F494153
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1464 | 508 | 2928 | 415 |
Family's Representative Sequence
| Representative Sequence | 3300009092|Ga0105250_10013627|Ga0105250_100136273 |
| Length | 486 |
| Sequence | MTRKPLDLGGIDAGHAGFSGDHADDLIIWVSAVVAARRPHRYVYAPFQAGARGFRAGRLLAPFGAHGNVMARLVMKFGGTSVADLDRIRNVARHVKREVDAGYDVVVVVSAMAGVTNQLVEWCRQAAMLHDAREYDAVVATGEQVTAGLLALVLEGMGVNARSWQGWQLPILTDNAHASARILNVNGTELIKRFKEHGQVAVIAGFQGMHGDTGRVTTLGRGGSDTSAVAIASAIGAERCDIYTDVDGVYTTDPRVVPQAHRMDKIAYEEMLEFASLGAKVMQVRSVELGMVHNVRIFVRSSFDKPEDIDPKKPPSGTLICDEGDIVEQQVVTGIAFSKDEAQISIRRVQDKPGVAAAIFGPLADNNVNVDMIVQNVSADGATTDLTFTVPSADYERARMTLDKAKGAIGYERLDGATDVAKVSVIGIGMRSHAGVAAKAFKALSGQKINILAITTSEIKFSVLIKAAQTDLAVRTLHTLYGLDRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 161 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 162 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 163 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 242 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 244 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 245 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 246 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 247 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 251 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 252 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 253 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 260 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 262 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 263 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 264 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 265 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 266 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 267 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 269 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 270 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 272 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 282 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 283 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 284 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 288 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 289 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 290 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 296 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 299 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 300 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 301 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 303 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 305 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 306 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 307 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 308 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 309 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 310 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 311 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 312 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 313 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 314 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 315 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 316 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 317 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 318 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 319 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 320 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 321 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 322 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 323 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 324 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 325 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 326 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 327 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 328 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 329 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 330 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 331 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 408 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 409 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 410 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 411 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 412 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 413 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 416 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 417 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 418 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 419 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 420 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 421 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 422 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 423 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 424 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 425 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 426 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 427 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 428 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 429 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 451 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 452 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 461 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 462 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 463 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 464 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 474 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 480 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 482 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 483 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 485 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 486 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 487 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 488 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 489 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 491 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 493 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 494 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 495 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 496 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 497 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 498 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 499 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 500 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 501 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 502 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 503 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 504 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 505 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 506 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 507 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 508 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 0.07 |
| Isolates | 1.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 0.2 |
| Rhizoplane | 6.35 |
| Rhizosphere | 88.46 |
| Stem | 0 |
| Stem Tuber | 0.07 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105250_10013627 | 3300009092 | Bacteria | 3349 |
| 2 | 2214745200 | 2209111006 | Bacteria | 16385 |
| 3 | ARcpr5oldR_c000003 | 3300000041 | Bacteria | 66110 |
| 4 | ARSoilYngRDRAFT_c00037 | 3300000042 | Bacteria | 21051 |
| 5 | ARcpr5yngRDRAFT_c000010 | 3300000043 | Bacteria | 36497 |
| 6 | ARSoilOldRDRAFT_c000045 | 3300000044 | Bacteria | 25938 |
| 7 | ARCol0yngRDRAFT_1000086 | 3300000652 | Bacteria | 17270 |
| 8 | JGI24741J21665_1005824 | 3300001915 | Bacteria | 2530 |
| 9 | JGI24741J21665_1006916 | 3300001915 | Bacteria | 2238 |
| 10 | JGI24746J21847_1000225 | 3300001977 | Bacteria | 7752 |
| 11 | JGI24740J21852_10018132 | 3300001979 | Bacteria | 2505 |
| 12 | JGI24740J21852_10032414 | 3300001979 | Bacteria | 1671 |
| 13 | JGI24739J22299_10000887 | 3300001989 | Bacteria | 11064 |
| 14 | JGI24739J22299_10002234 | 3300001989 | Bacteria | 7439 |
| 15 | JGI24739J22299_10007003 | 3300001989 | Bacteria | 4246 |
| 16 | JGI24737J22298_10000286 | 3300001990 | Bacteria | 16793 |
| 17 | JGI24737J22298_10018510 | 3300001990 | Bacteria | 2235 |
| 18 | JGI24737J22298_10023419 | 3300001990 | Bacteria | 1959 |
| 19 | JGI24743J22301_10001925 | 3300001991 | Bacteria | 3016 |
| 20 | JGI24743J22301_10004783 | 3300001991 | Bacteria | 2225 |
| 21 | JGI24735J21928_10001811 | 3300002067 | Bacteria | 7508 |
| 22 | JGI24735J21928_10002726 | 3300002067 | Bacteria | 6093 |
| 23 | JGI24750J21931_1000044 | 3300002070 | Bacteria | 16702 |
| 24 | JGI24750J21931_1001976 | 3300002070 | Bacteria | 2504 |
| 25 | JGI24748J21848_1003070 | 3300002074 | Bacteria | 1903 |
| 26 | JGI24738J21930_10000666 | 3300002075 | Bacteria | 9974 |
| 27 | JGI24738J21930_10003659 | 3300002075 | Bacteria | 3851 |
| 28 | JGI24749J21850_1002556 | 3300002076 | Bacteria | 2555 |
| 29 | JGI24744J21845_10001499 | 3300002077 | Bacteria | 4642 |
| 30 | JGI24744J21845_10008784 | 3300002077 | Bacteria | 2076 |
| 31 | JGI24035J26624_1000205 | 3300002126 | Bacteria | 5357 |
| 32 | JGI24034J26672_10000348 | 3300002239 | Bacteria | 6015 |
| 33 | JGI24742J22300_10000091 | 3300002244 | Bacteria | 13233 |
| 34 | JGI24751J29686_10009779 | 3300002459 | Bacteria | 1975 |
| 35 | JGI25406J46586_10033627 | 3300003203 | Bacteria | 1891 |
| 36 | JGI25404J52841_10005123 | 3300003659 | Bacteria | 2699 |
| 37 | Ga0055530_10006443 | 3300003791 | Bacteria | 5242 |
| 38 | Ga0065716_1001671 | 3300005277 | Bacteria | 4329 |
| 39 | Ga0065712_10001083 | 3300005290 | Bacteria | 9078 |
| 40 | Ga0065712_10016249 | 3300005290 | Bacteria | 1799 |
| 41 | Ga0065712_10081197 | 3300005290 | Bacteria | 3029 |
| 42 | Ga0065715_10089726 | 3300005293 | Bacteria | 8711 |
| 43 | Ga0070658_10000264 | 3300005327 | Bacteria | 46199 |
| 44 | Ga0070658_10002220 | 3300005327 | Bacteria | 16299 |
| 45 | Ga0070658_10008993 | 3300005327 | Bacteria | 8030 |
| 46 | Ga0070658_10010453 | 3300005327 | Bacteria | 7444 |
| 47 | Ga0070658_10022506 | 3300005327 | Bacteria | 5058 |
| 48 | Ga0070658_10049510 | 3300005327 | Bacteria | 3404 |
| 49 | Ga0070658_10124174 | 3300005327 | Bacteria | 2147 |
| 50 | Ga0070658_10126593 | 3300005327 | Bacteria | 2127 |
| 51 | Ga0070676_10000186 | 3300005328 | Bacteria | 25797 |
| 52 | Ga0070676_10025905 | 3300005328 | Bacteria | 3318 |
| 53 | Ga0070676_10102088 | 3300005328 | Bacteria | 1773 |
| 54 | Ga0070683_100000064 | 3300005329 | Bacteria | 76343 |
| 55 | Ga0070683_100037722 | 3300005329 | Bacteria | 4424 |
| 56 | Ga0070683_100096585 | 3300005329 | Bacteria | 2779 |
| 57 | Ga0070683_100231247 | 3300005329 | Bacteria | 1758 |
| 58 | Ga0070690_100055973 | 3300005330 | Bacteria | 2527 |
| 59 | Ga0070690_100078858 | 3300005330 | Bacteria | 2152 |
| 60 | Ga0070670_100002541 | 3300005331 | Bacteria | 15048 |
| 61 | Ga0070670_100006533 | 3300005331 | Bacteria | 9875 |
| 62 | Ga0070670_100007186 | 3300005331 | Bacteria | 9432 |
| 63 | Ga0070670_100011611 | 3300005331 | Bacteria | 7529 |
| 64 | Ga0070670_100024387 | 3300005331 | Bacteria | 5201 |
| 65 | Ga0070670_100036861 | 3300005331 | Bacteria | 4207 |
| 66 | Ga0070670_100062640 | 3300005331 | Bacteria | 3193 |
| 67 | Ga0070670_100187930 | 3300005331 | Bacteria | 1794 |
| 68 | Ga0070677_10000050 | 3300005333 | Bacteria | 37198 |
| 69 | Ga0070677_10027622 | 3300005333 | Bacteria | 2138 |
| 70 | Ga0068869_100000191 | 3300005334 | Bacteria | 31688 |
| 71 | Ga0068869_100027748 | 3300005334 | Bacteria | 3950 |
| 72 | Ga0068869_100149583 | 3300005334 | Bacteria | 1810 |
| 73 | Ga0070666_10022428 | 3300005335 | Bacteria | 4099 |
| 74 | Ga0070666_10056441 | 3300005335 | Bacteria | 2652 |
| 75 | Ga0070666_10059573 | 3300005335 | Bacteria | 2582 |
| 76 | Ga0070680_100007728 | 3300005336 | Bacteria | 8193 |
| 77 | Ga0070680_100066516 | 3300005336 | Bacteria | 2955 |
| 78 | Ga0070680_100142711 | 3300005336 | Bacteria | 2008 |
| 79 | Ga0070680_100196106 | 3300005336 | Bacteria | 1702 |
| 80 | Ga0070682_100001714 | 3300005337 | Bacteria | 12197 |
| 81 | Ga0070682_100035477 | 3300005337 | Bacteria | 3045 |
| 82 | Ga0070682_100069856 | 3300005337 | Bacteria | 2243 |
| 83 | Ga0070682_100096978 | 3300005337 | Bacteria | 1939 |
| 84 | Ga0068868_100000233 | 3300005338 | Bacteria | 37955 |
| 85 | Ga0068868_100032246 | 3300005338 | Bacteria | 4029 |
| 86 | Ga0070660_100000091 | 3300005339 | Bacteria | 54397 |
| 87 | Ga0070660_100004304 | 3300005339 | Bacteria | 9834 |
| 88 | Ga0070660_100005461 | 3300005339 | Bacteria | 8800 |
| 89 | Ga0070660_100064748 | 3300005339 | Bacteria | 2844 |
| 90 | Ga0070660_100117995 | 3300005339 | Bacteria | 2116 |
| 91 | Ga0070660_100119041 | 3300005339 | Bacteria | 2106 |
| 92 | Ga0070660_100165159 | 3300005339 | Bacteria | 1786 |
| 93 | Ga0070689_100006518 | 3300005340 | Bacteria | 8093 |
| 94 | Ga0070689_100113223 | 3300005340 | Bacteria | 2160 |
| 95 | Ga0070691_10006662 | 3300005341 | Bacteria | 5287 |
| 96 | Ga0070691_10022854 | 3300005341 | Bacteria | 2903 |
| 97 | Ga0070691_10037130 | 3300005341 | Bacteria | 2298 |
| 98 | Ga0070687_100000337 | 3300005343 | Bacteria | 15983 |
| 99 | Ga0070687_100010015 | 3300005343 | Bacteria | 4080 |
| 100 | Ga0070687_100050606 | 3300005343 | Bacteria | 2146 |
| 101 | Ga0070687_100134806 | 3300005343 | Bacteria | 1430 |
| 102 | Ga0070661_100000188 | 3300005344 | Bacteria | 51025 |
| 103 | Ga0070661_100006306 | 3300005344 | Bacteria | 8181 |
| 104 | Ga0070661_100018063 | 3300005344 | Bacteria | 5011 |
| 105 | Ga0070661_100057653 | 3300005344 | Bacteria | 2846 |
| 106 | Ga0070661_100085828 | 3300005344 | Bacteria | 2326 |
| 107 | Ga0070661_100087437 | 3300005344 | Bacteria | 2305 |
| 108 | Ga0070661_100160492 | 3300005344 | Bacteria | 1702 |
| 109 | Ga0070692_10050483 | 3300005345 | Bacteria | 2160 |
| 110 | Ga0070692_10056796 | 3300005345 | Bacteria | 2050 |
| 111 | Ga0070692_10069571 | 3300005345 | Bacteria | 1872 |
| 112 | Ga0070668_100000409 | 3300005347 | Bacteria | 28506 |
| 113 | Ga0070669_100000523 | 3300005353 | Bacteria | 28564 |
| 114 | Ga0070669_100062266 | 3300005353 | Bacteria | 2743 |
| 115 | Ga0070675_100000034 | 3300005354 | Bacteria | 87135 |
| 116 | Ga0070675_100002418 | 3300005354 | Bacteria | 13921 |
| 117 | Ga0070675_100016370 | 3300005354 | Bacteria | 5885 |
| 118 | Ga0070675_100092638 | 3300005354 | Bacteria | 2533 |
| 119 | Ga0070671_100000111 | 3300005355 | Bacteria | 52298 |
| 120 | Ga0070671_100001584 | 3300005355 | Bacteria | 17103 |
| 121 | Ga0070671_100010789 | 3300005355 | Bacteria | 7331 |
| 122 | Ga0070671_100011792 | 3300005355 | Bacteria | 7031 |
| 123 | Ga0070671_100018174 | 3300005355 | Bacteria | 5708 |
| 124 | Ga0070671_100019157 | 3300005355 | Bacteria | 5567 |
| 125 | Ga0070671_100045533 | 3300005355 | Bacteria | 3647 |
| 126 | Ga0070671_100083737 | 3300005355 | Bacteria | 2667 |
| 127 | Ga0070671_100116863 | 3300005355 | Bacteria | 2243 |
| 128 | Ga0070674_100003026 | 3300005356 | Bacteria | 9349 |
| 129 | Ga0070674_100035850 | 3300005356 | Bacteria | 3325 |
| 130 | Ga0070674_100063764 | 3300005356 | Bacteria | 2580 |
| 131 | Ga0070673_100001357 | 3300005364 | Bacteria | 14305 |
| 132 | Ga0070673_100008515 | 3300005364 | Bacteria | 6823 |
| 133 | Ga0070673_100153387 | 3300005364 | Bacteria | 1953 |
| 134 | Ga0070673_100169148 | 3300005364 | Bacteria | 1864 |
| 135 | Ga0070688_100000401 | 3300005365 | Bacteria | 21994 |
| 136 | Ga0070688_100052107 | 3300005365 | Bacteria | 2555 |
| 137 | Ga0070688_100054570 | 3300005365 | Bacteria | 2503 |
| 138 | Ga0070688_100071567 | 3300005365 | Bacteria | 2220 |
| 139 | Ga0070659_100002194 | 3300005366 | Bacteria | 13899 |
| 140 | Ga0070659_100005493 | 3300005366 | Bacteria | 9108 |
| 141 | Ga0070659_100114249 | 3300005366 | Bacteria | 2181 |
| 142 | Ga0070659_100117346 | 3300005366 | Bacteria | 2152 |
| 143 | Ga0070659_100132646 | 3300005366 | Bacteria | 2024 |
| 144 | Ga0070659_100139737 | 3300005366 | Bacteria | 1972 |
| 145 | Ga0070659_100187150 | 3300005366 | Bacteria | 1701 |
| 146 | Ga0070659_100192052 | 3300005366 | Bacteria | 1679 |
| 147 | Ga0070659_100263079 | 3300005366 | Bacteria | 1431 |
| 148 | Ga0070667_100005633 | 3300005367 | Bacteria | 10458 |
| 149 | Ga0070667_100010235 | 3300005367 | Bacteria | 7748 |
| 150 | Ga0070667_100015164 | 3300005367 | Bacteria | 6365 |
| 151 | Ga0070667_100016010 | 3300005367 | Bacteria | 6204 |
| 152 | Ga0070667_100058925 | 3300005367 | Bacteria | 3247 |
| 153 | Ga0070667_100186025 | 3300005367 | Bacteria | 1838 |
| 154 | Ga0070667_100253537 | 3300005367 | Bacteria | 1574 |
| 155 | Ga0070709_10028699 | 3300005434 | Bacteria | 3321 |
| 156 | Ga0070709_10035379 | 3300005434 | Bacteria | 3035 |
| 157 | Ga0070714_100011938 | 3300005435 | Bacteria | 6910 |
| 158 | Ga0070714_100022892 | 3300005435 | Bacteria | 5127 |
| 159 | Ga0070714_100050119 | 3300005435 | Bacteria | 3555 |
| 160 | Ga0070714_100087174 | 3300005435 | Bacteria | 2730 |
| 161 | Ga0070714_100238776 | 3300005435 | Bacteria | 1677 |
| 162 | Ga0070713_100007751 | 3300005436 | Bacteria | 7560 |
| 163 | Ga0070713_100010936 | 3300005436 | Bacteria | 6581 |
| 164 | Ga0070713_100063116 | 3300005436 | Bacteria | 3104 |
| 165 | Ga0070713_100067951 | 3300005436 | Bacteria | 3002 |
| 166 | Ga0070710_10008568 | 3300005437 | Bacteria | 4978 |
| 167 | Ga0070710_10010806 | 3300005437 | Bacteria | 4490 |
| 168 | Ga0070710_10021500 | 3300005437 | Bacteria | 3364 |
| 169 | Ga0070710_10022840 | 3300005437 | Bacteria | 3279 |
| 170 | Ga0070701_10000524 | 3300005438 | Bacteria | 13233 |
| 171 | Ga0070701_10019632 | 3300005438 | Bacteria | 3195 |
| 172 | Ga0070711_100011116 | 3300005439 | Bacteria | 5585 |
| 173 | Ga0070711_100015201 | 3300005439 | Bacteria | 4868 |
| 174 | Ga0070711_100023573 | 3300005439 | Bacteria | 4005 |
| 175 | Ga0070705_100000252 | 3300005440 | Bacteria | 31840 |
| 176 | Ga0070700_100000657 | 3300005441 | Bacteria | 17071 |
| 177 | Ga0070700_100006474 | 3300005441 | Bacteria | 6269 |
| 178 | Ga0070694_100021318 | 3300005444 | Bacteria | 4139 |
| 179 | Ga0070694_100089908 | 3300005444 | Bacteria | 2152 |
| 180 | Ga0070708_100112727 | 3300005445 | Bacteria | 2501 |
| 181 | Ga0070663_100004855 | 3300005455 | Bacteria | 7931 |
| 182 | Ga0070663_100015911 | 3300005455 | Bacteria | 4870 |
| 183 | Ga0070663_100028662 | 3300005455 | Bacteria | 3794 |
| 184 | Ga0070663_100085590 | 3300005455 | Bacteria | 2326 |
| 185 | Ga0070663_100121253 | 3300005455 | Bacteria | 1975 |
| 186 | Ga0070663_100131583 | 3300005455 | Bacteria | 1900 |
| 187 | Ga0070663_100191807 | 3300005455 | Bacteria | 1590 |
| 188 | Ga0070678_100001414 | 3300005456 | Bacteria | 12797 |
| 189 | Ga0070678_100010734 | 3300005456 | Bacteria | 5611 |
| 190 | Ga0070678_100011766 | 3300005456 | Bacteria | 5411 |
| 191 | Ga0070662_100001002 | 3300005457 | Bacteria | 17247 |
| 192 | Ga0070662_100017420 | 3300005457 | Bacteria | 4844 |
| 193 | Ga0070662_100064810 | 3300005457 | Bacteria | 2676 |
| 194 | Ga0070662_100069580 | 3300005457 | Bacteria | 2591 |
| 195 | Ga0070662_100076669 | 3300005457 | Bacteria | 2479 |
| 196 | Ga0070681_10047969 | 3300005458 | Bacteria | 4268 |
| 197 | Ga0070681_10052703 | 3300005458 | Bacteria | 4058 |
| 198 | Ga0070681_10071322 | 3300005458 | Bacteria | 3438 |
| 199 | Ga0070681_10072311 | 3300005458 | Bacteria | 3411 |
| 200 | Ga0070681_10082351 | 3300005458 | Bacteria | 3173 |
| 201 | Ga0070681_10123273 | 3300005458 | Bacteria | 2524 |
| 202 | Ga0068867_100001011 | 3300005459 | Bacteria | 19191 |
| 203 | Ga0068867_100083074 | 3300005459 | Bacteria | 2417 |
| 204 | Ga0070685_10002699 | 3300005466 | Bacteria | 9088 |
| 205 | Ga0070685_10065248 | 3300005466 | Bacteria | 2142 |
| 206 | Ga0070707_100043599 | 3300005468 | Bacteria | 4293 |
| 207 | Ga0070699_100014320 | 3300005518 | Bacteria | 6819 |
| 208 | Ga0070679_100004731 | 3300005530 | Bacteria | 12558 |
| 209 | Ga0070679_100016615 | 3300005530 | Bacteria | 7107 |
| 210 | Ga0070679_100034565 | 3300005530 | Bacteria | 5010 |
| 211 | Ga0070679_100036926 | 3300005530 | Bacteria | 4850 |
| 212 | Ga0070679_100150520 | 3300005530 | Bacteria | 2304 |
| 213 | Ga0070679_100261883 | 3300005530 | Bacteria | 1684 |
| 214 | Ga0070684_100000275 | 3300005535 | Bacteria | 35701 |
| 215 | Ga0070684_100031635 | 3300005535 | Bacteria | 4506 |
| 216 | Ga0070684_100061891 | 3300005535 | Bacteria | 3277 |
| 217 | Ga0070684_100123682 | 3300005535 | Bacteria | 2328 |
| 218 | Ga0070684_100134572 | 3300005535 | Bacteria | 2232 |
| 219 | Ga0070697_100137122 | 3300005536 | Bacteria | 2055 |
| 220 | Ga0068853_100002273 | 3300005539 | Bacteria | 14352 |
| 221 | Ga0068853_100017670 | 3300005539 | Bacteria | 5886 |
| 222 | Ga0068853_100083372 | 3300005539 | Bacteria | 2801 |
| 223 | Ga0068853_100160014 | 3300005539 | Bacteria | 2031 |
| 224 | Ga0068853_100251885 | 3300005539 | Bacteria | 1620 |
| 225 | Ga0070672_100000008 | 3300005543 | Bacteria | 91782 |
| 226 | Ga0070672_100013010 | 3300005543 | Bacteria | 5865 |
| 227 | Ga0070672_100027974 | 3300005543 | Bacteria | 4212 |
| 228 | Ga0070672_100028466 | 3300005543 | Bacteria | 4180 |
| 229 | Ga0070672_100094811 | 3300005543 | Bacteria | 2413 |
| 230 | Ga0070686_100062116 | 3300005544 | Bacteria | 2416 |
| 231 | Ga0070686_100080097 | 3300005544 | Bacteria | 2160 |
| 232 | Ga0070695_100063612 | 3300005545 | Bacteria | 2398 |
| 233 | Ga0070696_100017449 | 3300005546 | Bacteria | 4844 |
| 234 | Ga0070696_100056926 | 3300005546 | Bacteria | 2728 |
| 235 | Ga0070696_100070532 | 3300005546 | Bacteria | 2458 |
| 236 | Ga0070696_100250150 | 3300005546 | Bacteria | 1340 |
| 237 | Ga0070693_100007754 | 3300005547 | Bacteria | 5264 |
| 238 | Ga0070693_100008375 | 3300005547 | Bacteria | 5095 |
| 239 | Ga0070665_100043426 | 3300005548 | Bacteria | 4518 |
| 240 | Ga0070704_100001016 | 3300005549 | Bacteria | 14398 |
| 241 | Ga0070704_100091417 | 3300005549 | Bacteria | 2269 |
| 242 | Ga0068855_100000129 | 3300005563 | Bacteria | 96519 |
| 243 | Ga0068855_100007455 | 3300005563 | Bacteria | 13251 |
| 244 | Ga0068855_100033428 | 3300005563 | Bacteria | 6137 |
| 245 | Ga0068855_100034657 | 3300005563 | Bacteria | 6016 |
| 246 | Ga0068855_100055594 | 3300005563 | Bacteria | 4648 |
| 247 | Ga0068855_100058535 | 3300005563 | Bacteria | 4512 |
| 248 | Ga0068855_100187219 | 3300005563 | Bacteria | 2337 |
| 249 | Ga0068855_100217650 | 3300005563 | Bacteria | 2143 |
| 250 | Ga0070664_100000419 | 3300005564 | Bacteria | 31758 |
| 251 | Ga0070664_100005421 | 3300005564 | Bacteria | 10239 |
| 252 | Ga0070664_100017741 | 3300005564 | Bacteria | 5847 |
| 253 | Ga0070664_100036462 | 3300005564 | Bacteria | 4131 |
| 254 | Ga0070664_100048170 | 3300005564 | Bacteria | 3601 |
| 255 | Ga0070664_100232242 | 3300005564 | Bacteria | 1654 |
| 256 | Ga0068857_100002666 | 3300005577 | Bacteria | 14652 |
| 257 | Ga0068857_100009744 | 3300005577 | Bacteria | 8343 |
| 258 | Ga0068857_100012690 | 3300005577 | Bacteria | 7343 |
| 259 | Ga0068857_100244218 | 3300005577 | Bacteria | 1644 |
| 260 | Ga0068854_100001824 | 3300005578 | Bacteria | 12963 |
| 261 | Ga0068854_100037514 | 3300005578 | Bacteria | 3402 |
| 262 | Ga0068856_100000963 | 3300005614 | Bacteria | 30708 |
| 263 | Ga0070702_100003016 | 3300005615 | Bacteria | 7444 |
| 264 | Ga0070702_100008357 | 3300005615 | Bacteria | 5009 |
| 265 | Ga0068852_100001994 | 3300005616 | Bacteria | 13910 |
| 266 | Ga0068852_100015664 | 3300005616 | Bacteria | 5889 |
| 267 | Ga0068852_100039158 | 3300005616 | Bacteria | 3989 |
| 268 | Ga0068852_100044588 | 3300005616 | Bacteria | 3767 |
| 269 | Ga0068852_100090988 | 3300005616 | Bacteria | 2730 |
| 270 | Ga0068852_100179374 | 3300005616 | Bacteria | 1991 |
| 271 | Ga0068859_100000088 | 3300005617 | Bacteria | 84390 |
| 272 | Ga0068859_100107572 | 3300005617 | Bacteria | 2849 |
| 273 | Ga0068859_100132405 | 3300005617 | Bacteria | 2565 |
| 274 | Ga0068859_100209476 | 3300005617 | Bacteria | 2035 |
| 275 | Ga0068859_100311275 | 3300005617 | Bacteria | 1668 |
| 276 | Ga0068859_100397254 | 3300005617 | Bacteria | 1474 |
| 277 | Ga0068864_100000136 | 3300005618 | Bacteria | 70797 |
| 278 | Ga0068864_100001346 | 3300005618 | Bacteria | 20428 |
| 279 | Ga0068864_100003805 | 3300005618 | Bacteria | 12441 |
| 280 | Ga0068864_100019015 | 3300005618 | Bacteria | 5742 |
| 281 | Ga0068866_10000291 | 3300005718 | Bacteria | 23901 |
| 282 | Ga0068861_100001924 | 3300005719 | Bacteria | 13364 |
| 283 | Ga0068861_100116771 | 3300005719 | Bacteria | 2146 |
| 284 | Ga0068851_10049564 | 3300005834 | Bacteria | 2130 |
| 285 | Ga0068870_10000005 | 3300005840 | Bacteria | 79445 |
| 286 | Ga0068863_100000384 | 3300005841 | Bacteria | 44825 |
| 287 | Ga0068863_100000608 | 3300005841 | Bacteria | 36316 |
| 288 | Ga0068863_100024134 | 3300005841 | Bacteria | 5802 |
| 289 | Ga0068863_100074646 | 3300005841 | Bacteria | 3208 |
| 290 | Ga0068863_100107829 | 3300005841 | Bacteria | 2650 |
| 291 | Ga0068863_100271166 | 3300005841 | Bacteria | 1643 |
| 292 | Ga0068858_100000063 | 3300005842 | Bacteria | 111811 |
| 293 | Ga0068858_100011061 | 3300005842 | Bacteria | 8532 |
| 294 | Ga0068858_100021963 | 3300005842 | Bacteria | 5960 |
| 295 | Ga0068858_100026552 | 3300005842 | Bacteria | 5379 |
| 296 | Ga0068858_100149146 | 3300005842 | Bacteria | 2198 |
| 297 | Ga0068858_100244735 | 3300005842 | Bacteria | 1702 |
| 298 | Ga0068860_100001183 | 3300005843 | Bacteria | 28556 |
| 299 | Ga0068860_100022772 | 3300005843 | Bacteria | 6058 |
| 300 | Ga0068860_100034044 | 3300005843 | Bacteria | 4886 |
| 301 | Ga0068860_100067885 | 3300005843 | Bacteria | 3387 |
| 302 | Ga0068860_100079433 | 3300005843 | Bacteria | 3119 |
| 303 | Ga0068860_100080163 | 3300005843 | Bacteria | 3105 |
| 304 | Ga0068860_100113496 | 3300005843 | Bacteria | 2591 |
| 305 | Ga0068860_100198147 | 3300005843 | Bacteria | 1945 |
| 306 | Ga0068860_100237878 | 3300005843 | Bacteria | 1771 |
| 307 | Ga0068862_100007190 | 3300005844 | Bacteria | 9245 |
| 308 | Ga0068862_100010432 | 3300005844 | Bacteria | 7672 |
| 309 | Ga0068862_100011427 | 3300005844 | Bacteria | 7328 |
| 310 | Ga0068862_100017057 | 3300005844 | Bacteria | 6042 |
| 311 | Ga0068862_100024857 | 3300005844 | Bacteria | 5026 |
| 312 | Ga0068862_100079551 | 3300005844 | Bacteria | 2841 |
| 313 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 314 | Ga0081455_10000329 | 3300005937 | Bacteria | 62107 |
| 315 | Ga0081455_10015834 | 3300005937 | Bacteria | 7303 |
| 316 | Ga0081538_10002523 | 3300005981 | Bacteria | 17830 |
| 317 | Ga0081538_10021900 | 3300005981 | Bacteria | 4647 |
| 318 | Ga0081540_1001201 | 3300005983 | Bacteria | 22688 |
| 319 | Ga0081540_1009095 | 3300005983 | Bacteria | 6860 |
| 320 | Ga0081540_1010246 | 3300005983 | Bacteria | 6365 |
| 321 | Ga0081539_10000522 | 3300005985 | Bacteria | 79973 |
| 322 | Ga0070717_10001785 | 3300006028 | Bacteria | 14994 |
| 323 | Ga0075365_10013799 | 3300006038 | Bacteria | 4847 |
| 324 | Ga0075365_10024810 | 3300006038 | Bacteria | 3789 |
| 325 | Ga0075368_10000129 | 3300006042 | Bacteria | 20027 |
| 326 | Ga0075363_100002771 | 3300006048 | Bacteria | 7269 |
| 327 | Ga0075363_100004616 | 3300006048 | Bacteria | 6051 |
| 328 | Ga0075432_10013821 | 3300006058 | Bacteria | 2746 |
| 329 | Ga0070715_10005920 | 3300006163 | Bacteria | 4120 |
| 330 | Ga0070715_10009052 | 3300006163 | Bacteria | 3495 |
| 331 | Ga0070715_10025330 | 3300006163 | Bacteria | 2348 |
| 332 | Ga0070716_100000730 | 3300006173 | Bacteria | 14019 |
| 333 | Ga0070716_100012351 | 3300006173 | Bacteria | 4327 |
| 334 | Ga0070716_100044410 | 3300006173 | Bacteria | 2489 |
| 335 | Ga0070712_100000963 | 3300006175 | Bacteria | 17331 |
| 336 | Ga0070712_100041974 | 3300006175 | Bacteria | 3144 |
| 337 | Ga0070712_100048764 | 3300006175 | Bacteria | 2937 |
| 338 | Ga0070712_100153292 | 3300006175 | Bacteria | 1771 |
| 339 | Ga0075362_10013349 | 3300006177 | Bacteria | 3288 |
| 340 | Ga0075367_10002669 | 3300006178 | Bacteria | 8224 |
| 341 | Ga0075367_10014764 | 3300006178 | Bacteria | 4230 |
| 342 | Ga0075427_10000026 | 3300006194 | Bacteria | 9852 |
| 343 | Ga0075366_10089288 | 3300006195 | Bacteria | 1846 |
| 344 | Ga0097621_100000006 | 3300006237 | Bacteria | 134536 |
| 345 | Ga0097621_100008279 | 3300006237 | Bacteria | 7484 |
| 346 | Ga0097621_100182116 | 3300006237 | Bacteria | 1815 |
| 347 | Ga0068871_100000022 | 3300006358 | Bacteria | 82775 |
| 348 | Ga0068871_100030110 | 3300006358 | Bacteria | 4271 |
| 349 | Ga0068871_100200826 | 3300006358 | Bacteria | 1721 |
| 350 | Ga0075428_100003527 | 3300006844 | Bacteria | 17133 |
| 351 | Ga0075428_100009313 | 3300006844 | Bacteria | 10891 |
| 352 | Ga0075428_100055661 | 3300006844 | Bacteria | 4334 |
| 353 | Ga0075430_100001061 | 3300006846 | Bacteria | 21766 |
| 354 | Ga0075430_100005415 | 3300006846 | Bacteria | 10781 |
| 355 | Ga0075430_100034066 | 3300006846 | Bacteria | 4322 |
| 356 | Ga0075430_100069113 | 3300006846 | Bacteria | 2963 |
| 357 | Ga0075431_100000856 | 3300006847 | Bacteria | 26728 |
| 358 | Ga0075431_100035384 | 3300006847 | Bacteria | 5142 |
| 359 | Ga0075433_10003278 | 3300006852 | Bacteria | 12496 |
| 360 | Ga0075433_10028588 | 3300006852 | Bacteria | 4741 |
| 361 | Ga0075434_100000346 | 3300006871 | Bacteria | 33425 |
| 362 | Ga0075434_100017393 | 3300006871 | Bacteria | 6926 |
| 363 | Ga0075434_100035969 | 3300006871 | Bacteria | 4897 |
| 364 | Ga0075434_100171152 | 3300006871 | Bacteria | 2192 |
| 365 | Ga0075429_100001137 | 3300006880 | Bacteria | 21442 |
| 366 | Ga0075429_100007463 | 3300006880 | Bacteria | 9488 |
| 367 | Ga0075429_100022293 | 3300006880 | Bacteria | 5493 |
| 368 | Ga0068865_100000196 | 3300006881 | Bacteria | 33650 |
| 369 | Ga0068865_100133796 | 3300006881 | Bacteria | 1860 |
| 370 | Ga0097620_100000088 | 3300006931 | Bacteria | 84390 |
| 371 | Ga0097620_100107561 | 3300006931 | Bacteria | 2849 |
| 372 | Ga0097620_100132405 | 3300006931 | Bacteria | 2565 |
| 373 | Ga0097620_100209474 | 3300006931 | Bacteria | 2035 |
| 374 | Ga0097620_100311247 | 3300006931 | Bacteria | 1668 |
| 375 | Ga0097620_100397247 | 3300006931 | Bacteria | 1474 |
| 376 | Ga0075435_100003799 | 3300007076 | Bacteria | 10296 |
| 377 | Ga0075435_100019065 | 3300007076 | Bacteria | 5230 |
| 378 | Ga0075435_100038442 | 3300007076 | Bacteria | 3815 |
| 379 | Ga0099795_10033014 | 3300007788 | Bacteria | 1794 |
| 380 | Ga0099795_10048007 | 3300007788 | Bacteria | 1544 |
| 381 | Ga0105251_10034057 | 3300009011 | Bacteria | 2524 |
| 382 | Ga0105240_10021899 | 3300009093 | Bacteria | 8490 |
| 383 | Ga0105240_10068944 | 3300009093 | Bacteria | 4379 |
| 384 | Ga0105240_10190806 | 3300009093 | Bacteria | 2410 |
| 385 | Ga0105240_10380728 | 3300009093 | Bacteria | 1594 |
| 386 | Ga0111539_10000817 | 3300009094 | Bacteria | 40427 |
| 387 | Ga0111539_10001765 | 3300009094 | Bacteria | 28723 |
| 388 | Ga0111539_10001792 | 3300009094 | Bacteria | 28559 |
| 389 | Ga0111539_10016539 | 3300009094 | Bacteria | 9143 |
| 390 | Ga0111539_10289486 | 3300009094 | Bacteria | 1906 |
| 391 | Ga0105245_10006255 | 3300009098 | Bacteria | 10475 |
| 392 | Ga0105245_10051976 | 3300009098 | Bacteria | 3674 |
| 393 | Ga0105245_10053755 | 3300009098 | Bacteria | 3615 |
| 394 | Ga0105245_10160885 | 3300009098 | Bacteria | 2130 |
| 395 | Ga0105247_10004177 | 3300009101 | Bacteria | 9267 |
| 396 | Ga0105247_10014764 | 3300009101 | Bacteria | 4682 |
| 397 | Ga0105247_10113196 | 3300009101 | Bacteria | 1749 |
| 398 | Ga0114129_10001060 | 3300009147 | Bacteria | 36097 |
| 399 | Ga0114129_10003956 | 3300009147 | Bacteria | 20922 |
| 400 | Ga0114129_10021909 | 3300009147 | Bacteria | 9069 |
| 401 | Ga0114129_10024577 | 3300009147 | Bacteria | 8536 |
| 402 | Ga0105243_10003212 | 3300009148 | Bacteria | 13374 |
| 403 | Ga0105241_10002185 | 3300009174 | Bacteria | 14733 |
| 404 | Ga0105241_10022254 | 3300009174 | Bacteria | 4693 |
| 405 | Ga0105241_10044485 | 3300009174 | Bacteria | 3365 |
| 406 | Ga0105242_10002746 | 3300009176 | Bacteria | 13773 |
| 407 | Ga0105242_10023628 | 3300009176 | Bacteria | 4845 |
| 408 | Ga0105248_10000169 | 3300009177 | Bacteria | 75948 |
| 409 | Ga0105248_10005067 | 3300009177 | Bacteria | 14550 |
| 410 | Ga0105248_10006401 | 3300009177 | Bacteria | 12919 |
| 411 | Ga0105248_10020884 | 3300009177 | Bacteria | 7257 |
| 412 | Ga0105248_10021626 | 3300009177 | Bacteria | 7124 |
| 413 | Ga0105248_10214425 | 3300009177 | Bacteria | 2169 |
| 414 | Ga0105237_10085695 | 3300009545 | Bacteria | 3140 |
| 415 | Ga0105237_10096569 | 3300009545 | Bacteria | 2945 |
| 416 | Ga0105238_10004728 | 3300009551 | Bacteria | 13465 |
| 417 | Ga0105238_10038260 | 3300009551 | Bacteria | 4871 |
| 418 | Ga0105249_10003096 | 3300009553 | Bacteria | 14360 |
| 419 | Ga0105249_10039603 | 3300009553 | Bacteria | 4279 |
| 420 | Ga0105249_10139808 | 3300009553 | Bacteria | 2321 |
| 421 | Ga0105239_10001436 | 3300010375 | Bacteria | 31755 |
| 422 | Ga0105239_10021456 | 3300010375 | Bacteria | 7121 |
| 423 | Ga0105239_10025721 | 3300010375 | Bacteria | 6482 |
| 424 | Ga0105239_10079131 | 3300010375 | Bacteria | 3617 |
| 425 | Ga0105246_10001322 | 3300011119 | Bacteria | 14587 |
| 426 | Ga0105246_10056113 | 3300011119 | Bacteria | 2721 |
| 427 | Ga0105246_10122645 | 3300011119 | Bacteria | 1928 |
| 428 | Ga0157373_10014713 | 3300013100 | Bacteria | 5732 |
| 429 | Ga0157373_10062685 | 3300013100 | Bacteria | 2633 |
| 430 | Ga0157371_10005808 | 3300013102 | Bacteria | 10326 |
| 431 | Ga0157371_10011416 | 3300013102 | Bacteria | 6846 |
| 432 | Ga0157371_10031596 | 3300013102 | Bacteria | 3815 |
| 433 | Ga0157371_10035537 | 3300013102 | Bacteria | 3570 |
| 434 | Ga0157371_10036397 | 3300013102 | Bacteria | 3525 |
| 435 | Ga0157371_10123912 | 3300013102 | Bacteria | 1838 |
| 436 | Ga0157371_10202790 | 3300013102 | Bacteria | 1422 |
| 437 | Ga0157371_10211537 | 3300013102 | Bacteria | 1392 |
| 438 | Ga0157370_10021346 | 3300013104 | Bacteria | 6452 |
| 439 | Ga0157370_10040486 | 3300013104 | Bacteria | 4499 |
| 440 | Ga0157369_10042326 | 3300013105 | Bacteria | 4969 |
| 441 | Ga0157369_10088883 | 3300013105 | Bacteria | 3298 |
| 442 | Ga0157374_10023096 | 3300013296 | Bacteria | 5557 |
| 443 | Ga0157374_10059192 | 3300013296 | Bacteria | 3581 |
| 444 | Ga0157378_10004038 | 3300013297 | Bacteria | 12960 |
| 445 | Ga0157378_10050000 | 3300013297 | Bacteria | 3720 |
| 446 | Ga0163162_10002546 | 3300013306 | Bacteria | 17252 |
| 447 | Ga0163162_10039471 | 3300013306 | Bacteria | 4718 |
| 448 | Ga0163162_10041821 | 3300013306 | Bacteria | 4585 |
| 449 | Ga0163162_10370488 | 3300013306 | Bacteria | 1565 |
| 450 | Ga0157372_10029143 | 3300013307 | Bacteria | 6025 |
| 451 | Ga0157372_10066996 | 3300013307 | Bacteria | 4034 |
| 452 | Ga0157372_10068034 | 3300013307 | Bacteria | 4004 |
| 453 | Ga0157372_10243052 | 3300013307 | Bacteria | 2089 |
| 454 | Ga0157372_10336092 | 3300013307 | Bacteria | 1759 |
| 455 | Ga0157375_10056614 | 3300013308 | Bacteria | 3872 |
| 456 | Ga0157375_10161948 | 3300013308 | Bacteria | 2380 |
| 457 | Ga0163163_10000170 | 3300014325 | Bacteria | 68377 |
| 458 | Ga0163163_10001683 | 3300014325 | Bacteria | 18663 |
| 459 | Ga0163163_10066801 | 3300014325 | Bacteria | 3573 |
| 460 | Ga0163163_10122875 | 3300014325 | Bacteria | 2631 |
| 461 | Ga0163163_10188748 | 3300014325 | Bacteria | 2109 |
| 462 | Ga0157380_10067347 | 3300014326 | Bacteria | 2883 |
| 463 | Ga0157377_10000127 | 3300014745 | Bacteria | 49198 |
| 464 | Ga0157379_10008840 | 3300014968 | Bacteria | 8784 |
| 465 | Ga0157379_10008961 | 3300014968 | Bacteria | 8721 |
| 466 | Ga0157379_10013169 | 3300014968 | Bacteria | 7241 |
| 467 | Ga0157379_10054179 | 3300014968 | Bacteria | 3584 |
| 468 | Ga0157376_10000126 | 3300014969 | Bacteria | 52844 |
| 469 | Ga0157376_10011024 | 3300014969 | Bacteria | 6643 |
| 470 | Ga0163161_10000562 | 3300017792 | Bacteria | 29937 |
| 471 | Ga0163161_10049148 | 3300017792 | Bacteria | 3047 |
| 472 | Ga0213874_10001300 | 3300021377 | Bacteria | 5163 |
| 473 | Ga0213876_10054320 | 3300021384 | Bacteria | 2115 |
| 474 | Ga0228598_1000321 | 3300024227 | Bacteria | 9375 |
| 475 | Ga0207666_1002396 | 3300025271 | Bacteria | 2260 |
| 476 | Ga0207673_1000208 | 3300025290 | Bacteria | 5916 |
| 477 | Ga0209050_1000262 | 3300025298 | Bacteria | 112798 |
| 478 | Ga0207697_10029097 | 3300025315 | Bacteria | 2260 |
| 479 | Ga0207653_10009245 | 3300025885 | Bacteria | 3070 |
| 480 | Ga0207682_10000001 | 3300025893 | Bacteria | 152713 |
| 481 | Ga0207682_10001899 | 3300025893 | Bacteria | 9485 |
| 482 | Ga0207692_10034318 | 3300025898 | Bacteria | 2455 |
| 483 | Ga0207692_10041374 | 3300025898 | Bacteria | 2281 |
| 484 | Ga0207642_10001429 | 3300025899 | Bacteria | 7409 |
| 485 | Ga0207710_10000895 | 3300025900 | Bacteria | 15956 |
| 486 | Ga0207710_10005202 | 3300025900 | Bacteria | 5624 |
| 487 | Ga0207688_10001997 | 3300025901 | Bacteria | 10941 |
| 488 | Ga0207688_10008183 | 3300025901 | Bacteria | 5683 |
| 489 | Ga0207688_10053713 | 3300025901 | Bacteria | 2260 |
| 490 | Ga0207680_10007725 | 3300025903 | Bacteria | 5257 |
| 491 | Ga0207647_10000627 | 3300025904 | Bacteria | 27507 |
| 492 | Ga0207647_10002335 | 3300025904 | Bacteria | 14419 |
| 493 | Ga0207647_10004040 | 3300025904 | Bacteria | 10933 |
| 494 | Ga0207647_10006288 | 3300025904 | Bacteria | 8647 |
| 495 | Ga0207647_10097072 | 3300025904 | Bacteria | 1753 |
| 496 | Ga0207647_10120962 | 3300025904 | Bacteria | 1544 |
| 497 | Ga0207699_10044303 | 3300025906 | Bacteria | 2590 |
| 498 | Ga0207699_10045606 | 3300025906 | Bacteria | 2560 |
| 499 | Ga0207645_10000276 | 3300025907 | Bacteria | 42632 |
| 500 | Ga0207645_10005447 | 3300025907 | Bacteria | 9222 |
| 501 | Ga0207645_10020893 | 3300025907 | Bacteria | 4277 |
| 502 | Ga0207643_10000041 | 3300025908 | Bacteria | 85133 |
| 503 | Ga0207643_10000613 | 3300025908 | Bacteria | 22494 |
| 504 | Ga0207643_10117178 | 3300025908 | Bacteria | 1574 |
| 505 | Ga0207705_10000091 | 3300025909 | Bacteria | 110768 |
| 506 | Ga0207705_10009087 | 3300025909 | Bacteria | 7244 |
| 507 | Ga0207705_10018644 | 3300025909 | Bacteria | 4962 |
| 508 | Ga0207705_10029024 | 3300025909 | Bacteria | 3945 |
| 509 | Ga0207705_10035312 | 3300025909 | Bacteria | 3576 |
| 510 | Ga0207705_10037339 | 3300025909 | Bacteria | 3476 |
| 511 | Ga0207705_10044392 | 3300025909 | Bacteria | 3194 |
| 512 | Ga0207705_10049030 | 3300025909 | Bacteria | 3039 |
| 513 | Ga0207705_10069088 | 3300025909 | Bacteria | 2558 |
| 514 | Ga0207654_10003566 | 3300025911 | Bacteria | 7872 |
| 515 | Ga0207654_10028711 | 3300025911 | Bacteria | 3035 |
| 516 | Ga0207707_10005534 | 3300025912 | Bacteria | 11046 |
| 517 | Ga0207707_10017298 | 3300025912 | Bacteria | 6284 |
| 518 | Ga0207707_10041404 | 3300025912 | Bacteria | 4023 |
| 519 | Ga0207707_10059659 | 3300025912 | Bacteria | 3319 |
| 520 | Ga0207707_10185051 | 3300025912 | Bacteria | 1818 |
| 521 | Ga0207707_10205317 | 3300025912 | Bacteria | 1717 |
| 522 | Ga0207695_10043579 | 3300025913 | Bacteria | 4782 |
| 523 | Ga0207671_10013164 | 3300025914 | Bacteria | 6606 |
| 524 | Ga0207671_10054159 | 3300025914 | Bacteria | 2973 |
| 525 | Ga0207693_10004802 | 3300025915 | Bacteria | 11369 |
| 526 | Ga0207693_10005773 | 3300025915 | Bacteria | 10265 |
| 527 | Ga0207693_10012871 | 3300025915 | Bacteria | 6750 |
| 528 | Ga0207693_10052850 | 3300025915 | Bacteria | 3187 |
| 529 | Ga0207693_10054500 | 3300025915 | Bacteria | 3136 |
| 530 | Ga0207693_10093817 | 3300025915 | Bacteria | 2352 |
| 531 | Ga0207663_10004685 | 3300025916 | Bacteria | 6826 |
| 532 | Ga0207663_10018835 | 3300025916 | Bacteria | 3877 |
| 533 | Ga0207663_10036004 | 3300025916 | Bacteria | 2974 |
| 534 | Ga0207660_10000006 | 3300025917 | Bacteria | 106298 |
| 535 | Ga0207660_10000864 | 3300025917 | Bacteria | 20005 |
| 536 | Ga0207660_10006249 | 3300025917 | Bacteria | 7734 |
| 537 | Ga0207660_10043755 | 3300025917 | Bacteria | 3147 |
| 538 | Ga0207660_10237190 | 3300025917 | Bacteria | 1436 |
| 539 | Ga0207662_10000207 | 3300025918 | Bacteria | 27378 |
| 540 | Ga0207662_10003504 | 3300025918 | Bacteria | 8083 |
| 541 | Ga0207662_10011850 | 3300025918 | Bacteria | 4847 |
| 542 | Ga0207662_10024769 | 3300025918 | Bacteria | 3454 |
| 543 | Ga0207662_10110690 | 3300025918 | Bacteria | 1712 |
| 544 | Ga0207657_10000092 | 3300025919 | Bacteria | 85665 |
| 545 | Ga0207657_10000252 | 3300025919 | Bacteria | 57036 |
| 546 | Ga0207657_10001742 | 3300025919 | Bacteria | 23458 |
| 547 | Ga0207657_10002395 | 3300025919 | Bacteria | 20270 |
| 548 | Ga0207657_10004547 | 3300025919 | Bacteria | 14659 |
| 549 | Ga0207657_10004799 | 3300025919 | Bacteria | 14261 |
| 550 | Ga0207657_10015568 | 3300025919 | Bacteria | 7362 |
| 551 | Ga0207657_10018720 | 3300025919 | Bacteria | 6600 |
| 552 | Ga0207657_10019350 | 3300025919 | Bacteria | 6469 |
| 553 | Ga0207657_10019526 | 3300025919 | Bacteria | 6433 |
| 554 | Ga0207657_10019679 | 3300025919 | Bacteria | 6401 |
| 555 | Ga0207657_10024115 | 3300025919 | Bacteria | 5648 |
| 556 | Ga0207657_10040408 | 3300025919 | Bacteria | 4133 |
| 557 | Ga0207657_10054523 | 3300025919 | Bacteria | 3457 |
| 558 | Ga0207657_10164423 | 3300025919 | Bacteria | 1801 |
| 559 | Ga0207649_10000049 | 3300025920 | Bacteria | 109723 |
| 560 | Ga0207649_10114529 | 3300025920 | Bacteria | 1807 |
| 561 | Ga0207652_10000300 | 3300025921 | Bacteria | 51095 |
| 562 | Ga0207652_10015009 | 3300025921 | Bacteria | 6284 |
| 563 | Ga0207652_10017153 | 3300025921 | Bacteria | 5922 |
| 564 | Ga0207652_10070600 | 3300025921 | Bacteria | 3033 |
| 565 | Ga0207652_10085936 | 3300025921 | Bacteria | 2757 |
| 566 | Ga0207652_10114203 | 3300025921 | Bacteria | 2398 |
| 567 | Ga0207681_10000024 | 3300025923 | Bacteria | 206607 |
| 568 | Ga0207681_10018745 | 3300025923 | Bacteria | 4364 |
| 569 | Ga0207694_10001718 | 3300025924 | Bacteria | 18345 |
| 570 | Ga0207694_10007596 | 3300025924 | Bacteria | 8220 |
| 571 | Ga0207650_10000990 | 3300025925 | Bacteria | 21364 |
| 572 | Ga0207650_10005202 | 3300025925 | Bacteria | 8873 |
| 573 | Ga0207650_10007269 | 3300025925 | Bacteria | 7540 |
| 574 | Ga0207650_10019900 | 3300025925 | Bacteria | 4724 |
| 575 | Ga0207650_10044215 | 3300025925 | Bacteria | 3272 |
| 576 | Ga0207659_10000042 | 3300025926 | Bacteria | 90881 |
| 577 | Ga0207659_10000885 | 3300025926 | Bacteria | 17789 |
| 578 | Ga0207659_10024411 | 3300025926 | Bacteria | 4050 |
| 579 | Ga0207659_10033789 | 3300025926 | Bacteria | 3523 |
| 580 | Ga0207659_10245158 | 3300025926 | Bacteria | 1451 |
| 581 | Ga0207687_10003253 | 3300025927 | Bacteria | 11003 |
| 582 | Ga0207687_10124486 | 3300025927 | Bacteria | 1933 |
| 583 | Ga0207700_10001840 | 3300025928 | Bacteria | 12027 |
| 584 | Ga0207700_10142645 | 3300025928 | Bacteria | 1970 |
| 585 | Ga0207664_10035347 | 3300025929 | Bacteria | 3855 |
| 586 | Ga0207664_10042440 | 3300025929 | Bacteria | 3550 |
| 587 | Ga0207664_10051499 | 3300025929 | Bacteria | 3251 |
| 588 | Ga0207664_10171022 | 3300025929 | Bacteria | 1860 |
| 589 | Ga0207644_10000041 | 3300025931 | Bacteria | 114951 |
| 590 | Ga0207644_10001327 | 3300025931 | Bacteria | 15896 |
| 591 | Ga0207644_10005264 | 3300025931 | Bacteria | 8445 |
| 592 | Ga0207644_10015084 | 3300025931 | Bacteria | 5184 |
| 593 | Ga0207644_10048211 | 3300025931 | Bacteria | 3044 |
| 594 | Ga0207644_10057501 | 3300025931 | Bacteria | 2808 |
| 595 | Ga0207644_10120300 | 3300025931 | Bacteria | 1998 |
| 596 | Ga0207690_10000137 | 3300025932 | Bacteria | 59768 |
| 597 | Ga0207690_10000709 | 3300025932 | Bacteria | 21444 |
| 598 | Ga0207690_10002665 | 3300025932 | Bacteria | 10761 |
| 599 | Ga0207690_10015489 | 3300025932 | Bacteria | 4622 |
| 600 | Ga0207690_10031479 | 3300025932 | Bacteria | 3395 |
| 601 | Ga0207690_10042617 | 3300025932 | Bacteria | 2982 |
| 602 | Ga0207690_10054048 | 3300025932 | Bacteria | 2698 |
| 603 | Ga0207690_10136594 | 3300025932 | Bacteria | 1801 |
| 604 | Ga0207690_10148699 | 3300025932 | Bacteria | 1734 |
| 605 | Ga0207706_10000568 | 3300025933 | Bacteria | 39206 |
| 606 | Ga0207706_10000746 | 3300025933 | Bacteria | 33880 |
| 607 | Ga0207706_10004407 | 3300025933 | Bacteria | 13227 |
| 608 | Ga0207706_10010385 | 3300025933 | Bacteria | 8503 |
| 609 | Ga0207706_10011126 | 3300025933 | Bacteria | 8200 |
| 610 | Ga0207706_10015457 | 3300025933 | Bacteria | 6895 |
| 611 | Ga0207706_10024460 | 3300025933 | Bacteria | 5415 |
| 612 | Ga0207706_10027262 | 3300025933 | Bacteria | 5109 |
| 613 | Ga0207706_10065107 | 3300025933 | Bacteria | 3209 |
| 614 | Ga0207706_10131449 | 3300025933 | Bacteria | 2202 |
| 615 | Ga0207706_10281828 | 3300025933 | Bacteria | 1449 |
| 616 | Ga0207686_10000571 | 3300025934 | Bacteria | 23350 |
| 617 | Ga0207686_10056004 | 3300025934 | Bacteria | 2476 |
| 618 | Ga0207709_10000220 | 3300025935 | Bacteria | 72291 |
| 619 | Ga0207709_10010336 | 3300025935 | Bacteria | 5140 |
| 620 | Ga0207709_10089212 | 3300025935 | Bacteria | 2010 |
| 621 | Ga0207709_10201888 | 3300025935 | Bacteria | 1421 |
| 622 | Ga0207670_10000323 | 3300025936 | Bacteria | 28564 |
| 623 | Ga0207669_10000005 | 3300025937 | Bacteria | 185218 |
| 624 | Ga0207669_10004706 | 3300025937 | Bacteria | 6039 |
| 625 | Ga0207669_10007517 | 3300025937 | Bacteria | 5045 |
| 626 | Ga0207669_10008276 | 3300025937 | Bacteria | 4873 |
| 627 | Ga0207704_10000060 | 3300025938 | Bacteria | 76535 |
| 628 | Ga0207665_10000117 | 3300025939 | Bacteria | 52204 |
| 629 | Ga0207665_10000210 | 3300025939 | Bacteria | 39483 |
| 630 | Ga0207691_10005532 | 3300025940 | Bacteria | 12201 |
| 631 | Ga0207691_10006907 | 3300025940 | Bacteria | 10948 |
| 632 | Ga0207691_10017079 | 3300025940 | Bacteria | 6884 |
| 633 | Ga0207691_10037116 | 3300025940 | Bacteria | 4513 |
| 634 | Ga0207691_10077281 | 3300025940 | Bacteria | 2999 |
| 635 | Ga0207691_10129432 | 3300025940 | Bacteria | 2231 |
| 636 | Ga0207691_10129978 | 3300025940 | Bacteria | 2225 |
| 637 | Ga0207711_10000039 | 3300025941 | Bacteria | 162974 |
| 638 | Ga0207711_10001557 | 3300025941 | Bacteria | 21221 |
| 639 | Ga0207711_10014181 | 3300025941 | Bacteria | 6620 |
| 640 | Ga0207711_10015227 | 3300025941 | Bacteria | 6384 |
| 641 | Ga0207711_10022126 | 3300025941 | Bacteria | 5314 |
| 642 | Ga0207711_10031874 | 3300025941 | Bacteria | 4453 |
| 643 | Ga0207711_10063794 | 3300025941 | Bacteria | 3181 |
| 644 | Ga0207711_10070811 | 3300025941 | Bacteria | 3025 |
| 645 | Ga0207689_10000053 | 3300025942 | Bacteria | 88245 |
| 646 | Ga0207689_10007517 | 3300025942 | Bacteria | 9554 |
| 647 | Ga0207689_10009414 | 3300025942 | Bacteria | 8439 |
| 648 | Ga0207689_10027153 | 3300025942 | Bacteria | 4793 |
| 649 | Ga0207689_10052697 | 3300025942 | Bacteria | 3352 |
| 650 | Ga0207661_10000036 | 3300025944 | Bacteria | 149720 |
| 651 | Ga0207661_10019697 | 3300025944 | Bacteria | 5036 |
| 652 | Ga0207679_10000060 | 3300025945 | Bacteria | 100711 |
| 653 | Ga0207679_10002925 | 3300025945 | Bacteria | 10572 |
| 654 | Ga0207679_10010577 | 3300025945 | Bacteria | 5946 |
| 655 | Ga0207679_10026824 | 3300025945 | Bacteria | 3976 |
| 656 | Ga0207679_10081322 | 3300025945 | Bacteria | 2477 |
| 657 | Ga0207679_10106286 | 3300025945 | Bacteria | 2206 |
| 658 | Ga0207679_10139096 | 3300025945 | Bacteria | 1960 |
| 659 | Ga0207667_10000303 | 3300025949 | Bacteria | 68209 |
| 660 | Ga0207667_10197000 | 3300025949 | Bacteria | 2067 |
| 661 | Ga0207667_10198839 | 3300025949 | Bacteria | 2056 |
| 662 | Ga0207651_10000014 | 3300025960 | Bacteria | 166931 |
| 663 | Ga0207651_10224986 | 3300025960 | Bacteria | 1519 |
| 664 | Ga0207712_10000134 | 3300025961 | Bacteria | 78054 |
| 665 | Ga0207712_10000195 | 3300025961 | Bacteria | 62560 |
| 666 | Ga0207712_10116473 | 3300025961 | Bacteria | 2014 |
| 667 | Ga0207668_10000350 | 3300025972 | Bacteria | 29956 |
| 668 | Ga0207668_10075099 | 3300025972 | Bacteria | 2429 |
| 669 | Ga0207668_10114395 | 3300025972 | Bacteria | 2031 |
| 670 | Ga0207668_10132031 | 3300025972 | Bacteria | 1908 |
| 671 | Ga0207668_10137641 | 3300025972 | Bacteria | 1873 |
| 672 | Ga0207640_10001960 | 3300025981 | Bacteria | 11088 |
| 673 | Ga0207640_10026231 | 3300025981 | Bacteria | 3535 |
| 674 | Ga0207658_10001042 | 3300025986 | Bacteria | 22510 |
| 675 | Ga0207658_10001227 | 3300025986 | Bacteria | 20271 |
| 676 | Ga0207658_10003771 | 3300025986 | Bacteria | 10675 |
| 677 | Ga0207658_10017582 | 3300025986 | Bacteria | 4930 |
| 678 | Ga0207658_10071331 | 3300025986 | Bacteria | 2630 |
| 679 | Ga0207658_10072259 | 3300025986 | Bacteria | 2615 |
| 680 | Ga0207658_10257038 | 3300025986 | Bacteria | 1487 |
| 681 | Ga0207658_10268364 | 3300025986 | Bacteria | 1457 |
| 682 | Ga0207677_10003136 | 3300026023 | Bacteria | 8720 |
| 683 | Ga0207677_10003572 | 3300026023 | Bacteria | 8236 |
| 684 | Ga0207703_10000327 | 3300026035 | Bacteria | 51797 |
| 685 | Ga0207703_10032671 | 3300026035 | Bacteria | 4119 |
| 686 | Ga0207703_10250734 | 3300026035 | Bacteria | 1595 |
| 687 | Ga0207703_10302439 | 3300026035 | Bacteria | 1459 |
| 688 | Ga0207639_10000835 | 3300026041 | Bacteria | 20893 |
| 689 | Ga0207639_10001105 | 3300026041 | Bacteria | 18312 |
| 690 | Ga0207639_10048488 | 3300026041 | Bacteria | 3215 |
| 691 | Ga0207639_10093241 | 3300026041 | Bacteria | 2414 |
| 692 | Ga0207678_10000892 | 3300026067 | Bacteria | 27377 |
| 693 | Ga0207678_10001535 | 3300026067 | Bacteria | 21206 |
| 694 | Ga0207678_10001718 | 3300026067 | Bacteria | 20053 |
| 695 | Ga0207678_10003104 | 3300026067 | Bacteria | 15046 |
| 696 | Ga0207678_10011286 | 3300026067 | Bacteria | 7843 |
| 697 | Ga0207678_10026959 | 3300026067 | Bacteria | 5011 |
| 698 | Ga0207678_10034704 | 3300026067 | Bacteria | 4393 |
| 699 | Ga0207678_10041314 | 3300026067 | Bacteria | 3998 |
| 700 | Ga0207678_10047163 | 3300026067 | Bacteria | 3727 |
| 701 | Ga0207678_10099602 | 3300026067 | Bacteria | 2482 |
| 702 | Ga0207678_10160785 | 3300026067 | Bacteria | 1918 |
| 703 | Ga0207678_10161923 | 3300026067 | Bacteria | 1911 |
| 704 | Ga0207708_10001777 | 3300026075 | Bacteria | 15902 |
| 705 | Ga0207708_10101112 | 3300026075 | Bacteria | 2231 |
| 706 | Ga0207708_10101648 | 3300026075 | Bacteria | 2225 |
| 707 | Ga0207702_10011181 | 3300026078 | Bacteria | 7486 |
| 708 | Ga0207702_10091065 | 3300026078 | Bacteria | 2669 |
| 709 | Ga0207641_10000138 | 3300026088 | Bacteria | 106531 |
| 710 | Ga0207641_10000664 | 3300026088 | Bacteria | 37481 |
| 711 | Ga0207641_10009374 | 3300026088 | Bacteria | 8069 |
| 712 | Ga0207641_10054912 | 3300026088 | Bacteria | 3382 |
| 713 | Ga0207641_10142163 | 3300026088 | Bacteria | 2166 |
| 714 | Ga0207648_10004308 | 3300026089 | Bacteria | 14655 |
| 715 | Ga0207648_10017594 | 3300026089 | Bacteria | 6493 |
| 716 | Ga0207648_10063136 | 3300026089 | Bacteria | 3229 |
| 717 | Ga0207676_10000358 | 3300026095 | Bacteria | 38949 |
| 718 | Ga0207676_10000983 | 3300026095 | Bacteria | 21929 |
| 719 | Ga0207676_10005202 | 3300026095 | Bacteria | 9209 |
| 720 | Ga0207676_10016480 | 3300026095 | Bacteria | 5351 |
| 721 | Ga0207674_10000185 | 3300026116 | Bacteria | 76519 |
| 722 | Ga0207674_10000314 | 3300026116 | Bacteria | 61753 |
| 723 | Ga0207674_10002181 | 3300026116 | Bacteria | 24762 |
| 724 | Ga0207674_10002696 | 3300026116 | Bacteria | 22163 |
| 725 | Ga0207674_10024950 | 3300026116 | Bacteria | 6381 |
| 726 | Ga0207674_10044244 | 3300026116 | Bacteria | 4585 |
| 727 | Ga0207675_100002850 | 3300026118 | Bacteria | 17017 |
| 728 | Ga0207675_100018253 | 3300026118 | Bacteria | 6540 |
| 729 | Ga0207675_100154693 | 3300026118 | Bacteria | 2185 |
| 730 | Ga0207675_100162829 | 3300026118 | Bacteria | 2129 |
| 731 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 732 | Ga0207683_10027328 | 3300026121 | Bacteria | 4930 |
| 733 | Ga0207683_10038667 | 3300026121 | Bacteria | 4161 |
| 734 | Ga0207683_10127233 | 3300026121 | Bacteria | 2290 |
| 735 | Ga0207698_10000857 | 3300026142 | Bacteria | 17683 |
| 736 | Ga0207698_10044221 | 3300026142 | Bacteria | 3344 |
| 737 | Ga0207698_10084683 | 3300026142 | Bacteria | 2571 |
| 738 | Ga0207698_10162661 | 3300026142 | Bacteria | 1954 |
| 739 | Ga0207698_10220339 | 3300026142 | Bacteria | 1714 |
| 740 | Ga0209179_1005986 | 3300027512 | Bacteria | 1934 |
| 741 | Ga0209966_1000701 | 3300027695 | Bacteria | 7232 |
| 742 | Ga0209813_10000184 | 3300027866 | Bacteria | 19954 |
| 743 | Ga0209974_10006072 | 3300027876 | Bacteria | 4228 |
| 744 | Ga0207428_10000316 | 3300027907 | Bacteria | 63363 |
| 745 | Ga0207428_10000897 | 3300027907 | Bacteria | 33272 |
| 746 | Ga0207428_10000923 | 3300027907 | Bacteria | 32854 |
| 747 | Ga0268266_10016735 | 3300028379 | Bacteria | 6270 |
| 748 | Ga0268266_10019041 | 3300028379 | Bacteria | 5847 |
| 749 | Ga0268266_10028106 | 3300028379 | Bacteria | 4782 |
| 750 | Ga0268266_10028711 | 3300028379 | Bacteria | 4728 |
| 751 | Ga0268265_10002015 | 3300028380 | Bacteria | 15954 |
| 752 | Ga0268265_10006389 | 3300028380 | Bacteria | 7988 |
| 753 | Ga0268265_10007116 | 3300028380 | Bacteria | 7552 |
| 754 | Ga0268265_10010473 | 3300028380 | Bacteria | 6263 |
| 755 | Ga0268265_10019093 | 3300028380 | Bacteria | 4758 |
| 756 | Ga0268265_10036082 | 3300028380 | Bacteria | 3619 |
| 757 | Ga0268265_10073525 | 3300028380 | Bacteria | 2670 |
| 758 | Ga0268265_10108458 | 3300028380 | Bacteria | 2260 |
| 759 | Ga0268265_10115467 | 3300028380 | Bacteria | 2200 |
| 760 | Ga0268264_10000976 | 3300028381 | Bacteria | 29278 |
| 761 | Ga0268264_10002587 | 3300028381 | Bacteria | 15829 |
| 762 | Ga0268264_10003561 | 3300028381 | Bacteria | 13410 |
| 763 | Ga0268264_10010537 | 3300028381 | Bacteria | 7644 |
| 764 | Ga0268264_10048516 | 3300028381 | Bacteria | 3532 |
| 765 | Ga0268264_10118751 | 3300028381 | Bacteria | 2327 |
| 766 | Ga0268264_10123474 | 3300028381 | Bacteria | 2285 |
| 767 | Ga0268264_10184721 | 3300028381 | Bacteria | 1896 |
| 768 | Ga0265318_10022180 | 3300028577 | Bacteria | 2541 |
| 769 | Ga0265338_10014430 | 3300028800 | Bacteria | 8794 |
| 770 | Ga0265760_10023408 | 3300031090 | Bacteria | 1795 |
| 771 | Ga0265330_10021930 | 3300031235 | Bacteria | 2910 |
| 772 | Ga0265332_10035887 | 3300031238 | Bacteria | 2153 |
| 773 | Ga0265332_10066004 | 3300031238 | Bacteria | 1545 |
| 774 | Ga0265328_10011073 | 3300031239 | Bacteria | 3613 |
| 775 | Ga0265325_10000097 | 3300031241 | Bacteria | 61606 |
| 776 | Ga0265325_10003705 | 3300031241 | Bacteria | 9887 |
| 777 | Ga0265325_10009260 | 3300031241 | Bacteria | 5757 |
| 778 | Ga0265325_10009896 | 3300031241 | Bacteria | 5548 |
| 779 | Ga0265325_10050320 | 3300031241 | Bacteria | 2146 |
| 780 | Ga0265340_10010971 | 3300031247 | Bacteria | 4832 |
| 781 | Ga0265339_10000091 | 3300031249 | Bacteria | 75937 |
| 782 | Ga0265339_10007468 | 3300031249 | Bacteria | 7064 |
| 783 | Ga0265339_10013800 | 3300031249 | Bacteria | 4889 |
| 784 | Ga0265331_10023779 | 3300031250 | Bacteria | 3108 |
| 785 | Ga0265316_10008071 | 3300031344 | Bacteria | 9820 |
| 786 | Ga0265316_10023549 | 3300031344 | Bacteria | 5171 |
| 787 | Ga0307513_10200910 | 3300031456 | Bacteria | 1834 |
| 788 | Ga0307408_100020885 | 3300031548 | Bacteria | 4425 |
| 789 | Ga0307408_100036610 | 3300031548 | Bacteria | 3451 |
| 790 | Ga0307408_100038872 | 3300031548 | Bacteria | 3359 |
| 791 | Ga0307408_100175266 | 3300031548 | Bacteria | 1715 |
| 792 | Ga0265313_10000260 | 3300031595 | Bacteria | 57581 |
| 793 | Ga0265313_10004440 | 3300031595 | Bacteria | 10791 |
| 794 | Ga0265313_10006139 | 3300031595 | Bacteria | 8626 |
| 795 | Ga0265313_10009745 | 3300031595 | Bacteria | 6191 |
| 796 | Ga0265313_10017993 | 3300031595 | Bacteria | 3987 |
| 797 | Ga0265313_10026282 | 3300031595 | Bacteria | 3069 |
| 798 | Ga0265313_10063235 | 3300031595 | Bacteria | 1726 |
| 799 | Ga0316579_10007010 | 3300031691 | Bacteria | 4633 |
| 800 | Ga0265314_10001493 | 3300031711 | Bacteria | 25971 |
| 801 | Ga0265314_10029986 | 3300031711 | Bacteria | 4032 |
| 802 | Ga0265314_10034505 | 3300031711 | Bacteria | 3698 |
| 803 | Ga0265342_10035680 | 3300031712 | Bacteria | 3042 |
| 804 | Ga0265342_10065731 | 3300031712 | Bacteria | 2125 |
| 805 | Ga0265342_10075153 | 3300031712 | Bacteria | 1961 |
| 806 | Ga0307405_10019312 | 3300031731 | Bacteria | 3782 |
| 807 | Ga0307405_10099604 | 3300031731 | Bacteria | 1945 |
| 808 | Ga0307413_10004947 | 3300031824 | Bacteria | 5873 |
| 809 | Ga0307413_10005807 | 3300031824 | Bacteria | 5558 |
| 810 | Ga0307413_10041306 | 3300031824 | Bacteria | 2699 |
| 811 | Ga0307410_10000196 | 3300031852 | Bacteria | 22538 |
| 812 | Ga0307410_10006424 | 3300031852 | Bacteria | 6340 |
| 813 | Ga0307410_10008268 | 3300031852 | Bacteria | 5760 |
| 814 | Ga0307410_10067718 | 3300031852 | Bacteria | 2463 |
| 815 | Ga0307410_10078392 | 3300031852 | Bacteria | 2312 |
| 816 | Ga0307410_10107900 | 3300031852 | Bacteria | 2009 |
| 817 | Ga0307406_10006125 | 3300031901 | Bacteria | 6610 |
| 818 | Ga0307406_10082294 | 3300031901 | Bacteria | 2143 |
| 819 | Ga0307407_10002297 | 3300031903 | Bacteria | 7419 |
| 820 | Ga0307407_10005484 | 3300031903 | Bacteria | 5510 |
| 821 | Ga0307407_10027269 | 3300031903 | Bacteria | 3036 |
| 822 | Ga0307412_10018182 | 3300031911 | Bacteria | 4224 |
| 823 | Ga0307412_10082897 | 3300031911 | Bacteria | 2221 |
| 824 | Ga0307412_10095467 | 3300031911 | Bacteria | 2090 |
| 825 | Ga0307412_10117210 | 3300031911 | Bacteria | 1911 |
| 826 | Ga0307412_10178438 | 3300031911 | Bacteria | 1595 |
| 827 | Ga0307409_100000135 | 3300031995 | Bacteria | 27853 |
| 828 | Ga0307409_100003671 | 3300031995 | Bacteria | 8404 |
| 829 | Ga0307409_100023312 | 3300031995 | Bacteria | 4286 |
| 830 | Ga0307409_100031858 | 3300031995 | Bacteria | 3813 |
| 831 | Ga0307409_100122463 | 3300031995 | Bacteria | 2205 |
| 832 | Ga0307416_100004600 | 3300032002 | Bacteria | 8347 |
| 833 | Ga0307416_100030220 | 3300032002 | Bacteria | 4062 |
| 834 | Ga0307416_100036347 | 3300032002 | Bacteria | 3776 |
| 835 | Ga0307416_100063662 | 3300032002 | Bacteria | 3021 |
| 836 | Ga0307416_100167519 | 3300032002 | Bacteria | 2040 |
| 837 | Ga0307414_10008740 | 3300032004 | Bacteria | 5772 |
| 838 | Ga0307414_10031793 | 3300032004 | Bacteria | 3466 |
| 839 | Ga0307414_10044294 | 3300032004 | Bacteria | 3037 |
| 840 | Ga0307414_10080811 | 3300032004 | Bacteria | 2378 |
| 841 | Ga0307414_10091118 | 3300032004 | Bacteria | 2265 |
| 842 | Ga0307414_10116781 | 3300032004 | Bacteria | 2043 |
| 843 | Ga0307414_10219992 | 3300032004 | Bacteria | 1558 |
| 844 | Ga0307414_10230655 | 3300032004 | Bacteria | 1526 |
| 845 | Ga0307411_10001690 | 3300032005 | Bacteria | 9252 |
| 846 | Ga0307411_10002367 | 3300032005 | Bacteria | 8292 |
| 847 | Ga0307411_10008891 | 3300032005 | Bacteria | 5239 |
| 848 | Ga0307411_10022155 | 3300032005 | Bacteria | 3734 |
| 849 | Ga0307411_10042276 | 3300032005 | Bacteria | 2906 |
| 850 | Ga0307411_10046202 | 3300032005 | Bacteria | 2805 |
| 851 | Ga0307411_10047788 | 3300032005 | Bacteria | 2768 |
| 852 | Ga0307411_10068032 | 3300032005 | Bacteria | 2399 |
| 853 | Ga0307411_10104022 | 3300032005 | Bacteria | 2015 |
| 854 | Ga0307415_100031263 | 3300032126 | Bacteria | 3427 |
| 855 | Ga0307415_100059518 | 3300032126 | Bacteria | 2635 |
| 856 | Ga0307415_100148538 | 3300032126 | Bacteria | 1800 |
| 857 | Ga0307415_100226374 | 3300032126 | Bacteria | 1503 |
| 858 | Ga0316583_10000081 | 3300032133 | Bacteria | 20405 |
| 859 | Ga0373930_0000006 | 3300034816 | Bacteria | 23914 |
| 860 | Ga0373958_0000694 | 3300034819 | Bacteria | 4267 |
| 861 | Ga0373958_0001103 | 3300034819 | Bacteria | 3564 |
| 862 | Ga0373959_0005640 | 3300034820 | Bacteria | 2056 |
| 863 | Ga0373938_0000479 | 3300034957 | Bacteria | 6462 |
| 864 | Ga0373938_0001513 | 3300034957 | Bacteria | 3730 |
| 865 | Ga0373926_0007041 | 3300035083 | Bacteria | 3740 |
| 866 | Ga0373928_0003420 | 3300035084 | Bacteria | 3021 |
| 867 | Ga0373928_0004315 | 3300035084 | Bacteria | 2713 |
| 868 | Ga0373929_0000474 | 3300035085 | Bacteria | 7702 |
| 869 | Ga0373934_0003474 | 3300035086 | Bacteria | 5783 |
| 870 | Ga0373934_0047832 | 3300035086 | Bacteria | 1693 |
| 871 | Ga0373940_0000343 | 3300035088 | Bacteria | 6919 |
| 872 | Ga0373940_0008788 | 3300035088 | Bacteria | 2329 |
| 873 | Ga0373944_0002019 | 3300035089 | Bacteria | 5143 |
| 874 | Ga0373944_0002875 | 3300035089 | Bacteria | 4412 |
| 875 | Ga0373944_0003428 | 3300035089 | Bacteria | 4090 |
| 876 | Ga0373944_0024959 | 3300035089 | Bacteria | 1756 |
| 877 | Ga0373951_0000313 | 3300035091 | Bacteria | 15313 |
| 878 | Ga0373952_0000218 | 3300035092 | Bacteria | 9116 |
| 879 | Ga0373952_0000939 | 3300035092 | Bacteria | 5291 |
| 880 | Ga0373923_0018708 | 3300035111 | Bacteria | 2671 |
| 881 | Ga0373932_0002670 | 3300035112 | Bacteria | 4437 |
| 882 | Ga0373932_0003226 | 3300035112 | Bacteria | 3956 |
| 883 | Ga0373932_0017848 | 3300035112 | Bacteria | 1828 |
| 884 | Ga0373936_0045373 | 3300035113 | Bacteria | 1770 |
| 885 | Ga0373939_0000569 | 3300035114 | Bacteria | 9219 |
| 886 | Ga0373939_0005627 | 3300035114 | Bacteria | 2986 |
| 887 | Ga0373941_0001350 | 3300035115 | Bacteria | 5161 |
| 888 | Ga0373941_0025498 | 3300035115 | Bacteria | 1708 |
| 889 | Ga0373941_0031985 | 3300035115 | Bacteria | 1572 |
| 890 | Ga0373945_0004285 | 3300035116 | Bacteria | 4527 |
| 891 | Ga0373945_0012804 | 3300035116 | Bacteria | 2791 |
| 892 | Ga0373953_0006282 | 3300035117 | Bacteria | 3906 |
| 893 | Ga0373954_0013421 | 3300035118 | Bacteria | 3651 |
| 894 | Ga0373954_0016582 | 3300035118 | Bacteria | 3300 |
| 895 | Ga0373954_0036014 | 3300035118 | Bacteria | 2296 |
| 896 | Ga0373956_0006720 | 3300035119 | Bacteria | 4612 |
| 897 | Ga0373956_0037549 | 3300035119 | Bacteria | 2141 |
| 898 | Ga0373956_0040827 | 3300035119 | Bacteria | 2059 |
| 899 | Ga0373957_0013818 | 3300035120 | Bacteria | 2748 |
| 900 | Ga0373960_0000093 | 3300035121 | Bacteria | 13747 |
| 901 | Ga0373943_0000567 | 3300035170 | Bacteria | 16034 |
| 902 | Ga0373943_0012619 | 3300035170 | Bacteria | 3808 |
| 903 | Ga0373946_0002942 | 3300035171 | Bacteria | 6038 |
| 904 | Ga0373946_0008443 | 3300035171 | Bacteria | 3778 |
| 905 | Ga0373946_0023518 | 3300035171 | Bacteria | 2408 |
| 906 | Ga0373946_0063818 | 3300035171 | Bacteria | 1574 |
| 907 | Ga0373955_0000962 | 3300035172 | Bacteria | 12266 |
| 908 | Ga0373955_0001391 | 3300035172 | Bacteria | 10289 |
| 909 | Ga0373955_0025552 | 3300035172 | Bacteria | 3034 |
| 910 | Ga0373955_0043621 | 3300035172 | Bacteria | 2413 |
| 911 | Ga0373942_0000292 | 3300035207 | Bacteria | 13607 |
| 912 | Ga0373942_0010958 | 3300035207 | Bacteria | 2141 |
| 913 | Ga0373961_0001147 | 3300035241 | Bacteria | 8298 |
| 914 | Ga0373961_0010379 | 3300035241 | Bacteria | 2294 |
| 915 | Ga0373962_0000301 | 3300035242 | Bacteria | 10672 |
| 916 | Ga0373962_0001628 | 3300035242 | Bacteria | 5333 |
| 917 | Ga0373962_0011123 | 3300035242 | Bacteria | 2252 |
| 918 | Ga0373931_0000086 | 3300035691 | Bacteria | 43093 |
| 919 | Ga0373931_0003593 | 3300035691 | Bacteria | 6996 |
| 920 | Ga0373935_0031599 | 3300035692 | Bacteria | 3287 |
| 921 | Ga0373935_0057184 | 3300035692 | Bacteria | 2488 |
| 922 | Ga0373935_0065204 | 3300035692 | Bacteria | 2336 |
| 923 | Ga0373935_0067547 | 3300035692 | Bacteria | 2298 |
| 924 | Ga0373927_0005131 | 3300035695 | Bacteria | 9063 |
| 925 | Ga0373927_0034920 | 3300035695 | Bacteria | 3270 |
| 926 | Ga0373927_0059331 | 3300035695 | Bacteria | 2474 |
| 927 | Ga0373927_0071753 | 3300035695 | Bacteria | 2241 |
| 928 | Ga0373927_0114791 | 3300035695 | Bacteria | 1755 |
| 929 | Ga0373933_0009812 | 3300035724 | Bacteria | 5238 |
| 930 | Ga0373933_0017845 | 3300035724 | Bacteria | 3984 |
| 931 | Ga0373933_0028060 | 3300035724 | Bacteria | 3245 |
| 932 | Ga0373947_0009204 | 3300035725 | Bacteria | 5675 |
| 933 | Ga0373947_0014769 | 3300035725 | Bacteria | 4480 |
| 934 | Ga0373947_0021695 | 3300035725 | Bacteria | 3719 |
| 935 | Ga0373937_0004313 | 3300036401 | Bacteria | 12059 |
| 936 | Ga0373937_0004822 | 3300036401 | Bacteria | 11465 |
| 937 | Ga0373937_0013053 | 3300036401 | Bacteria | 7316 |
| 938 | Ga0373937_0023035 | 3300036401 | Bacteria | 5602 |
| 939 | Ga0373937_0031048 | 3300036401 | Bacteria | 4838 |
| 940 | Ga0373937_0117379 | 3300036401 | Bacteria | 2478 |
| 941 | Ga0316582_0080845 | 3300036647 | Bacteria | 2122 |
| 942 | Ga0373925_0003922 | 3300037068 | Bacteria | 11355 |
| 943 | Ga0373925_0015075 | 3300037068 | Bacteria | 5586 |
| 944 | Ga0373925_0023858 | 3300037068 | Bacteria | 4462 |
| 945 | Ga0395899_0000132 | 3300037312 | Bacteria | 115455 |
| 946 | Ga0395899_0025245 | 3300037312 | Bacteria | 4486 |
| 947 | Ga0395900_0000477 | 3300037418 | Bacteria | 56791 |
| 948 | Ga0395900_0000997 | 3300037418 | Bacteria | 36770 |
| 949 | Ga0395900_0001169 | 3300037418 | Bacteria | 32753 |
| 950 | Ga0395900_0003479 | 3300037418 | Bacteria | 16993 |
| 951 | Ga0395900_0016968 | 3300037418 | Bacteria | 7431 |
| 952 | Ga0395900_0078138 | 3300037418 | Bacteria | 3400 |
| 953 | Ga0395900_0085220 | 3300037418 | Bacteria | 3247 |
| 954 | Ga0395900_0091734 | 3300037418 | Bacteria | 3121 |
| 955 | Ga0395898_0015973 | 3300037466 | Bacteria | 7691 |
| 956 | Ga0395898_0017326 | 3300037466 | Bacteria | 7360 |
| 957 | Ga0395898_0028510 | 3300037466 | Bacteria | 5594 |
| 958 | Ga0395898_0061634 | 3300037466 | Bacteria | 3644 |
| 959 | Ga0395898_0067555 | 3300037466 | Bacteria | 3461 |
| 960 | Ga0395898_0117554 | 3300037466 | Bacteria | 2547 |
| 961 | Ga0395898_0121892 | 3300037466 | Bacteria | 2498 |
| 962 | Ga0395905_0000818 | 3300037471 | Bacteria | 40874 |
| 963 | Ga0395905_0001164 | 3300037471 | Bacteria | 32823 |
| 964 | Ga0395905_0002761 | 3300037471 | Bacteria | 19234 |
| 965 | Ga0395905_0010864 | 3300037471 | Bacteria | 8818 |
| 966 | Ga0395905_0021647 | 3300037471 | Bacteria | 6082 |
| 967 | Ga0395905_0043421 | 3300037471 | Bacteria | 4218 |
| 968 | Ga0395905_0053027 | 3300037471 | Bacteria | 3797 |
| 969 | Ga0395905_0068826 | 3300037471 | Bacteria | 3315 |
| 970 | Ga0436364_0319726 | 3300037853 | Bacteria | 1794 |
| 971 | Ga0395901_0000208 | 3300038443 | Bacteria | 73874 |
| 972 | Ga0395901_0000589 | 3300038443 | Bacteria | 42319 |
| 973 | Ga0395901_0002866 | 3300038443 | Bacteria | 17413 |
| 974 | Ga0395901_0007227 | 3300038443 | Bacteria | 11200 |
| 975 | Ga0395901_0087854 | 3300038443 | Bacteria | 3250 |
| 976 | Ga0395901_0114738 | 3300038443 | Bacteria | 2829 |
| 977 | Ga0395901_0197617 | 3300038443 | Bacteria | 2108 |
| 978 | Ga0395901_0295086 | 3300038443 | Bacteria | 1681 |
| 979 | Ga0395901_0368745 | 3300038443 | Bacteria | 1479 |
| 980 | Ga0436365_0414414 | 3300039437 | Bacteria | 44510 |
| 981 | Ga0436365_0458815 | 3300039437 | Bacteria | 12358 |
| 982 | Ga0436360_0251329 | 3300039438 | Bacteria | 2226 |
| 983 | Ga0436361_0896735 | 3300039447 | Bacteria | 20111 |
| 984 | Ga0439445_0002205 | 3300042004 | Bacteria | 4320 |
| 985 | Ga0439448_0020086 | 3300042005 | Bacteria | 2064 |
| 986 | Ga0439432_008816 | 3300042006 | Bacteria | 3528 |
| 987 | Ga0439432_023841 | 3300042006 | Bacteria | 2013 |
| 988 | Ga0439452_023708 | 3300042010 | Bacteria | 1577 |
| 989 | Ga0439455_0025551 | 3300042012 | Bacteria | 1436 |
| 990 | Ga0439462_0031594 | 3300042015 | Bacteria | 1403 |
| 991 | Ga0450905_003094 | 3300042142 | Bacteria | 2173 |
| 992 | Ga0450889_000019 | 3300042144 | Bacteria | 13862 |
| 993 | Ga0439435_0000116 | 3300042436 | Bacteria | 10320 |
| 994 | Ga0451577_0012529 | 3300042876 | Bacteria | 7962 |
| 995 | Ga0466972_0068169 | 3300044658 | Bacteria | 1699 |
| 996 | Ga0466966_0167740 | 3300044684 | Bacteria | 1335 |
| 997 | Ga0466963_0003406 | 3300044694 | Bacteria | 9099 |
| 998 | Ga0466963_0015451 | 3300044694 | Bacteria | 4728 |
| 999 | Ga0466963_0042944 | 3300044694 | Bacteria | 2970 |
| 1000 | Ga0466963_0155714 | 3300044694 | Bacteria | 1588 |
| 1001 | Ga0453684_0082525 | 3300044712 | Bacteria | 4004 |
| 1002 | Ga0466959_0059587 | 3300045049 | Bacteria | 2780 |
| 1003 | Ga0451576_0027924 | 3300045051 | Bacteria | 6053 |
| 1004 | Ga0466958_0035584 | 3300045836 | Bacteria | 2975 |
| 1005 | Ga0466967_0002255 | 3300045976 | Bacteria | 11880 |
| 1006 | Ga0466967_0007911 | 3300045976 | Bacteria | 7730 |
| 1007 | Ga0466967_0053981 | 3300045976 | Bacteria | 3534 |
| 1008 | Ga0466967_0066726 | 3300045976 | Bacteria | 3207 |
| 1009 | Ga0466967_0081609 | 3300045976 | Bacteria | 2921 |
| 1010 | Ga0466967_0172865 | 3300045976 | Bacteria | 2034 |
| 1011 | Ga0466967_0178004 | 3300045976 | Bacteria | 2004 |
| 1012 | Ga0466967_0191450 | 3300045976 | Bacteria | 1933 |
| 1013 | Ga0495592_0008217 | 3300046454 | Bacteria | 7838 |
| 1014 | Ga0495592_0027775 | 3300046454 | Bacteria | 4286 |
| 1015 | Ga0495592_0101871 | 3300046454 | Bacteria | 2045 |
| 1016 | Ga0495603_0087900 | 3300046455 | Bacteria | 1818 |
| 1017 | Ga0495629_0000668 | 3300046459 | Bacteria | 27756 |
| 1018 | Ga0495629_0135648 | 3300046459 | Bacteria | 1713 |
| 1019 | Ga0495638_0000204 | 3300046460 | Bacteria | 84182 |
| 1020 | Ga0495638_0017966 | 3300046460 | Bacteria | 4706 |
| 1021 | Ga0495638_0021126 | 3300046460 | Bacteria | 4294 |
| 1022 | Ga0495641_0034802 | 3300046461 | Bacteria | 2378 |
| 1023 | Ga0495641_0068827 | 3300046461 | Bacteria | 1591 |
| 1024 | Ga0495651_0000237 | 3300046462 | Bacteria | 42533 |
| 1025 | Ga0495651_0009743 | 3300046462 | Bacteria | 7388 |
| 1026 | Ga0495651_0014732 | 3300046462 | Bacteria | 6046 |
| 1027 | Ga0495651_0064792 | 3300046462 | Bacteria | 2792 |
| 1028 | Ga0495653_0009351 | 3300046463 | Bacteria | 8019 |
| 1029 | Ga0495653_0020295 | 3300046463 | Bacteria | 5388 |
| 1030 | Ga0495653_0047643 | 3300046463 | Bacteria | 3314 |
| 1031 | Ga0495580_0024260 | 3300046472 | Bacteria | 4444 |
| 1032 | Ga0495580_0044157 | 3300046472 | Bacteria | 3171 |
| 1033 | Ga0495582_0035811 | 3300046473 | Bacteria | 2730 |
| 1034 | Ga0495639_0020552 | 3300046475 | Bacteria | 2885 |
| 1035 | Ga0495662_0000280 | 3300046476 | Bacteria | 21964 |
| 1036 | Ga0495662_0007973 | 3300046476 | Bacteria | 5216 |
| 1037 | Ga0495662_0015169 | 3300046476 | Bacteria | 3743 |
| 1038 | Ga0495664_0000112 | 3300046477 | Bacteria | 40522 |
| 1039 | Ga0495664_0006025 | 3300046477 | Bacteria | 6683 |
| 1040 | Ga0495664_0092353 | 3300046477 | Bacteria | 1820 |
| 1041 | Ga0495584_0011269 | 3300046491 | Bacteria | 4579 |
| 1042 | Ga0495584_0055204 | 3300046491 | Bacteria | 1999 |
| 1043 | Ga0495584_0074316 | 3300046491 | Bacteria | 1708 |
| 1044 | Ga0495585_0000734 | 3300046492 | Bacteria | 29222 |
| 1045 | Ga0495585_0006706 | 3300046492 | Bacteria | 7107 |
| 1046 | Ga0495596_0008510 | 3300046500 | Bacteria | 4563 |
| 1047 | Ga0495607_0011035 | 3300046501 | Bacteria | 6034 |
| 1048 | Ga0495608_0005221 | 3300046511 | Bacteria | 9279 |
| 1049 | Ga0495608_0067866 | 3300046511 | Bacteria | 2332 |
| 1050 | Ga0495610_0002641 | 3300046512 | Bacteria | 14823 |
| 1051 | Ga0495618_0001016 | 3300046514 | Bacteria | 19217 |
| 1052 | Ga0495618_0007304 | 3300046514 | Bacteria | 6686 |
| 1053 | Ga0495618_0066673 | 3300046514 | Bacteria | 2288 |
| 1054 | Ga0495618_0134541 | 3300046514 | Bacteria | 1581 |
| 1055 | Ga0495628_0004625 | 3300046516 | Bacteria | 12159 |
| 1056 | Ga0495628_0018442 | 3300046516 | Bacteria | 5780 |
| 1057 | Ga0495628_0211069 | 3300046516 | Bacteria | 1460 |
| 1058 | Ga0495630_0024126 | 3300046517 | Bacteria | 4497 |
| 1059 | Ga0495630_0034111 | 3300046517 | Bacteria | 3797 |
| 1060 | Ga0495631_0016466 | 3300046518 | Bacteria | 3523 |
| 1061 | Ga0495632_0000075 | 3300046519 | Bacteria | 102051 |
| 1062 | Ga0495632_0046880 | 3300046519 | Bacteria | 2146 |
| 1063 | Ga0495637_0000123 | 3300046520 | Bacteria | 57717 |
| 1064 | Ga0495637_0034787 | 3300046520 | Bacteria | 2204 |
| 1065 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 1066 | Ga0495644_0000306 | 3300046523 | Bacteria | 22634 |
| 1067 | Ga0495648_0037541 | 3300046524 | Bacteria | 3111 |
| 1068 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 1069 | Ga0495663_0017730 | 3300046525 | Bacteria | 2023 |
| 1070 | Ga0495666_0023948 | 3300046526 | Bacteria | 3019 |
| 1071 | Ga0495666_0034834 | 3300046526 | Bacteria | 2455 |
| 1072 | Ga0495652_0019482 | 3300046529 | Bacteria | 6042 |
| 1073 | Ga0495652_0105926 | 3300046529 | Bacteria | 2271 |
| 1074 | Ga0495665_0007482 | 3300046531 | Bacteria | 5909 |
| 1075 | Ga0495665_0012616 | 3300046531 | Bacteria | 4575 |
| 1076 | Ga0495665_0030802 | 3300046531 | Bacteria | 2870 |
| 1077 | Ga0495640_0000871 | 3300046533 | Bacteria | 23106 |
| 1078 | Ga0495640_0084501 | 3300046533 | Bacteria | 2105 |
| 1079 | Ga0495586_0014023 | 3300046535 | Bacteria | 4255 |
| 1080 | Ga0495586_0041668 | 3300046535 | Bacteria | 2473 |
| 1081 | Ga0495586_0111993 | 3300046535 | Bacteria | 1519 |
| 1082 | Ga0495587_0006533 | 3300046536 | Bacteria | 7598 |
| 1083 | Ga0495587_0072252 | 3300046536 | Bacteria | 2006 |
| 1084 | Ga0495587_0118441 | 3300046536 | Bacteria | 1517 |
| 1085 | Ga0495598_0003015 | 3300046537 | Bacteria | 3534 |
| 1086 | Ga0495621_0000652 | 3300046539 | Bacteria | 8756 |
| 1087 | Ga0495621_0011175 | 3300046539 | Bacteria | 2769 |
| 1088 | Ga0495621_0019245 | 3300046539 | Bacteria | 2228 |
| 1089 | Ga0495645_0003375 | 3300046543 | Bacteria | 10820 |
| 1090 | Ga0495645_0004586 | 3300046543 | Bacteria | 9430 |
| 1091 | Ga0495645_0076719 | 3300046543 | Bacteria | 2403 |
| 1092 | Ga0495622_0034756 | 3300046557 | Bacteria | 2351 |
| 1093 | Ga0495622_0054674 | 3300046557 | Bacteria | 1852 |
| 1094 | Ga0495633_0000173 | 3300046558 | Bacteria | 84576 |
| 1095 | Ga0495633_0001183 | 3300046558 | Bacteria | 20947 |
| 1096 | Ga0495633_0001327 | 3300046558 | Bacteria | 19427 |
| 1097 | Ga0495667_0003141 | 3300046559 | Bacteria | 11080 |
| 1098 | Ga0495667_0004903 | 3300046559 | Bacteria | 9045 |
| 1099 | Ga0495667_0079413 | 3300046559 | Bacteria | 2133 |
| 1100 | Ga0495667_0095258 | 3300046559 | Bacteria | 1927 |
| 1101 | Ga0495656_0000381 | 3300046615 | Bacteria | 14786 |
| 1102 | Ga0495656_0072045 | 3300046615 | Bacteria | 1537 |
| 1103 | Ga0495668_0076134 | 3300046616 | Bacteria | 1842 |
| 1104 | Ga0495634_0003493 | 3300046642 | Bacteria | 12595 |
| 1105 | Ga0495634_0033846 | 3300046642 | Bacteria | 3509 |
| 1106 | Ga0495634_0038870 | 3300046642 | Bacteria | 3243 |
| 1107 | Ga0495611_0001463 | 3300046648 | Bacteria | 11757 |
| 1108 | Ga0495635_0002093 | 3300046663 | Bacteria | 13548 |
| 1109 | Ga0495635_0028467 | 3300046663 | Bacteria | 3884 |
| 1110 | Ga0495635_0116987 | 3300046663 | Bacteria | 1819 |
| 1111 | Ga0495659_0003761 | 3300046664 | Bacteria | 4823 |
| 1112 | Ga0495661_0082450 | 3300046665 | Bacteria | 1851 |
| 1113 | Ga0495588_0002225 | 3300046674 | Bacteria | 8308 |
| 1114 | Ga0495657_0006644 | 3300046675 | Bacteria | 9033 |
| 1115 | Ga0495657_0008508 | 3300046675 | Bacteria | 7845 |
| 1116 | Ga0495657_0008561 | 3300046675 | Bacteria | 7814 |
| 1117 | Ga0495599_0021673 | 3300046678 | Bacteria | 4009 |
| 1118 | Ga0495623_0026503 | 3300046679 | Bacteria | 3731 |
| 1119 | Ga0495646_0004362 | 3300046680 | Bacteria | 8917 |
| 1120 | Ga0495658_0000229 | 3300046683 | Bacteria | 32147 |
| 1121 | Ga0495669_0000599 | 3300046684 | Bacteria | 15785 |
| 1122 | Ga0495669_0001837 | 3300046684 | Bacteria | 8692 |
| 1123 | Ga0495669_0010207 | 3300046684 | Bacteria | 3967 |
| 1124 | Ga0495613_0011247 | 3300046689 | Bacteria | 6650 |
| 1125 | Ga0495613_0037688 | 3300046689 | Bacteria | 3584 |
| 1126 | Ga0495613_0103240 | 3300046689 | Bacteria | 2058 |
| 1127 | Ga0495613_0121505 | 3300046689 | Bacteria | 1875 |
| 1128 | Ga0495624_0001093 | 3300046690 | Bacteria | 21434 |
| 1129 | Ga0495624_0022372 | 3300046690 | Bacteria | 4179 |
| 1130 | Ga0495670_0002180 | 3300046691 | Bacteria | 9687 |
| 1131 | Ga0495670_0003882 | 3300046691 | Bacteria | 7342 |
| 1132 | Ga0495670_0102255 | 3300046691 | Bacteria | 1476 |
| 1133 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 1134 | Ga0495600_0019287 | 3300046809 | Bacteria | 4354 |
| 1135 | Ga0495600_0067544 | 3300046809 | Bacteria | 2337 |
| 1136 | Ga0495600_0084015 | 3300046809 | Bacteria | 2078 |
| 1137 | Ga0495581_0054776 | 3300047315 | Bacteria | 2302 |
| 1138 | Ga0495581_0056281 | 3300047315 | Bacteria | 2270 |
| 1139 | Ga0495581_0058993 | 3300047315 | Bacteria | 2216 |
| 1140 | Ga0495581_0084168 | 3300047315 | Bacteria | 1843 |
| 1141 | Ga0495604_0002806 | 3300047317 | Bacteria | 13980 |
| 1142 | Ga0495604_0008011 | 3300047317 | Bacteria | 8369 |
| 1143 | Ga0495604_0009095 | 3300047317 | Bacteria | 7860 |
| 1144 | Ga0495674_0001513 | 3300047319 | Bacteria | 22779 |
| 1145 | Ga0495674_0151891 | 3300047319 | Bacteria | 1941 |
| 1146 | Ga0495674_0280038 | 3300047319 | Bacteria | 1366 |
| 1147 | Ga0495672_0002402 | 3300047320 | Bacteria | 17288 |
| 1148 | Ga0495672_0004345 | 3300047320 | Bacteria | 11663 |
| 1149 | Ga0495672_0083360 | 3300047320 | Bacteria | 1776 |
| 1150 | Ga0495676_0072836 | 3300047321 | Bacteria | 2636 |
| 1151 | Ga0495676_0125444 | 3300047321 | Bacteria | 1861 |
| 1152 | Ga0495680_0016671 | 3300047322 | Bacteria | 6304 |
| 1153 | Ga0495680_0025791 | 3300047322 | Bacteria | 4859 |
| 1154 | Ga0495680_0028426 | 3300047322 | Bacteria | 4584 |
| 1155 | Ga0495680_0077960 | 3300047322 | Bacteria | 2508 |
| 1156 | Ga0495680_0098613 | 3300047322 | Bacteria | 2180 |
| 1157 | Ga0495675_0005331 | 3300047444 | Bacteria | 7834 |
| 1158 | Ga0495677_0018861 | 3300047445 | Bacteria | 2501 |
| 1159 | Ga0495681_0001636 | 3300047470 | Bacteria | 16634 |
| 1160 | Ga0495684_0000264 | 3300047471 | Bacteria | 41677 |
| 1161 | Ga0495684_0001309 | 3300047471 | Bacteria | 20014 |
| 1162 | Ga0495593_0030842 | 3300047673 | Bacteria | 2931 |
| 1163 | Ga0495593_0046463 | 3300047673 | Bacteria | 2313 |
| 1164 | Ga0495602_0005783 | 3300048088 | Bacteria | 12976 |
| 1165 | Ga0495602_0021033 | 3300048088 | Bacteria | 6431 |
| 1166 | Ga0495602_0040285 | 3300048088 | Bacteria | 4287 |
| 1167 | Ga0495602_0186809 | 3300048088 | Bacteria | 1593 |
| 1168 | Ga0495614_0012220 | 3300048089 | Bacteria | 3771 |
| 1169 | Ga0495615_0004517 | 3300048090 | Bacteria | 2436 |
| 1170 | Ga0495626_0000214 | 3300048091 | Bacteria | 69009 |
| 1171 | Ga0496100_0001253 | 3300048903 | Bacteria | 12380 |
| 1172 | Ga0496100_0040891 | 3300048903 | Bacteria | 2952 |
| 1173 | Ga0496101_0001852 | 3300048904 | Bacteria | 12758 |
| 1174 | Ga0496101_0002475 | 3300048904 | Bacteria | 11344 |
| 1175 | Ga0496101_0004266 | 3300048904 | Bacteria | 8964 |
| 1176 | Ga0496101_0043198 | 3300048904 | Bacteria | 3221 |
| 1177 | Ga0496101_0061187 | 3300048904 | Bacteria | 2734 |
| 1178 | Ga0496102_0002526 | 3300048905 | Bacteria | 15627 |
| 1179 | Ga0496102_0006171 | 3300048905 | Bacteria | 10219 |
| 1180 | Ga0496102_0024435 | 3300048905 | Bacteria | 5373 |
| 1181 | Ga0496102_0203451 | 3300048905 | Bacteria | 1866 |
| 1182 | Ga0496103_0000130 | 3300048906 | Bacteria | 80826 |
| 1183 | Ga0496103_0000715 | 3300048906 | Bacteria | 24556 |
| 1184 | Ga0496103_0012088 | 3300048906 | Bacteria | 5127 |
| 1185 | Ga0496103_0031446 | 3300048906 | Bacteria | 3234 |
| 1186 | Ga0496104_0000311 | 3300048907 | Bacteria | 43387 |
| 1187 | Ga0496104_0000900 | 3300048907 | Bacteria | 25552 |
| 1188 | Ga0496104_0001975 | 3300048907 | Bacteria | 17756 |
| 1189 | Ga0496104_0011188 | 3300048907 | Bacteria | 8029 |
| 1190 | Ga0496104_0047862 | 3300048907 | Bacteria | 4031 |
| 1191 | Ga0496104_0095212 | 3300048907 | Bacteria | 2849 |
| 1192 | Ga0496105_0000144 | 3300048908 | Bacteria | 46774 |
| 1193 | Ga0496105_0000363 | 3300048908 | Bacteria | 30056 |
| 1194 | Ga0496105_0010173 | 3300048908 | Bacteria | 7391 |
| 1195 | Ga0496105_0052297 | 3300048908 | Bacteria | 3374 |
| 1196 | Ga0496105_0075082 | 3300048908 | Bacteria | 2792 |
| 1197 | Ga0496105_0075755 | 3300048908 | Bacteria | 2778 |
| 1198 | Ga0496105_0200163 | 3300048908 | Bacteria | 1630 |
| 1199 | Ga0496106_0000135 | 3300048909 | Bacteria | 55500 |
| 1200 | Ga0496106_0005392 | 3300048909 | Bacteria | 9457 |
| 1201 | Ga0496106_0011849 | 3300048909 | Bacteria | 6436 |
| 1202 | Ga0496106_0015796 | 3300048909 | Bacteria | 5583 |
| 1203 | Ga0496106_0106463 | 3300048909 | Bacteria | 2180 |
| 1204 | Ga0496107_0012327 | 3300048910 | Bacteria | 5968 |
| 1205 | Ga0496107_0031189 | 3300048910 | Bacteria | 3801 |
| 1206 | Ga0496107_0059074 | 3300048910 | Bacteria | 2774 |
| 1207 | Ga0496107_0120197 | 3300048910 | Bacteria | 1935 |
| 1208 | Ga0496107_0255400 | 3300048910 | Bacteria | 1304 |
| 1209 | Ga0496108_0000256 | 3300048911 | Bacteria | 46076 |
| 1210 | Ga0496108_0004267 | 3300048911 | Bacteria | 11515 |
| 1211 | Ga0496108_0005425 | 3300048911 | Bacteria | 10309 |
| 1212 | Ga0496108_0005764 | 3300048911 | Bacteria | 10033 |
| 1213 | Ga0496108_0008672 | 3300048911 | Bacteria | 8244 |
| 1214 | Ga0496108_0022065 | 3300048911 | Bacteria | 5234 |
| 1215 | Ga0496108_0040349 | 3300048911 | Bacteria | 3891 |
| 1216 | Ga0496108_0125821 | 3300048911 | Bacteria | 2200 |
| 1217 | Ga0496109_0000490 | 3300048912 | Bacteria | 33902 |
| 1218 | Ga0496109_0000730 | 3300048912 | Bacteria | 27368 |
| 1219 | Ga0496109_0012503 | 3300048912 | Bacteria | 7328 |
| 1220 | Ga0496109_0027371 | 3300048912 | Bacteria | 5090 |
| 1221 | Ga0496109_0041709 | 3300048912 | Bacteria | 4157 |
| 1222 | Ga0496109_0048395 | 3300048912 | Bacteria | 3868 |
| 1223 | Ga0496109_0066682 | 3300048912 | Bacteria | 3296 |
| 1224 | Ga0496109_0167510 | 3300048912 | Bacteria | 2060 |
| 1225 | Ga0496109_0219015 | 3300048912 | Bacteria | 1790 |
| 1226 | Ga0496110_0005771 | 3300048913 | Bacteria | 9726 |
| 1227 | Ga0496110_0008763 | 3300048913 | Bacteria | 8150 |
| 1228 | Ga0496110_0008841 | 3300048913 | Bacteria | 8115 |
| 1229 | Ga0496110_0010176 | 3300048913 | Bacteria | 7641 |
| 1230 | Ga0496110_0124874 | 3300048913 | Bacteria | 2321 |
| 1231 | Ga0496110_0257683 | 3300048913 | Bacteria | 1588 |
| 1232 | Ga0496111_0002097 | 3300048914 | Bacteria | 11899 |
| 1233 | Ga0496111_0012561 | 3300048914 | Bacteria | 5739 |
| 1234 | Ga0496111_0015368 | 3300048914 | Bacteria | 5251 |
| 1235 | Ga0496111_0030426 | 3300048914 | Bacteria | 3838 |
| 1236 | Ga0496111_0047442 | 3300048914 | Bacteria | 3093 |
| 1237 | Ga0496111_0074374 | 3300048914 | Bacteria | 2474 |
| 1238 | Ga0496111_0084864 | 3300048914 | Bacteria | 2315 |
| 1239 | Ga0496111_0098668 | 3300048914 | Bacteria | 2145 |
| 1240 | Ga0496112_0002301 | 3300048915 | Bacteria | 15303 |
| 1241 | Ga0496112_0040962 | 3300048915 | Bacteria | 4530 |
| 1242 | Ga0496112_0051044 | 3300048915 | Bacteria | 4056 |
| 1243 | Ga0496112_0053767 | 3300048915 | Bacteria | 3956 |
| 1244 | Ga0496112_0083002 | 3300048915 | Bacteria | 3168 |
| 1245 | Ga0496112_0086797 | 3300048915 | Bacteria | 3095 |
| 1246 | Ga0496112_0116008 | 3300048915 | Bacteria | 2648 |
| 1247 | Ga0496112_0196859 | 3300048915 | Bacteria | 1975 |
| 1248 | Ga0496113_0000318 | 3300048916 | Bacteria | 22869 |
| 1249 | Ga0496113_0004239 | 3300048916 | Bacteria | 8777 |
| 1250 | Ga0496113_0008442 | 3300048916 | Bacteria | 6712 |
| 1251 | Ga0496113_0016292 | 3300048916 | Bacteria | 5131 |
| 1252 | Ga0496113_0079873 | 3300048916 | Bacteria | 2504 |
| 1253 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 1254 | Ga0496114_0000287 | 3300048917 | Bacteria | 36856 |
| 1255 | Ga0496114_0058988 | 3300048917 | Bacteria | 3205 |
| 1256 | Ga0496114_0131587 | 3300048917 | Bacteria | 2161 |
| 1257 | Ga0496115_0003371 | 3300048918 | Bacteria | 11463 |
| 1258 | Ga0496115_0009373 | 3300048918 | Bacteria | 7274 |
| 1259 | Ga0496115_0018872 | 3300048918 | Bacteria | 5302 |
| 1260 | Ga0496115_0019923 | 3300048918 | Bacteria | 5169 |
| 1261 | Ga0496115_0061836 | 3300048918 | Bacteria | 3020 |
| 1262 | Ga0496115_0064194 | 3300048918 | Bacteria | 2963 |
| 1263 | Ga0496115_0113708 | 3300048918 | Bacteria | 2224 |
| 1264 | Ga0496116_0000062 | 3300048919 | Bacteria | 271104 |
| 1265 | Ga0496118_0039378 | 3300048921 | Bacteria | 3773 |
| 1266 | Ga0496119_0000936 | 3300048922 | Bacteria | 37609 |
| 1267 | Ga0496121_0002503 | 3300048924 | Bacteria | 27924 |
| 1268 | Ga0496121_0010966 | 3300048924 | Bacteria | 10120 |
| 1269 | Ga0496122_0000589 | 3300048925 | Bacteria | 74585 |
| 1270 | Ga0496122_0009287 | 3300048925 | Bacteria | 10397 |
| 1271 | Ga0496122_0019558 | 3300048925 | Bacteria | 6178 |
| 1272 | Ga0496122_0020036 | 3300048925 | Bacteria | 6074 |
| 1273 | Ga0496123_0000278 | 3300048926 | Bacteria | 100746 |
| 1274 | Ga0496123_0000545 | 3300048926 | Bacteria | 64687 |
| 1275 | Ga0496123_0001298 | 3300048926 | Bacteria | 35561 |
| 1276 | Ga0496123_0002167 | 3300048926 | Bacteria | 25064 |
| 1277 | Ga0496124_0010346 | 3300048927 | Bacteria | 9463 |
| 1278 | Ga0496124_0052085 | 3300048927 | Bacteria | 3479 |
| 1279 | Ga0496125_0004774 | 3300048928 | Bacteria | 15434 |
| 1280 | Ga0496125_0027784 | 3300048928 | Bacteria | 5121 |
| 1281 | Ga0496126_0000801 | 3300048929 | Bacteria | 56279 |
| 1282 | Ga0501032_0039527 | 3300049569 | Bacteria | 3208 |
| 1283 | Ga0501032_0063370 | 3300049569 | Bacteria | 2475 |
| 1284 | Ga0501032_0162501 | 3300049569 | Bacteria | 1466 |
| 1285 | Ga0501033_0004204 | 3300049570 | Bacteria | 11589 |
| 1286 | Ga0501033_0024281 | 3300049570 | Bacteria | 4574 |
| 1287 | Ga0501033_0026129 | 3300049570 | Bacteria | 4394 |
| 1288 | Ga0501034_0000436 | 3300049571 | Bacteria | 69142 |
| 1289 | Ga0501034_0005233 | 3300049571 | Bacteria | 14236 |
| 1290 | Ga0501034_0009627 | 3300049571 | Bacteria | 10109 |
| 1291 | Ga0501034_0027067 | 3300049571 | Bacteria | 5834 |
| 1292 | Ga0501034_0099430 | 3300049571 | Bacteria | 2903 |
| 1293 | Ga0501036_0001221 | 3300049572 | Bacteria | 19615 |
| 1294 | Ga0501036_0027487 | 3300049572 | Bacteria | 4806 |
| 1295 | Ga0501036_0044521 | 3300049572 | Bacteria | 3759 |
| 1296 | Ga0501036_0131217 | 3300049572 | Bacteria | 2115 |
| 1297 | Ga0501037_0003949 | 3300049573 | Bacteria | 10757 |
| 1298 | Ga0501038_0028790 | 3300049574 | Bacteria | 4932 |
| 1299 | Ga0501038_0085958 | 3300049574 | Bacteria | 2643 |
| 1300 | Ga0501038_0095777 | 3300049574 | Bacteria | 2479 |
| 1301 | Ga0501039_0033073 | 3300049575 | Bacteria | 3989 |
| 1302 | Ga0501039_0044143 | 3300049575 | Bacteria | 3442 |
| 1303 | Ga0501039_0214251 | 3300049575 | Bacteria | 1514 |
| 1304 | Ga0501040_0108027 | 3300049576 | Bacteria | 1945 |
| 1305 | Ga0501043_0008146 | 3300049579 | Bacteria | 8271 |
| 1306 | Ga0501043_0009282 | 3300049579 | Bacteria | 7730 |
| 1307 | Ga0501043_0034819 | 3300049579 | Bacteria | 3960 |
| 1308 | Ga0501046_0105803 | 3300049580 | Bacteria | 2154 |
| 1309 | Ga0501047_0000223 | 3300049581 | Bacteria | 67658 |
| 1310 | Ga0501047_0000384 | 3300049581 | Bacteria | 49644 |
| 1311 | Ga0501047_0035760 | 3300049581 | Bacteria | 4798 |
| 1312 | Ga0501047_0116121 | 3300049581 | Bacteria | 2558 |
| 1313 | Ga0501047_0146712 | 3300049581 | Bacteria | 2236 |
| 1314 | Ga0501048_0000074 | 3300049582 | Bacteria | 51762 |
| 1315 | Ga0501048_0123057 | 3300049582 | Bacteria | 1833 |
| 1316 | Ga0501067_0011404 | 3300049583 | Bacteria | 4920 |
| 1317 | Ga0501067_0055988 | 3300049583 | Bacteria | 2185 |
| 1318 | Ga0501067_0076510 | 3300049583 | Bacteria | 1854 |
| 1319 | Ga0501068_0032961 | 3300049584 | Bacteria | 3082 |
| 1320 | Ga0501069_0006054 | 3300049585 | Bacteria | 6317 |
| 1321 | Ga0501069_0019134 | 3300049585 | Bacteria | 3699 |
| 1322 | Ga0501070_0008586 | 3300049586 | Bacteria | 8639 |
| 1323 | Ga0501070_0011258 | 3300049586 | Bacteria | 7554 |
| 1324 | Ga0501070_0025736 | 3300049586 | Bacteria | 4936 |
| 1325 | Ga0501070_0032074 | 3300049586 | Bacteria | 4398 |
| 1326 | Ga0501070_0032152 | 3300049586 | Bacteria | 4392 |
| 1327 | Ga0501071_0011938 | 3300049587 | Bacteria | 5869 |
| 1328 | Ga0501071_0071204 | 3300049587 | Bacteria | 2534 |
| 1329 | Ga0501071_0126813 | 3300049587 | Bacteria | 1895 |
| 1330 | Ga0501072_0001326 | 3300049588 | Bacteria | 18567 |
| 1331 | Ga0501074_0012491 | 3300049590 | Bacteria | 6174 |
| 1332 | Ga0501076_0012519 | 3300049592 | Bacteria | 6345 |
| 1333 | Ga0501076_0064957 | 3300049592 | Bacteria | 2909 |
| 1334 | Ga0501076_0091509 | 3300049592 | Bacteria | 2447 |
| 1335 | Ga0501235_011191 | 3300049669 | Bacteria | 1965 |
| 1336 | Ga0501221_006804 | 3300049704 | Bacteria | 1943 |
| 1337 | Ga0501079_0135107 | 3300049741 | Bacteria | 1920 |
| 1338 | Ga0501079_0202160 | 3300049741 | Bacteria | 1552 |
| 1339 | Ga0501080_0001854 | 3300049742 | Bacteria | 18155 |
| 1340 | Ga0501080_0025491 | 3300049742 | Bacteria | 5488 |
| 1341 | Ga0501080_0059932 | 3300049742 | Bacteria | 3542 |
| 1342 | Ga0501081_0053559 | 3300049743 | Bacteria | 2786 |
| 1343 | Ga0501083_0001146 | 3300049744 | Bacteria | 17823 |
| 1344 | Ga0501083_0022266 | 3300049744 | Bacteria | 4397 |
| 1345 | Ga0501083_0043876 | 3300049744 | Bacteria | 3028 |
| 1346 | Ga0501083_0170931 | 3300049744 | Bacteria | 1420 |
| 1347 | Ga0501035_0000371 | 3300049822 | Bacteria | 51668 |
| 1348 | Ga0501035_0007311 | 3300049822 | Bacteria | 10327 |
| 1349 | Ga0501035_0033698 | 3300049822 | Bacteria | 4655 |
| 1350 | Ga0501035_0060863 | 3300049822 | Bacteria | 3361 |
| 1351 | Ga0501035_0253117 | 3300049822 | Bacteria | 1495 |
| 1352 | Ga0501044_0001720 | 3300049823 | Bacteria | 25612 |
| 1353 | Ga0501044_0011870 | 3300049823 | Bacteria | 9439 |
| 1354 | Ga0501044_0124863 | 3300049823 | Bacteria | 2571 |
| 1355 | Ga0501045_0168021 | 3300049824 | Bacteria | 1634 |
| 1356 | nmdc:mga03n38_6277_c1 | 3300050490 | Bacteria | 4117 |
| 1357 | nmdc:mga03n38_92370_c1 | 3300050490 | Bacteria | 1443 |
| 1358 | nmdc:mga0yw44_23578_c1 | 3300050492 | Bacteria | 3470 |
| 1359 | nmdc:mga0yw44_2995_c1 | 3300050492 | Bacteria | 7373 |
| 1360 | nmdc:mga0yw44_63475_c1 | 3300050492 | Bacteria | 2271 |
| 1361 | nmdc:mga06z11_11391_c1 | 3300050494 | Bacteria | 3833 |
| 1362 | nmdc:mga06z11_49590_c1 | 3300050494 | Bacteria | 2143 |
| 1363 | nmdc:mga06z11_60_c1 | 3300050494 | Bacteria | 46715 |
| 1364 | nmdc:mga04h51_39509_c1 | 3300050495 | Bacteria | 1533 |
| 1365 | nmdc:mga04h51_403_c1 | 3300050495 | Bacteria | 10448 |
| 1366 | nmdc:mga07m45_136286_c1 | 3300050496 | Bacteria | 1421 |
| 1367 | nmdc:mga07m45_81046_c1 | 3300050496 | Bacteria | 1853 |
| 1368 | nmdc:mga07m45_8495_c1 | 3300050496 | Bacteria | 5282 |
| 1369 | nmdc:mga05p37_1191_c1 | 3300050507 | Bacteria | 30041 |
| 1370 | nmdc:mga05p37_222_c1 | 3300050507 | Bacteria | 57449 |
| 1371 | nmdc:mga05p37_30060_c1 | 3300050507 | Bacteria | 6630 |
| 1372 | nmdc:mga05p37_71985_c1 | 3300050507 | Bacteria | 4253 |
| 1373 | nmdc:mga05p37_81621_c1 | 3300050507 | Bacteria | 3983 |
| 1374 | nmdc:mga09592_16877_c1 | 3300050508 | Bacteria | 5975 |
| 1375 | nmdc:mga09592_3118_c1 | 3300050508 | Bacteria | 13463 |
| 1376 | nmdc:mga09592_70637_c1 | 3300050508 | Bacteria | 2963 |
| 1377 | nmdc:mga0qj67_141077_c1 | 3300050509 | Bacteria | 1954 |
| 1378 | nmdc:mga0qj67_1677_c1 | 3300050509 | Bacteria | 15599 |
| 1379 | nmdc:mga0qj67_60328_c1 | 3300050509 | Bacteria | 3010 |
| 1380 | nmdc:mga06r32_1077_c1 | 3300050510 | Bacteria | 24523 |
| 1381 | nmdc:mga06r32_284100_c1 | 3300050510 | Bacteria | 1642 |
| 1382 | nmdc:mga08y16_11073_c1 | 3300050511 | Bacteria | 9470 |
| 1383 | nmdc:mga08y16_116433_c1 | 3300050511 | Bacteria | 2782 |
| 1384 | nmdc:mga08y16_121832_c1 | 3300050511 | Bacteria | 2714 |
| 1385 | nmdc:mga08y16_13536_c1 | 3300050511 | Bacteria | 8586 |
| 1386 | nmdc:mga08y16_13718_c1 | 3300050511 | Bacteria | 8532 |
| 1387 | nmdc:mga08y16_57400_c1 | 3300050511 | Bacteria | 4068 |
| 1388 | nmdc:mga08y16_587_c1 | 3300050511 | Bacteria | 33873 |
| 1389 | nmdc:mga0n895_126764_c1 | 3300050512 | Bacteria | 2577 |
| 1390 | nmdc:mga0n895_150771_c1 | 3300050512 | Bacteria | 2355 |
| 1391 | nmdc:mga0n895_200633_c1 | 3300050512 | Bacteria | 2026 |
| 1392 | nmdc:mga0n895_425063_c1 | 3300050512 | Bacteria | 1343 |
| 1393 | nmdc:mga0n895_437_c1 | 3300050512 | Bacteria | 28072 |
| 1394 | nmdc:mga0n895_741_c1 | 3300050512 | Bacteria | 23095 |
| 1395 | nmdc:mga0rr50_185351_c1 | 3300050513 | Bacteria | 1703 |
| 1396 | nmdc:mga0rr50_5627_c1 | 3300050513 | Bacteria | 7503 |
| 1397 | nmdc:mga0rr50_6644_c1 | 3300050513 | Bacteria | 7069 |
| 1398 | nmdc:mga0rr50_88555_c1 | 3300050513 | Bacteria | 2405 |
| 1399 | nmdc:mga08x19_165289_c1 | 3300050514 | Bacteria | 1504 |
| 1400 | nmdc:mga08x19_49275_c1 | 3300050514 | Bacteria | 2701 |
| 1401 | nmdc:mga0a205_158439_c1 | 3300050515 | Bacteria | 2161 |
| 1402 | nmdc:mga0a205_3283_c1 | 3300050515 | Bacteria | 14388 |
| 1403 | nmdc:mga0a205_40207_c1 | 3300050515 | Bacteria | 4501 |
| 1404 | nmdc:mga0a205_43507_c1 | 3300050515 | Bacteria | 4330 |
| 1405 | nmdc:mga0a205_6511_c1 | 3300050515 | Bacteria | 10559 |
| 1406 | nmdc:mga0a205_802_c1 | 3300050515 | Bacteria | 25500 |
| 1407 | nmdc:mga0sz30_19123_c1 | 3300050516 | Bacteria | 2749 |
| 1408 | Ga0495601_0000441 | 3300053077 | Bacteria | 21726 |
| 1409 | Ga0495601_0001951 | 3300053077 | Bacteria | 11535 |
| 1410 | Ga0495601_0006078 | 3300053077 | Bacteria | 7043 |
| 1411 | Ga0495601_0020031 | 3300053077 | Bacteria | 4082 |
| 1412 | Ga0495601_0042861 | 3300053077 | Bacteria | 2841 |
| 1413 | Ga0495612_0006563 | 3300053078 | Bacteria | 4774 |
| 1414 | Ga0495612_0019001 | 3300053078 | Bacteria | 2750 |
| 1415 | Ga0495612_0048622 | 3300053078 | Bacteria | 1739 |
| 1416 | Ga0495595_0000551 | 3300053084 | Bacteria | 14288 |
| 1417 | Ga0495595_0002072 | 3300053084 | Bacteria | 7796 |
| 1418 | Ga0495595_0003250 | 3300053084 | Bacteria | 6456 |
| 1419 | Ga0495595_0008006 | 3300053084 | Bacteria | 4328 |
| 1420 | Ga0495595_0110045 | 3300053084 | Bacteria | 1335 |
| 1421 | Ga0495619_0000063 | 3300053085 | Bacteria | 84834 |
| 1422 | Ga0495619_0000170 | 3300053085 | Bacteria | 47706 |
| 1423 | Ga0495619_0001482 | 3300053085 | Bacteria | 15480 |
| 1424 | Ga0495619_0011350 | 3300053085 | Bacteria | 5609 |
| 1425 | Ga0495619_0022077 | 3300053085 | Bacteria | 4068 |
| 1426 | Ga0495619_0022235 | 3300053085 | Bacteria | 4056 |
| 1427 | Ga0500644_0000715 | 3300053088 | Bacteria | 11751 |
| 1428 | Ga0500651_0004383 | 3300053093 | Bacteria | 7888 |
| 1429 | Ga0500641_0017324 | 3300053096 | Bacteria | 2693 |
| 1430 | Ga0500556_0000160 | 3300053104 | Bacteria | 55309 |
| 1431 | Ga0500593_000044 | 3300053117 | Bacteria | 45032 |
| 1432 | Ga0500593_007593 | 3300053117 | Bacteria | 4424 |
| 1433 | Ga0500594_0036322 | 3300053118 | Bacteria | 1326 |
| 1434 | Ga0500595_000085 | 3300053119 | Bacteria | 65800 |
| 1435 | Ga0500652_000056 | 3300053131 | Bacteria | 51871 |
| 1436 | Ga0500652_005144 | 3300053131 | Bacteria | 4095 |
| 1437 | Ga0500568_0000004 | 3300053139 | Bacteria | 621666 |
| 1438 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1439 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 1440 | Ga0500624_000072 | 3300053157 | Bacteria | 57950 |
| 1441 | Ga0500636_0029690 | 3300053177 | Bacteria | 3231 |
| 1442 | Ga0500645_004638 | 3300053730 | Bacteria | 5232 |
| 1443 | Ga0500645_006791 | 3300053730 | Bacteria | 4047 |
| 1444 | Ga0501084_0128391 | 3300054114 | Bacteria | 2134 |
| 1445 | Ga0501082_0001551 | 3300060353 | Bacteria | 20235 |
| 1446 | Ga0501082_0060009 | 3300060353 | Bacteria | 3277 |
| 1447 | Ga0501082_0083169 | 3300060353 | Bacteria | 2762 |
| 1448 | Ga0501082_0127916 | 3300060353 | Bacteria | 2203 |
| 1449 | 2512645674 | 2512564014 | Bacteria | 4639632 |
| 1450 | 2513590353 | 2513237087 | Bacteria | 5817514 |
| 1451 | 2643758965 | 2643221547 | Bacteria | 4740017 |
| 1452 | 2644290723 | 2643221651 | Bacteria | 4798932 |
| 1453 | 2723849349 | 2721755755 | Bacteria | 8322773 |
| 1454 | 2809063054 | 2808606401 | Bacteria | 4586670 |
| 1455 | 2809079018 | 2808606404 | Bacteria | 4652788 |
| 1456 | 2809083607 | 2808606405 | Bacteria | 4586632 |
| 1457 | 2819552788 | 2818991438 | Bacteria | 5793701 |
| 1458 | 2880520309 | 2880518877 | Bacteria | 5012590 |
| 1459 | 2885427367 | 2885427238 | Bacteria | 2291351 |
| 1460 | 2919452146 | 2919450847 | Bacteria | 5631160 |
| 1461 | 2919709844 | 2919709256 | Bacteria | 4318106 |
| 1462 | 2922364341 | 2922361189 | Bacteria | 7436256 |
| 1463 | 8001845825 | 8001845381 | Bacteria | 5804942 |
| 1464 | 8054306822 | 8054302542 | Bacteria | 5698134 |
| 1465 | Ga0105250_10013627 | |||
| 1466 | 2214745200 | |||
| 1467 | ARcpr5oldR_c000003 | |||
| 1468 | ARSoilYngRDRAFT_c00037 | |||
| 1469 | ARcpr5yngRDRAFT_c000010 | |||
| 1470 | ARSoilOldRDRAFT_c000045 | |||
| 1471 | ARCol0yngRDRAFT_1000086 | |||
| 1472 | JGI24741J21665_1005824 | |||
| 1473 | JGI24741J21665_1006916 | |||
| 1474 | JGI24746J21847_1000225 | |||
| 1475 | JGI24740J21852_10018132 | |||
| 1476 | JGI24740J21852_10032414 | |||
| 1477 | JGI24739J22299_10000887 | |||
| 1478 | JGI24739J22299_10002234 | |||
| 1479 | JGI24739J22299_10007003 | |||
| 1480 | JGI24737J22298_10000286 | |||
| 1481 | JGI24737J22298_10018510 | |||
| 1482 | JGI24737J22298_10023419 | |||
| 1483 | JGI24743J22301_10001925 | |||
| 1484 | JGI24743J22301_10004783 | |||
| 1485 | JGI24735J21928_10001811 | |||
| 1486 | JGI24735J21928_10002726 | |||
| 1487 | JGI24750J21931_1000044 | |||
| 1488 | JGI24750J21931_1001976 | |||
| 1489 | JGI24748J21848_1003070 | |||
| 1490 | JGI24738J21930_10000666 | |||
| 1491 | JGI24738J21930_10003659 | |||
| 1492 | JGI24749J21850_1002556 | |||
| 1493 | JGI24744J21845_10001499 | |||
| 1494 | JGI24744J21845_10008784 | |||
| 1495 | JGI24035J26624_1000205 | |||
| 1496 | JGI24034J26672_10000348 | |||
| 1497 | JGI24742J22300_10000091 | |||
| 1498 | JGI24751J29686_10009779 | |||
| 1499 | JGI25406J46586_10033627 | |||
| 1500 | JGI25404J52841_10005123 | |||
| 1501 | Ga0055530_10006443 | |||
| 1502 | Ga0065716_1001671 | |||
| 1503 | Ga0065712_10001083 | |||
| 1504 | Ga0065712_10016249 | |||
| 1505 | Ga0065712_10081197 | |||
| 1506 | Ga0065715_10089726 | |||
| 1507 | Ga0070658_10000264 | |||
| 1508 | Ga0070658_10002220 | |||
| 1509 | Ga0070658_10008993 | |||
| 1510 | Ga0070658_10010453 | |||
| 1511 | Ga0070658_10022506 | |||
| 1512 | Ga0070658_10049510 | |||
| 1513 | Ga0070658_10124174 | |||
| 1514 | Ga0070658_10126593 | |||
| 1515 | Ga0070676_10000186 | |||
| 1516 | Ga0070676_10025905 | |||
| 1517 | Ga0070676_10102088 | |||
| 1518 | Ga0070683_100000064 | |||
| 1519 | Ga0070683_100037722 | |||
| 1520 | Ga0070683_100096585 | |||
| 1521 | Ga0070683_100231247 | |||
| 1522 | Ga0070690_100055973 | |||
| 1523 | Ga0070690_100078858 | |||
| 1524 | Ga0070670_100002541 | |||
| 1525 | Ga0070670_100006533 | |||
| 1526 | Ga0070670_100007186 | |||
| 1527 | Ga0070670_100011611 | |||
| 1528 | Ga0070670_100024387 | |||
| 1529 | Ga0070670_100036861 | |||
| 1530 | Ga0070670_100062640 | |||
| 1531 | Ga0070670_100187930 | |||
| 1532 | Ga0070677_10000050 | |||
| 1533 | Ga0070677_10027622 | |||
| 1534 | Ga0068869_100000191 | |||
| 1535 | Ga0068869_100027748 | |||
| 1536 | Ga0068869_100149583 | |||
| 1537 | Ga0070666_10022428 | |||
| 1538 | Ga0070666_10056441 | |||
| 1539 | Ga0070666_10059573 | |||
| 1540 | Ga0070680_100007728 | |||
| 1541 | Ga0070680_100066516 | |||
| 1542 | Ga0070680_100142711 | |||
| 1543 | Ga0070680_100196106 | |||
| 1544 | Ga0070682_100001714 | |||
| 1545 | Ga0070682_100035477 | |||
| 1546 | Ga0070682_100069856 | |||
| 1547 | Ga0070682_100096978 | |||
| 1548 | Ga0068868_100000233 | |||
| 1549 | Ga0068868_100032246 | |||
| 1550 | Ga0070660_100000091 | |||
| 1551 | Ga0070660_100004304 | |||
| 1552 | Ga0070660_100005461 | |||
| 1553 | Ga0070660_100064748 | |||
| 1554 | Ga0070660_100117995 | |||
| 1555 | Ga0070660_100119041 | |||
| 1556 | Ga0070660_100165159 | |||
| 1557 | Ga0070689_100006518 | |||
| 1558 | Ga0070689_100113223 | |||
| 1559 | Ga0070691_10006662 | |||
| 1560 | Ga0070691_10022854 | |||
| 1561 | Ga0070691_10037130 | |||
| 1562 | Ga0070687_100000337 | |||
| 1563 | Ga0070687_100010015 | |||
| 1564 | Ga0070687_100050606 | |||
| 1565 | Ga0070687_100134806 | |||
| 1566 | Ga0070661_100000188 | |||
| 1567 | Ga0070661_100006306 | |||
| 1568 | Ga0070661_100018063 | |||
| 1569 | Ga0070661_100057653 | |||
| 1570 | Ga0070661_100085828 | |||
| 1571 | Ga0070661_100087437 | |||
| 1572 | Ga0070661_100160492 | |||
| 1573 | Ga0070692_10050483 | |||
| 1574 | Ga0070692_10056796 | |||
| 1575 | Ga0070692_10069571 | |||
| 1576 | Ga0070668_100000409 | |||
| 1577 | Ga0070669_100000523 | |||
| 1578 | Ga0070669_100062266 | |||
| 1579 | Ga0070675_100000034 | |||
| 1580 | Ga0070675_100002418 | |||
| 1581 | Ga0070675_100016370 | |||
| 1582 | Ga0070675_100092638 | |||
| 1583 | Ga0070671_100000111 | |||
| 1584 | Ga0070671_100001584 | |||
| 1585 | Ga0070671_100010789 | |||
| 1586 | Ga0070671_100011792 | |||
| 1587 | Ga0070671_100018174 | |||
| 1588 | Ga0070671_100019157 | |||
| 1589 | Ga0070671_100045533 | |||
| 1590 | Ga0070671_100083737 | |||
| 1591 | Ga0070671_100116863 | |||
| 1592 | Ga0070674_100003026 | |||
| 1593 | Ga0070674_100035850 | |||
| 1594 | Ga0070674_100063764 | |||
| 1595 | Ga0070673_100001357 | |||
| 1596 | Ga0070673_100008515 | |||
| 1597 | Ga0070673_100153387 | |||
| 1598 | Ga0070673_100169148 | |||
| 1599 | Ga0070688_100000401 | |||
| 1600 | Ga0070688_100052107 | |||
| 1601 | Ga0070688_100054570 | |||
| 1602 | Ga0070688_100071567 | |||
| 1603 | Ga0070659_100002194 | |||
| 1604 | Ga0070659_100005493 | |||
| 1605 | Ga0070659_100114249 | |||
| 1606 | Ga0070659_100117346 | |||
| 1607 | Ga0070659_100132646 | |||
| 1608 | Ga0070659_100139737 | |||
| 1609 | Ga0070659_100187150 | |||
| 1610 | Ga0070659_100192052 | |||
| 1611 | Ga0070659_100263079 | |||
| 1612 | Ga0070667_100005633 | |||
| 1613 | Ga0070667_100010235 | |||
| 1614 | Ga0070667_100015164 | |||
| 1615 | Ga0070667_100016010 | |||
| 1616 | Ga0070667_100058925 | |||
| 1617 | Ga0070667_100186025 | |||
| 1618 | Ga0070667_100253537 | |||
| 1619 | Ga0070709_10028699 | |||
| 1620 | Ga0070709_10035379 | |||
| 1621 | Ga0070714_100011938 | |||
| 1622 | Ga0070714_100022892 | |||
| 1623 | Ga0070714_100050119 | |||
| 1624 | Ga0070714_100087174 | |||
| 1625 | Ga0070714_100238776 | |||
| 1626 | Ga0070713_100007751 | |||
| 1627 | Ga0070713_100010936 | |||
| 1628 | Ga0070713_100063116 | |||
| 1629 | Ga0070713_100067951 | |||
| 1630 | Ga0070710_10008568 | |||
| 1631 | Ga0070710_10010806 | |||
| 1632 | Ga0070710_10021500 | |||
| 1633 | Ga0070710_10022840 | |||
| 1634 | Ga0070701_10000524 | |||
| 1635 | Ga0070701_10019632 | |||
| 1636 | Ga0070711_100011116 | |||
| 1637 | Ga0070711_100015201 | |||
| 1638 | Ga0070711_100023573 | |||
| 1639 | Ga0070705_100000252 | |||
| 1640 | Ga0070700_100000657 | |||
| 1641 | Ga0070700_100006474 | |||
| 1642 | Ga0070694_100021318 | |||
| 1643 | Ga0070694_100089908 | |||
| 1644 | Ga0070708_100112727 | |||
| 1645 | Ga0070663_100004855 | |||
| 1646 | Ga0070663_100015911 | |||
| 1647 | Ga0070663_100028662 | |||
| 1648 | Ga0070663_100085590 | |||
| 1649 | Ga0070663_100121253 | |||
| 1650 | Ga0070663_100131583 | |||
| 1651 | Ga0070663_100191807 | |||
| 1652 | Ga0070678_100001414 | |||
| 1653 | Ga0070678_100010734 | |||
| 1654 | Ga0070678_100011766 | |||
| 1655 | Ga0070662_100001002 | |||
| 1656 | Ga0070662_100017420 | |||
| 1657 | Ga0070662_100064810 | |||
| 1658 | Ga0070662_100069580 | |||
| 1659 | Ga0070662_100076669 | |||
| 1660 | Ga0070681_10047969 | |||
| 1661 | Ga0070681_10052703 | |||
| 1662 | Ga0070681_10071322 | |||
| 1663 | Ga0070681_10072311 | |||
| 1664 | Ga0070681_10082351 | |||
| 1665 | Ga0070681_10123273 | |||
| 1666 | Ga0068867_100001011 | |||
| 1667 | Ga0068867_100083074 | |||
| 1668 | Ga0070685_10002699 | |||
| 1669 | Ga0070685_10065248 | |||
| 1670 | Ga0070707_100043599 | |||
| 1671 | Ga0070699_100014320 | |||
| 1672 | Ga0070679_100004731 | |||
| 1673 | Ga0070679_100016615 | |||
| 1674 | Ga0070679_100034565 | |||
| 1675 | Ga0070679_100036926 | |||
| 1676 | Ga0070679_100150520 | |||
| 1677 | Ga0070679_100261883 | |||
| 1678 | Ga0070684_100000275 | |||
| 1679 | Ga0070684_100031635 | |||
| 1680 | Ga0070684_100061891 | |||
| 1681 | Ga0070684_100123682 | |||
| 1682 | Ga0070684_100134572 | |||
| 1683 | Ga0070697_100137122 | |||
| 1684 | Ga0068853_100002273 | |||
| 1685 | Ga0068853_100017670 | |||
| 1686 | Ga0068853_100083372 | |||
| 1687 | Ga0068853_100160014 | |||
| 1688 | Ga0068853_100251885 | |||
| 1689 | Ga0070672_100000008 | |||
| 1690 | Ga0070672_100013010 | |||
| 1691 | Ga0070672_100027974 | |||
| 1692 | Ga0070672_100028466 | |||
| 1693 | Ga0070672_100094811 | |||
| 1694 | Ga0070686_100062116 | |||
| 1695 | Ga0070686_100080097 | |||
| 1696 | Ga0070695_100063612 | |||
| 1697 | Ga0070696_100017449 | |||
| 1698 | Ga0070696_100056926 | |||
| 1699 | Ga0070696_100070532 | |||
| 1700 | Ga0070696_100250150 | |||
| 1701 | Ga0070693_100007754 | |||
| 1702 | Ga0070693_100008375 | |||
| 1703 | Ga0070665_100043426 | |||
| 1704 | Ga0070704_100001016 | |||
| 1705 | Ga0070704_100091417 | |||
| 1706 | Ga0068855_100000129 | |||
| 1707 | Ga0068855_100007455 | |||
| 1708 | Ga0068855_100033428 | |||
| 1709 | Ga0068855_100034657 | |||
| 1710 | Ga0068855_100055594 | |||
| 1711 | Ga0068855_100058535 | |||
| 1712 | Ga0068855_100187219 | |||
| 1713 | Ga0068855_100217650 | |||
| 1714 | Ga0070664_100000419 | |||
| 1715 | Ga0070664_100005421 | |||
| 1716 | Ga0070664_100017741 | |||
| 1717 | Ga0070664_100036462 | |||
| 1718 | Ga0070664_100048170 | |||
| 1719 | Ga0070664_100232242 | |||
| 1720 | Ga0068857_100002666 | |||
| 1721 | Ga0068857_100009744 | |||
| 1722 | Ga0068857_100012690 | |||
| 1723 | Ga0068857_100244218 | |||
| 1724 | Ga0068854_100001824 | |||
| 1725 | Ga0068854_100037514 | |||
| 1726 | Ga0068856_100000963 | |||
| 1727 | Ga0070702_100003016 | |||
| 1728 | Ga0070702_100008357 | |||
| 1729 | Ga0068852_100001994 | |||
| 1730 | Ga0068852_100015664 | |||
| 1731 | Ga0068852_100039158 | |||
| 1732 | Ga0068852_100044588 | |||
| 1733 | Ga0068852_100090988 | |||
| 1734 | Ga0068852_100179374 | |||
| 1735 | Ga0068859_100000088 | |||
| 1736 | Ga0068859_100107572 | |||
| 1737 | Ga0068859_100132405 | |||
| 1738 | Ga0068859_100209476 | |||
| 1739 | Ga0068859_100311275 | |||
| 1740 | Ga0068859_100397254 | |||
| 1741 | Ga0068864_100000136 | |||
| 1742 | Ga0068864_100001346 | |||
| 1743 | Ga0068864_100003805 | |||
| 1744 | Ga0068864_100019015 | |||
| 1745 | Ga0068866_10000291 | |||
| 1746 | Ga0068861_100001924 | |||
| 1747 | Ga0068861_100116771 | |||
| 1748 | Ga0068851_10049564 | |||
| 1749 | Ga0068870_10000005 | |||
| 1750 | Ga0068863_100000384 | |||
| 1751 | Ga0068863_100000608 | |||
| 1752 | Ga0068863_100024134 | |||
| 1753 | Ga0068863_100074646 | |||
| 1754 | Ga0068863_100107829 | |||
| 1755 | Ga0068863_100271166 | |||
| 1756 | Ga0068858_100000063 | |||
| 1757 | Ga0068858_100011061 | |||
| 1758 | Ga0068858_100021963 | |||
| 1759 | Ga0068858_100026552 | |||
| 1760 | Ga0068858_100149146 | |||
| 1761 | Ga0068858_100244735 | |||
| 1762 | Ga0068860_100001183 | |||
| 1763 | Ga0068860_100022772 | |||
| 1764 | Ga0068860_100034044 | |||
| 1765 | Ga0068860_100067885 | |||
| 1766 | Ga0068860_100079433 | |||
| 1767 | Ga0068860_100080163 | |||
| 1768 | Ga0068860_100113496 | |||
| 1769 | Ga0068860_100198147 | |||
| 1770 | Ga0068860_100237878 | |||
| 1771 | Ga0068862_100007190 | |||
| 1772 | Ga0068862_100010432 | |||
| 1773 | Ga0068862_100011427 | |||
| 1774 | Ga0068862_100017057 | |||
| 1775 | Ga0068862_100024857 | |||
| 1776 | Ga0068862_100079551 | |||
| 1777 | Ga0081455_10000002 | |||
| 1778 | Ga0081455_10000329 | |||
| 1779 | Ga0081455_10015834 | |||
| 1780 | Ga0081538_10002523 | |||
| 1781 | Ga0081538_10021900 | |||
| 1782 | Ga0081540_1001201 | |||
| 1783 | Ga0081540_1009095 | |||
| 1784 | Ga0081540_1010246 | |||
| 1785 | Ga0081539_10000522 | |||
| 1786 | Ga0070717_10001785 | |||
| 1787 | Ga0075365_10013799 | |||
| 1788 | Ga0075365_10024810 | |||
| 1789 | Ga0075368_10000129 | |||
| 1790 | Ga0075363_100002771 | |||
| 1791 | Ga0075363_100004616 | |||
| 1792 | Ga0075432_10013821 | |||
| 1793 | Ga0070715_10005920 | |||
| 1794 | Ga0070715_10009052 | |||
| 1795 | Ga0070715_10025330 | |||
| 1796 | Ga0070716_100000730 | |||
| 1797 | Ga0070716_100012351 | |||
| 1798 | Ga0070716_100044410 | |||
| 1799 | Ga0070712_100000963 | |||
| 1800 | Ga0070712_100041974 | |||
| 1801 | Ga0070712_100048764 | |||
| 1802 | Ga0070712_100153292 | |||
| 1803 | Ga0075362_10013349 | |||
| 1804 | Ga0075367_10002669 | |||
| 1805 | Ga0075367_10014764 | |||
| 1806 | Ga0075427_10000026 | |||
| 1807 | Ga0075366_10089288 | |||
| 1808 | Ga0097621_100000006 | |||
| 1809 | Ga0097621_100008279 | |||
| 1810 | Ga0097621_100182116 | |||
| 1811 | Ga0068871_100000022 | |||
| 1812 | Ga0068871_100030110 | |||
| 1813 | Ga0068871_100200826 | |||
| 1814 | Ga0075428_100003527 | |||
| 1815 | Ga0075428_100009313 | |||
| 1816 | Ga0075428_100055661 | |||
| 1817 | Ga0075430_100001061 | |||
| 1818 | Ga0075430_100005415 | |||
| 1819 | Ga0075430_100034066 | |||
| 1820 | Ga0075430_100069113 | |||
| 1821 | Ga0075431_100000856 | |||
| 1822 | Ga0075431_100035384 | |||
| 1823 | Ga0075433_10003278 | |||
| 1824 | Ga0075433_10028588 | |||
| 1825 | Ga0075434_100000346 | |||
| 1826 | Ga0075434_100017393 | |||
| 1827 | Ga0075434_100035969 | |||
| 1828 | Ga0075434_100171152 | |||
| 1829 | Ga0075429_100001137 | |||
| 1830 | Ga0075429_100007463 | |||
| 1831 | Ga0075429_100022293 | |||
| 1832 | Ga0068865_100000196 | |||
| 1833 | Ga0068865_100133796 | |||
| 1834 | Ga0097620_100000088 | |||
| 1835 | Ga0097620_100107561 | |||
| 1836 | Ga0097620_100132405 | |||
| 1837 | Ga0097620_100209474 | |||
| 1838 | Ga0097620_100311247 | |||
| 1839 | Ga0097620_100397247 | |||
| 1840 | Ga0075435_100003799 | |||
| 1841 | Ga0075435_100019065 | |||
| 1842 | Ga0075435_100038442 | |||
| 1843 | Ga0099795_10033014 | |||
| 1844 | Ga0099795_10048007 | |||
| 1845 | Ga0105251_10034057 | |||
| 1846 | Ga0105240_10021899 | |||
| 1847 | Ga0105240_10068944 | |||
| 1848 | Ga0105240_10190806 | |||
| 1849 | Ga0105240_10380728 | |||
| 1850 | Ga0111539_10000817 | |||
| 1851 | Ga0111539_10001765 | |||
| 1852 | Ga0111539_10001792 | |||
| 1853 | Ga0111539_10016539 | |||
| 1854 | Ga0111539_10289486 | |||
| 1855 | Ga0105245_10006255 | |||
| 1856 | Ga0105245_10051976 | |||
| 1857 | Ga0105245_10053755 | |||
| 1858 | Ga0105245_10160885 | |||
| 1859 | Ga0105247_10004177 | |||
| 1860 | Ga0105247_10014764 | |||
| 1861 | Ga0105247_10113196 | |||
| 1862 | Ga0114129_10001060 | |||
| 1863 | Ga0114129_10003956 | |||
| 1864 | Ga0114129_10021909 | |||
| 1865 | Ga0114129_10024577 | |||
| 1866 | Ga0105243_10003212 | |||
| 1867 | Ga0105241_10002185 | |||
| 1868 | Ga0105241_10022254 | |||
| 1869 | Ga0105241_10044485 | |||
| 1870 | Ga0105242_10002746 | |||
| 1871 | Ga0105242_10023628 | |||
| 1872 | Ga0105248_10000169 | |||
| 1873 | Ga0105248_10005067 | |||
| 1874 | Ga0105248_10006401 | |||
| 1875 | Ga0105248_10020884 | |||
| 1876 | Ga0105248_10021626 | |||
| 1877 | Ga0105248_10214425 | |||
| 1878 | Ga0105237_10085695 | |||
| 1879 | Ga0105237_10096569 | |||
| 1880 | Ga0105238_10004728 | |||
| 1881 | Ga0105238_10038260 | |||
| 1882 | Ga0105249_10003096 | |||
| 1883 | Ga0105249_10039603 | |||
| 1884 | Ga0105249_10139808 | |||
| 1885 | Ga0105239_10001436 | |||
| 1886 | Ga0105239_10021456 | |||
| 1887 | Ga0105239_10025721 | |||
| 1888 | Ga0105239_10079131 | |||
| 1889 | Ga0105246_10001322 | |||
| 1890 | Ga0105246_10056113 | |||
| 1891 | Ga0105246_10122645 | |||
| 1892 | Ga0157373_10014713 | |||
| 1893 | Ga0157373_10062685 | |||
| 1894 | Ga0157371_10005808 | |||
| 1895 | Ga0157371_10011416 | |||
| 1896 | Ga0157371_10031596 | |||
| 1897 | Ga0157371_10035537 | |||
| 1898 | Ga0157371_10036397 | |||
| 1899 | Ga0157371_10123912 | |||
| 1900 | Ga0157371_10202790 | |||
| 1901 | Ga0157371_10211537 | |||
| 1902 | Ga0157370_10021346 | |||
| 1903 | Ga0157370_10040486 | |||
| 1904 | Ga0157369_10042326 | |||
| 1905 | Ga0157369_10088883 | |||
| 1906 | Ga0157374_10023096 | |||
| 1907 | Ga0157374_10059192 | |||
| 1908 | Ga0157378_10004038 | |||
| 1909 | Ga0157378_10050000 | |||
| 1910 | Ga0163162_10002546 | |||
| 1911 | Ga0163162_10039471 | |||
| 1912 | Ga0163162_10041821 | |||
| 1913 | Ga0163162_10370488 | |||
| 1914 | Ga0157372_10029143 | |||
| 1915 | Ga0157372_10066996 | |||
| 1916 | Ga0157372_10068034 | |||
| 1917 | Ga0157372_10243052 | |||
| 1918 | Ga0157372_10336092 | |||
| 1919 | Ga0157375_10056614 | |||
| 1920 | Ga0157375_10161948 | |||
| 1921 | Ga0163163_10000170 | |||
| 1922 | Ga0163163_10001683 | |||
| 1923 | Ga0163163_10066801 | |||
| 1924 | Ga0163163_10122875 | |||
| 1925 | Ga0163163_10188748 | |||
| 1926 | Ga0157380_10067347 | |||
| 1927 | Ga0157377_10000127 | |||
| 1928 | Ga0157379_10008840 | |||
| 1929 | Ga0157379_10008961 | |||
| 1930 | Ga0157379_10013169 | |||
| 1931 | Ga0157379_10054179 | |||
| 1932 | Ga0157376_10000126 | |||
| 1933 | Ga0157376_10011024 | |||
| 1934 | Ga0163161_10000562 | |||
| 1935 | Ga0163161_10049148 | |||
| 1936 | Ga0213874_10001300 | |||
| 1937 | Ga0213876_10054320 | |||
| 1938 | Ga0228598_1000321 | |||
| 1939 | Ga0207666_1002396 | |||
| 1940 | Ga0207673_1000208 | |||
| 1941 | Ga0209050_1000262 | |||
| 1942 | Ga0207697_10029097 | |||
| 1943 | Ga0207653_10009245 | |||
| 1944 | Ga0207682_10000001 | |||
| 1945 | Ga0207682_10001899 | |||
| 1946 | Ga0207692_10034318 | |||
| 1947 | Ga0207692_10041374 | |||
| 1948 | Ga0207642_10001429 | |||
| 1949 | Ga0207710_10000895 | |||
| 1950 | Ga0207710_10005202 | |||
| 1951 | Ga0207688_10001997 | |||
| 1952 | Ga0207688_10008183 | |||
| 1953 | Ga0207688_10053713 | |||
| 1954 | Ga0207680_10007725 | |||
| 1955 | Ga0207647_10000627 | |||
| 1956 | Ga0207647_10002335 | |||
| 1957 | Ga0207647_10004040 | |||
| 1958 | Ga0207647_10006288 | |||
| 1959 | Ga0207647_10097072 | |||
| 1960 | Ga0207647_10120962 | |||
| 1961 | Ga0207699_10044303 | |||
| 1962 | Ga0207699_10045606 | |||
| 1963 | Ga0207645_10000276 | |||
| 1964 | Ga0207645_10005447 | |||
| 1965 | Ga0207645_10020893 | |||
| 1966 | Ga0207643_10000041 | |||
| 1967 | Ga0207643_10000613 | |||
| 1968 | Ga0207643_10117178 | |||
| 1969 | Ga0207705_10000091 | |||
| 1970 | Ga0207705_10009087 | |||
| 1971 | Ga0207705_10018644 | |||
| 1972 | Ga0207705_10029024 | |||
| 1973 | Ga0207705_10035312 | |||
| 1974 | Ga0207705_10037339 | |||
| 1975 | Ga0207705_10044392 | |||
| 1976 | Ga0207705_10049030 | |||
| 1977 | Ga0207705_10069088 | |||
| 1978 | Ga0207654_10003566 | |||
| 1979 | Ga0207654_10028711 | |||
| 1980 | Ga0207707_10005534 | |||
| 1981 | Ga0207707_10017298 | |||
| 1982 | Ga0207707_10041404 | |||
| 1983 | Ga0207707_10059659 | |||
| 1984 | Ga0207707_10185051 | |||
| 1985 | Ga0207707_10205317 | |||
| 1986 | Ga0207695_10043579 | |||
| 1987 | Ga0207671_10013164 | |||
| 1988 | Ga0207671_10054159 | |||
| 1989 | Ga0207693_10004802 | |||
| 1990 | Ga0207693_10005773 | |||
| 1991 | Ga0207693_10012871 | |||
| 1992 | Ga0207693_10052850 | |||
| 1993 | Ga0207693_10054500 | |||
| 1994 | Ga0207693_10093817 | |||
| 1995 | Ga0207663_10004685 | |||
| 1996 | Ga0207663_10018835 | |||
| 1997 | Ga0207663_10036004 | |||
| 1998 | Ga0207660_10000006 | |||
| 1999 | Ga0207660_10000864 | |||
| 2000 | Ga0207660_10006249 | |||
| 2001 | Ga0207660_10043755 | |||
| 2002 | Ga0207660_10237190 | |||
| 2003 | Ga0207662_10000207 | |||
| 2004 | Ga0207662_10003504 | |||
| 2005 | Ga0207662_10011850 | |||
| 2006 | Ga0207662_10024769 | |||
| 2007 | Ga0207662_10110690 | |||
| 2008 | Ga0207657_10000092 | |||
| 2009 | Ga0207657_10000252 | |||
| 2010 | Ga0207657_10001742 | |||
| 2011 | Ga0207657_10002395 | |||
| 2012 | Ga0207657_10004547 | |||
| 2013 | Ga0207657_10004799 | |||
| 2014 | Ga0207657_10015568 | |||
| 2015 | Ga0207657_10018720 | |||
| 2016 | Ga0207657_10019350 | |||
| 2017 | Ga0207657_10019526 | |||
| 2018 | Ga0207657_10019679 | |||
| 2019 | Ga0207657_10024115 | |||
| 2020 | Ga0207657_10040408 | |||
| 2021 | Ga0207657_10054523 | |||
| 2022 | Ga0207657_10164423 | |||
| 2023 | Ga0207649_10000049 | |||
| 2024 | Ga0207649_10114529 | |||
| 2025 | Ga0207652_10000300 | |||
| 2026 | Ga0207652_10015009 | |||
| 2027 | Ga0207652_10017153 | |||
| 2028 | Ga0207652_10070600 | |||
| 2029 | Ga0207652_10085936 | |||
| 2030 | Ga0207652_10114203 | |||
| 2031 | Ga0207681_10000024 | |||
| 2032 | Ga0207681_10018745 | |||
| 2033 | Ga0207694_10001718 | |||
| 2034 | Ga0207694_10007596 | |||
| 2035 | Ga0207650_10000990 | |||
| 2036 | Ga0207650_10005202 | |||
| 2037 | Ga0207650_10007269 | |||
| 2038 | Ga0207650_10019900 | |||
| 2039 | Ga0207650_10044215 | |||
| 2040 | Ga0207659_10000042 | |||
| 2041 | Ga0207659_10000885 | |||
| 2042 | Ga0207659_10024411 | |||
| 2043 | Ga0207659_10033789 | |||
| 2044 | Ga0207659_10245158 | |||
| 2045 | Ga0207687_10003253 | |||
| 2046 | Ga0207687_10124486 | |||
| 2047 | Ga0207700_10001840 | |||
| 2048 | Ga0207700_10142645 | |||
| 2049 | Ga0207664_10035347 | |||
| 2050 | Ga0207664_10042440 | |||
| 2051 | Ga0207664_10051499 | |||
| 2052 | Ga0207664_10171022 | |||
| 2053 | Ga0207644_10000041 | |||
| 2054 | Ga0207644_10001327 | |||
| 2055 | Ga0207644_10005264 | |||
| 2056 | Ga0207644_10015084 | |||
| 2057 | Ga0207644_10048211 | |||
| 2058 | Ga0207644_10057501 | |||
| 2059 | Ga0207644_10120300 | |||
| 2060 | Ga0207690_10000137 | |||
| 2061 | Ga0207690_10000709 | |||
| 2062 | Ga0207690_10002665 | |||
| 2063 | Ga0207690_10015489 | |||
| 2064 | Ga0207690_10031479 | |||
| 2065 | Ga0207690_10042617 | |||
| 2066 | Ga0207690_10054048 | |||
| 2067 | Ga0207690_10136594 | |||
| 2068 | Ga0207690_10148699 | |||
| 2069 | Ga0207706_10000568 | |||
| 2070 | Ga0207706_10000746 | |||
| 2071 | Ga0207706_10004407 | |||
| 2072 | Ga0207706_10010385 | |||
| 2073 | Ga0207706_10011126 | |||
| 2074 | Ga0207706_10015457 | |||
| 2075 | Ga0207706_10024460 | |||
| 2076 | Ga0207706_10027262 | |||
| 2077 | Ga0207706_10065107 | |||
| 2078 | Ga0207706_10131449 | |||
| 2079 | Ga0207706_10281828 | |||
| 2080 | Ga0207686_10000571 | |||
| 2081 | Ga0207686_10056004 | |||
| 2082 | Ga0207709_10000220 | |||
| 2083 | Ga0207709_10010336 | |||
| 2084 | Ga0207709_10089212 | |||
| 2085 | Ga0207709_10201888 | |||
| 2086 | Ga0207670_10000323 | |||
| 2087 | Ga0207669_10000005 | |||
| 2088 | Ga0207669_10004706 | |||
| 2089 | Ga0207669_10007517 | |||
| 2090 | Ga0207669_10008276 | |||
| 2091 | Ga0207704_10000060 | |||
| 2092 | Ga0207665_10000117 | |||
| 2093 | Ga0207665_10000210 | |||
| 2094 | Ga0207691_10005532 | |||
| 2095 | Ga0207691_10006907 | |||
| 2096 | Ga0207691_10017079 | |||
| 2097 | Ga0207691_10037116 | |||
| 2098 | Ga0207691_10077281 | |||
| 2099 | Ga0207691_10129432 | |||
| 2100 | Ga0207691_10129978 | |||
| 2101 | Ga0207711_10000039 | |||
| 2102 | Ga0207711_10001557 | |||
| 2103 | Ga0207711_10014181 | |||
| 2104 | Ga0207711_10015227 | |||
| 2105 | Ga0207711_10022126 | |||
| 2106 | Ga0207711_10031874 | |||
| 2107 | Ga0207711_10063794 | |||
| 2108 | Ga0207711_10070811 | |||
| 2109 | Ga0207689_10000053 | |||
| 2110 | Ga0207689_10007517 | |||
| 2111 | Ga0207689_10009414 | |||
| 2112 | Ga0207689_10027153 | |||
| 2113 | Ga0207689_10052697 | |||
| 2114 | Ga0207661_10000036 | |||
| 2115 | Ga0207661_10019697 | |||
| 2116 | Ga0207679_10000060 | |||
| 2117 | Ga0207679_10002925 | |||
| 2118 | Ga0207679_10010577 | |||
| 2119 | Ga0207679_10026824 | |||
| 2120 | Ga0207679_10081322 | |||
| 2121 | Ga0207679_10106286 | |||
| 2122 | Ga0207679_10139096 | |||
| 2123 | Ga0207667_10000303 | |||
| 2124 | Ga0207667_10197000 | |||
| 2125 | Ga0207667_10198839 | |||
| 2126 | Ga0207651_10000014 | |||
| 2127 | Ga0207651_10224986 | |||
| 2128 | Ga0207712_10000134 | |||
| 2129 | Ga0207712_10000195 | |||
| 2130 | Ga0207712_10116473 | |||
| 2131 | Ga0207668_10000350 | |||
| 2132 | Ga0207668_10075099 | |||
| 2133 | Ga0207668_10114395 | |||
| 2134 | Ga0207668_10132031 | |||
| 2135 | Ga0207668_10137641 | |||
| 2136 | Ga0207640_10001960 | |||
| 2137 | Ga0207640_10026231 | |||
| 2138 | Ga0207658_10001042 | |||
| 2139 | Ga0207658_10001227 | |||
| 2140 | Ga0207658_10003771 | |||
| 2141 | Ga0207658_10017582 | |||
| 2142 | Ga0207658_10071331 | |||
| 2143 | Ga0207658_10072259 | |||
| 2144 | Ga0207658_10257038 | |||
| 2145 | Ga0207658_10268364 | |||
| 2146 | Ga0207677_10003136 | |||
| 2147 | Ga0207677_10003572 | |||
| 2148 | Ga0207703_10000327 | |||
| 2149 | Ga0207703_10032671 | |||
| 2150 | Ga0207703_10250734 | |||
| 2151 | Ga0207703_10302439 | |||
| 2152 | Ga0207639_10000835 | |||
| 2153 | Ga0207639_10001105 | |||
| 2154 | Ga0207639_10048488 | |||
| 2155 | Ga0207639_10093241 | |||
| 2156 | Ga0207678_10000892 | |||
| 2157 | Ga0207678_10001535 | |||
| 2158 | Ga0207678_10001718 | |||
| 2159 | Ga0207678_10003104 | |||
| 2160 | Ga0207678_10011286 | |||
| 2161 | Ga0207678_10026959 | |||
| 2162 | Ga0207678_10034704 | |||
| 2163 | Ga0207678_10041314 | |||
| 2164 | Ga0207678_10047163 | |||
| 2165 | Ga0207678_10099602 | |||
| 2166 | Ga0207678_10160785 | |||
| 2167 | Ga0207678_10161923 | |||
| 2168 | Ga0207708_10001777 | |||
| 2169 | Ga0207708_10101112 | |||
| 2170 | Ga0207708_10101648 | |||
| 2171 | Ga0207702_10011181 | |||
| 2172 | Ga0207702_10091065 | |||
| 2173 | Ga0207641_10000138 | |||
| 2174 | Ga0207641_10000664 | |||
| 2175 | Ga0207641_10009374 | |||
| 2176 | Ga0207641_10054912 | |||
| 2177 | Ga0207641_10142163 | |||
| 2178 | Ga0207648_10004308 | |||
| 2179 | Ga0207648_10017594 | |||
| 2180 | Ga0207648_10063136 | |||
| 2181 | Ga0207676_10000358 | |||
| 2182 | Ga0207676_10000983 | |||
| 2183 | Ga0207676_10005202 | |||
| 2184 | Ga0207676_10016480 | |||
| 2185 | Ga0207674_10000185 | |||
| 2186 | Ga0207674_10000314 | |||
| 2187 | Ga0207674_10002181 | |||
| 2188 | Ga0207674_10002696 | |||
| 2189 | Ga0207674_10024950 | |||
| 2190 | Ga0207674_10044244 | |||
| 2191 | Ga0207675_100002850 | |||
| 2192 | Ga0207675_100018253 | |||
| 2193 | Ga0207675_100154693 | |||
| 2194 | Ga0207675_100162829 | |||
| 2195 | Ga0207683_10000001 | |||
| 2196 | Ga0207683_10027328 | |||
| 2197 | Ga0207683_10038667 | |||
| 2198 | Ga0207683_10127233 | |||
| 2199 | Ga0207698_10000857 | |||
| 2200 | Ga0207698_10044221 | |||
| 2201 | Ga0207698_10084683 | |||
| 2202 | Ga0207698_10162661 | |||
| 2203 | Ga0207698_10220339 | |||
| 2204 | Ga0209179_1005986 | |||
| 2205 | Ga0209966_1000701 | |||
| 2206 | Ga0209813_10000184 | |||
| 2207 | Ga0209974_10006072 | |||
| 2208 | Ga0207428_10000316 | |||
| 2209 | Ga0207428_10000897 | |||
| 2210 | Ga0207428_10000923 | |||
| 2211 | Ga0268266_10016735 | |||
| 2212 | Ga0268266_10019041 | |||
| 2213 | Ga0268266_10028106 | |||
| 2214 | Ga0268266_10028711 | |||
| 2215 | Ga0268265_10002015 | |||
| 2216 | Ga0268265_10006389 | |||
| 2217 | Ga0268265_10007116 | |||
| 2218 | Ga0268265_10010473 | |||
| 2219 | Ga0268265_10019093 | |||
| 2220 | Ga0268265_10036082 | |||
| 2221 | Ga0268265_10073525 | |||
| 2222 | Ga0268265_10108458 | |||
| 2223 | Ga0268265_10115467 | |||
| 2224 | Ga0268264_10000976 | |||
| 2225 | Ga0268264_10002587 | |||
| 2226 | Ga0268264_10003561 | |||
| 2227 | Ga0268264_10010537 | |||
| 2228 | Ga0268264_10048516 | |||
| 2229 | Ga0268264_10118751 | |||
| 2230 | Ga0268264_10123474 | |||
| 2231 | Ga0268264_10184721 | |||
| 2232 | Ga0265318_10022180 | |||
| 2233 | Ga0265338_10014430 | |||
| 2234 | Ga0265760_10023408 | |||
| 2235 | Ga0265330_10021930 | |||
| 2236 | Ga0265332_10035887 | |||
| 2237 | Ga0265332_10066004 | |||
| 2238 | Ga0265328_10011073 | |||
| 2239 | Ga0265325_10000097 | |||
| 2240 | Ga0265325_10003705 | |||
| 2241 | Ga0265325_10009260 | |||
| 2242 | Ga0265325_10009896 | |||
| 2243 | Ga0265325_10050320 | |||
| 2244 | Ga0265340_10010971 | |||
| 2245 | Ga0265339_10000091 | |||
| 2246 | Ga0265339_10007468 | |||
| 2247 | Ga0265339_10013800 | |||
| 2248 | Ga0265331_10023779 | |||
| 2249 | Ga0265316_10008071 | |||
| 2250 | Ga0265316_10023549 | |||
| 2251 | Ga0307513_10200910 | |||
| 2252 | Ga0307408_100020885 | |||
| 2253 | Ga0307408_100036610 | |||
| 2254 | Ga0307408_100038872 | |||
| 2255 | Ga0307408_100175266 | |||
| 2256 | Ga0265313_10000260 | |||
| 2257 | Ga0265313_10004440 | |||
| 2258 | Ga0265313_10006139 | |||
| 2259 | Ga0265313_10009745 | |||
| 2260 | Ga0265313_10017993 | |||
| 2261 | Ga0265313_10026282 | |||
| 2262 | Ga0265313_10063235 | |||
| 2263 | Ga0316579_10007010 | |||
| 2264 | Ga0265314_10001493 | |||
| 2265 | Ga0265314_10029986 | |||
| 2266 | Ga0265314_10034505 | |||
| 2267 | Ga0265342_10035680 | |||
| 2268 | Ga0265342_10065731 | |||
| 2269 | Ga0265342_10075153 | |||
| 2270 | Ga0307405_10019312 | |||
| 2271 | Ga0307405_10099604 | |||
| 2272 | Ga0307413_10004947 | |||
| 2273 | Ga0307413_10005807 | |||
| 2274 | Ga0307413_10041306 | |||
| 2275 | Ga0307410_10000196 | |||
| 2276 | Ga0307410_10006424 | |||
| 2277 | Ga0307410_10008268 | |||
| 2278 | Ga0307410_10067718 | |||
| 2279 | Ga0307410_10078392 | |||
| 2280 | Ga0307410_10107900 | |||
| 2281 | Ga0307406_10006125 | |||
| 2282 | Ga0307406_10082294 | |||
| 2283 | Ga0307407_10002297 | |||
| 2284 | Ga0307407_10005484 | |||
| 2285 | Ga0307407_10027269 | |||
| 2286 | Ga0307412_10018182 | |||
| 2287 | Ga0307412_10082897 | |||
| 2288 | Ga0307412_10095467 | |||
| 2289 | Ga0307412_10117210 | |||
| 2290 | Ga0307412_10178438 | |||
| 2291 | Ga0307409_100000135 | |||
| 2292 | Ga0307409_100003671 | |||
| 2293 | Ga0307409_100023312 | |||
| 2294 | Ga0307409_100031858 | |||
| 2295 | Ga0307409_100122463 | |||
| 2296 | Ga0307416_100004600 | |||
| 2297 | Ga0307416_100030220 | |||
| 2298 | Ga0307416_100036347 | |||
| 2299 | Ga0307416_100063662 | |||
| 2300 | Ga0307416_100167519 | |||
| 2301 | Ga0307414_10008740 | |||
| 2302 | Ga0307414_10031793 | |||
| 2303 | Ga0307414_10044294 | |||
| 2304 | Ga0307414_10080811 | |||
| 2305 | Ga0307414_10091118 | |||
| 2306 | Ga0307414_10116781 | |||
| 2307 | Ga0307414_10219992 | |||
| 2308 | Ga0307414_10230655 | |||
| 2309 | Ga0307411_10001690 | |||
| 2310 | Ga0307411_10002367 | |||
| 2311 | Ga0307411_10008891 | |||
| 2312 | Ga0307411_10022155 | |||
| 2313 | Ga0307411_10042276 | |||
| 2314 | Ga0307411_10046202 | |||
| 2315 | Ga0307411_10047788 | |||
| 2316 | Ga0307411_10068032 | |||
| 2317 | Ga0307411_10104022 | |||
| 2318 | Ga0307415_100031263 | |||
| 2319 | Ga0307415_100059518 | |||
| 2320 | Ga0307415_100148538 | |||
| 2321 | Ga0307415_100226374 | |||
| 2322 | Ga0316583_10000081 | |||
| 2323 | Ga0373930_0000006 | |||
| 2324 | Ga0373958_0000694 | |||
| 2325 | Ga0373958_0001103 | |||
| 2326 | Ga0373959_0005640 | |||
| 2327 | Ga0373938_0000479 | |||
| 2328 | Ga0373938_0001513 | |||
| 2329 | Ga0373926_0007041 | |||
| 2330 | Ga0373928_0003420 | |||
| 2331 | Ga0373928_0004315 | |||
| 2332 | Ga0373929_0000474 | |||
| 2333 | Ga0373934_0003474 | |||
| 2334 | Ga0373934_0047832 | |||
| 2335 | Ga0373940_0000343 | |||
| 2336 | Ga0373940_0008788 | |||
| 2337 | Ga0373944_0002019 | |||
| 2338 | Ga0373944_0002875 | |||
| 2339 | Ga0373944_0003428 | |||
| 2340 | Ga0373944_0024959 | |||
| 2341 | Ga0373951_0000313 | |||
| 2342 | Ga0373952_0000218 | |||
| 2343 | Ga0373952_0000939 | |||
| 2344 | Ga0373923_0018708 | |||
| 2345 | Ga0373932_0002670 | |||
| 2346 | Ga0373932_0003226 | |||
| 2347 | Ga0373932_0017848 | |||
| 2348 | Ga0373936_0045373 | |||
| 2349 | Ga0373939_0000569 | |||
| 2350 | Ga0373939_0005627 | |||
| 2351 | Ga0373941_0001350 | |||
| 2352 | Ga0373941_0025498 | |||
| 2353 | Ga0373941_0031985 | |||
| 2354 | Ga0373945_0004285 | |||
| 2355 | Ga0373945_0012804 | |||
| 2356 | Ga0373953_0006282 | |||
| 2357 | Ga0373954_0013421 | |||
| 2358 | Ga0373954_0016582 | |||
| 2359 | Ga0373954_0036014 | |||
| 2360 | Ga0373956_0006720 | |||
| 2361 | Ga0373956_0037549 | |||
| 2362 | Ga0373956_0040827 | |||
| 2363 | Ga0373957_0013818 | |||
| 2364 | Ga0373960_0000093 | |||
| 2365 | Ga0373943_0000567 | |||
| 2366 | Ga0373943_0012619 | |||
| 2367 | Ga0373946_0002942 | |||
| 2368 | Ga0373946_0008443 | |||
| 2369 | Ga0373946_0023518 | |||
| 2370 | Ga0373946_0063818 | |||
| 2371 | Ga0373955_0000962 | |||
| 2372 | Ga0373955_0001391 | |||
| 2373 | Ga0373955_0025552 | |||
| 2374 | Ga0373955_0043621 | |||
| 2375 | Ga0373942_0000292 | |||
| 2376 | Ga0373942_0010958 | |||
| 2377 | Ga0373961_0001147 | |||
| 2378 | Ga0373961_0010379 | |||
| 2379 | Ga0373962_0000301 | |||
| 2380 | Ga0373962_0001628 | |||
| 2381 | Ga0373962_0011123 | |||
| 2382 | Ga0373931_0000086 | |||
| 2383 | Ga0373931_0003593 | |||
| 2384 | Ga0373935_0031599 | |||
| 2385 | Ga0373935_0057184 | |||
| 2386 | Ga0373935_0065204 | |||
| 2387 | Ga0373935_0067547 | |||
| 2388 | Ga0373927_0005131 | |||
| 2389 | Ga0373927_0034920 | |||
| 2390 | Ga0373927_0059331 | |||
| 2391 | Ga0373927_0071753 | |||
| 2392 | Ga0373927_0114791 | |||
| 2393 | Ga0373933_0009812 | |||
| 2394 | Ga0373933_0017845 | |||
| 2395 | Ga0373933_0028060 | |||
| 2396 | Ga0373947_0009204 | |||
| 2397 | Ga0373947_0014769 | |||
| 2398 | Ga0373947_0021695 | |||
| 2399 | Ga0373937_0004313 | |||
| 2400 | Ga0373937_0004822 | |||
| 2401 | Ga0373937_0013053 | |||
| 2402 | Ga0373937_0023035 | |||
| 2403 | Ga0373937_0031048 | |||
| 2404 | Ga0373937_0117379 | |||
| 2405 | Ga0316582_0080845 | |||
| 2406 | Ga0373925_0003922 | |||
| 2407 | Ga0373925_0015075 | |||
| 2408 | Ga0373925_0023858 | |||
| 2409 | Ga0395899_0000132 | |||
| 2410 | Ga0395899_0025245 | |||
| 2411 | Ga0395900_0000477 | |||
| 2412 | Ga0395900_0000997 | |||
| 2413 | Ga0395900_0001169 | |||
| 2414 | Ga0395900_0003479 | |||
| 2415 | Ga0395900_0016968 | |||
| 2416 | Ga0395900_0078138 | |||
| 2417 | Ga0395900_0085220 | |||
| 2418 | Ga0395900_0091734 | |||
| 2419 | Ga0395898_0015973 | |||
| 2420 | Ga0395898_0017326 | |||
| 2421 | Ga0395898_0028510 | |||
| 2422 | Ga0395898_0061634 | |||
| 2423 | Ga0395898_0067555 | |||
| 2424 | Ga0395898_0117554 | |||
| 2425 | Ga0395898_0121892 | |||
| 2426 | Ga0395905_0000818 | |||
| 2427 | Ga0395905_0001164 | |||
| 2428 | Ga0395905_0002761 | |||
| 2429 | Ga0395905_0010864 | |||
| 2430 | Ga0395905_0021647 | |||
| 2431 | Ga0395905_0043421 | |||
| 2432 | Ga0395905_0053027 | |||
| 2433 | Ga0395905_0068826 | |||
| 2434 | Ga0436364_0319726 | |||
| 2435 | Ga0395901_0000208 | |||
| 2436 | Ga0395901_0000589 | |||
| 2437 | Ga0395901_0002866 | |||
| 2438 | Ga0395901_0007227 | |||
| 2439 | Ga0395901_0087854 | |||
| 2440 | Ga0395901_0114738 | |||
| 2441 | Ga0395901_0197617 | |||
| 2442 | Ga0395901_0295086 | |||
| 2443 | Ga0395901_0368745 | |||
| 2444 | Ga0436365_0414414 | |||
| 2445 | Ga0436365_0458815 | |||
| 2446 | Ga0436360_0251329 | |||
| 2447 | Ga0436361_0896735 | |||
| 2448 | Ga0439445_0002205 | |||
| 2449 | Ga0439448_0020086 | |||
| 2450 | Ga0439432_008816 | |||
| 2451 | Ga0439432_023841 | |||
| 2452 | Ga0439452_023708 | |||
| 2453 | Ga0439455_0025551 | |||
| 2454 | Ga0439462_0031594 | |||
| 2455 | Ga0450905_003094 | |||
| 2456 | Ga0450889_000019 | |||
| 2457 | Ga0439435_0000116 | |||
| 2458 | Ga0451577_0012529 | |||
| 2459 | Ga0466972_0068169 | |||
| 2460 | Ga0466966_0167740 | |||
| 2461 | Ga0466963_0003406 | |||
| 2462 | Ga0466963_0015451 | |||
| 2463 | Ga0466963_0042944 | |||
| 2464 | Ga0466963_0155714 | |||
| 2465 | Ga0453684_0082525 | |||
| 2466 | Ga0466959_0059587 | |||
| 2467 | Ga0451576_0027924 | |||
| 2468 | Ga0466958_0035584 | |||
| 2469 | Ga0466967_0002255 | |||
| 2470 | Ga0466967_0007911 | |||
| 2471 | Ga0466967_0053981 | |||
| 2472 | Ga0466967_0066726 | |||
| 2473 | Ga0466967_0081609 | |||
| 2474 | Ga0466967_0172865 | |||
| 2475 | Ga0466967_0178004 | |||
| 2476 | Ga0466967_0191450 | |||
| 2477 | Ga0495592_0008217 | |||
| 2478 | Ga0495592_0027775 | |||
| 2479 | Ga0495592_0101871 | |||
| 2480 | Ga0495603_0087900 | |||
| 2481 | Ga0495629_0000668 | |||
| 2482 | Ga0495629_0135648 | |||
| 2483 | Ga0495638_0000204 | |||
| 2484 | Ga0495638_0017966 | |||
| 2485 | Ga0495638_0021126 | |||
| 2486 | Ga0495641_0034802 | |||
| 2487 | Ga0495641_0068827 | |||
| 2488 | Ga0495651_0000237 | |||
| 2489 | Ga0495651_0009743 | |||
| 2490 | Ga0495651_0014732 | |||
| 2491 | Ga0495651_0064792 | |||
| 2492 | Ga0495653_0009351 | |||
| 2493 | Ga0495653_0020295 | |||
| 2494 | Ga0495653_0047643 | |||
| 2495 | Ga0495580_0024260 | |||
| 2496 | Ga0495580_0044157 | |||
| 2497 | Ga0495582_0035811 | |||
| 2498 | Ga0495639_0020552 | |||
| 2499 | Ga0495662_0000280 | |||
| 2500 | Ga0495662_0007973 | |||
| 2501 | Ga0495662_0015169 | |||
| 2502 | Ga0495664_0000112 | |||
| 2503 | Ga0495664_0006025 | |||
| 2504 | Ga0495664_0092353 | |||
| 2505 | Ga0495584_0011269 | |||
| 2506 | Ga0495584_0055204 | |||
| 2507 | Ga0495584_0074316 | |||
| 2508 | Ga0495585_0000734 | |||
| 2509 | Ga0495585_0006706 | |||
| 2510 | Ga0495596_0008510 | |||
| 2511 | Ga0495607_0011035 | |||
| 2512 | Ga0495608_0005221 | |||
| 2513 | Ga0495608_0067866 | |||
| 2514 | Ga0495610_0002641 | |||
| 2515 | Ga0495618_0001016 | |||
| 2516 | Ga0495618_0007304 | |||
| 2517 | Ga0495618_0066673 | |||
| 2518 | Ga0495618_0134541 | |||
| 2519 | Ga0495628_0004625 | |||
| 2520 | Ga0495628_0018442 | |||
| 2521 | Ga0495628_0211069 | |||
| 2522 | Ga0495630_0024126 | |||
| 2523 | Ga0495630_0034111 | |||
| 2524 | Ga0495631_0016466 | |||
| 2525 | Ga0495632_0000075 | |||
| 2526 | Ga0495632_0046880 | |||
| 2527 | Ga0495637_0000123 | |||
| 2528 | Ga0495637_0034787 | |||
| 2529 | Ga0495643_0000009 | |||
| 2530 | Ga0495644_0000306 | |||
| 2531 | Ga0495648_0037541 | |||
| 2532 | Ga0495663_0000003 | |||
| 2533 | Ga0495663_0017730 | |||
| 2534 | Ga0495666_0023948 | |||
| 2535 | Ga0495666_0034834 | |||
| 2536 | Ga0495652_0019482 | |||
| 2537 | Ga0495652_0105926 | |||
| 2538 | Ga0495665_0007482 | |||
| 2539 | Ga0495665_0012616 | |||
| 2540 | Ga0495665_0030802 | |||
| 2541 | Ga0495640_0000871 | |||
| 2542 | Ga0495640_0084501 | |||
| 2543 | Ga0495586_0014023 | |||
| 2544 | Ga0495586_0041668 | |||
| 2545 | Ga0495586_0111993 | |||
| 2546 | Ga0495587_0006533 | |||
| 2547 | Ga0495587_0072252 | |||
| 2548 | Ga0495587_0118441 | |||
| 2549 | Ga0495598_0003015 | |||
| 2550 | Ga0495621_0000652 | |||
| 2551 | Ga0495621_0011175 | |||
| 2552 | Ga0495621_0019245 | |||
| 2553 | Ga0495645_0003375 | |||
| 2554 | Ga0495645_0004586 | |||
| 2555 | Ga0495645_0076719 | |||
| 2556 | Ga0495622_0034756 | |||
| 2557 | Ga0495622_0054674 | |||
| 2558 | Ga0495633_0000173 | |||
| 2559 | Ga0495633_0001183 | |||
| 2560 | Ga0495633_0001327 | |||
| 2561 | Ga0495667_0003141 | |||
| 2562 | Ga0495667_0004903 | |||
| 2563 | Ga0495667_0079413 | |||
| 2564 | Ga0495667_0095258 | |||
| 2565 | Ga0495656_0000381 | |||
| 2566 | Ga0495656_0072045 | |||
| 2567 | Ga0495668_0076134 | |||
| 2568 | Ga0495634_0003493 | |||
| 2569 | Ga0495634_0033846 | |||
| 2570 | Ga0495634_0038870 | |||
| 2571 | Ga0495611_0001463 | |||
| 2572 | Ga0495635_0002093 | |||
| 2573 | Ga0495635_0028467 | |||
| 2574 | Ga0495635_0116987 | |||
| 2575 | Ga0495659_0003761 | |||
| 2576 | Ga0495661_0082450 | |||
| 2577 | Ga0495588_0002225 | |||
| 2578 | Ga0495657_0006644 | |||
| 2579 | Ga0495657_0008508 | |||
| 2580 | Ga0495657_0008561 | |||
| 2581 | Ga0495599_0021673 | |||
| 2582 | Ga0495623_0026503 | |||
| 2583 | Ga0495646_0004362 | |||
| 2584 | Ga0495658_0000229 | |||
| 2585 | Ga0495669_0000599 | |||
| 2586 | Ga0495669_0001837 | |||
| 2587 | Ga0495669_0010207 | |||
| 2588 | Ga0495613_0011247 | |||
| 2589 | Ga0495613_0037688 | |||
| 2590 | Ga0495613_0103240 | |||
| 2591 | Ga0495613_0121505 | |||
| 2592 | Ga0495624_0001093 | |||
| 2593 | Ga0495624_0022372 | |||
| 2594 | Ga0495670_0002180 | |||
| 2595 | Ga0495670_0003882 | |||
| 2596 | Ga0495670_0102255 | |||
| 2597 | Ga0495671_0000013 | |||
| 2598 | Ga0495600_0019287 | |||
| 2599 | Ga0495600_0067544 | |||
| 2600 | Ga0495600_0084015 | |||
| 2601 | Ga0495581_0054776 | |||
| 2602 | Ga0495581_0056281 | |||
| 2603 | Ga0495581_0058993 | |||
| 2604 | Ga0495581_0084168 | |||
| 2605 | Ga0495604_0002806 | |||
| 2606 | Ga0495604_0008011 | |||
| 2607 | Ga0495604_0009095 | |||
| 2608 | Ga0495674_0001513 | |||
| 2609 | Ga0495674_0151891 | |||
| 2610 | Ga0495674_0280038 | |||
| 2611 | Ga0495672_0002402 | |||
| 2612 | Ga0495672_0004345 | |||
| 2613 | Ga0495672_0083360 | |||
| 2614 | Ga0495676_0072836 | |||
| 2615 | Ga0495676_0125444 | |||
| 2616 | Ga0495680_0016671 | |||
| 2617 | Ga0495680_0025791 | |||
| 2618 | Ga0495680_0028426 | |||
| 2619 | Ga0495680_0077960 | |||
| 2620 | Ga0495680_0098613 | |||
| 2621 | Ga0495675_0005331 | |||
| 2622 | Ga0495677_0018861 | |||
| 2623 | Ga0495681_0001636 | |||
| 2624 | Ga0495684_0000264 | |||
| 2625 | Ga0495684_0001309 | |||
| 2626 | Ga0495593_0030842 | |||
| 2627 | Ga0495593_0046463 | |||
| 2628 | Ga0495602_0005783 | |||
| 2629 | Ga0495602_0021033 | |||
| 2630 | Ga0495602_0040285 | |||
| 2631 | Ga0495602_0186809 | |||
| 2632 | Ga0495614_0012220 | |||
| 2633 | Ga0495615_0004517 | |||
| 2634 | Ga0495626_0000214 | |||
| 2635 | Ga0496100_0001253 | |||
| 2636 | Ga0496100_0040891 | |||
| 2637 | Ga0496101_0001852 | |||
| 2638 | Ga0496101_0002475 | |||
| 2639 | Ga0496101_0004266 | |||
| 2640 | Ga0496101_0043198 | |||
| 2641 | Ga0496101_0061187 | |||
| 2642 | Ga0496102_0002526 | |||
| 2643 | Ga0496102_0006171 | |||
| 2644 | Ga0496102_0024435 | |||
| 2645 | Ga0496102_0203451 | |||
| 2646 | Ga0496103_0000130 | |||
| 2647 | Ga0496103_0000715 | |||
| 2648 | Ga0496103_0012088 | |||
| 2649 | Ga0496103_0031446 | |||
| 2650 | Ga0496104_0000311 | |||
| 2651 | Ga0496104_0000900 | |||
| 2652 | Ga0496104_0001975 | |||
| 2653 | Ga0496104_0011188 | |||
| 2654 | Ga0496104_0047862 | |||
| 2655 | Ga0496104_0095212 | |||
| 2656 | Ga0496105_0000144 | |||
| 2657 | Ga0496105_0000363 | |||
| 2658 | Ga0496105_0010173 | |||
| 2659 | Ga0496105_0052297 | |||
| 2660 | Ga0496105_0075082 | |||
| 2661 | Ga0496105_0075755 | |||
| 2662 | Ga0496105_0200163 | |||
| 2663 | Ga0496106_0000135 | |||
| 2664 | Ga0496106_0005392 | |||
| 2665 | Ga0496106_0011849 | |||
| 2666 | Ga0496106_0015796 | |||
| 2667 | Ga0496106_0106463 | |||
| 2668 | Ga0496107_0012327 | |||
| 2669 | Ga0496107_0031189 | |||
| 2670 | Ga0496107_0059074 | |||
| 2671 | Ga0496107_0120197 | |||
| 2672 | Ga0496107_0255400 | |||
| 2673 | Ga0496108_0000256 | |||
| 2674 | Ga0496108_0004267 | |||
| 2675 | Ga0496108_0005425 | |||
| 2676 | Ga0496108_0005764 | |||
| 2677 | Ga0496108_0008672 | |||
| 2678 | Ga0496108_0022065 | |||
| 2679 | Ga0496108_0040349 | |||
| 2680 | Ga0496108_0125821 | |||
| 2681 | Ga0496109_0000490 | |||
| 2682 | Ga0496109_0000730 | |||
| 2683 | Ga0496109_0012503 | |||
| 2684 | Ga0496109_0027371 | |||
| 2685 | Ga0496109_0041709 | |||
| 2686 | Ga0496109_0048395 | |||
| 2687 | Ga0496109_0066682 | |||
| 2688 | Ga0496109_0167510 | |||
| 2689 | Ga0496109_0219015 | |||
| 2690 | Ga0496110_0005771 | |||
| 2691 | Ga0496110_0008763 | |||
| 2692 | Ga0496110_0008841 | |||
| 2693 | Ga0496110_0010176 | |||
| 2694 | Ga0496110_0124874 | |||
| 2695 | Ga0496110_0257683 | |||
| 2696 | Ga0496111_0002097 | |||
| 2697 | Ga0496111_0012561 | |||
| 2698 | Ga0496111_0015368 | |||
| 2699 | Ga0496111_0030426 | |||
| 2700 | Ga0496111_0047442 | |||
| 2701 | Ga0496111_0074374 | |||
| 2702 | Ga0496111_0084864 | |||
| 2703 | Ga0496111_0098668 | |||
| 2704 | Ga0496112_0002301 | |||
| 2705 | Ga0496112_0040962 | |||
| 2706 | Ga0496112_0051044 | |||
| 2707 | Ga0496112_0053767 | |||
| 2708 | Ga0496112_0083002 | |||
| 2709 | Ga0496112_0086797 | |||
| 2710 | Ga0496112_0116008 | |||
| 2711 | Ga0496112_0196859 | |||
| 2712 | Ga0496113_0000318 | |||
| 2713 | Ga0496113_0004239 | |||
| 2714 | Ga0496113_0008442 | |||
| 2715 | Ga0496113_0016292 | |||
| 2716 | Ga0496113_0079873 | |||
| 2717 | Ga0496114_0000006 | |||
| 2718 | Ga0496114_0000287 | |||
| 2719 | Ga0496114_0058988 | |||
| 2720 | Ga0496114_0131587 | |||
| 2721 | Ga0496115_0003371 | |||
| 2722 | Ga0496115_0009373 | |||
| 2723 | Ga0496115_0018872 | |||
| 2724 | Ga0496115_0019923 | |||
| 2725 | Ga0496115_0061836 | |||
| 2726 | Ga0496115_0064194 | |||
| 2727 | Ga0496115_0113708 | |||
| 2728 | Ga0496116_0000062 | |||
| 2729 | Ga0496118_0039378 | |||
| 2730 | Ga0496119_0000936 | |||
| 2731 | Ga0496121_0002503 | |||
| 2732 | Ga0496121_0010966 | |||
| 2733 | Ga0496122_0000589 | |||
| 2734 | Ga0496122_0009287 | |||
| 2735 | Ga0496122_0019558 | |||
| 2736 | Ga0496122_0020036 | |||
| 2737 | Ga0496123_0000278 | |||
| 2738 | Ga0496123_0000545 | |||
| 2739 | Ga0496123_0001298 | |||
| 2740 | Ga0496123_0002167 | |||
| 2741 | Ga0496124_0010346 | |||
| 2742 | Ga0496124_0052085 | |||
| 2743 | Ga0496125_0004774 | |||
| 2744 | Ga0496125_0027784 | |||
| 2745 | Ga0496126_0000801 | |||
| 2746 | Ga0501032_0039527 | |||
| 2747 | Ga0501032_0063370 | |||
| 2748 | Ga0501032_0162501 | |||
| 2749 | Ga0501033_0004204 | |||
| 2750 | Ga0501033_0024281 | |||
| 2751 | Ga0501033_0026129 | |||
| 2752 | Ga0501034_0000436 | |||
| 2753 | Ga0501034_0005233 | |||
| 2754 | Ga0501034_0009627 | |||
| 2755 | Ga0501034_0027067 | |||
| 2756 | Ga0501034_0099430 | |||
| 2757 | Ga0501036_0001221 | |||
| 2758 | Ga0501036_0027487 | |||
| 2759 | Ga0501036_0044521 | |||
| 2760 | Ga0501036_0131217 | |||
| 2761 | Ga0501037_0003949 | |||
| 2762 | Ga0501038_0028790 | |||
| 2763 | Ga0501038_0085958 | |||
| 2764 | Ga0501038_0095777 | |||
| 2765 | Ga0501039_0033073 | |||
| 2766 | Ga0501039_0044143 | |||
| 2767 | Ga0501039_0214251 | |||
| 2768 | Ga0501040_0108027 | |||
| 2769 | Ga0501043_0008146 | |||
| 2770 | Ga0501043_0009282 | |||
| 2771 | Ga0501043_0034819 | |||
| 2772 | Ga0501046_0105803 | |||
| 2773 | Ga0501047_0000223 | |||
| 2774 | Ga0501047_0000384 | |||
| 2775 | Ga0501047_0035760 | |||
| 2776 | Ga0501047_0116121 | |||
| 2777 | Ga0501047_0146712 | |||
| 2778 | Ga0501048_0000074 | |||
| 2779 | Ga0501048_0123057 | |||
| 2780 | Ga0501067_0011404 | |||
| 2781 | Ga0501067_0055988 | |||
| 2782 | Ga0501067_0076510 | |||
| 2783 | Ga0501068_0032961 | |||
| 2784 | Ga0501069_0006054 | |||
| 2785 | Ga0501069_0019134 | |||
| 2786 | Ga0501070_0008586 | |||
| 2787 | Ga0501070_0011258 | |||
| 2788 | Ga0501070_0025736 | |||
| 2789 | Ga0501070_0032074 | |||
| 2790 | Ga0501070_0032152 | |||
| 2791 | Ga0501071_0011938 | |||
| 2792 | Ga0501071_0071204 | |||
| 2793 | Ga0501071_0126813 | |||
| 2794 | Ga0501072_0001326 | |||
| 2795 | Ga0501074_0012491 | |||
| 2796 | Ga0501076_0012519 | |||
| 2797 | Ga0501076_0064957 | |||
| 2798 | Ga0501076_0091509 | |||
| 2799 | Ga0501235_011191 | |||
| 2800 | Ga0501221_006804 | |||
| 2801 | Ga0501079_0135107 | |||
| 2802 | Ga0501079_0202160 | |||
| 2803 | Ga0501080_0001854 | |||
| 2804 | Ga0501080_0025491 | |||
| 2805 | Ga0501080_0059932 | |||
| 2806 | Ga0501081_0053559 | |||
| 2807 | Ga0501083_0001146 | |||
| 2808 | Ga0501083_0022266 | |||
| 2809 | Ga0501083_0043876 | |||
| 2810 | Ga0501083_0170931 | |||
| 2811 | Ga0501035_0000371 | |||
| 2812 | Ga0501035_0007311 | |||
| 2813 | Ga0501035_0033698 | |||
| 2814 | Ga0501035_0060863 | |||
| 2815 | Ga0501035_0253117 | |||
| 2816 | Ga0501044_0001720 | |||
| 2817 | Ga0501044_0011870 | |||
| 2818 | Ga0501044_0124863 | |||
| 2819 | Ga0501045_0168021 | |||
| 2820 | nmdc:mga03n38_6277_c1 | |||
| 2821 | nmdc:mga03n38_92370_c1 | |||
| 2822 | nmdc:mga0yw44_23578_c1 | |||
| 2823 | nmdc:mga0yw44_2995_c1 | |||
| 2824 | nmdc:mga0yw44_63475_c1 | |||
| 2825 | nmdc:mga06z11_11391_c1 | |||
| 2826 | nmdc:mga06z11_49590_c1 | |||
| 2827 | nmdc:mga06z11_60_c1 | |||
| 2828 | nmdc:mga04h51_39509_c1 | |||
| 2829 | nmdc:mga04h51_403_c1 | |||
| 2830 | nmdc:mga07m45_136286_c1 | |||
| 2831 | nmdc:mga07m45_81046_c1 | |||
| 2832 | nmdc:mga07m45_8495_c1 | |||
| 2833 | nmdc:mga05p37_1191_c1 | |||
| 2834 | nmdc:mga05p37_222_c1 | |||
| 2835 | nmdc:mga05p37_30060_c1 | |||
| 2836 | nmdc:mga05p37_71985_c1 | |||
| 2837 | nmdc:mga05p37_81621_c1 | |||
| 2838 | nmdc:mga09592_16877_c1 | |||
| 2839 | nmdc:mga09592_3118_c1 | |||
| 2840 | nmdc:mga09592_70637_c1 | |||
| 2841 | nmdc:mga0qj67_141077_c1 | |||
| 2842 | nmdc:mga0qj67_1677_c1 | |||
| 2843 | nmdc:mga0qj67_60328_c1 | |||
| 2844 | nmdc:mga06r32_1077_c1 | |||
| 2845 | nmdc:mga06r32_284100_c1 | |||
| 2846 | nmdc:mga08y16_11073_c1 | |||
| 2847 | nmdc:mga08y16_116433_c1 | |||
| 2848 | nmdc:mga08y16_121832_c1 | |||
| 2849 | nmdc:mga08y16_13536_c1 | |||
| 2850 | nmdc:mga08y16_13718_c1 | |||
| 2851 | nmdc:mga08y16_57400_c1 | |||
| 2852 | nmdc:mga08y16_587_c1 | |||
| 2853 | nmdc:mga0n895_126764_c1 | |||
| 2854 | nmdc:mga0n895_150771_c1 | |||
| 2855 | nmdc:mga0n895_200633_c1 | |||
| 2856 | nmdc:mga0n895_425063_c1 | |||
| 2857 | nmdc:mga0n895_437_c1 | |||
| 2858 | nmdc:mga0n895_741_c1 | |||
| 2859 | nmdc:mga0rr50_185351_c1 | |||
| 2860 | nmdc:mga0rr50_5627_c1 | |||
| 2861 | nmdc:mga0rr50_6644_c1 | |||
| 2862 | nmdc:mga0rr50_88555_c1 | |||
| 2863 | nmdc:mga08x19_165289_c1 | |||
| 2864 | nmdc:mga08x19_49275_c1 | |||
| 2865 | nmdc:mga0a205_158439_c1 | |||
| 2866 | nmdc:mga0a205_3283_c1 | |||
| 2867 | nmdc:mga0a205_40207_c1 | |||
| 2868 | nmdc:mga0a205_43507_c1 | |||
| 2869 | nmdc:mga0a205_6511_c1 | |||
| 2870 | nmdc:mga0a205_802_c1 | |||
| 2871 | nmdc:mga0sz30_19123_c1 | |||
| 2872 | Ga0495601_0000441 | |||
| 2873 | Ga0495601_0001951 | |||
| 2874 | Ga0495601_0006078 | |||
| 2875 | Ga0495601_0020031 | |||
| 2876 | Ga0495601_0042861 | |||
| 2877 | Ga0495612_0006563 | |||
| 2878 | Ga0495612_0019001 | |||
| 2879 | Ga0495612_0048622 | |||
| 2880 | Ga0495595_0000551 | |||
| 2881 | Ga0495595_0002072 | |||
| 2882 | Ga0495595_0003250 | |||
| 2883 | Ga0495595_0008006 | |||
| 2884 | Ga0495595_0110045 | |||
| 2885 | Ga0495619_0000063 | |||
| 2886 | Ga0495619_0000170 | |||
| 2887 | Ga0495619_0001482 | |||
| 2888 | Ga0495619_0011350 | |||
| 2889 | Ga0495619_0022077 | |||
| 2890 | Ga0495619_0022235 | |||
| 2891 | Ga0500644_0000715 | |||
| 2892 | Ga0500651_0004383 | |||
| 2893 | Ga0500641_0017324 | |||
| 2894 | Ga0500556_0000160 | |||
| 2895 | Ga0500593_000044 | |||
| 2896 | Ga0500593_007593 | |||
| 2897 | Ga0500594_0036322 | |||
| 2898 | Ga0500595_000085 | |||
| 2899 | Ga0500652_000056 | |||
| 2900 | Ga0500652_005144 | |||
| 2901 | Ga0500568_0000004 | |||
| 2902 | Ga0500616_0000001 | |||
| 2903 | Ga0500616_0000038 | |||
| 2904 | Ga0500624_000072 | |||
| 2905 | Ga0500636_0029690 | |||
| 2906 | Ga0500645_004638 | |||
| 2907 | Ga0500645_006791 | |||
| 2908 | Ga0501084_0128391 | |||
| 2909 | Ga0501082_0001551 | |||
| 2910 | Ga0501082_0060009 | |||
| 2911 | Ga0501082_0083169 | |||
| 2912 | Ga0501082_0127916 | |||
| 2913 | 2512645674 | |||
| 2914 | 2513590353 | |||
| 2915 | 2643758965 | |||
| 2916 | 2644290723 | |||
| 2917 | 2723849349 | |||
| 2918 | 2809063054 | |||
| 2919 | 2809079018 | |||
| 2920 | 2809083607 | |||
| 2921 | 2819552788 | |||
| 2922 | 2880520309 | |||
| 2923 | 2885427367 | |||
| 2924 | 2919452146 | |||
| 2925 | 2919709844 | |||
| 2926 | 2922364341 | |||
| 2927 | 8001845825 | |||
| 2928 | 8054306822 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4go7-assembly1.cif.gz_X-2 | the regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis | 0.9585 | 258 | 415 |
| 3s1t-assembly1.cif.gz_B | structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis | 0.9577 | 260 | 413 |
| 2re1-assembly1.cif.gz_A | crystal structure of aspartokinase alpha and beta subunits | 0.9565 | 262 | 413 |
| 4go5-assembly1.cif.gz_X-2 | the regulatory subunit of aspartate kinase from mycobacterium tuberculosis | 0.956 | 258 | 413 |
| 2zho-assembly3.cif.gz_F | crystal structure of the regulatory subunit of aspartate kinase from thermus thermophilus (ligand free form) | 0.9464 | 262 | 412 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4go5X02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9589 | 272 | 348 | 3.30.70.260 |
| 2zhoF01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9478 | 350 | 412 | 3.30.70.260 |
| 5yeiG02 | Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like | 0.9442 | 262 | 415 | 3.30.2130.10 |
| af_Q2FYP1_2_256_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9298 | 1 | 267 | 3.40.1160.10 |
| 2zhoB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.9296 | 271 | 347 | 3.30.70.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9K1I4-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9695 | 267 | 417 |
GO:0004072
GO:0005829 GO:0009088 GO:0009089 GO:0009090 |
| AF-A0A3P1Y057-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9642 | 258 | 413 |
GO:0004072
GO:0005829 GO:0009088 GO:0009089 GO:0009090 |
| AF-A0A7Z9K1I4-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9571 | 267 | 417 |
GO:0004072
GO:0005829 GO:0009088 GO:0009089 GO:0009090 |
| AF-A0A2H0LI16-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9555 | 270 | 416 |
GO:0004072
GO:0005829 GO:0009088 GO:0009089 GO:0009090 |
| AF-A0A3D3R500-F1-model_v4 | aspartate kinase (EC 2.7.2.4) | 0.9551 | 258 | 414 |
GO:0004072
GO:0005829 GO:0009088 GO:0009089 GO:0009090 |