 Bacteria 6053
1004 Ga0466958_0035584 3300045836 Bacteria 2975
1005 Ga0466967_0002255 3300045976 Bacteria 11880
1006 Ga0466967_0007911 3300045976 Bacteria 7730
1007 Ga0466967_0053981 3300045976 Bacteria 3534
1008 Ga0466967_0066726 3300045976 Bacteria 3207
1009 Ga0466967_0081609 3300045976 Bacteria 2921
1010 Ga0466967_0172865 3300045976 Bacteria 2034
1011 Ga0466967_0178004 3300045976 Bacteria 2004
1012 Ga0466967_0191450 3300045976 Bacteria 1933
1013 Ga0495592_0008217 3300046454 Bacteria 7838
1014 Ga0495592_0027775 3300046454 Bacteria 4286
1015 Ga0495592_0101871 3300046454 Bacteria 2045
1016 Ga0495603_0087900 3300046455 Bacteria 1818
1017 Ga0495629_0000668 3300046459 Bacteria 27756
1018 Ga0495629_0135648 3300046459 Bacteria 1713
1019 Ga0495638_0000204 3300046460 Bacteria 84182
1020 Ga0495638_0017966 3300046460 Bacteria 4706
1021 Ga0495638_0021126 3300046460 Bacteria 4294
1022 Ga0495641_0034802 3300046461 Bacteria 2378
1023 Ga0495641_0068827 3300046461 Bacteria 1591
1024 Ga0495651_0000237 3300046462 Bacteria 42533
1025 Ga0495651_0009743 3300046462 Bacteria 7388
1026 Ga0495651_0014732 3300046462 Bacteria 6046
1027 Ga0495651_0064792 3300046462 Bacteria 2792
1028 Ga0495653_0009351 3300046463 Bacteria 8019
1029 Ga0495653_0020295 3300046463 Bacteria 5388
1030 Ga0495653_0047643 3300046463 Bacteria 3314
1031 Ga0495580_0024260 3300046472 Bacteria 4444
1032 Ga0495580_0044157 3300046472 Bacteria 3171
1033 Ga0495582_0035811 3300046473 Bacteria 2730
1034 Ga0495639_0020552 3300046475 Bacteria 2885
1035 Ga0495662_0000280 3300046476 Bacteria 21964
1036 Ga0495662_0007973 3300046476 Bacteria 5216
1037 Ga0495662_0015169 3300046476 Bacteria 3743
1038 Ga0495664_0000112 3300046477 Bacteria 40522
1039 Ga0495664_0006025 3300046477 Bacteria 6683
1040 Ga0495664_0092353 3300046477 Bacteria 1820
1041 Ga0495584_0011269 3300046491 Bacteria 4579
1042 Ga0495584_0055204 3300046491 Bacteria 1999
1043 Ga0495584_0074316 3300046491 Bacteria 1708
1044 Ga0495585_0000734 3300046492 Bacteria 29222
1045 Ga0495585_0006706 3300046492 Bacteria 7107
1046 Ga0495596_0008510 3300046500 Bacteria 4563
1047 Ga0495607_0011035 3300046501 Bacteria 6034
1048 Ga0495608_0005221 3300046511 Bacteria 9279
1049 Ga0495608_0067866 3300046511 Bacteria 2332
1050 Ga0495610_0002641 3300046512 Bacteria 14823
1051 Ga0495618_0001016 3300046514 Bacteria 19217
1052 Ga0495618_0007304 3300046514 Bacteria 6686
1053 Ga0495618_0066673 3300046514 Bacteria 2288
1054 Ga0495618_0134541 3300046514 Bacteria 1581
1055 Ga0495628_0004625 3300046516 Bacteria 12159
1056 Ga0495628_0018442 3300046516 Bacteria 5780
1057 Ga0495628_0211069 3300046516 Bacteria 1460
1058 Ga0495630_0024126 3300046517 Bacteria 4497
1059 Ga0495630_0034111 3300046517 Bacteria 3797
1060 Ga0495631_0016466 3300046518 Bacteria 3523
1061 Ga0495632_0000075 3300046519 Bacteria 102051
1062 Ga0495632_0046880 3300046519 Bacteria 2146
1063 Ga0495637_0000123 3300046520 Bacteria 57717
1064 Ga0495637_0034787 3300046520 Bacteria 2204
1065 Ga0495643_0000009 3300046522 Bacteria 344767
1066 Ga0495644_0000306 3300046523 Bacteria 22634
1067 Ga0495648_0037541 3300046524 Bacteria 3111
1068 Ga0495663_0000003 3300046525 Bacteria 362694
1069 Ga0495663_0017730 3300046525 Bacteria 2023
1070 Ga0495666_0023948 3300046526 Bacteria 3019
1071 Ga0495666_0034834 3300046526 Bacteria 2455
1072 Ga0495652_0019482 3300046529 Bacteria 6042
1073 Ga0495652_0105926 3300046529 Bacteria 2271
1074 Ga0495665_0007482 3300046531 Bacteria 5909
1075 Ga0495665_0012616 3300046531 Bacteria 4575
1076 Ga0495665_0030802 3300046531 Bacteria 2870
1077 Ga0495640_0000871 3300046533 Bacteria 23106
1078 Ga0495640_0084501 3300046533 Bacteria 2105
1079 Ga0495586_0014023 3300046535 Bacteria 4255
1080 Ga0495586_0041668 3300046535 Bacteria 2473
1081 Ga0495586_0111993 3300046535 Bacteria 1519
1082 Ga0495587_0006533 3300046536 Bacteria 7598
1083 Ga0495587_0072252 3300046536 Bacteria 2006
1084 Ga0495587_0118441 3300046536 Bacteria 1517
1085 Ga0495598_0003015 3300046537 Bacteria 3534
1086 Ga0495621_0000652 3300046539 Bacteria 8756
1087 Ga0495621_0011175 3300046539 Bacteria 2769
1088 Ga0495621_0019245 3300046539 Bacteria 2228
1089 Ga0495645_0003375 3300046543 Bacteria 10820
1090 Ga0495645_0004586 3300046543 Bacteria 9430
1091 Ga0495645_0076719 3300046543 Bacteria 2403
1092 Ga0495622_0034756 3300046557 Bacteria 2351
1093 Ga0495622_0054674 3300046557 Bacteria 1852
1094 Ga0495633_0000173 3300046558 Bacteria 84576
1095 Ga0495633_0001183 3300046558 Bacteria 20947
1096 Ga0495633_0001327 3300046558 Bacteria 19427
1097 Ga0495667_0003141 3300046559 Bacteria 11080
1098 Ga0495667_0004903 3300046559 Bacteria 9045
1099 Ga0495667_0079413 3300046559 Bacteria 2133
1100 Ga0495667_0095258 3300046559 Bacteria 1927
1101 Ga0495656_0000381 3300046615 Bacteria 14786
1102 Ga0495656_0072045 3300046615 Bacteria 1537
1103 Ga0495668_0076134 3300046616 Bacteria 1842
1104 Ga0495634_0003493 3300046642 Bacteria 12595
1105 Ga0495634_0033846 3300046642 Bacteria 3509
1106 Ga0495634_0038870 3300046642 Bacteria 3243
1107 Ga0495611_0001463 3300046648 Bacteria 11757
1108 Ga0495635_0002093 3300046663 Bacteria 13548
1109 Ga0495635_0028467 3300046663 Bacteria 3884
1110 Ga0495635_0116987 3300046663 Bacteria 1819
1111 Ga0495659_0003761 3300046664 Bacteria 4823
1112 Ga0495661_0082450 3300046665 Bacteria 1851
1113 Ga0495588_0002225 3300046674 Bacteria 8308
1114 Ga0495657_0006644 3300046675 Bacteria 9033
1115 Ga0495657_0008508 3300046675 Bacteria 7845
1116 Ga0495657_0008561 3300046675 Bacteria 7814
1117 Ga0495599_0021673 3300046678 Bacteria 4009
1118 Ga0495623_0026503 3300046679 Bacteria 3731
1119 Ga0495646_0004362 3300046680 Bacteria 8917
1120 Ga0495658_0000229 3300046683 Bacteria 32147
1121 Ga0495669_0000599 3300046684 Bacteria 15785
1122 Ga0495669_0001837 3300046684 Bacteria 8692
1123 Ga0495669_0010207 3300046684 Bacteria 3967
1124 Ga0495613_0011247 3300046689 Bacteria 6650
1125 Ga0495613_0037688 3300046689 Bacteria 3584
1126 Ga0495613_0103240 3300046689 Bacteria 2058
1127 Ga0495613_0121505 3300046689 Bacteria 1875
1128 Ga0495624_0001093 3300046690 Bacteria 21434
1129 Ga0495624_0022372 3300046690 Bacteria 4179
1130 Ga0495670_0002180 3300046691 Bacteria 9687
1131 Ga0495670_0003882 3300046691 Bacteria 7342
1132 Ga0495670_0102255 3300046691 Bacteria 1476
1133 Ga0495671_0000013 3300046692 Bacteria 344767
1134 Ga0495600_0019287 3300046809 Bacteria 4354
1135 Ga0495600_0067544 3300046809 Bacteria 2337
1136 Ga0495600_0084015 3300046809 Bacteria 2078
1137 Ga0495581_0054776 3300047315 Bacteria 2302
1138 Ga0495581_0056281 3300047315 Bacteria 2270
1139 Ga0495581_0058993 3300047315 Bacteria 2216
1140 Ga0495581_0084168 3300047315 Bacteria 1843
1141 Ga0495604_0002806 3300047317 Bacteria 13980
1142 Ga0495604_0008011 3300047317 Bacteria 8369
1143 Ga0495604_0009095 3300047317 Bacteria 7860
1144 Ga0495674_0001513 3300047319 Bacteria 22779
1145 Ga0495674_0151891 3300047319 Bacteria 1941
1146 Ga0495674_0280038 3300047319 Bacteria 1366
1147 Ga0495672_0002402 3300047320 Bacteria 17288
1148 Ga0495672_0004345 3300047320 Bacteria 11663
1149 Ga0495672_0083360 3300047320 Bacteria 1776
1150 Ga0495676_0072836 3300047321 Bacteria 2636
1151 Ga0495676_0125444 3300047321 Bacteria 1861
1152 Ga0495680_0016671 3300047322 Bacteria 6304
1153 Ga0495680_0025791 3300047322 Bacteria 4859
1154 Ga0495680_0028426 3300047322 Bacteria 4584
1155 Ga0495680_0077960 3300047322 Bacteria 2508
1156 Ga0495680_0098613 3300047322 Bacteria 2180
1157 Ga0495675_0005331 3300047444 Bacteria 7834
1158 Ga0495677_0018861 3300047445 Bacteria 2501
1159 Ga0495681_0001636 3300047470 Bacteria 16634
1160 Ga0495684_0000264 3300047471 Bacteria 41677
1161 Ga0495684_0001309 3300047471 Bacteria 20014
1162 Ga0495593_0030842 3300047673 Bacteria 2931
1163 Ga0495593_0046463 3300047673 Bacteria 2313
1164 Ga0495602_0005783 3300048088 Bacteria 12976
1165 Ga0495602_0021033 3300048088 Bacteria 6431
1166 Ga0495602_0040285 3300048088 Bacteria 4287
1167 Ga0495602_0186809 3300048088 Bacteria 1593
1168 Ga0495614_0012220 3300048089 Bacteria 3771
1169 Ga0495615_0004517 3300048090 Bacteria 2436
1170 Ga0495626_0000214 3300048091 Bacteria 69009
1171 Ga0496100_0001253 3300048903 Bacteria 12380
1172 Ga0496100_0040891 3300048903 Bacteria 2952
1173 Ga0496101_0001852 3300048904 Bacteria 12758
1174 Ga0496101_0002475 3300048904 Bacteria 11344
1175 Ga0496101_0004266 3300048904 Bacteria 8964
1176 Ga0496101_0043198 3300048904 Bacteria 3221
1177 Ga0496101_0061187 3300048904 Bacteria 2734
1178 Ga0496102_0002526 3300048905 Bacteria 15627
1179 Ga0496102_0006171 3300048905 Bacteria 10219
1180 Ga0496102_0024435 3300048905 Bacteria 5373
1181 Ga0496102_0203451 3300048905 Bacteria 1866
1182 Ga0496103_0000130 3300048906 Bacteria 80826
1183 Ga0496103_0000715 3300048906 Bacteria 24556
1184 Ga0496103_0012088 3300048906 Bacteria 5127
1185 Ga0496103_0031446 3300048906 Bacteria 3234
1186 Ga0496104_0000311 3300048907 Bacteria 43387
1187 Ga0496104_0000900 3300048907 Bacteria 25552
1188 Ga0496104_0001975 3300048907 Bacteria 17756
1189 Ga0496104_0011188 3300048907 Bacteria 8029
1190 Ga0496104_0047862 3300048907 Bacteria 4031
1191 Ga0496104_0095212 3300048907 Bacteria 2849
1192 Ga0496105_0000144 3300048908 Bacteria 46774
1193 Ga0496105_0000363 3300048908 Bacteria 30056
1194 Ga0496105_0010173 3300048908 Bacteria 7391
1195 Ga0496105_0052297 3300048908 Bacteria 3374
1196 Ga0496105_0075082 3300048908 Bacteria 2792
1197 Ga0496105_0075755 3300048908 Bacteria 2778
1198 Ga0496105_0200163 3300048908 Bacteria 1630
1199 Ga0496106_0000135 3300048909 Bacteria 55500
1200 Ga0496106_0005392 3300048909 Bacteria 9457
1201 Ga0496106_0011849 3300048909 Bacteria 6436
1202 Ga0496106_0015796 3300048909 Bacteria 5583
1203 Ga0496106_0106463 3300048909 Bacteria 2180
1204 Ga0496107_0012327 3300048910 Bacteria 5968
1205 Ga0496107_0031189 3300048910 Bacteria 3801
1206 Ga0496107_0059074 3300048910 Bacteria 2774
1207 Ga0496107_0120197 3300048910 Bacteria 1935
1208 Ga0496107_0255400 3300048910 Bacteria 1304
1209 Ga0496108_0000256 3300048911 Bacteria 46076
1210 Ga0496108_0004267 3300048911 Bacteria 11515
1211 Ga0496108_0005425 3300048911 Bacteria 10309
1212 Ga0496108_0005764 3300048911 Bacteria 10033
1213 Ga0496108_0008672 3300048911 Bacteria 8244
1214 Ga0496108_0022065 3300048911 Bacteria 5234
1215 Ga0496108_0040349 3300048911 Bacteria 3891
1216 Ga0496108_0125821 3300048911 Bacteria 2200
1217 Ga0496109_0000490 3300048912 Bacteria 33902
1218 Ga0496109_0000730 3300048912 Bacteria 27368
1219 Ga0496109_0012503 3300048912 Bacteria 7328
1220 Ga0496109_0027371 3300048912 Bacteria 5090
1221 Ga0496109_0041709 3300048912 Bacteria 4157
1222 Ga0496109_0048395 3300048912 Bacteria 3868
1223 Ga0496109_0066682 3300048912 Bacteria 3296
1224 Ga0496109_0167510 3300048912 Bacteria 2060
1225 Ga0496109_0219015 3300048912 Bacteria 1790
1226 Ga0496110_0005771 3300048913 Bacteria 9726
1227 Ga0496110_0008763 3300048913 Bacteria 8150
1228 Ga0496110_0008841 3300048913 Bacteria 8115
1229 Ga0496110_0010176 3300048913 Bacteria 7641
1230 Ga0496110_0124874 3300048913 Bacteria 2321
1231 Ga0496110_0257683 3300048913 Bacteria 1588
1232 Ga0496111_0002097 3300048914 Bacteria 11899
1233 Ga0496111_0012561 3300048914 Bacteria 5739
1234 Ga0496111_0015368 3300048914 Bacteria 5251
1235 Ga0496111_0030426 3300048914 Bacteria 3838
1236 Ga0496111_0047442 3300048914 Bacteria 3093
1237 Ga0496111_0074374 3300048914 Bacteria 2474
1238 Ga0496111_0084864 3300048914 Bacteria 2315
1239 Ga0496111_0098668 3300048914 Bacteria 2145
1240 Ga0496112_0002301 3300048915 Bacteria 15303
1241 Ga0496112_0040962 3300048915 Bacteria 4530
1242 Ga0496112_0051044 3300048915 Bacteria 4056
1243 Ga0496112_0053767 3300048915 Bacteria 3956
1244 Ga0496112_0083002 3300048915 Bacteria 3168
1245 Ga0496112_0086797 3300048915 Bacteria 3095
1246 Ga0496112_0116008 3300048915 Bacteria 2648
1247 Ga0496112_0196859 3300048915 Bacteria 1975
1248 Ga0496113_0000318 3300048916 Bacteria 22869
1249 Ga0496113_0004239 3300048916 Bacteria 8777
1250 Ga0496113_0008442 3300048916 Bacteria 6712
1251 Ga0496113_0016292 3300048916 Bacteria 5131
1252 Ga0496113_0079873 3300048916 Bacteria 2504
1253 Ga0496114_0000006 3300048917 Bacteria 472921
1254 Ga0496114_0000287 3300048917 Bacteria 36856
1255 Ga0496114_0058988 3300048917 Bacteria 3205
1256 Ga0496114_0131587 3300048917 Bacteria 2161
1257 Ga0496115_0003371 3300048918 Bacteria 11463
1258 Ga0496115_0009373 3300048918 Bacteria 7274
1259 Ga0496115_0018872 3300048918 Bacteria 5302
1260 Ga0496115_0019923 3300048918 Bacteria 5169
1261 Ga0496115_0061836 3300048918 Bacteria 3020
1262 Ga0496115_0064194 3300048918 Bacteria 2963
1263 Ga0496115_0113708 3300048918 Bacteria 2224
1264 Ga0496116_0000062 3300048919 Bacteria 271104
1265 Ga0496118_0039378 3300048921 Bacteria 3773
1266 Ga0496119_0000936 3300048922 Bacteria 37609
1267 Ga0496121_0002503 3300048924 Bacteria 27924
1268 Ga0496121_0010966 3300048924 Bacteria 10120
1269 Ga0496122_0000589 3300048925 Bacteria 74585
1270 Ga0496122_0009287 3300048925 Bacteria 10397
1271 Ga0496122_0019558 3300048925 Bacteria 6178
1272 Ga0496122_0020036 3300048925 Bacteria 6074
1273 Ga0496123_0000278 3300048926 Bacteria 100746
1274 Ga0496123_0000545 3300048926 Bacteria 64687
1275 Ga0496123_0001298 3300048926 Bacteria 35561
1276 Ga0496123_0002167 3300048926 Bacteria 25064
1277 Ga0496124_0010346 3300048927 Bacteria 9463
1278 Ga0496124_0052085 3300048927 Bacteria 3479
1279 Ga0496125_0004774 3300048928 Bacteria 15434
1280 Ga0496125_0027784 3300048928 Bacteria 5121
1281 Ga0496126_0000801 3300048929 Bacteria 56279
1282 Ga0501032_0039527 3300049569 Bacteria 3208
1283 Ga0501032_0063370 3300049569 Bacteria 2475
1284 Ga0501032_0162501 3300049569 Bacteria 1466
1285 Ga0501033_0004204 3300049570 Bacteria 11589
1286 Ga0501033_0024281 3300049570 Bacteria 4574
1287 Ga0501033_0026129 3300049570 Bacteria 4394
1288 Ga0501034_0000436 3300049571 Bacteria 69142
1289 Ga0501034_0005233 3300049571 Bacteria 14236
1290 Ga0501034_0009627 3300049571 Bacteria 10109
1291 Ga0501034_0027067 3300049571 Bacteria 5834
1292 Ga0501034_0099430 3300049571 Bacteria 2903
1293 Ga0501036_0001221 3300049572 Bacteria 19615
1294 Ga0501036_0027487 3300049572 Bacteria 4806
1295 Ga0501036_0044521 3300049572 Bacteria 3759
1296 Ga0501036_0131217 3300049572 Bacteria 2115
1297 Ga0501037_0003949 3300049573 Bacteria 10757
1298 Ga0501038_0028790 3300049574 Bacteria 4932
1299 Ga0501038_0085958 3300049574 Bacteria 2643
1300 Ga0501038_0095777 3300049574 Bacteria 2479
1301 Ga0501039_0033073 3300049575 Bacteria 3989
1302 Ga0501039_0044143 3300049575 Bacteria 3442
1303 Ga0501039_0214251 3300049575 Bacteria 1514
1304 Ga0501040_0108027 3300049576 Bacteria 1945
1305 Ga0501043_0008146 3300049579 Bacteria 8271
1306 Ga0501043_0009282 3300049579 Bacteria 7730
1307 Ga0501043_0034819 3300049579 Bacteria 3960
1308 Ga0501046_0105803 3300049580 Bacteria 2154
1309 Ga0501047_0000223 3300049581 Bacteria 67658
1310 Ga0501047_0000384 3300049581 Bacteria 49644
1311 Ga0501047_0035760 3300049581 Bacteria 4798
1312 Ga0501047_0116121 3300049581 Bacteria 2558
1313 Ga0501047_0146712 3300049581 Bacteria 2236
1314 Ga0501048_0000074 3300049582 Bacteria 51762
1315 Ga0501048_0123057 3300049582 Bacteria 1833
1316 Ga0501067_0011404 3300049583 Bacteria 4920
1317 Ga0501067_0055988 3300049583 Bacteria 2185
1318 Ga0501067_0076510 3300049583 Bacteria 1854
1319 Ga0501068_0032961 3300049584 Bacteria 3082
1320 Ga0501069_0006054 3300049585 Bacteria 6317
1321 Ga0501069_0019134 3300049585 Bacteria 3699
1322 Ga0501070_0008586 3300049586 Bacteria 8639
1323 Ga0501070_0011258 3300049586 Bacteria 7554
1324 Ga0501070_0025736 3300049586 Bacteria 4936
1325 Ga0501070_0032074 3300049586 Bacteria 4398
1326 Ga0501070_0032152 3300049586 Bacteria 4392
1327 Ga0501071_0011938 3300049587 Bacteria 5869
1328 Ga0501071_0071204 3300049587 Bacteria 2534
1329 Ga0501071_0126813 3300049587 Bacteria 1895
1330 Ga0501072_0001326 3300049588 Bacteria 18567
1331 Ga0501074_0012491 3300049590 Bacteria 6174
1332 Ga0501076_0012519 3300049592 Bacteria 6345
1333 Ga0501076_0064957 3300049592 Bacteria 2909
1334 Ga0501076_0091509 3300049592 Bacteria 2447
1335 Ga0501235_011191 3300049669 Bacteria 1965
1336 Ga0501221_006804 3300049704 Bacteria 1943
1337 Ga0501079_0135107 3300049741 Bacteria 1920
1338 Ga0501079_0202160 3300049741 Bacteria 1552
1339 Ga0501080_0001854 3300049742 Bacteria 18155
1340 Ga0501080_0025491 3300049742 Bacteria 5488
1341 Ga0501080_0059932 3300049742 Bacteria 3542
1342 Ga0501081_0053559 3300049743 Bacteria 2786
1343 Ga0501083_0001146 3300049744 Bacteria 17823
1344 Ga0501083_0022266 3300049744 Bacteria 4397
1345 Ga0501083_0043876 3300049744 Bacteria 3028
1346 Ga0501083_0170931 3300049744 Bacteria 1420
1347 Ga0501035_0000371 3300049822 Bacteria 51668
1348 Ga0501035_0007311 3300049822 Bacteria 10327
1349 Ga0501035_0033698 3300049822 Bacteria 4655
1350 Ga0501035_0060863 3300049822 Bacteria 3361
1351 Ga0501035_0253117 3300049822 Bacteria 1495
1352 Ga0501044_0001720 3300049823 Bacteria 25612
1353 Ga0501044_0011870 3300049823 Bacteria 9439
1354 Ga0501044_0124863 3300049823 Bacteria 2571
1355 Ga0501045_0168021 3300049824 Bacteria 1634
1356 nmdc:mga03n38_6277_c1 3300050490 Bacteria 4117
1357 nmdc:mga03n38_92370_c1 3300050490 Bacteria 1443
1358 nmdc:mga0yw44_23578_c1 3300050492 Bacteria 3470
1359 nmdc:mga0yw44_2995_c1 3300050492 Bacteria 7373
1360 nmdc:mga0yw44_63475_c1 3300050492 Bacteria 2271
1361 nmdc:mga06z11_11391_c1 3300050494 Bacteria 3833
1362 nmdc:mga06z11_49590_c1 3300050494 Bacteria 2143
1363 nmdc:mga06z11_60_c1 3300050494 Bacteria 46715
1364 nmdc:mga04h51_39509_c1 3300050495 Bacteria 1533
1365 nmdc:mga04h51_403_c1 3300050495 Bacteria 10448
1366 nmdc:mga07m45_136286_c1 3300050496 Bacteria 1421
1367 nmdc:mga07m45_81046_c1 3300050496 Bacteria 1853
1368 nmdc:mga07m45_8495_c1 3300050496 Bacteria 5282
1369 nmdc:mga05p37_1191_c1 3300050507 Bacteria 30041
1370 nmdc:mga05p37_222_c1 3300050507 Bacteria 57449
1371 nmdc:mga05p37_30060_c1 3300050507 Bacteria 6630
1372 nmdc:mga05p37_71985_c1 3300050507 Bacteria 4253
1373 nmdc:mga05p37_81621_c1 3300050507 Bacteria 3983
1374 nmdc:mga09592_16877_c1 3300050508 Bacteria 5975
1375 nmdc:mga09592_3118_c1 3300050508 Bacteria 13463
1376 nmdc:mga09592_70637_c1 3300050508 Bacteria 2963
1377 nmdc:mga0qj67_141077_c1 3300050509 Bacteria 1954
1378 nmdc:mga0qj67_1677_c1 3300050509 Bacteria 15599
1379 nmdc:mga0qj67_60328_c1 3300050509 Bacteria 3010
1380 nmdc:mga06r32_1077_c1 3300050510 Bacteria 24523
1381 nmdc:mga06r32_284100_c1 3300050510 Bacteria 1642
1382 nmdc:mga08y16_11073_c1 3300050511 Bacteria 9470
1383 nmdc:mga08y16_116433_c1 3300050511 Bacteria 2782
1384 nmdc:mga08y16_121832_c1 3300050511 Bacteria 2714
1385 nmdc:mga08y16_13536_c1 3300050511 Bacteria 8586
1386 nmdc:mga08y16_13718_c1 3300050511 Bacteria 8532
1387 nmdc:mga08y16_57400_c1 3300050511 Bacteria 4068
1388 nmdc:mga08y16_587_c1 3300050511 Bacteria 33873
1389 nmdc:mga0n895_126764_c1 3300050512 Bacteria 2577
1390 nmdc:mga0n895_150771_c1 3300050512 Bacteria 2355
1391 nmdc:mga0n895_200633_c1 3300050512 Bacteria 2026
1392 nmdc:mga0n895_425063_c1 3300050512 Bacteria 1343
1393 nmdc:mga0n895_437_c1 3300050512 Bacteria 28072
1394 nmdc:mga0n895_741_c1 3300050512 Bacteria 23095
1395 nmdc:mga0rr50_185351_c1 3300050513 Bacteria 1703
1396 nmdc:mga0rr50_5627_c1 3300050513 Bacteria 7503
1397 nmdc:mga0rr50_6644_c1 3300050513 Bacteria 7069
1398 nmdc:mga0rr50_88555_c1 3300050513 Bacteria 2405
1399 nmdc:mga08x19_165289_c1 3300050514 Bacteria 1504
1400 nmdc:mga08x19_49275_c1 3300050514 Bacteria 2701
1401 nmdc:mga0a205_158439_c1 3300050515 Bacteria 2161
1402 nmdc:mga0a205_3283_c1 3300050515 Bacteria 14388
1403 nmdc:mga0a205_40207_c1 3300050515 Bacteria 4501
1404 nmdc:mga0a205_43507_c1 3300050515 Bacteria 4330
1405 nmdc:mga0a205_6511_c1 3300050515 Bacteria 10559
1406 nmdc:mga0a205_802_c1 3300050515 Bacteria 25500
1407 nmdc:mga0sz30_19123_c1 3300050516 Bacteria 2749
1408 Ga0495601_0000441 3300053077 Bacteria 21726
1409 Ga0495601_0001951 3300053077 Bacteria 11535
1410 Ga0495601_0006078 3300053077 Bacteria 7043
1411 Ga0495601_0020031 3300053077 Bacteria 4082
1412 Ga0495601_0042861 3300053077 Bacteria 2841
1413 Ga0495612_0006563 3300053078 Bacteria 4774
1414 Ga0495612_0019001 3300053078 Bacteria 2750
1415 Ga0495612_0048622 3300053078 Bacteria 1739
1416 Ga0495595_0000551 3300053084 Bacteria 14288
1417 Ga0495595_0002072 3300053084 Bacteria 7796
1418 Ga0495595_0003250 3300053084 Bacteria 6456
1419 Ga0495595_0008006 3300053084 Bacteria 4328
1420 Ga0495595_0110045 3300053084 Bacteria 1335
1421 Ga0495619_0000063 3300053085 Bacteria 84834
1422 Ga0495619_0000170 3300053085 Bacteria 47706
1423 Ga0495619_0001482 3300053085 Bacteria 15480
1424 Ga0495619_0011350 3300053085 Bacteria 5609
1425 Ga0495619_0022077 3300053085 Bacteria 4068
1426 Ga0495619_0022235 3300053085 Bacteria 4056
1427 Ga0500644_0000715 3300053088 Bacteria 11751
1428 Ga0500651_0004383 3300053093 Bacteria 7888
1429 Ga0500641_0017324 3300053096 Bacteria 2693
1430 Ga0500556_0000160 3300053104 Bacteria 55309
1431 Ga0500593_000044 3300053117 Bacteria 45032
1432 Ga0500593_007593 3300053117 Bacteria 4424
1433 Ga0500594_0036322 3300053118 Bacteria 1326
1434 Ga0500595_000085 3300053119 Bacteria 65800
1435 Ga0500652_000056 3300053131 Bacteria 51871
1436 Ga0500652_005144 3300053131 Bacteria 4095
1437 Ga0500568_0000004 3300053139 Bacteria 621666
1438 Ga0500616_0000001 3300053153 Bacteria 1986011
1439 Ga0500616_0000038 3300053153 Bacteria 386801
1440 Ga0500624_000072 3300053157 Bacteria 57950
1441 Ga0500636_0029690 3300053177 Bacteria 3231
1442 Ga0500645_004638 3300053730 Bacteria 5232
1443 Ga0500645_006791 3300053730 Bacteria 4047
1444 Ga0501084_0128391 3300054114 Bacteria 2134
1445 Ga0501082_0001551 3300060353 Bacteria 20235
1446 Ga0501082_0060009 3300060353 Bacteria 3277
1447 Ga0501082_0083169 3300060353 Bacteria 2762
1448 Ga0501082_0127916 3300060353 Bacteria 2203
1449 2512645674 2512564014 Bacteria 4639632
1450 2513590353 2513237087 Bacteria 5817514
1451 2643758965 2643221547 Bacteria 4740017
1452 2644290723 2643221651 Bacteria 4798932
1453 2723849349 2721755755 Bacteria 8322773
1454 2809063054 2808606401 Bacteria 4586670
1455 2809079018 2808606404 Bacteria 4652788
1456 2809083607 2808606405 Bacteria 4586632
1457 2819552788 2818991438 Bacteria 5793701
1458 2880520309 2880518877 Bacteria 5012590
1459 2885427367 2885427238 Bacteria 2291351
1460 2919452146 2919450847 Bacteria 5631160
1461 2919709844 2919709256 Bacteria 4318106
1462 2922364341 2922361189 Bacteria 7436256
1463 8001845825 8001845381 Bacteria 5804942
1464 8054306822 8054302542 Bacteria 5698134
1465 Ga0105250_10013627
1466 2214745200
1467 ARcpr5oldR_c000003
1468 ARSoilYngRDRAFT_c00037
1469 ARcpr5yngRDRAFT_c000010
1470 ARSoilOldRDRAFT_c000045
1471 ARCol0yngRDRAFT_1000086
1472 JGI24741J21665_1005824
1473 JGI24741J21665_1006916
1474 JGI24746J21847_1000225
1475 JGI24740J21852_10018132
1476 JGI24740J21852_10032414
1477 JGI24739J22299_10000887
1478 JGI24739J22299_10002234
1479 JGI24739J22299_10007003
1480 JGI24737J22298_10000286
1481 JGI24737J22298_10018510
1482 JGI24737J22298_10023419
1483 JGI24743J22301_10001925
1484 JGI24743J22301_10004783
1485 JGI24735J21928_10001811
1486 JGI24735J21928_10002726
1487 JGI24750J21931_1000044
1488 JGI24750J21931_1001976
1489 JGI24748J21848_1003070
1490 JGI24738J21930_10000666
1491 JGI24738J21930_10003659
1492 JGI24749J21850_1002556
1493 JGI24744J21845_10001499
1494 JGI24744J21845_10008784
1495 JGI24035J26624_1000205
1496 JGI24034J26672_10000348
1497 JGI24742J22300_10000091
1498 JGI24751J29686_10009779
1499 JGI25406J46586_10033627
1500 JGI25404J52841_10005123
1501 Ga0055530_10006443
1502 Ga0065716_1001671
1503 Ga0065712_10001083
1504 Ga0065712_10016249
1505 Ga0065712_10081197
1506 Ga0065715_10089726
1507 Ga0070658_10000264
1508 Ga0070658_10002220
1509 Ga0070658_10008993
1510 Ga0070658_10010453
1511 Ga0070658_10022506
1512 Ga0070658_10049510
1513 Ga0070658_10124174
1514 Ga0070658_10126593
1515 Ga0070676_10000186
1516 Ga0070676_10025905
1517 Ga0070676_10102088
1518 Ga0070683_100000064
1519 Ga0070683_100037722
1520 Ga0070683_100096585
1521 Ga0070683_100231247
1522 Ga0070690_100055973
1523 Ga0070690_100078858
1524 Ga0070670_100002541
1525 Ga0070670_100006533
1526 Ga0070670_100007186
1527 Ga0070670_100011611
1528 Ga0070670_100024387
1529 Ga0070670_100036861
1530 Ga0070670_100062640
1531 Ga0070670_100187930
1532 Ga0070677_10000050
1533 Ga0070677_10027622
1534 Ga0068869_100000191
1535 Ga0068869_100027748
1536 Ga0068869_100149583
1537 Ga0070666_10022428
1538 Ga0070666_10056441
1539 Ga0070666_10059573
1540 Ga0070680_100007728
1541 Ga0070680_100066516
1542 Ga0070680_100142711
1543 Ga0070680_100196106
1544 Ga0070682_100001714
1545 Ga0070682_100035477
1546 Ga0070682_100069856
1547 Ga0070682_100096978
1548 Ga0068868_100000233
1549 Ga0068868_100032246
1550 Ga0070660_100000091
1551 Ga0070660_100004304
1552 Ga0070660_100005461
1553 Ga0070660_100064748
1554 Ga0070660_100117995
1555 Ga0070660_100119041
1556 Ga0070660_100165159
1557 Ga0070689_100006518
1558 Ga0070689_100113223
1559 Ga0070691_10006662
1560 Ga0070691_10022854
1561 Ga0070691_10037130
1562 Ga0070687_100000337
1563 Ga0070687_100010015
1564 Ga0070687_100050606
1565 Ga0070687_100134806
1566 Ga0070661_100000188
1567 Ga0070661_100006306
1568 Ga0070661_100018063
1569 Ga0070661_100057653
1570 Ga0070661_100085828
1571 Ga0070661_100087437
1572 Ga0070661_100160492
1573 Ga0070692_10050483
1574 Ga0070692_10056796
1575 Ga0070692_10069571
1576 Ga0070668_100000409
1577 Ga0070669_100000523
1578 Ga0070669_100062266
1579 Ga0070675_100000034
1580 Ga0070675_100002418
1581 Ga0070675_100016370
1582 Ga0070675_100092638
1583 Ga0070671_100000111
1584 Ga0070671_100001584
1585 Ga0070671_100010789
1586 Ga0070671_100011792
1587 Ga0070671_100018174
1588 Ga0070671_100019157
1589 Ga0070671_100045533
1590 Ga0070671_100083737
1591 Ga0070671_100116863
1592 Ga0070674_100003026
1593 Ga0070674_100035850
1594 Ga0070674_100063764
1595 Ga0070673_100001357
1596 Ga0070673_100008515
1597 Ga0070673_100153387
1598 Ga0070673_100169148
1599 Ga0070688_100000401
1600 Ga0070688_100052107
1601 Ga0070688_100054570
1602 Ga0070688_100071567
1603 Ga0070659_100002194
1604 Ga0070659_100005493
1605 Ga0070659_100114249
1606 Ga0070659_100117346
1607 Ga0070659_100132646
1608 Ga0070659_100139737
1609 Ga0070659_100187150
1610 Ga0070659_100192052
1611 Ga0070659_100263079
1612 Ga0070667_100005633
1613 Ga0070667_100010235
1614 Ga0070667_100015164
1615 Ga0070667_100016010
1616 Ga0070667_100058925
1617 Ga0070667_100186025
1618 Ga0070667_100253537
1619 Ga0070709_10028699
1620 Ga0070709_10035379
1621 Ga0070714_100011938
1622 Ga0070714_100022892
1623 Ga0070714_100050119
1624 Ga0070714_100087174
1625 Ga0070714_100238776
1626 Ga0070713_100007751
1627 Ga0070713_100010936
1628 Ga0070713_100063116
1629 Ga0070713_100067951
1630 Ga0070710_10008568
1631 Ga0070710_10010806
1632 Ga0070710_10021500
1633 Ga0070710_10022840
1634 Ga0070701_10000524
1635 Ga0070701_10019632
1636 Ga0070711_100011116
1637 Ga0070711_100015201
1638 Ga0070711_100023573
1639 Ga0070705_100000252
1640 Ga0070700_100000657
1641 Ga0070700_100006474
1642 Ga0070694_100021318
1643 Ga0070694_100089908
1644 Ga0070708_100112727
1645 Ga0070663_100004855
1646 Ga0070663_100015911
1647 Ga0070663_100028662
1648 Ga0070663_100085590
1649 Ga0070663_100121253
1650 Ga0070663_100131583
1651 Ga0070663_100191807
1652 Ga0070678_100001414
1653 Ga0070678_100010734
1654 Ga0070678_100011766
1655 Ga0070662_100001002
1656 Ga0070662_100017420
1657 Ga0070662_100064810
1658 Ga0070662_100069580
1659 Ga0070662_100076669
1660 Ga0070681_10047969
1661 Ga0070681_10052703
1662 Ga0070681_10071322
1663 Ga0070681_10072311
1664 Ga0070681_10082351
1665 Ga0070681_10123273
1666 Ga0068867_100001011
1667 Ga0068867_100083074
1668 Ga0070685_10002699
1669 Ga0070685_10065248
1670 Ga0070707_100043599
1671 Ga0070699_100014320
1672 Ga0070679_100004731
1673 Ga0070679_100016615
1674 Ga0070679_100034565
1675 Ga0070679_100036926
1676 Ga0070679_100150520
1677 Ga0070679_100261883
1678 Ga0070684_100000275
1679 Ga0070684_100031635
1680 Ga0070684_100061891
1681 Ga0070684_100123682
1682 Ga0070684_100134572
1683 Ga0070697_100137122
1684 Ga0068853_100002273
1685 Ga0068853_100017670
1686 Ga0068853_100083372
1687 Ga0068853_100160014
1688 Ga0068853_100251885
1689 Ga0070672_100000008
1690 Ga0070672_100013010
1691 Ga0070672_100027974
1692 Ga0070672_100028466
1693 Ga0070672_100094811
1694 Ga0070686_100062116
1695 Ga0070686_100080097
1696 Ga0070695_100063612
1697 Ga0070696_100017449
1698 Ga0070696_100056926
1699 Ga0070696_100070532
1700 Ga0070696_100250150
1701 Ga0070693_100007754
1702 Ga0070693_100008375
1703 Ga0070665_100043426
1704 Ga0070704_100001016
1705 Ga0070704_100091417
1706 Ga0068855_100000129
1707 Ga0068855_100007455
1708 Ga0068855_100033428
1709 Ga0068855_100034657
1710 Ga0068855_100055594
1711 Ga0068855_100058535
1712 Ga0068855_100187219
1713 Ga0068855_100217650
1714 Ga0070664_100000419
1715 Ga0070664_100005421
1716 Ga0070664_100017741
1717 Ga0070664_100036462
1718 Ga0070664_100048170
1719 Ga0070664_100232242
1720 Ga0068857_100002666
1721 Ga0068857_100009744
1722 Ga0068857_100012690
1723 Ga0068857_100244218
1724 Ga0068854_100001824
1725 Ga0068854_100037514
1726 Ga0068856_100000963
1727 Ga0070702_100003016
1728 Ga0070702_100008357
1729 Ga0068852_100001994
1730 Ga0068852_100015664
1731 Ga0068852_100039158
1732 Ga0068852_100044588
1733 Ga0068852_100090988
1734 Ga0068852_100179374
1735 Ga0068859_100000088
1736 Ga0068859_100107572
1737 Ga0068859_100132405
1738 Ga0068859_100209476
1739 Ga0068859_100311275
1740 Ga0068859_100397254
1741 Ga0068864_100000136
1742 Ga0068864_100001346
1743 Ga0068864_100003805
1744 Ga0068864_100019015
1745 Ga0068866_10000291
1746 Ga0068861_100001924
1747 Ga0068861_100116771
1748 Ga0068851_10049564
1749 Ga0068870_10000005
1750 Ga0068863_100000384
1751 Ga0068863_100000608
1752 Ga0068863_100024134
1753 Ga0068863_100074646
1754 Ga0068863_100107829
1755 Ga0068863_100271166
1756 Ga0068858_100000063
1757 Ga0068858_100011061
1758 Ga0068858_100021963
1759 Ga0068858_100026552
1760 Ga0068858_100149146
1761 Ga0068858_100244735
1762 Ga0068860_100001183
1763 Ga0068860_100022772
1764 Ga0068860_100034044
1765 Ga0068860_100067885
1766 Ga0068860_100079433
1767 Ga0068860_100080163
1768 Ga0068860_100113496
1769 Ga0068860_100198147
1770 Ga0068860_100237878
1771 Ga0068862_100007190
1772 Ga0068862_100010432
1773 Ga0068862_100011427
1774 Ga0068862_100017057
1775 Ga0068862_100024857
1776 Ga0068862_100079551
1777 Ga0081455_10000002
1778 Ga0081455_10000329
1779 Ga0081455_10015834
1780 Ga0081538_10002523
1781 Ga0081538_10021900
1782 Ga0081540_1001201
1783 Ga0081540_1009095
1784 Ga0081540_1010246
1785 Ga0081539_10000522
1786 Ga0070717_10001785
1787 Ga0075365_10013799
1788 Ga0075365_10024810
1789 Ga0075368_10000129
1790 Ga0075363_100002771
1791 Ga0075363_100004616
1792 Ga0075432_10013821
1793 Ga0070715_10005920
1794 Ga0070715_10009052
1795 Ga0070715_10025330
1796 Ga0070716_100000730
1797 Ga0070716_100012351
1798 Ga0070716_100044410
1799 Ga0070712_100000963
1800 Ga0070712_100041974
1801 Ga0070712_100048764
1802 Ga0070712_100153292
1803 Ga0075362_10013349
1804 Ga0075367_10002669
1805 Ga0075367_10014764
1806 Ga0075427_10000026
1807 Ga0075366_10089288
1808 Ga0097621_100000006
1809 Ga0097621_100008279
1810 Ga0097621_100182116
1811 Ga0068871_100000022
1812 Ga0068871_100030110
1813 Ga0068871_100200826
1814 Ga0075428_100003527
1815 Ga0075428_100009313
1816 Ga0075428_100055661
1817 Ga0075430_100001061
1818 Ga0075430_100005415
1819 Ga0075430_100034066
1820 Ga0075430_100069113
1821 Ga0075431_100000856
1822 Ga0075431_100035384
1823 Ga0075433_10003278
1824 Ga0075433_10028588
1825 Ga0075434_100000346
1826 Ga0075434_100017393
1827 Ga0075434_100035969
1828 Ga0075434_100171152
1829 Ga0075429_100001137
1830 Ga0075429_100007463
1831 Ga0075429_100022293
1832 Ga0068865_100000196
1833 Ga0068865_100133796
1834 Ga0097620_100000088
1835 Ga0097620_100107561
1836 Ga0097620_100132405
1837 Ga0097620_100209474
1838 Ga0097620_100311247
1839 Ga0097620_100397247
1840 Ga0075435_100003799
1841 Ga0075435_100019065
1842 Ga0075435_100038442
1843 Ga0099795_10033014
1844 Ga0099795_10048007
1845 Ga0105251_10034057
1846 Ga0105240_10021899
1847 Ga0105240_10068944
1848 Ga0105240_10190806
1849 Ga0105240_10380728
1850 Ga0111539_10000817
1851 Ga0111539_10001765
1852 Ga0111539_10001792
1853 Ga0111539_10016539
1854 Ga0111539_10289486
1855 Ga0105245_10006255
1856 Ga0105245_10051976
1857 Ga0105245_10053755
1858 Ga0105245_10160885
1859 Ga0105247_10004177
1860 Ga0105247_10014764
1861 Ga0105247_10113196
1862 Ga0114129_10001060
1863 Ga0114129_10003956
1864 Ga0114129_10021909
1865 Ga0114129_10024577
1866 Ga0105243_10003212
1867 Ga0105241_10002185
1868 Ga0105241_10022254
1869 Ga0105241_10044485
1870 Ga0105242_10002746
1871 Ga0105242_10023628
1872 Ga0105248_10000169
1873 Ga0105248_10005067
1874 Ga0105248_10006401
1875 Ga0105248_10020884
1876 Ga0105248_10021626
1877 Ga0105248_10214425
1878 Ga0105237_10085695
1879 Ga0105237_10096569
1880 Ga0105238_10004728
1881 Ga0105238_10038260
1882 Ga0105249_10003096
1883 Ga0105249_10039603
1884 Ga0105249_10139808
1885 Ga0105239_10001436
1886 Ga0105239_10021456
1887 Ga0105239_10025721
1888 Ga0105239_10079131
1889 Ga0105246_10001322
1890 Ga0105246_10056113
1891 Ga0105246_10122645
1892 Ga0157373_10014713
1893 Ga0157373_10062685
1894 Ga0157371_10005808
1895 Ga0157371_10011416
1896 Ga0157371_10031596
1897 Ga0157371_10035537
1898 Ga0157371_10036397
1899 Ga0157371_10123912
1900 Ga0157371_10202790
1901 Ga0157371_10211537
1902 Ga0157370_10021346
1903 Ga0157370_10040486
1904 Ga0157369_10042326
1905 Ga0157369_10088883
1906 Ga0157374_10023096
1907 Ga0157374_10059192
1908 Ga0157378_10004038
1909 Ga0157378_10050000
1910 Ga0163162_10002546
1911 Ga0163162_10039471
1912 Ga0163162_10041821
1913 Ga0163162_10370488
1914 Ga0157372_10029143
1915 Ga0157372_10066996
1916 Ga0157372_10068034
1917 Ga0157372_10243052
1918 Ga0157372_10336092
1919 Ga0157375_10056614
1920 Ga0157375_10161948
1921 Ga0163163_10000170
1922 Ga0163163_10001683
1923 Ga0163163_10066801
1924 Ga0163163_10122875
1925 Ga0163163_10188748
1926 Ga0157380_10067347
1927 Ga0157377_10000127
1928 Ga0157379_10008840
1929 Ga0157379_10008961
1930 Ga0157379_10013169
1931 Ga0157379_10054179
1932 Ga0157376_10000126
1933 Ga0157376_10011024
1934 Ga0163161_10000562
1935 Ga0163161_10049148
1936 Ga0213874_10001300
1937 Ga0213876_10054320
1938 Ga0228598_1000321
1939 Ga0207666_1002396
1940 Ga0207673_1000208
1941 Ga0209050_1000262
1942 Ga0207697_10029097
1943 Ga0207653_10009245
1944 Ga0207682_10000001
1945 Ga0207682_10001899
1946 Ga0207692_10034318
1947 Ga0207692_10041374
1948 Ga0207642_10001429
1949 Ga0207710_10000895
1950 Ga0207710_10005202
1951 Ga0207688_10001997
1952 Ga0207688_10008183
1953 Ga0207688_10053713
1954 Ga0207680_10007725
1955 Ga0207647_10000627
1956 Ga0207647_10002335
1957 Ga0207647_10004040
1958 Ga0207647_10006288
1959 Ga0207647_10097072
1960 Ga0207647_10120962
1961 Ga0207699_10044303
1962 Ga0207699_10045606
1963 Ga0207645_10000276
1964 Ga0207645_10005447
1965 Ga0207645_10020893
1966 Ga0207643_10000041
1967 Ga0207643_10000613
1968 Ga0207643_10117178
1969 Ga0207705_10000091
1970 Ga0207705_10009087
1971 Ga0207705_10018644
1972 Ga0207705_10029024
1973 Ga0207705_10035312
1974 Ga0207705_10037339
1975 Ga0207705_10044392
1976 Ga0207705_10049030
1977 Ga0207705_10069088
1978 Ga0207654_10003566
1979 Ga0207654_10028711
1980 Ga0207707_10005534
1981 Ga0207707_10017298
1982 Ga0207707_10041404
1983 Ga0207707_10059659
1984 Ga0207707_10185051
1985 Ga0207707_10205317
1986 Ga0207695_10043579
1987 Ga0207671_10013164
1988 Ga0207671_10054159
1989 Ga0207693_10004802
1990 Ga0207693_10005773
1991 Ga0207693_10012871
1992 Ga0207693_10052850
1993 Ga0207693_10054500
1994 Ga0207693_10093817
1995 Ga0207663_10004685
1996 Ga0207663_10018835
1997 Ga0207663_10036004
1998 Ga0207660_10000006
1999 Ga0207660_10000864
2000 Ga0207660_10006249
2001 Ga0207660_10043755
2002 Ga0207660_10237190
2003 Ga0207662_10000207
2004 Ga0207662_10003504
2005 Ga0207662_10011850
2006 Ga0207662_10024769
2007 Ga0207662_10110690
2008 Ga0207657_10000092
2009 Ga0207657_10000252
2010 Ga0207657_10001742
2011 Ga0207657_10002395
2012 Ga0207657_10004547
2013 Ga0207657_10004799
2014 Ga0207657_10015568
2015 Ga0207657_10018720
2016 Ga0207657_10019350
2017 Ga0207657_10019526
2018 Ga0207657_10019679
2019 Ga0207657_10024115
2020 Ga0207657_10040408
2021 Ga0207657_10054523
2022 Ga0207657_10164423
2023 Ga0207649_10000049
2024 Ga0207649_10114529
2025 Ga0207652_10000300
2026 Ga0207652_10015009
2027 Ga0207652_10017153
2028 Ga0207652_10070600
2029 Ga0207652_10085936
2030 Ga0207652_10114203
2031 Ga0207681_10000024
2032 Ga0207681_10018745
2033 Ga0207694_10001718
2034 Ga0207694_10007596
2035 Ga0207650_10000990
2036 Ga0207650_10005202
2037 Ga0207650_10007269
2038 Ga0207650_10019900
2039 Ga0207650_10044215
2040 Ga0207659_10000042
2041 Ga0207659_10000885
2042 Ga0207659_10024411
2043 Ga0207659_10033789
2044 Ga0207659_10245158
2045 Ga0207687_10003253
2046 Ga0207687_10124486
2047 Ga0207700_10001840
2048 Ga0207700_10142645
2049 Ga0207664_10035347
2050 Ga0207664_10042440
2051 Ga0207664_10051499
2052 Ga0207664_10171022
2053 Ga0207644_10000041
2054 Ga0207644_10001327
2055 Ga0207644_10005264
2056 Ga0207644_10015084
2057 Ga0207644_10048211
2058 Ga0207644_10057501
2059 Ga0207644_10120300
2060 Ga0207690_10000137
2061 Ga0207690_10000709
2062 Ga0207690_10002665
2063 Ga0207690_10015489
2064 Ga0207690_10031479
2065 Ga0207690_10042617
2066 Ga0207690_10054048
2067 Ga0207690_10136594
2068 Ga0207690_10148699
2069 Ga0207706_10000568
2070 Ga0207706_10000746
2071 Ga0207706_10004407
2072 Ga0207706_10010385
2073 Ga0207706_10011126
2074 Ga0207706_10015457
2075 Ga0207706_10024460
2076 Ga0207706_10027262
2077 Ga0207706_10065107
2078 Ga0207706_10131449
2079 Ga0207706_10281828
2080 Ga0207686_10000571
2081 Ga0207686_10056004
2082 Ga0207709_10000220
2083 Ga0207709_10010336
2084 Ga0207709_10089212
2085 Ga0207709_10201888
2086 Ga0207670_10000323
2087 Ga0207669_10000005
2088 Ga0207669_10004706
2089 Ga0207669_10007517
2090 Ga0207669_10008276
2091 Ga0207704_10000060
2092 Ga0207665_10000117
2093 Ga0207665_10000210
2094 Ga0207691_10005532
2095 Ga0207691_10006907
2096 Ga0207691_10017079
2097 Ga0207691_10037116
2098 Ga0207691_10077281
2099 Ga0207691_10129432
2100 Ga0207691_10129978
2101 Ga0207711_10000039
2102 Ga0207711_10001557
2103 Ga0207711_10014181
2104 Ga0207711_10015227
2105 Ga0207711_10022126
2106 Ga0207711_10031874
2107 Ga0207711_10063794
2108 Ga0207711_10070811
2109 Ga0207689_10000053
2110 Ga0207689_10007517
2111 Ga0207689_10009414
2112 Ga0207689_10027153
2113 Ga0207689_10052697
2114 Ga0207661_10000036
2115 Ga0207661_10019697
2116 Ga0207679_10000060
2117 Ga0207679_10002925
2118 Ga0207679_10010577
2119 Ga0207679_10026824
2120 Ga0207679_10081322
2121 Ga0207679_10106286
2122 Ga0207679_10139096
2123 Ga0207667_10000303
2124 Ga0207667_10197000
2125 Ga0207667_10198839
2126 Ga0207651_10000014
2127 Ga0207651_10224986
2128 Ga0207712_10000134
2129 Ga0207712_10000195
2130 Ga0207712_10116473
2131 Ga0207668_10000350
2132 Ga0207668_10075099
2133 Ga0207668_10114395
2134 Ga0207668_10132031
2135 Ga0207668_10137641
2136 Ga0207640_10001960
2137 Ga0207640_10026231
2138 Ga0207658_10001042
2139 Ga0207658_10001227
2140 Ga0207658_10003771
2141 Ga0207658_10017582
2142 Ga0207658_10071331
2143 Ga0207658_10072259
2144 Ga0207658_10257038
2145 Ga0207658_10268364
2146 Ga0207677_10003136
2147 Ga0207677_10003572
2148 Ga0207703_10000327
2149 Ga0207703_10032671
2150 Ga0207703_10250734
2151 Ga0207703_10302439
2152 Ga0207639_10000835
2153 Ga0207639_10001105
2154 Ga0207639_10048488
2155 Ga0207639_10093241
2156 Ga0207678_10000892
2157 Ga0207678_10001535
2158 Ga0207678_10001718
2159 Ga0207678_10003104
2160 Ga0207678_10011286
2161 Ga0207678_10026959
2162 Ga0207678_10034704
2163 Ga0207678_10041314
2164 Ga0207678_10047163
2165 Ga0207678_10099602
2166 Ga0207678_10160785
2167 Ga0207678_10161923
2168 Ga0207708_10001777
2169 Ga0207708_10101112
2170 Ga0207708_10101648
2171 Ga0207702_10011181
2172 Ga0207702_10091065
2173 Ga0207641_10000138
2174 Ga0207641_10000664
2175 Ga0207641_10009374
2176 Ga0207641_10054912
2177 Ga0207641_10142163
2178 Ga0207648_10004308
2179 Ga0207648_10017594
2180 Ga0207648_10063136
2181 Ga0207676_10000358
2182 Ga0207676_10000983
2183 Ga0207676_10005202
2184 Ga0207676_10016480
2185 Ga0207674_10000185
2186 Ga0207674_10000314
2187 Ga0207674_10002181
2188 Ga0207674_10002696
2189 Ga0207674_10024950
2190 Ga0207674_10044244
2191 Ga0207675_100002850
2192 Ga0207675_100018253
2193 Ga0207675_100154693
2194 Ga0207675_100162829
2195 Ga0207683_10000001
2196 Ga0207683_10027328
2197 Ga0207683_10038667
2198 Ga0207683_10127233
2199 Ga0207698_10000857
2200 Ga0207698_10044221
2201 Ga0207698_10084683
2202 Ga0207698_10162661
2203 Ga0207698_10220339
2204 Ga0209179_1005986
2205 Ga0209966_1000701
2206 Ga0209813_10000184
2207 Ga0209974_10006072
2208 Ga0207428_10000316
2209 Ga0207428_10000897
2210 Ga0207428_10000923
2211 Ga0268266_10016735
2212 Ga0268266_10019041
2213 Ga0268266_10028106
2214 Ga0268266_10028711
2215 Ga0268265_10002015
2216 Ga0268265_10006389
2217 Ga0268265_10007116
2218 Ga0268265_10010473
2219 Ga0268265_10019093
2220 Ga0268265_10036082
2221 Ga0268265_10073525
2222 Ga0268265_10108458
2223 Ga0268265_10115467
2224 Ga0268264_10000976
2225 Ga0268264_10002587
2226 Ga0268264_10003561
2227 Ga0268264_10010537
2228 Ga0268264_10048516
2229 Ga0268264_10118751
2230 Ga0268264_10123474
2231 Ga0268264_10184721
2232 Ga0265318_10022180
2233 Ga0265338_10014430
2234 Ga0265760_10023408
2235 Ga0265330_10021930
2236 Ga0265332_10035887
2237 Ga0265332_10066004
2238 Ga0265328_10011073
2239 Ga0265325_10000097
2240 Ga0265325_10003705
2241 Ga0265325_10009260
2242 Ga0265325_10009896
2243 Ga0265325_10050320
2244 Ga0265340_10010971
2245 Ga0265339_10000091
2246 Ga0265339_10007468
2247 Ga0265339_10013800
2248 Ga0265331_10023779
2249 Ga0265316_10008071
2250 Ga0265316_10023549
2251 Ga0307513_10200910
2252 Ga0307408_100020885
2253 Ga0307408_100036610
2254 Ga0307408_100038872
2255 Ga0307408_100175266
2256 Ga0265313_10000260
2257 Ga0265313_10004440
2258 Ga0265313_10006139
2259 Ga0265313_10009745
2260 Ga0265313_10017993
2261 Ga0265313_10026282
2262 Ga0265313_10063235
2263 Ga0316579_10007010
2264 Ga0265314_10001493
2265 Ga0265314_10029986
2266 Ga0265314_10034505
2267 Ga0265342_10035680
2268 Ga0265342_10065731
2269 Ga0265342_10075153
2270 Ga0307405_10019312
2271 Ga0307405_10099604
2272 Ga0307413_10004947
2273 Ga0307413_10005807
2274 Ga0307413_10041306
2275 Ga0307410_10000196
2276 Ga0307410_10006424
2277 Ga0307410_10008268
2278 Ga0307410_10067718
2279 Ga0307410_10078392
2280 Ga0307410_10107900
2281 Ga0307406_10006125
2282 Ga0307406_10082294
2283 Ga0307407_10002297
2284 Ga0307407_10005484
2285 Ga0307407_10027269
2286 Ga0307412_10018182
2287 Ga0307412_10082897
2288 Ga0307412_10095467
2289 Ga0307412_10117210
2290 Ga0307412_10178438
2291 Ga0307409_100000135
2292 Ga0307409_100003671
2293 Ga0307409_100023312
2294 Ga0307409_100031858
2295 Ga0307409_100122463
2296 Ga0307416_100004600
2297 Ga0307416_100030220
2298 Ga0307416_100036347
2299 Ga0307416_100063662
2300 Ga0307416_100167519
2301 Ga0307414_10008740
2302 Ga0307414_10031793
2303 Ga0307414_10044294
2304 Ga0307414_10080811
2305 Ga0307414_10091118
2306 Ga0307414_10116781
2307 Ga0307414_10219992
2308 Ga0307414_10230655
2309 Ga0307411_10001690
2310 Ga0307411_10002367
2311 Ga0307411_10008891
2312 Ga0307411_10022155
2313 Ga0307411_10042276
2314 Ga0307411_10046202
2315 Ga0307411_10047788
2316 Ga0307411_10068032
2317 Ga0307411_10104022
2318 Ga0307415_100031263
2319 Ga0307415_100059518
2320 Ga0307415_100148538
2321 Ga0307415_100226374
2322 Ga0316583_10000081
2323 Ga0373930_0000006
2324 Ga0373958_0000694
2325 Ga0373958_0001103
2326 Ga0373959_0005640
2327 Ga0373938_0000479
2328 Ga0373938_0001513
2329 Ga0373926_0007041
2330 Ga0373928_0003420
2331 Ga0373928_0004315
2332 Ga0373929_0000474
2333 Ga0373934_0003474
2334 Ga0373934_0047832
2335 Ga0373940_0000343
2336 Ga0373940_0008788
2337 Ga0373944_0002019
2338 Ga0373944_0002875
2339 Ga0373944_0003428
2340 Ga0373944_0024959
2341 Ga0373951_0000313
2342 Ga0373952_0000218
2343 Ga0373952_0000939
2344 Ga0373923_0018708
2345 Ga0373932_0002670
2346 Ga0373932_0003226
2347 Ga0373932_0017848
2348 Ga0373936_0045373
2349 Ga0373939_0000569
2350 Ga0373939_0005627
2351 Ga0373941_0001350
2352 Ga0373941_0025498
2353 Ga0373941_0031985
2354 Ga0373945_0004285
2355 Ga0373945_0012804
2356 Ga0373953_0006282
2357 Ga0373954_0013421
2358 Ga0373954_0016582
2359 Ga0373954_0036014
2360 Ga0373956_0006720
2361 Ga0373956_0037549
2362 Ga0373956_0040827
2363 Ga0373957_0013818
2364 Ga0373960_0000093
2365 Ga0373943_0000567
2366 Ga0373943_0012619
2367 Ga0373946_0002942
2368 Ga0373946_0008443
2369 Ga0373946_0023518
2370 Ga0373946_0063818
2371 Ga0373955_0000962
2372 Ga0373955_0001391
2373 Ga0373955_0025552
2374 Ga0373955_0043621
2375 Ga0373942_0000292
2376 Ga0373942_0010958
2377 Ga0373961_0001147
2378 Ga0373961_0010379
2379 Ga0373962_0000301
2380 Ga0373962_0001628
2381 Ga0373962_0011123
2382 Ga0373931_0000086
2383 Ga0373931_0003593
2384 Ga0373935_0031599
2385 Ga0373935_0057184
2386 Ga0373935_0065204
2387 Ga0373935_0067547
2388 Ga0373927_0005131
2389 Ga0373927_0034920
2390 Ga0373927_0059331
2391 Ga0373927_0071753
2392 Ga0373927_0114791
2393 Ga0373933_0009812
2394 Ga0373933_0017845
2395 Ga0373933_0028060
2396 Ga0373947_0009204
2397 Ga0373947_0014769
2398 Ga0373947_0021695
2399 Ga0373937_0004313
2400 Ga0373937_0004822
2401 Ga0373937_0013053
2402 Ga0373937_0023035
2403 Ga0373937_0031048
2404 Ga0373937_0117379
2405 Ga0316582_0080845
2406 Ga0373925_0003922
2407 Ga0373925_0015075
2408 Ga0373925_0023858
2409 Ga0395899_0000132
2410 Ga0395899_0025245
2411 Ga0395900_0000477
2412 Ga0395900_0000997
2413 Ga0395900_0001169
2414 Ga0395900_0003479
2415 Ga0395900_0016968
2416 Ga0395900_0078138
2417 Ga0395900_0085220
2418 Ga0395900_0091734
2419 Ga0395898_0015973
2420 Ga0395898_0017326
2421 Ga0395898_0028510
2422 Ga0395898_0061634
2423 Ga0395898_0067555
2424 Ga0395898_0117554
2425 Ga0395898_0121892
2426 Ga0395905_0000818
2427 Ga0395905_0001164
2428 Ga0395905_0002761
2429 Ga0395905_0010864
2430 Ga0395905_0021647
2431 Ga0395905_0043421
2432 Ga0395905_0053027
2433 Ga0395905_0068826
2434 Ga0436364_0319726
2435 Ga0395901_0000208
2436 Ga0395901_0000589
2437 Ga0395901_0002866
2438 Ga0395901_0007227
2439 Ga0395901_0087854
2440 Ga0395901_0114738
2441 Ga0395901_0197617
2442 Ga0395901_0295086
2443 Ga0395901_0368745
2444 Ga0436365_0414414
2445 Ga0436365_0458815
2446 Ga0436360_0251329
2447 Ga0436361_0896735
2448 Ga0439445_0002205
2449 Ga0439448_0020086
2450 Ga0439432_008816
2451 Ga0439432_023841
2452 Ga0439452_023708
2453 Ga0439455_0025551
2454 Ga0439462_0031594
2455 Ga0450905_003094
2456 Ga0450889_000019
2457 Ga0439435_0000116
2458 Ga0451577_0012529
2459 Ga0466972_0068169
2460 Ga0466966_0167740
2461 Ga0466963_0003406
2462 Ga0466963_0015451
2463 Ga0466963_0042944
2464 Ga0466963_0155714
2465 Ga0453684_0082525
2466 Ga0466959_0059587
2467 Ga0451576_0027924
2468 Ga0466958_0035584
2469 Ga0466967_0002255
2470 Ga0466967_0007911
2471 Ga0466967_0053981
2472 Ga0466967_0066726
2473 Ga0466967_0081609
2474 Ga0466967_0172865
2475 Ga0466967_0178004
2476 Ga0466967_0191450
2477 Ga0495592_0008217
2478 Ga0495592_0027775
2479 Ga0495592_0101871
2480 Ga0495603_0087900
2481 Ga0495629_0000668
2482 Ga0495629_0135648
2483 Ga0495638_0000204
2484 Ga0495638_0017966
2485 Ga0495638_0021126
2486 Ga0495641_0034802
2487 Ga0495641_0068827
2488 Ga0495651_0000237
2489 Ga0495651_0009743
2490 Ga0495651_0014732
2491 Ga0495651_0064792
2492 Ga0495653_0009351
2493 Ga0495653_0020295
2494 Ga0495653_0047643
2495 Ga0495580_0024260
2496 Ga0495580_0044157
2497 Ga0495582_0035811
2498 Ga0495639_0020552
2499 Ga0495662_0000280
2500 Ga0495662_0007973
2501 Ga0495662_0015169
2502 Ga0495664_0000112
2503 Ga0495664_0006025
2504 Ga0495664_0092353
2505 Ga0495584_0011269
2506 Ga0495584_0055204
2507 Ga0495584_0074316
2508 Ga0495585_0000734
2509 Ga0495585_0006706
2510 Ga0495596_0008510
2511 Ga0495607_0011035
2512 Ga0495608_0005221
2513 Ga0495608_0067866
2514 Ga0495610_0002641
2515 Ga0495618_0001016
2516 Ga0495618_0007304
2517 Ga0495618_0066673
2518 Ga0495618_0134541
2519 Ga0495628_0004625
2520 Ga0495628_0018442
2521 Ga0495628_0211069
2522 Ga0495630_0024126
2523 Ga0495630_0034111
2524 Ga0495631_0016466
2525 Ga0495632_0000075
2526 Ga0495632_0046880
2527 Ga0495637_0000123
2528 Ga0495637_0034787
2529 Ga0495643_0000009
2530 Ga0495644_0000306
2531 Ga0495648_0037541
2532 Ga0495663_0000003
2533 Ga0495663_0017730
2534 Ga0495666_0023948
2535 Ga0495666_0034834
2536 Ga0495652_0019482
2537 Ga0495652_0105926
2538 Ga0495665_0007482
2539 Ga0495665_0012616
2540 Ga0495665_0030802
2541 Ga0495640_0000871
2542 Ga0495640_0084501
2543 Ga0495586_0014023
2544 Ga0495586_0041668
2545 Ga0495586_0111993
2546 Ga0495587_0006533
2547 Ga0495587_0072252
2548 Ga0495587_0118441
2549 Ga0495598_0003015
2550 Ga0495621_0000652
2551 Ga0495621_0011175
2552 Ga0495621_0019245
2553 Ga0495645_0003375
2554 Ga0495645_0004586
2555 Ga0495645_0076719
2556 Ga0495622_0034756
2557 Ga0495622_0054674
2558 Ga0495633_0000173
2559 Ga0495633_0001183
2560 Ga0495633_0001327
2561 Ga0495667_0003141
2562 Ga0495667_0004903
2563 Ga0495667_0079413
2564 Ga0495667_0095258
2565 Ga0495656_0000381
2566 Ga0495656_0072045
2567 Ga0495668_0076134
2568 Ga0495634_0003493
2569 Ga0495634_0033846
2570 Ga0495634_0038870
2571 Ga0495611_0001463
2572 Ga0495635_0002093
2573 Ga0495635_0028467
2574 Ga0495635_0116987
2575 Ga0495659_0003761
2576 Ga0495661_0082450
2577 Ga0495588_0002225
2578 Ga0495657_0006644
2579 Ga0495657_0008508
2580 Ga0495657_0008561
2581 Ga0495599_0021673
2582 Ga0495623_0026503
2583 Ga0495646_0004362
2584 Ga0495658_0000229
2585 Ga0495669_0000599
2586 Ga0495669_0001837
2587 Ga0495669_0010207
2588 Ga0495613_0011247
2589 Ga0495613_0037688
2590 Ga0495613_0103240
2591 Ga0495613_0121505
2592 Ga0495624_0001093
2593 Ga0495624_0022372
2594 Ga0495670_0002180
2595 Ga0495670_0003882
2596 Ga0495670_0102255
2597 Ga0495671_0000013
2598 Ga0495600_0019287
2599 Ga0495600_0067544
2600 Ga0495600_0084015
2601 Ga0495581_0054776
2602 Ga0495581_0056281
2603 Ga0495581_0058993
2604 Ga0495581_0084168
2605 Ga0495604_0002806
2606 Ga0495604_0008011
2607 Ga0495604_0009095
2608 Ga0495674_0001513
2609 Ga0495674_0151891
2610 Ga0495674_0280038
2611 Ga0495672_0002402
2612 Ga0495672_0004345
2613 Ga0495672_0083360
2614 Ga0495676_0072836
2615 Ga0495676_0125444
2616 Ga0495680_0016671
2617 Ga0495680_0025791
2618 Ga0495680_0028426
2619 Ga0495680_0077960
2620 Ga0495680_0098613
2621 Ga0495675_0005331
2622 Ga0495677_0018861
2623 Ga0495681_0001636
2624 Ga0495684_0000264
2625 Ga0495684_0001309
2626 Ga0495593_0030842
2627 Ga0495593_0046463
2628 Ga0495602_0005783
2629 Ga0495602_0021033
2630 Ga0495602_0040285
2631 Ga0495602_0186809
2632 Ga0495614_0012220
2633 Ga0495615_0004517
2634 Ga0495626_0000214
2635 Ga0496100_0001253
2636 Ga0496100_0040891
2637 Ga0496101_0001852
2638 Ga0496101_0002475
2639 Ga0496101_0004266
2640 Ga0496101_0043198
2641 Ga0496101_0061187
2642 Ga0496102_0002526
2643 Ga0496102_0006171
2644 Ga0496102_0024435
2645 Ga0496102_0203451
2646 Ga0496103_0000130
2647 Ga0496103_0000715
2648 Ga0496103_0012088
2649 Ga0496103_0031446
2650 Ga0496104_0000311
2651 Ga0496104_0000900
2652 Ga0496104_0001975
2653 Ga0496104_0011188
2654 Ga0496104_0047862
2655 Ga0496104_0095212
2656 Ga0496105_0000144
2657 Ga0496105_0000363
2658 Ga0496105_0010173
2659 Ga0496105_0052297
2660 Ga0496105_0075082
2661 Ga0496105_0075755
2662 Ga0496105_0200163
2663 Ga0496106_0000135
2664 Ga0496106_0005392
2665 Ga0496106_0011849
2666 Ga0496106_0015796
2667 Ga0496106_0106463
2668 Ga0496107_0012327
2669 Ga0496107_0031189
2670 Ga0496107_0059074
2671 Ga0496107_0120197
2672 Ga0496107_0255400
2673 Ga0496108_0000256
2674 Ga0496108_0004267
2675 Ga0496108_0005425
2676 Ga0496108_0005764
2677 Ga0496108_0008672
2678 Ga0496108_0022065
2679 Ga0496108_0040349
2680 Ga0496108_0125821
2681 Ga0496109_0000490
2682 Ga0496109_0000730
2683 Ga0496109_0012503
2684 Ga0496109_0027371
2685 Ga0496109_0041709
2686 Ga0496109_0048395
2687 Ga0496109_0066682
2688 Ga0496109_0167510
2689 Ga0496109_0219015
2690 Ga0496110_0005771
2691 Ga0496110_0008763
2692 Ga0496110_0008841
2693 Ga0496110_0010176
2694 Ga0496110_0124874
2695 Ga0496110_0257683
2696 Ga0496111_0002097
2697 Ga0496111_0012561
2698 Ga0496111_0015368
2699 Ga0496111_0030426
2700 Ga0496111_0047442
2701 Ga0496111_0074374
2702 Ga0496111_0084864
2703 Ga0496111_0098668
2704 Ga0496112_0002301
2705 Ga0496112_0040962
2706 Ga0496112_0051044
2707 Ga0496112_0053767
2708 Ga0496112_0083002
2709 Ga0496112_0086797
2710 Ga0496112_0116008
2711 Ga0496112_0196859
2712 Ga0496113_0000318
2713 Ga0496113_0004239
2714 Ga0496113_0008442
2715 Ga0496113_0016292
2716 Ga0496113_0079873
2717 Ga0496114_0000006
2718 Ga0496114_0000287
2719 Ga0496114_0058988
2720 Ga0496114_0131587
2721 Ga0496115_0003371
2722 Ga0496115_0009373
2723 Ga0496115_0018872
2724 Ga0496115_0019923
2725 Ga0496115_0061836
2726 Ga0496115_0064194
2727 Ga0496115_0113708
2728 Ga0496116_0000062
2729 Ga0496118_0039378
2730 Ga0496119_0000936
2731 Ga0496121_0002503
2732 Ga0496121_0010966
2733 Ga0496122_0000589
2734 Ga0496122_0009287
2735 Ga0496122_0019558
2736 Ga0496122_0020036
2737 Ga0496123_0000278
2738 Ga0496123_0000545
2739 Ga0496123_0001298
2740 Ga0496123_0002167
2741 Ga0496124_0010346
2742 Ga0496124_0052085
2743 Ga0496125_0004774
2744 Ga0496125_0027784
2745 Ga0496126_0000801
2746 Ga0501032_0039527
2747 Ga0501032_0063370
2748 Ga0501032_0162501
2749 Ga0501033_0004204
2750 Ga0501033_0024281
2751 Ga0501033_0026129
2752 Ga0501034_0000436
2753 Ga0501034_0005233
2754 Ga0501034_0009627
2755 Ga0501034_0027067
2756 Ga0501034_0099430
2757 Ga0501036_0001221
2758 Ga0501036_0027487
2759 Ga0501036_0044521
2760 Ga0501036_0131217
2761 Ga0501037_0003949
2762 Ga0501038_0028790
2763 Ga0501038_0085958
2764 Ga0501038_0095777
2765 Ga0501039_0033073
2766 Ga0501039_0044143
2767 Ga0501039_0214251
2768 Ga0501040_0108027
2769 Ga0501043_0008146
2770 Ga0501043_0009282
2771 Ga0501043_0034819
2772 Ga0501046_0105803
2773 Ga0501047_0000223
2774 Ga0501047_0000384
2775 Ga0501047_0035760
2776 Ga0501047_0116121
2777 Ga0501047_0146712
2778 Ga0501048_0000074
2779 Ga0501048_0123057
2780 Ga0501067_0011404
2781 Ga0501067_0055988
2782 Ga0501067_0076510
2783 Ga0501068_0032961
2784 Ga0501069_0006054
2785 Ga0501069_0019134
2786 Ga0501070_0008586
2787 Ga0501070_0011258
2788 Ga0501070_0025736
2789 Ga0501070_0032074
2790 Ga0501070_0032152
2791 Ga0501071_0011938
2792 Ga0501071_0071204
2793 Ga0501071_0126813
2794 Ga0501072_0001326
2795 Ga0501074_0012491
2796 Ga0501076_0012519
2797 Ga0501076_0064957
2798 Ga0501076_0091509
2799 Ga0501235_011191
2800 Ga0501221_006804
2801 Ga0501079_0135107
2802 Ga0501079_0202160
2803 Ga0501080_0001854
2804 Ga0501080_0025491
2805 Ga0501080_0059932
2806 Ga0501081_0053559
2807 Ga0501083_0001146
2808 Ga0501083_0022266
2809 Ga0501083_0043876
2810 Ga0501083_0170931
2811 Ga0501035_0000371
2812 Ga0501035_0007311
2813 Ga0501035_0033698
2814 Ga0501035_0060863
2815 Ga0501035_0253117
2816 Ga0501044_0001720
2817 Ga0501044_0011870
2818 Ga0501044_0124863
2819 Ga0501045_0168021
2820 nmdc:mga03n38_6277_c1
2821 nmdc:mga03n38_92370_c1
2822 nmdc:mga0yw44_23578_c1
2823 nmdc:mga0yw44_2995_c1
2824 nmdc:mga0yw44_63475_c1
2825 nmdc:mga06z11_11391_c1
2826 nmdc:mga06z11_49590_c1
2827 nmdc:mga06z11_60_c1
2828 nmdc:mga04h51_39509_c1
2829 nmdc:mga04h51_403_c1
2830 nmdc:mga07m45_136286_c1
2831 nmdc:mga07m45_81046_c1
2832 nmdc:mga07m45_8495_c1
2833 nmdc:mga05p37_1191_c1
2834 nmdc:mga05p37_222_c1
2835 nmdc:mga05p37_30060_c1
2836 nmdc:mga05p37_71985_c1
2837 nmdc:mga05p37_81621_c1
2838 nmdc:mga09592_16877_c1
2839 nmdc:mga09592_3118_c1
2840 nmdc:mga09592_70637_c1
2841 nmdc:mga0qj67_141077_c1
2842 nmdc:mga0qj67_1677_c1
2843 nmdc:mga0qj67_60328_c1
2844 nmdc:mga06r32_1077_c1
2845 nmdc:mga06r32_284100_c1
2846 nmdc:mga08y16_11073_c1
2847 nmdc:mga08y16_116433_c1
2848 nmdc:mga08y16_121832_c1
2849 nmdc:mga08y16_13536_c1
2850 nmdc:mga08y16_13718_c1
2851 nmdc:mga08y16_57400_c1
2852 nmdc:mga08y16_587_c1
2853 nmdc:mga0n895_126764_c1
2854 nmdc:mga0n895_150771_c1
2855 nmdc:mga0n895_200633_c1
2856 nmdc:mga0n895_425063_c1
2857 nmdc:mga0n895_437_c1
2858 nmdc:mga0n895_741_c1
2859 nmdc:mga0rr50_185351_c1
2860 nmdc:mga0rr50_5627_c1
2861 nmdc:mga0rr50_6644_c1
2862 nmdc:mga0rr50_88555_c1
2863 nmdc:mga08x19_165289_c1
2864 nmdc:mga08x19_49275_c1
2865 nmdc:mga0a205_158439_c1
2866 nmdc:mga0a205_3283_c1
2867 nmdc:mga0a205_40207_c1
2868 nmdc:mga0a205_43507_c1
2869 nmdc:mga0a205_6511_c1
2870 nmdc:mga0a205_802_c1
2871 nmdc:mga0sz30_19123_c1
2872 Ga0495601_0000441
2873 Ga0495601_0001951
2874 Ga0495601_0006078
2875 Ga0495601_0020031
2876 Ga0495601_0042861
2877 Ga0495612_0006563
2878 Ga0495612_0019001
2879 Ga0495612_0048622
2880 Ga0495595_0000551
2881 Ga0495595_0002072
2882 Ga0495595_0003250
2883 Ga0495595_0008006
2884 Ga0495595_0110045
2885 Ga0495619_0000063
2886 Ga0495619_0000170
2887 Ga0495619_0001482
2888 Ga0495619_0011350
2889 Ga0495619_0022077
2890 Ga0495619_0022235
2891 Ga0500644_0000715
2892 Ga0500651_0004383
2893 Ga0500641_0017324
2894 Ga0500556_0000160
2895 Ga0500593_000044
2896 Ga0500593_007593
2897 Ga0500594_0036322
2898 Ga0500595_000085
2899 Ga0500652_000056
2900 Ga0500652_005144
2901 Ga0500568_0000004
2902 Ga0500616_0000001
2903 Ga0500616_0000038
2904 Ga0500624_000072
2905 Ga0500636_0029690
2906 Ga0500645_004638
2907 Ga0500645_006791
2908 Ga0501084_0128391
2909 Ga0501082_0001551
2910 Ga0501082_0060009
2911 Ga0501082_0083169
2912 Ga0501082_0127916
2913 2512645674
2914 2513590353
2915 2643758965
2916 2644290723
2917 2723849349
2918 2809063054
2919 2809079018
2920 2809083607
2921 2819552788
2922 2880520309
2923 2885427367
2924 2919452146
2925 2919709844
2926 2922364341
2927 8001845825
2928 8054306822

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22468

ACT_9

ACT domain

423

481

0.98

PF13840

ACT_7

ACT domain

417

479

0.97

PF22468

ACT_9

ACT domain

344

405

0.94

PF00696

AA_kinase

Amino acid kinase family

71

301

0.91

PF01842

ACT

ACT domain

342

407

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4go7-assembly1.cif.gz_X-2 the regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis 0.9585 258 415
3s1t-assembly1.cif.gz_B structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis 0.9577 260 413
2re1-assembly1.cif.gz_A crystal structure of aspartokinase alpha and beta subunits 0.9565 262 413
4go5-assembly1.cif.gz_X-2 the regulatory subunit of aspartate kinase from mycobacterium tuberculosis 0.956 258 413
2zho-assembly3.cif.gz_F crystal structure of the regulatory subunit of aspartate kinase from thermus thermophilus (ligand free form) 0.9464 262 412
ID Description Score Start End Superfamily
4go5X02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9589 272 348 3.30.70.260
2zhoF01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9478 350 412 3.30.70.260
5yeiG02 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.9442 262 415 3.30.2130.10
af_Q2FYP1_2_256_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9298 1 267 3.40.1160.10
2zhoB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9296 271 347 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A7Z9K1I4-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9695 267 417 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090
AF-A0A3P1Y057-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9642 258 413 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090
AF-A0A7Z9K1I4-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9571 267 417 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090
AF-A0A2H0LI16-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9555 270 416 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090
AF-A0A3D3R500-F1-model_v4 aspartate kinase (EC 2.7.2.4) 0.9551 258 414 GO:0004072
GO:0005829
GO:0009088
GO:0009089
GO:0009090

Map