F494161

General Info

Members Datasets Scaffolds Average Seq Length
1465 514 2930 50

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0055390|Ga0495608_0055390_846_992
Length 48
Sequence MMDFVAELWRFMRARKKFWLLPILVMMVVFIVVLTKGTVFAPFIYTLF

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
99 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
114 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
130 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
145 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
154 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
159 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
160 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
161 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
162 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
163 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
239 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
240 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
241 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
242 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
243 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
244 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
245 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
246 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
247 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
248 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
249 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
252 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
253 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
254 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
255 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
256 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
257 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
258 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
259 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
262 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
265 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
266 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
267 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
268 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
272 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
273 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
274 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
275 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
276 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
284 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
285 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
292 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
293 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
294 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
295 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
296 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
297 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
298 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
304 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
305 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
306 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
307 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
308 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
309 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
310 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
311 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
312 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
313 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
314 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
315 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
316 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
317 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
318 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
319 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
320 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
321 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
322 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
323 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
324 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
325 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
326 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
327 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
328 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
329 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
330 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
331 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
332 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
333 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
334 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
335 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
336 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
337 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
338 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
339 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
340 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
341 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
342 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
343 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
344 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
345 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
348 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
349 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
350 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
353 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
354 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
355 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
356 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
357 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
358 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
359 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
360 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
361 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
362 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
363 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
364 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
365 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
366 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
367 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
368 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
373 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
374 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
375 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
376 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
377 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
378 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
379 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
380 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
381 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
382 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
383 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
384 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
385 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
386 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
387 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
388 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
389 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
390 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
391 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
392 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
395 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
396 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
397 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
398 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
399 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
400 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
406 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
407 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
408 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
409 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
410 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
411 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
412 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
413 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
417 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
418 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
419 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
420 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
441 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
442 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
443 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
444 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
445 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
448 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
449 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
450 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
451 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
452 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
453 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
454 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
455 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
456 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
457 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
458 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
459 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
460 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
461 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
462 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
463 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
464 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
465 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
466 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
467 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
468 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
469 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
470 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
471 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
475 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
476 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
477 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
478 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
479 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
480 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
481 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
482 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
483 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
484 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
485 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
486 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
487 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
488 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
489 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
490 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
491 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
492 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
493 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
494 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
495 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
496 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
497 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
498 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
499 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
500 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
501 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
502 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
503 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
504 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
507 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
508 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
509 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
510 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
511 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
512 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
513 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
514 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.23
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.56
Nodule 0.14
Rhizoplane 2.94
Rhizosphere 83.75
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0055390 3300046511 Bacteria 2621
2 JGI24737J22298_10019519 3300001990 Bacteria 2167
3 JGI25406J46586_10000940 3300003203 Bacteria 13721
4 JGI25406J46586_10021547 3300003203 Bacteria 2584
5 JGI25406J46586_10030719 3300003203 Bacteria 2018
6 JGI25153J46596_10002123 3300003215 Bacteria 11603
7 rootH2_10190176 3300003320 Bacteria 2104
8 JGI25404J52841_10013369 3300003659 Bacteria 1780
9 JGI25405J52794_10090595 3300003911 Bacteria 677
10 Ga0058862_12858404 3300004803 Bacteria 1080
11 Ga0065712_10185320 3300005290 Bacteria 1172
12 Ga0065715_10216814 3300005293 Bacteria 1289
13 Ga0065715_10874724 3300005293 Bacteria 583
14 Ga0070658_10006980 3300005327 Bacteria 9123
15 Ga0070658_10131935 3300005327 Bacteria 2082
16 Ga0070676_10251595 3300005328 Bacteria 1179
17 Ga0070676_11003826 3300005328 Bacteria 627
18 Ga0070683_100004443 3300005329 Bacteria 11562
19 Ga0070683_100033923 3300005329 Bacteria 4658
20 Ga0070683_100035249 3300005329 Bacteria 4573
21 Ga0070683_100066371 3300005329 Bacteria 3361
22 Ga0070683_100803745 3300005329 Bacteria 902
23 Ga0070683_100912673 3300005329 Bacteria 843
24 Ga0070690_100434208 3300005330 Bacteria 971
25 Ga0070690_100482699 3300005330 Bacteria 924
26 Ga0070690_100706536 3300005330 Bacteria 775
27 Ga0070670_100027724 3300005331 Bacteria 4873
28 Ga0070670_100162620 3300005331 Bacteria 1935
29 Ga0070670_100430999 3300005331 Bacteria 1167
30 Ga0070670_100440685 3300005331 Bacteria 1153
31 Ga0070670_100610163 3300005331 Bacteria 977
32 Ga0070677_10871200 3300005333 Bacteria 519
33 Ga0068869_100000708 3300005334 Bacteria 18924
34 Ga0070666_10016127 3300005335 Bacteria 4774
35 Ga0070680_100274888 3300005336 Bacteria 1426
36 Ga0070680_101621571 3300005336 Bacteria 561
37 Ga0070680_101713781 3300005336 Bacteria 545
38 Ga0070682_100039976 3300005337 Bacteria 2884
39 Ga0070682_100094786 3300005337 Bacteria 1959
40 Ga0070682_100162503 3300005337 Bacteria 1544
41 Ga0070682_101020341 3300005337 Bacteria 688
42 Ga0068868_100251129 3300005338 Bacteria 1489
43 Ga0068868_101340941 3300005338 Bacteria 666
44 Ga0068868_102038785 3300005338 Bacteria 545
45 Ga0068868_102378353 3300005338 Bacteria 506
46 Ga0068868_102390218 3300005338 Bacteria 505
47 Ga0070660_100103462 3300005339 Bacteria 2258
48 Ga0070660_100187370 3300005339 Bacteria 1675
49 Ga0070660_101891519 3300005339 Bacteria 509
50 Ga0070689_100147781 3300005340 Bacteria 1894
51 Ga0070689_100242355 3300005340 Bacteria 1485
52 Ga0070689_100293898 3300005340 Bacteria 1351
53 Ga0070691_10124334 3300005341 Bacteria 1301
54 Ga0070691_10365617 3300005341 Bacteria 805
55 Ga0070687_101140673 3300005343 Bacteria 572
56 Ga0070661_100043611 3300005344 Bacteria 3276
57 Ga0070661_100056480 3300005344 Bacteria 2876
58 Ga0070661_100669555 3300005344 Bacteria 844
59 Ga0070661_101067422 3300005344 Bacteria 672
60 Ga0070692_10100582 3300005345 Bacteria 1584
61 Ga0070692_10388411 3300005345 Bacteria 878
62 Ga0070692_11316610 3300005345 Bacteria 519
63 Ga0070668_100009348 3300005347 Bacteria 7272
64 Ga0070668_100120941 3300005347 Bacteria 2093
65 Ga0070668_100429687 3300005347 Bacteria 1132
66 Ga0070668_101055912 3300005347 Bacteria 732
67 Ga0070668_101784614 3300005347 Unclassified 566
68 Ga0070668_101953501 3300005347 Bacteria 541
69 Ga0070669_100021100 3300005353 Bacteria 4655
70 Ga0070669_100034441 3300005353 Bacteria 3666
71 Ga0070669_100050479 3300005353 Bacteria 3039
72 Ga0070669_100426557 3300005353 Bacteria 1089
73 Ga0070669_100778364 3300005353 Bacteria 812
74 Ga0070669_101457439 3300005353 Bacteria 595
75 Ga0070669_101569385 3300005353 Bacteria 573
76 Ga0070675_100066680 3300005354 Bacteria 2978
77 Ga0070675_100306306 3300005354 Bacteria 1401
78 Ga0070671_100628595 3300005355 Bacteria 929
79 Ga0070671_101430619 3300005355 Bacteria 611
80 Ga0070671_101661487 3300005355 Bacteria 567
81 Ga0070674_100290609 3300005356 Bacteria 1299
82 Ga0070674_101038574 3300005356 Bacteria 721
83 Ga0070673_100050408 3300005364 Bacteria 3255
84 Ga0070673_100176614 3300005364 Bacteria 1826
85 Ga0070673_100452159 3300005364 Bacteria 1156
86 Ga0070673_101620520 3300005364 Bacteria 612
87 Ga0070688_100384736 3300005365 Bacteria 1035
88 Ga0070688_100398958 3300005365 Bacteria 1017
89 Ga0070688_100873219 3300005365 Bacteria 708
90 Ga0070659_100110611 3300005366 Bacteria 2217
91 Ga0070659_102041878 3300005366 Bacteria 515
92 Ga0070667_100005347 3300005367 Bacteria 10725
93 Ga0070667_100031455 3300005367 Bacteria 4425
94 Ga0070667_100263592 3300005367 Bacteria 1543
95 Ga0070667_100630757 3300005367 Bacteria 989
96 Ga0070667_100772708 3300005367 Bacteria 891
97 Ga0070667_101973085 3300005367 Bacteria 550
98 Ga0070667_102266512 3300005367 Bacteria 511
99 Ga0070709_10112676 3300005434 Bacteria 1831
100 Ga0070709_10243301 3300005434 Bacteria 1293
101 Ga0070709_10273829 3300005434 Bacteria 1224
102 Ga0070709_10293176 3300005434 Bacteria 1186
103 Ga0070714_100006563 3300005435 Bacteria 8999
104 Ga0070714_100073056 3300005435 Bacteria 2971
105 Ga0070714_100102355 3300005435 Bacteria 2525
106 Ga0070714_100660723 3300005435 Bacteria 1007
107 Ga0070714_100865746 3300005435 Bacteria 877
108 Ga0070713_100027835 3300005436 Bacteria 4457
109 Ga0070713_100031740 3300005436 Bacteria 4210
110 Ga0070713_100047532 3300005436 Bacteria 3528
111 Ga0070713_100060357 3300005436 Bacteria 3170
112 Ga0070713_100216314 3300005436 Bacteria 1737
113 Ga0070713_100227269 3300005436 Bacteria 1695
114 Ga0070710_10077434 3300005437 Bacteria 1933
115 Ga0070710_10196582 3300005437 Bacteria 1271
116 Ga0070710_11222692 3300005437 Bacteria 556
117 Ga0070701_10809268 3300005438 Bacteria 640
118 Ga0070701_11207723 3300005438 Bacteria 537
119 Ga0070711_101028427 3300005439 Bacteria 708
120 Ga0070711_101118662 3300005439 Bacteria 679
121 Ga0070711_101947352 3300005439 Bacteria 517
122 Ga0070705_100672043 3300005440 Bacteria 810
123 Ga0070705_101437375 3300005440 Bacteria 576
124 Ga0070700_100888587 3300005441 Bacteria 725
125 Ga0070700_100958214 3300005441 Bacteria 701
126 Ga0070708_100252458 3300005445 Bacteria 1657
127 Ga0070708_100270417 3300005445 Bacteria 1598
128 Ga0070708_101540875 3300005445 Bacteria 619
129 Ga0070663_101250849 3300005455 Bacteria 653
130 Ga0070678_100038096 3300005456 Bacteria 3382
131 Ga0070678_100343831 3300005456 Bacteria 1281
132 Ga0070678_100496516 3300005456 Bacteria 1076
133 Ga0070678_100566086 3300005456 Bacteria 1010
134 Ga0070678_101876861 3300005456 Bacteria 566
135 Ga0070662_100161909 3300005457 Bacteria 1751
136 Ga0070662_100334207 3300005457 Bacteria 1238
137 Ga0070681_10048012 3300005458 Bacteria 4267
138 Ga0070681_10052271 3300005458 Bacteria 4074
139 Ga0070681_11164486 3300005458 Bacteria 692
140 Ga0070681_11432511 3300005458 Bacteria 615
141 Ga0070681_11505719 3300005458 Bacteria 597
142 Ga0068867_100026445 3300005459 Bacteria 4167
143 Ga0068867_100086826 3300005459 Bacteria 2368
144 Ga0068867_100192548 3300005459 Bacteria 1628
145 Ga0068867_100617106 3300005459 Bacteria 948
146 Ga0068867_101875773 3300005459 Bacteria 565
147 Ga0070685_10342578 3300005466 Bacteria 1020
148 Ga0070685_10413731 3300005466 Bacteria 937
149 Ga0070685_10654335 3300005466 Bacteria 762
150 Ga0070685_11123310 3300005466 Bacteria 595
151 Ga0070706_100065125 3300005467 Bacteria 3370
152 Ga0070707_100065107 3300005468 Unclassified 3501
153 Ga0070707_101370156 3300005468 Bacteria 674
154 Ga0070698_100058117 3300005471 Bacteria 3911
155 Ga0070698_100090301 3300005471 Bacteria 3047
156 Ga0070698_101609126 3300005471 Unclassified 602
157 Ga0070699_100059857 3300005518 Bacteria 3299
158 Ga0070679_100059679 3300005530 Bacteria 3801
159 Ga0070679_100382826 3300005530 Bacteria 1353
160 Ga0070679_100392092 3300005530 Bacteria 1335
161 Ga0070679_100444240 3300005530 Bacteria 1242
162 Ga0070679_101038979 3300005530 Bacteria 764
163 Ga0070679_101304261 3300005530 Bacteria 672
164 Ga0070684_100007463 3300005535 Bacteria 8503
165 Ga0070684_100012697 3300005535 Bacteria 6760
166 Ga0070684_100029010 3300005535 Bacteria 4685
167 Ga0070684_100106264 3300005535 Bacteria 2512
168 Ga0070684_100967433 3300005535 Bacteria 798
169 Ga0070684_101395147 3300005535 Bacteria 660
170 Ga0070697_100020437 3300005536 Bacteria 5237
171 Ga0070697_100508271 3300005536 Bacteria 1054
172 Ga0068853_100174646 3300005539 Bacteria 1945
173 Ga0068853_100239099 3300005539 Bacteria 1664
174 Ga0068853_100301289 3300005539 Bacteria 1482
175 Ga0068853_100478387 3300005539 Bacteria 1174
176 Ga0068853_100533732 3300005539 Bacteria 1110
177 Ga0068853_100637485 3300005539 Bacteria 1014
178 Ga0068853_101071634 3300005539 Bacteria 777
179 Ga0068853_101948537 3300005539 Bacteria 570
180 Ga0068853_101982387 3300005539 Bacteria 564
181 Ga0070672_100010053 3300005543 Bacteria 6550
182 Ga0070672_100334253 3300005543 Bacteria 1289
183 Ga0070672_100538371 3300005543 Bacteria 1013
184 Ga0070672_101073380 3300005543 Bacteria 715
185 Ga0070686_101810100 3300005544 Bacteria 520
186 Ga0070686_101841928 3300005544 Bacteria 516
187 Ga0070695_101293325 3300005545 Bacteria 602
188 Ga0070696_100310212 3300005546 Bacteria 1211
189 Ga0070696_101611494 3300005546 Bacteria 558
190 Ga0070693_100181407 3300005547 Bacteria 1355
191 Ga0070693_100465017 3300005547 Bacteria 891
192 Ga0070693_100969406 3300005547 Unclassified 641
193 Ga0070693_100976858 3300005547 Bacteria 639
194 Ga0070665_100020492 3300005548 Bacteria 6641
195 Ga0070665_100271847 3300005548 Bacteria 1696
196 Ga0070665_100385356 3300005548 Bacteria 1409
197 Ga0070665_100783324 3300005548 Bacteria 967
198 Ga0070665_101504249 3300005548 Bacteria 682
199 Ga0070704_100216017 3300005549 Bacteria 1556
200 Ga0068855_100025340 3300005563 Bacteria 7097
201 Ga0068855_100168944 3300005563 Bacteria 2477
202 Ga0068855_100187077 3300005563 Bacteria 2338
203 Ga0068855_100713535 3300005563 Bacteria 1072
204 Ga0068855_101178465 3300005563 Bacteria 797
205 Ga0068855_101303329 3300005563 Bacteria 752
206 Ga0068855_101603565 3300005563 Bacteria 666
207 Ga0070664_100064589 3300005564 Bacteria 3122
208 Ga0070664_100090167 3300005564 Bacteria 2653
209 Ga0070664_100316783 3300005564 Bacteria 1412
210 Ga0070664_100375151 3300005564 Bacteria 1297
211 Ga0070664_100423770 3300005564 Bacteria 1219
212 Ga0070664_101261183 3300005564 Bacteria 698
213 Ga0068857_100041668 3300005577 Bacteria 4072
214 Ga0068857_100096366 3300005577 Bacteria 2651
215 Ga0068857_100541876 3300005577 Bacteria 1095
216 Ga0068857_101286352 3300005577 Bacteria 709
217 Ga0068854_100219364 3300005578 Bacteria 1504
218 Ga0068854_100740106 3300005578 Bacteria 852
219 Ga0068854_101699283 3300005578 Bacteria 577
220 Ga0068856_100113034 3300005614 Bacteria 2714
221 Ga0068856_100212884 3300005614 Bacteria 1948
222 Ga0068856_100722067 3300005614 Bacteria 1017
223 Ga0068856_101044042 3300005614 Bacteria 835
224 Ga0068856_102147685 3300005614 Bacteria 568
225 Ga0070702_100019857 3300005615 Bacteria 3512
226 Ga0070702_100485335 3300005615 Bacteria 904
227 Ga0070702_101062416 3300005615 Bacteria 645
228 Ga0068852_100032353 3300005616 Bacteria 4330
229 Ga0068852_100422225 3300005616 Bacteria 1315
230 Ga0068852_100814121 3300005616 Bacteria 948
231 Ga0068852_101030749 3300005616 Bacteria 842
232 Ga0068852_101324341 3300005616 Bacteria 742
233 Ga0068859_100001245 3300005617 Bacteria 25989
234 Ga0068859_100184715 3300005617 Bacteria 2168
235 Ga0068859_102411696 3300005617 Bacteria 580
236 Ga0068864_100008273 3300005618 Bacteria 8583
237 Ga0068864_100042879 3300005618 Bacteria 3872
238 Ga0068864_102020404 3300005618 Bacteria 583
239 Ga0068864_102266430 3300005618 Bacteria 549
240 Ga0068866_10059936 3300005718 Bacteria 1971
241 Ga0068866_10295868 3300005718 Bacteria 1009
242 Ga0068866_10833761 3300005718 Bacteria 643
243 Ga0068861_100006169 3300005719 Bacteria 8155
244 Ga0068861_100749385 3300005719 Bacteria 912
245 Ga0068861_100948810 3300005719 Bacteria 818
246 Ga0068861_101210984 3300005719 Bacteria 731
247 Ga0068851_10234929 3300005834 Bacteria 1035
248 Ga0068870_10002331 3300005840 Bacteria 7896
249 Ga0068870_10488874 3300005840 Bacteria 818
250 Ga0068870_10661408 3300005840 Bacteria 717
251 Ga0068870_11124370 3300005840 Bacteria 566
252 Ga0068870_11242674 3300005840 Bacteria 541
253 Ga0068863_100000873 3300005841 Bacteria 30215
254 Ga0068863_100086250 3300005841 Bacteria 2974
255 Ga0068863_100302684 3300005841 Bacteria 1551
256 Ga0068863_101154561 3300005841 Bacteria 780
257 Ga0068863_101478691 3300005841 Bacteria 688
258 Ga0068858_100002812 3300005842 Bacteria 17501
259 Ga0068858_100143105 3300005842 Bacteria 2245
260 Ga0068858_100870038 3300005842 Bacteria 881
261 Ga0068858_100949509 3300005842 Bacteria 842
262 Ga0068858_100992624 3300005842 Bacteria 823
263 Ga0068858_101085492 3300005842 Unclassified 786
264 Ga0068858_101988129 3300005842 Bacteria 575
265 Ga0068860_100000149 3300005843 Bacteria 113068
266 Ga0068860_100012312 3300005843 Bacteria 8428
267 Ga0068860_100521163 3300005843 Bacteria 1189
268 Ga0068860_100792664 3300005843 Bacteria 961
269 Ga0068860_101365343 3300005843 Bacteria 730
270 Ga0068860_101617533 3300005843 Bacteria 670
271 Ga0068860_101762671 3300005843 Bacteria 641
272 Ga0068862_100012163 3300005844 Bacteria 7115
273 Ga0068862_100131633 3300005844 Bacteria 2213
274 Ga0068862_100222846 3300005844 Bacteria 1708
275 Ga0068862_100371395 3300005844 Bacteria 1332
276 Ga0068862_100406614 3300005844 Bacteria 1274
277 Ga0068862_100559699 3300005844 Bacteria 1093
278 Ga0068862_101773246 3300005844 Unclassified 626
279 Ga0068862_102369173 3300005844 Bacteria 542
280 Ga0081455_10001001 3300005937 Bacteria 35840
281 Ga0081455_10007427 3300005937 Bacteria 11546
282 Ga0081455_10090302 3300005937 Bacteria 2484
283 Ga0081455_10091268 3300005937 Bacteria 2467
284 Ga0081455_10128235 3300005937 Bacteria 1988
285 Ga0081455_10910420 3300005937 Bacteria 547
286 Ga0081538_10138715 3300005981 Bacteria 1126
287 Ga0081540_1000003 3300005983 Bacteria 233942
288 Ga0081540_1003189 3300005983 Bacteria 13057
289 Ga0081540_1035955 3300005983 Bacteria 2649
290 Ga0081540_1186596 3300005983 Bacteria 769
291 Ga0081539_10000191 3300005985 Bacteria 142387
292 Ga0081539_10001452 3300005985 Bacteria 40486
293 Ga0081539_10001574 3300005985 Bacteria 37718
294 Ga0081539_10007767 3300005985 Bacteria 9608
295 Ga0070717_10002484 3300006028 Bacteria 13019
296 Ga0070717_10003662 3300006028 Bacteria 11032
297 Ga0070717_10060928 3300006028 Bacteria 3126
298 Ga0070717_11202793 3300006028 Bacteria 690
299 Ga0075365_10005466 3300006038 Bacteria 6856
300 Ga0075365_10169119 3300006038 Bacteria 1525
301 Ga0075365_10207547 3300006038 Bacteria 1373
302 Ga0075365_10558838 3300006038 Bacteria 809
303 Ga0075365_10597471 3300006038 Bacteria 780
304 Ga0075365_10630465 3300006038 Bacteria 758
305 Ga0075365_10675477 3300006038 Bacteria 730
306 Ga0075368_10110543 3300006042 Bacteria 1133
307 Ga0075368_10374334 3300006042 Bacteria 622
308 Ga0075363_100067216 3300006048 Bacteria 1942
309 Ga0075363_100141991 3300006048 Bacteria 1352
310 Ga0075364_10035360 3300006051 Bacteria 3228
311 Ga0075364_10174371 3300006051 Bacteria 1454
312 Ga0075364_10503654 3300006051 Bacteria 828
313 Ga0075432_10085982 3300006058 Bacteria 1146
314 Ga0075432_10383668 3300006058 Bacteria 603
315 Ga0070715_10410531 3300006163 Bacteria 755
316 Ga0070715_10647226 3300006163 Unclassified 625
317 Ga0070715_11047873 3300006163 Bacteria 511
318 Ga0070716_100092196 3300006173 Bacteria 1836
319 Ga0070716_100174999 3300006173 Bacteria 1404
320 Ga0070716_101256805 3300006173 Bacteria 597
321 Ga0070716_101463376 3300006173 Bacteria 557
322 Ga0070712_100051865 3300006175 Bacteria 2859
323 Ga0070712_100729473 3300006175 Bacteria 847
324 Ga0075362_10002622 3300006177 Bacteria 6090
325 Ga0075362_10003948 3300006177 Bacteria 5269
326 Ga0075362_10004980 3300006177 Bacteria 4818
327 Ga0075362_10067150 3300006177 Bacteria 1631
328 Ga0075362_10104884 3300006177 Bacteria 1325
329 Ga0075362_10527718 3300006177 Bacteria 605
330 Ga0075367_10006371 3300006178 Bacteria 5956
331 Ga0075367_10081795 3300006178 Bacteria 1955
332 Ga0075367_10372777 3300006178 Bacteria 902
333 Ga0075367_10484337 3300006178 Bacteria 784
334 Ga0075369_10001306 3300006186 Bacteria 8479
335 Ga0075369_10075756 3300006186 Bacteria 1486
336 Ga0075369_10149250 3300006186 Bacteria 1068
337 Ga0075366_10000880 3300006195 Bacteria 14505
338 Ga0075366_10157169 3300006195 Bacteria 1377
339 Ga0075366_10187591 3300006195 Bacteria 1256
340 Ga0075366_10190723 3300006195 Bacteria 1245
341 Ga0075366_10425519 3300006195 Bacteria 818
342 Ga0097621_100278535 3300006237 Bacteria 1472
343 Ga0097621_100663585 3300006237 Bacteria 958
344 Ga0097621_100862381 3300006237 Bacteria 842
345 Ga0097621_101373661 3300006237 Bacteria 668
346 Ga0075370_10045498 3300006353 Bacteria 2482
347 Ga0075370_10078629 3300006353 Bacteria 1894
348 Ga0075370_10224866 3300006353 Bacteria 1109
349 Ga0075370_10346164 3300006353 Bacteria 887
350 Ga0075370_10435715 3300006353 Bacteria 788
351 Ga0068871_100385436 3300006358 Bacteria 1246
352 Ga0068871_100705272 3300006358 Bacteria 925
353 Ga0075428_100045105 3300006844 Bacteria 4844
354 Ga0075428_100080803 3300006844 Bacteria 3548
355 Ga0075428_100561180 3300006844 Unclassified 1220
356 Ga0075428_101171392 3300006844 Bacteria 811
357 Ga0075428_102272686 3300006844 Unclassified 558
358 Ga0075430_100084875 3300006846 Bacteria 2652
359 Ga0075430_100118025 3300006846 Bacteria 2211
360 Ga0075430_100812322 3300006846 Unclassified 771
361 Ga0075431_100014415 3300006847 Bacteria 7996
362 Ga0075431_100034312 3300006847 Bacteria 5227
363 Ga0075431_102136570 3300006847 Unclassified 514
364 Ga0075433_10003359 3300006852 Bacteria 12372
365 Ga0075433_10018901 3300006852 Bacteria 5736
366 Ga0075434_100017326 3300006871 Bacteria 6936
367 Ga0075434_100020139 3300006871 Bacteria 6465
368 Ga0075434_100067222 3300006871 Bacteria 3571
369 Ga0075434_100193791 3300006871 Bacteria 2052
370 Ga0075434_100522982 3300006871 Bacteria 1207
371 Ga0075434_100525994 3300006871 Bacteria 1203
372 Ga0075434_100866084 3300006871 Bacteria 919
373 Ga0075434_100870128 3300006871 Bacteria 916
374 Ga0075434_101077628 3300006871 Bacteria 817
375 Ga0075429_100047982 3300006880 Bacteria 3714
376 Ga0075429_100222872 3300006880 Bacteria 1652
377 Ga0075429_100437713 3300006880 Unclassified 1146
378 Ga0075429_100609623 3300006880 Bacteria 956
379 Ga0068865_100266213 3300006881 Bacteria 1359
380 Ga0075436_100270712 3300006914 Bacteria 1213
381 Ga0075436_100921172 3300006914 Unclassified 654
382 Ga0097620_100001245 3300006931 Bacteria 25989
383 Ga0097620_100184722 3300006931 Bacteria 2168
384 Ga0097620_102411355 3300006931 Bacteria 580
385 Ga0075435_100235203 3300007076 Bacteria 1557
386 Ga0075435_100531957 3300007076 Bacteria 1017
387 Ga0075435_100619304 3300007076 Bacteria 939
388 Ga0099794_10017466 3300007265 Bacteria 3199
389 Ga0099795_10104454 3300007788 Bacteria 1115
390 Ga0099795_10106440 3300007788 Bacteria 1106
391 Ga0099795_10473198 3300007788 Bacteria 580
392 Ga0105250_10108891 3300009092 Bacteria 1134
393 Ga0105240_10075127 3300009093 Bacteria 4169
394 Ga0105240_10357095 3300009093 Bacteria 1656
395 Ga0105240_10822753 3300009093 Bacteria 1004
396 Ga0105240_11779767 3300009093 Bacteria 642
397 Ga0105240_11879762 3300009093 Bacteria 623
398 Ga0111539_10015625 3300009094 Bacteria 9437
399 Ga0111539_10046064 3300009094 Bacteria 5219
400 Ga0111539_10068483 3300009094 Bacteria 4190
401 Ga0111539_10089231 3300009094 Bacteria 3622
402 Ga0111539_10645809 3300009094 Bacteria 1232
403 Ga0111539_12192369 3300009094 Bacteria 641
404 Ga0105245_10257845 3300009098 Bacteria 1696
405 Ga0105245_10575581 3300009098 Bacteria 1150
406 Ga0105245_10593084 3300009098 Bacteria 1134
407 Ga0105245_11669470 3300009098 Bacteria 689
408 Ga0105245_11764188 3300009098 Bacteria 671
409 Ga0105245_11818477 3300009098 Bacteria 662
410 Ga0105245_12994096 3300009098 Bacteria 524
411 Ga0105245_13258386 3300009098 Unclassified 503
412 Ga0105247_10041211 3300009101 Bacteria 2825
413 Ga0105247_10070694 3300009101 Bacteria 2181
414 Ga0105247_10324994 3300009101 Bacteria 1074
415 Ga0105247_10464790 3300009101 Bacteria 915
416 Ga0105247_10515367 3300009101 Bacteria 874
417 Ga0105247_10562553 3300009101 Bacteria 840
418 Ga0105247_11345847 3300009101 Bacteria 575
419 Ga0105247_11452821 3300009101 Bacteria 557
420 Ga0114129_10761458 3300009147 Bacteria 1239
421 Ga0114129_11558884 3300009147 Bacteria 810
422 Ga0114129_13123651 3300009147 Bacteria 541
423 Ga0105243_10188988 3300009148 Bacteria 1797
424 Ga0105243_11152555 3300009148 Bacteria 786
425 Ga0105243_11241130 3300009148 Bacteria 760
426 Ga0105243_11378026 3300009148 Bacteria 725
427 Ga0105243_12463319 3300009148 Bacteria 559
428 Ga0105241_10128324 3300009174 Bacteria 2050
429 Ga0105241_10304189 3300009174 Bacteria 1369
430 Ga0105241_11754185 3300009174 Bacteria 605
431 Ga0105241_11767469 3300009174 Bacteria 602
432 Ga0105241_11931794 3300009174 Bacteria 579
433 Ga0105241_11989951 3300009174 Bacteria 572
434 Ga0105242_11835702 3300009176 Bacteria 645
435 Ga0105242_12797035 3300009176 Bacteria 538
436 Ga0105248_10002517 3300009177 Bacteria 20397
437 Ga0105248_10049520 3300009177 Bacteria 4712
438 Ga0105248_11398025 3300009177 Bacteria 792
439 Ga0105248_11404553 3300009177 Bacteria 790
440 Ga0105248_12667761 3300009177 Bacteria 570
441 Ga0105248_13334491 3300009177 Bacteria 510
442 Ga0105237_10053338 3300009545 Bacteria 4056
443 Ga0105237_10055453 3300009545 Bacteria 3969
444 Ga0105237_10149240 3300009545 Bacteria 2334
445 Ga0105237_10229785 3300009545 Bacteria 1856
446 Ga0105237_10363524 3300009545 Bacteria 1451
447 Ga0105237_10876228 3300009545 Bacteria 905
448 Ga0105237_11547053 3300009545 Bacteria 670
449 Ga0105237_11926353 3300009545 Bacteria 599
450 Ga0105238_10257663 3300009551 Bacteria 1724
451 Ga0105238_10345144 3300009551 Bacteria 1477
452 Ga0105238_10793711 3300009551 Bacteria 962
453 Ga0105238_11280213 3300009551 Bacteria 759
454 Ga0105249_10117602 3300009553 Bacteria 2521
455 Ga0105249_11197395 3300009553 Bacteria 831
456 Ga0105249_11326698 3300009553 Bacteria 791
457 Ga0105249_11365889 3300009553 Bacteria 780
458 Ga0105249_12128511 3300009553 Bacteria 634
459 Ga0105035_116424 3300009988 Bacteria 684
460 Ga0099796_10095363 3300010159 Bacteria 1112
461 Ga0099796_10119314 3300010159 Bacteria 1012
462 Ga0099796_10533419 3300010159 Bacteria 527
463 Ga0105239_10085772 3300010375 Bacteria 3471
464 Ga0105239_10207156 3300010375 Bacteria 2197
465 Ga0105239_10644134 3300010375 Bacteria 1210
466 Ga0105239_12092602 3300010375 Bacteria 658
467 Ga0105239_12483287 3300010375 Bacteria 604
468 Ga0105239_12680615 3300010375 Bacteria 581
469 Ga0105246_10225045 3300011119 Bacteria 1473
470 Ga0105246_10772466 3300011119 Bacteria 850
471 Ga0105246_10811141 3300011119 Bacteria 831
472 Ga0157321_1017925 3300012487 Bacteria 622
473 Ga0157373_10304337 3300013100 Bacteria 1132
474 Ga0157373_10445422 3300013100 Bacteria 931
475 Ga0157371_10037740 3300013102 Bacteria 3457
476 Ga0157371_10202736 3300013102 Bacteria 1422
477 Ga0157371_10806974 3300013102 Bacteria 707
478 Ga0157370_10240766 3300013104 Bacteria 1674
479 Ga0157370_10598302 3300013104 Bacteria 1010
480 Ga0157370_10676620 3300013104 Bacteria 942
481 Ga0157370_10728503 3300013104 Bacteria 904
482 Ga0157370_10742744 3300013104 Bacteria 894
483 Ga0157370_11861012 3300013104 Bacteria 540
484 Ga0157370_12027016 3300013104 Bacteria 516
485 Ga0157369_10059379 3300013105 Bacteria 4124
486 Ga0157369_10273787 3300013105 Bacteria 1759
487 Ga0157369_10288107 3300013105 Bacteria 1710
488 Ga0157369_10484948 3300013105 Bacteria 1279
489 Ga0157369_10524350 3300013105 Bacteria 1225
490 Ga0157369_11040671 3300013105 Bacteria 838
491 Ga0157374_10194493 3300013296 Bacteria 1985
492 Ga0157374_10202392 3300013296 Bacteria 1944
493 Ga0157374_10782565 3300013296 Bacteria 969
494 Ga0157374_10797268 3300013296 Bacteria 960
495 Ga0157374_11170581 3300013296 Bacteria 790
496 Ga0157374_12908873 3300013296 Unclassified 506
497 Ga0157378_10016126 3300013297 Bacteria 6543
498 Ga0157378_10180605 3300013297 Bacteria 1985
499 Ga0157378_10395136 3300013297 Bacteria 1361
500 Ga0157378_10716397 3300013297 Bacteria 1021
501 Ga0157378_11194236 3300013297 Bacteria 800
502 Ga0157378_12561561 3300013297 Bacteria 562
503 Ga0163162_10082452 3300013306 Bacteria 3288
504 Ga0163162_10096960 3300013306 Bacteria 3037
505 Ga0163162_10354072 3300013306 Bacteria 1601
506 Ga0163162_10395900 3300013306 Bacteria 1514
507 Ga0163162_11056463 3300013306 Bacteria 919
508 Ga0163162_11410211 3300013306 Bacteria 793
509 Ga0163162_12087887 3300013306 Bacteria 650
510 Ga0163162_13246855 3300013306 Bacteria 521
511 Ga0163162_13334989 3300013306 Bacteria 514
512 Ga0157372_10044917 3300013307 Bacteria 4897
513 Ga0157372_10237973 3300013307 Bacteria 2112
514 Ga0157372_10538562 3300013307 Bacteria 1361
515 Ga0157372_11478237 3300013307 Bacteria 783
516 Ga0157372_12429284 3300013307 Bacteria 602
517 Ga0157375_10222455 3300013308 Bacteria 2046
518 Ga0157375_11454833 3300013308 Bacteria 808
519 Ga0163163_10000812 3300014325 Bacteria 26556
520 Ga0163163_10113227 3300014325 Bacteria 2743
521 Ga0163163_10490016 3300014325 Bacteria 1291
522 Ga0163163_11050982 3300014325 Unclassified 877
523 Ga0163163_12660334 3300014325 Bacteria 558
524 Ga0157380_11695684 3300014326 Bacteria 689
525 Ga0157380_11916092 3300014326 Bacteria 653
526 Ga0157380_12261617 3300014326 Bacteria 608
527 Ga0182008_10244091 3300014497 Bacteria 925
528 Ga0182008_10566222 3300014497 Bacteria 633
529 Ga0182008_10846232 3300014497 Bacteria 534
530 Ga0157377_10540151 3300014745 Bacteria 822
531 Ga0157377_10888734 3300014745 Bacteria 665
532 Ga0157377_11295171 3300014745 Bacteria 569
533 Ga0157379_10000401 3300014968 Bacteria 35047
534 Ga0157379_10398503 3300014968 Bacteria 1265
535 Ga0157379_10666434 3300014968 Bacteria 975
536 Ga0157379_10926495 3300014968 Bacteria 828
537 Ga0157379_11014445 3300014968 Bacteria 792
538 Ga0157379_11747140 3300014968 Bacteria 610
539 Ga0157376_10058405 3300014969 Bacteria 3231
540 Ga0157376_10452778 3300014969 Bacteria 1252
541 Ga0157376_10596257 3300014969 Bacteria 1099
542 Ga0157376_11840955 3300014969 Bacteria 642
543 Ga0157376_12196332 3300014969 Bacteria 591
544 Ga0157376_12687351 3300014969 Bacteria 538
545 Ga0157376_13008035 3300014969 Bacteria 510
546 Ga0163161_10229479 3300017792 Bacteria 1440
547 Ga0163161_10572716 3300017792 Bacteria 928
548 Ga0197907_11200871 3300020069 Bacteria 2421
549 Ga0206356_10599982 3300020070 Bacteria 756
550 Ga0206356_11246173 3300020070 Unclassified 544
551 Ga0206349_1682998 3300020075 Bacteria 788
552 Ga0206355_1179373 3300020076 Bacteria 1939
553 Ga0206350_10626026 3300020080 Bacteria 4374
554 Ga0206354_11293970 3300020081 Bacteria 1471
555 Ga0206353_10193602 3300020082 Bacteria 897
556 Ga0154015_1702973 3300020610 Bacteria 1198
557 Ga0213873_10263288 3300021358 Bacteria 549
558 Ga0213872_10400673 3300021361 Bacteria 556
559 Ga0213874_10022748 3300021377 Bacteria 1742
560 Ga0213876_10204990 3300021384 Bacteria 1048
561 Ga0213871_10023878 3300021441 Bacteria 1543
562 Ga0224712_10011865 3300022467 Bacteria 2719
563 Ga0224712_10361874 3300022467 Bacteria 687
564 Ga0209758_1000183 3300025297 Bacteria 140623
565 Ga0209758_1022536 3300025297 Bacteria 2881
566 Ga0209758_1064599 3300025297 Bacteria 1185
567 Ga0207426_1102116 3300025302 Bacteria 738
568 Ga0207697_10113298 3300025315 Bacteria 1162
569 Ga0207697_10136582 3300025315 Bacteria 1061
570 Ga0207656_10080629 3300025321 Bacteria 1462
571 Ga0207656_10269096 3300025321 Bacteria 838
572 Ga0207653_10038324 3300025885 Bacteria 1566
573 Ga0207682_10283279 3300025893 Bacteria 775
574 Ga0207692_10107183 3300025898 Bacteria 1544
575 Ga0207692_10195267 3300025898 Bacteria 1187
576 Ga0207692_10304093 3300025898 Bacteria 971
577 Ga0207692_10457524 3300025898 Bacteria 804
578 Ga0207692_10731483 3300025898 Bacteria 644
579 Ga0207642_10030849 3300025899 Bacteria 2238
580 Ga0207642_10468464 3300025899 Bacteria 766
581 Ga0207710_10059715 3300025900 Bacteria 1727
582 Ga0207710_10152875 3300025900 Bacteria 1120
583 Ga0207710_10241257 3300025900 Bacteria 902
584 Ga0207710_10441552 3300025900 Bacteria 671
585 Ga0207710_10503179 3300025900 Bacteria 629
586 Ga0207688_10264866 3300025901 Bacteria 1044
587 Ga0207688_10465756 3300025901 Bacteria 789
588 Ga0207688_10855520 3300025901 Bacteria 576
589 Ga0207680_11004005 3300025903 Bacteria 598
590 Ga0207685_10191741 3300025905 Bacteria 954
591 Ga0207685_10574958 3300025905 Bacteria 602
592 Ga0207699_10025581 3300025906 Bacteria 3242
593 Ga0207699_10199589 3300025906 Bacteria 1355
594 Ga0207699_10284276 3300025906 Bacteria 1150
595 Ga0207699_10679423 3300025906 Bacteria 753
596 Ga0207699_10870700 3300025906 Bacteria 664
597 Ga0207699_11357232 3300025906 Bacteria 526
598 Ga0207699_11370861 3300025906 Bacteria 523
599 Ga0207699_11423756 3300025906 Bacteria 513
600 Ga0207645_10074238 3300025907 Bacteria 2177
601 Ga0207645_10214199 3300025907 Bacteria 1269
602 Ga0207645_10291619 3300025907 Bacteria 1085
603 Ga0207645_10321812 3300025907 Bacteria 1032
604 Ga0207643_10022986 3300025908 Bacteria 3437
605 Ga0207643_10147552 3300025908 Bacteria 1408
606 Ga0207643_11093598 3300025908 Bacteria 514
607 Ga0207643_11103461 3300025908 Bacteria 512
608 Ga0207705_10087806 3300025909 Bacteria 2274
609 Ga0207684_10057054 3300025910 Bacteria 3313
610 Ga0207654_10276160 3300025911 Bacteria 1135
611 Ga0207654_10284125 3300025911 Bacteria 1120
612 Ga0207707_10019814 3300025912 Bacteria 5873
613 Ga0207707_10027775 3300025912 Bacteria 4947
614 Ga0207707_11157195 3300025912 Bacteria 628
615 Ga0207707_11525684 3300025912 Bacteria 529
616 Ga0207695_10054576 3300025913 Bacteria 4171
617 Ga0207695_10340223 3300025913 Bacteria 1388
618 Ga0207695_11330962 3300025913 Bacteria 599
619 Ga0207671_10099942 3300025914 Bacteria 2196
620 Ga0207671_10099958 3300025914 Bacteria 2196
621 Ga0207671_10103991 3300025914 Bacteria 2154
622 Ga0207671_10174515 3300025914 Bacteria 1670
623 Ga0207671_10292548 3300025914 Bacteria 1286
624 Ga0207671_10397523 3300025914 Bacteria 1096
625 Ga0207693_10008445 3300025915 Bacteria 8428
626 Ga0207693_10223615 3300025915 Bacteria 1479
627 Ga0207663_10337156 3300025916 Bacteria 1138
628 Ga0207663_10385522 3300025916 Bacteria 1068
629 Ga0207663_10554305 3300025916 Bacteria 899
630 Ga0207663_10953971 3300025916 Bacteria 687
631 Ga0207663_10982780 3300025916 Bacteria 677
632 Ga0207660_10017576 3300025917 Bacteria 4754
633 Ga0207660_10263412 3300025917 Bacteria 1364
634 Ga0207660_10742314 3300025917 Bacteria 801
635 Ga0207657_10099624 3300025919 Bacteria 2413
636 Ga0207657_10381680 3300025919 Bacteria 1109
637 Ga0207649_10143932 3300025920 Bacteria 1634
638 Ga0207649_10280444 3300025920 Bacteria 1211
639 Ga0207649_10295375 3300025920 Bacteria 1183
640 Ga0207649_10781425 3300025920 Bacteria 744
641 Ga0207649_10966266 3300025920 Bacteria 669
642 Ga0207652_10223971 3300025921 Bacteria 1695
643 Ga0207652_10407074 3300025921 Bacteria 1227
644 Ga0207652_10654237 3300025921 Bacteria 940
645 Ga0207652_11076474 3300025921 Bacteria 704
646 Ga0207652_11767678 3300025921 Bacteria 523
647 Ga0207646_10020117 3300025922 Bacteria 6190
648 Ga0207646_10223738 3300025922 Bacteria 1700
649 Ga0207646_10624543 3300025922 Bacteria 966
650 Ga0207681_10065491 3300025923 Bacteria 2512
651 Ga0207681_10108734 3300025923 Bacteria 2013
652 Ga0207681_10462411 3300025923 Bacteria 1034
653 Ga0207681_10918781 3300025923 Bacteria 733
654 Ga0207694_10168517 3300025924 Bacteria 1772
655 Ga0207694_10426931 3300025924 Bacteria 1105
656 Ga0207694_10437989 3300025924 Bacteria 1090
657 Ga0207694_10712461 3300025924 Bacteria 846
658 Ga0207650_10019282 3300025925 Bacteria 4790
659 Ga0207650_10160698 3300025925 Bacteria 1780
660 Ga0207650_10374865 3300025925 Bacteria 1174
661 Ga0207650_10382323 3300025925 Bacteria 1163
662 Ga0207650_10500076 3300025925 Bacteria 1016
663 Ga0207650_10670211 3300025925 Bacteria 875
664 Ga0207659_10051717 3300025926 Bacteria 2923
665 Ga0207687_10984439 3300025927 Bacteria 723
666 Ga0207687_11779417 3300025927 Bacteria 528
667 Ga0207700_10011883 3300025928 Bacteria 5581
668 Ga0207700_10050788 3300025928 Bacteria 3092
669 Ga0207700_10099449 3300025928 Bacteria 2316
670 Ga0207700_10117337 3300025928 Bacteria 2152
671 Ga0207700_10233831 3300025928 Bacteria 1564
672 Ga0207700_10249064 3300025928 Bacteria 1517
673 Ga0207664_10018321 3300025929 Bacteria 5152
674 Ga0207664_10104239 3300025929 Bacteria 2348
675 Ga0207664_10145841 3300025929 Bacteria 2007
676 Ga0207664_10231379 3300025929 Bacteria 1607
677 Ga0207664_10725311 3300025929 Bacteria 894
678 Ga0207644_10414810 3300025931 Bacteria 1102
679 Ga0207644_10881724 3300025931 Bacteria 750
680 Ga0207690_10019600 3300025932 Bacteria 4169
681 Ga0207690_10695748 3300025932 Bacteria 835
682 Ga0207706_10047908 3300025933 Bacteria 3780
683 Ga0207706_10358299 3300025933 Bacteria 1267
684 Ga0207706_11574436 3300025933 Bacteria 533
685 Ga0207686_10230613 3300025934 Bacteria 1342
686 Ga0207686_10308337 3300025934 Bacteria 1178
687 Ga0207709_10071831 3300025935 Bacteria 2199
688 Ga0207709_10506401 3300025935 Bacteria 943
689 Ga0207709_11820810 3300025935 Bacteria 506
690 Ga0207670_10058725 3300025936 Bacteria 2614
691 Ga0207670_10115792 3300025936 Bacteria 1940
692 Ga0207670_10173635 3300025936 Bacteria 1618
693 Ga0207670_10223015 3300025936 Bacteria 1444
694 Ga0207670_10393335 3300025936 Bacteria 1107
695 Ga0207670_11664827 3300025936 Bacteria 543
696 Ga0207669_10153160 3300025937 Bacteria 1618
697 Ga0207669_10253231 3300025937 Bacteria 1312
698 Ga0207669_11961854 3300025937 Bacteria 500
699 Ga0207704_10548350 3300025938 Bacteria 939
700 Ga0207704_10963653 3300025938 Unclassified 720
701 Ga0207704_11566462 3300025938 Bacteria 566
702 Ga0207665_10519596 3300025939 Bacteria 922
703 Ga0207665_11231095 3300025939 Bacteria 597
704 Ga0207691_10022379 3300025940 Bacteria 5961
705 Ga0207691_10048272 3300025940 Bacteria 3904
706 Ga0207691_10943404 3300025940 Bacteria 721
707 Ga0207691_10952283 3300025940 Bacteria 717
708 Ga0207711_10012928 3300025941 Bacteria 6934
709 Ga0207711_10243288 3300025941 Bacteria 1650
710 Ga0207711_12015424 3300025941 Bacteria 520
711 Ga0207689_10000171 3300025942 Bacteria 56716
712 Ga0207689_10676285 3300025942 Bacteria 870
713 Ga0207661_10012723 3300025944 Bacteria 6129
714 Ga0207661_10164372 3300025944 Bacteria 1927
715 Ga0207661_10481810 3300025944 Bacteria 1132
716 Ga0207661_10490613 3300025944 Bacteria 1122
717 Ga0207661_10583060 3300025944 Bacteria 1026
718 Ga0207661_10939988 3300025944 Bacteria 796
719 Ga0207661_11011652 3300025944 Bacteria 765
720 Ga0207661_12063635 3300025944 Bacteria 516
721 Ga0207679_10034445 3300025945 Bacteria 3572
722 Ga0207679_10244466 3300025945 Bacteria 1522
723 Ga0207679_10249924 3300025945 Bacteria 1507
724 Ga0207679_10349056 3300025945 Bacteria 1289
725 Ga0207679_10695184 3300025945 Bacteria 922
726 Ga0207667_10109147 3300025949 Bacteria 2854
727 Ga0207667_10119359 3300025949 Bacteria 2718
728 Ga0207667_10242401 3300025949 Bacteria 1844
729 Ga0207667_10351611 3300025949 Bacteria 1503
730 Ga0207667_10697254 3300025949 Bacteria 1018
731 Ga0207651_10230043 3300025960 Bacteria 1504
732 Ga0207651_10323237 3300025960 Bacteria 1290
733 Ga0207651_11298725 3300025960 Bacteria 654
734 Ga0207651_11465163 3300025960 Bacteria 615
735 Ga0207651_11666480 3300025960 Bacteria 574
736 Ga0207712_10238114 3300025961 Bacteria 1465
737 Ga0207712_11345480 3300025961 Bacteria 639
738 Ga0207668_10175746 3300025972 Unclassified 1684
739 Ga0207668_10662468 3300025972 Bacteria 914
740 Ga0207668_11229596 3300025972 Bacteria 673
741 Ga0207668_11542490 3300025972 Bacteria 600
742 Ga0207668_11905472 3300025972 Bacteria 536
743 Ga0207640_10121501 3300025981 Bacteria 1872
744 Ga0207640_10404867 3300025981 Bacteria 1112
745 Ga0207640_11457509 3300025981 Bacteria 614
746 Ga0207658_10036473 3300025986 Bacteria 3525
747 Ga0207658_10461656 3300025986 Unclassified 1126
748 Ga0207658_10569621 3300025986 Bacteria 1015
749 Ga0207677_10165314 3300026023 Bacteria 1724
750 Ga0207677_10977633 3300026023 Bacteria 767
751 Ga0207677_11645097 3300026023 Bacteria 595
752 Ga0207703_10000464 3300026035 Bacteria 42704
753 Ga0207703_10461782 3300026035 Bacteria 1188
754 Ga0207703_10480171 3300026035 Bacteria 1164
755 Ga0207703_10495105 3300026035 Bacteria 1147
756 Ga0207703_10583978 3300026035 Bacteria 1056
757 Ga0207703_11657165 3300026035 Bacteria 615
758 Ga0207703_11948419 3300026035 Unclassified 564
759 Ga0207703_12285119 3300026035 Bacteria 517
760 Ga0207639_10079336 3300026041 Bacteria 2594
761 Ga0207639_10156367 3300026041 Bacteria 1916
762 Ga0207639_10225846 3300026041 Bacteria 1620
763 Ga0207639_10496085 3300026041 Bacteria 1115
764 Ga0207639_10662177 3300026041 Bacteria 966
765 Ga0207639_11338573 3300026041 Bacteria 672
766 Ga0207678_11015145 3300026067 Bacteria 734
767 Ga0207708_10456892 3300026075 Bacteria 1065
768 Ga0207708_11873678 3300026075 Bacteria 526
769 Ga0207702_10086799 3300026078 Bacteria 2729
770 Ga0207702_10248372 3300026078 Bacteria 1670
771 Ga0207702_10510534 3300026078 Bacteria 1172
772 Ga0207702_10933250 3300026078 Bacteria 860
773 Ga0207702_11711522 3300026078 Bacteria 622
774 Ga0207702_12170194 3300026078 Bacteria 544
775 Ga0207641_10032716 3300026088 Bacteria 4319
776 Ga0207641_10033949 3300026088 Bacteria 4241
777 Ga0207641_11589305 3300026088 Bacteria 656
778 Ga0207641_11887704 3300026088 Bacteria 599
779 Ga0207648_10004075 3300026089 Bacteria 15150
780 Ga0207648_10244203 3300026089 Bacteria 1599
781 Ga0207648_10321347 3300026089 Unclassified 1391
782 Ga0207648_10384967 3300026089 Bacteria 1269
783 Ga0207648_10817150 3300026089 Bacteria 868
784 Ga0207676_10016916 3300026095 Bacteria 5280
785 Ga0207676_10785895 3300026095 Bacteria 928
786 Ga0207676_10840074 3300026095 Bacteria 898
787 Ga0207676_11028923 3300026095 Bacteria 812
788 Ga0207676_11782465 3300026095 Bacteria 614
789 Ga0207674_10003778 3300026116 Bacteria 18471
790 Ga0207674_10009315 3300026116 Bacteria 11243
791 Ga0207674_10019754 3300026116 Bacteria 7291
792 Ga0207674_10122256 3300026116 Bacteria 2569
793 Ga0207674_10540826 3300026116 Bacteria 1125
794 Ga0207674_10965182 3300026116 Bacteria 821
795 Ga0207674_12226465 3300026116 Bacteria 511
796 Ga0207675_100013122 3300026118 Bacteria 7732
797 Ga0207675_100640535 3300026118 Bacteria 1068
798 Ga0207675_100661262 3300026118 Bacteria 1051
799 Ga0207675_100745497 3300026118 Bacteria 990
800 Ga0207675_101118784 3300026118 Bacteria 807
801 Ga0207675_102121635 3300026118 Unclassified 578
802 Ga0207675_102568518 3300026118 Bacteria 519
803 Ga0207683_10064958 3300026121 Bacteria 3217
804 Ga0207683_10177746 3300026121 Bacteria 1929
805 Ga0207683_10557105 3300026121 Bacteria 1060
806 Ga0207683_10762643 3300026121 Bacteria 898
807 Ga0207698_10018429 3300026142 Bacteria 4756
808 Ga0207698_10103163 3300026142 Bacteria 2370
809 Ga0207698_11308132 3300026142 Bacteria 740
810 Ga0207698_11684942 3300026142 Bacteria 649
811 Ga0207698_12005545 3300026142 Unclassified 593
812 Ga0207698_12343020 3300026142 Bacteria 545
813 Ga0207698_12527861 3300026142 Bacteria 524
814 Ga0209588_1033693 3300027671 Bacteria 1643
815 Ga0209588_1075701 3300027671 Bacteria 1087
816 Ga0209813_10238556 3300027866 Bacteria 687
817 Ga0207428_10016765 3300027907 Bacteria 6299
818 Ga0207428_10021763 3300027907 Bacteria 5424
819 Ga0207428_10031923 3300027907 Bacteria 4337
820 Ga0207428_10526169 3300027907 Bacteria 857
821 Ga0207428_10851416 3300027907 Bacteria 646
822 Ga0268266_10005904 3300028379 Bacteria 11330
823 Ga0268266_10066473 3300028379 Bacteria 3119
824 Ga0268266_10092860 3300028379 Bacteria 2648
825 Ga0268266_10538458 3300028379 Bacteria 1118
826 Ga0268266_11217490 3300028379 Bacteria 728
827 Ga0268266_11788426 3300028379 Bacteria 589
828 Ga0268266_12350540 3300028379 Bacteria 504
829 Ga0268265_10011945 3300028380 Bacteria 5875
830 Ga0268265_10220537 3300028380 Bacteria 1659
831 Ga0268265_10303297 3300028380 Bacteria 1439
832 Ga0268265_10465074 3300028380 Bacteria 1184
833 Ga0268265_10488372 3300028380 Bacteria 1158
834 Ga0268265_12412420 3300028380 Bacteria 532
835 Ga0268265_12585260 3300028380 Bacteria 513
836 Ga0268264_10000084 3300028381 Bacteria 242128
837 Ga0268264_10001515 3300028381 Bacteria 21648
838 Ga0268264_10642713 3300028381 Bacteria 1049
839 Ga0268264_11413595 3300028381 Bacteria 706
840 Ga0268264_11735814 3300028381 Bacteria 634
841 Ga0268264_11892679 3300028381 Bacteria 606
842 Ga0307517_10578289 3300028786 Bacteria 557
843 Ga0265338_10114917 3300028800 Bacteria 2159
844 Ga0265338_10613556 3300028800 Unclassified 757
845 Ga0265338_10668674 3300028800 Bacteria 719
846 Ga0265324_10006763 3300029957 Bacteria 4732
847 Ga0307511_10052815 3300030521 Bacteria 3232
848 Ga0265328_10003733 3300031239 Bacteria 6711
849 Ga0265328_10098047 3300031239 Bacteria 1085
850 Ga0265325_10024269 3300031241 Bacteria 3301
851 Ga0265325_10095155 3300031241 Bacteria 1464
852 Ga0265325_10111380 3300031241 Bacteria 1330
853 Ga0265340_10303826 3300031247 Bacteria 707
854 Ga0265339_10044955 3300031249 Bacteria 2433
855 Ga0265339_10226916 3300031249 Bacteria 911
856 Ga0265331_10000247 3300031250 Bacteria 64888
857 Ga0265331_10036305 3300031250 Bacteria 2420
858 Ga0265331_10112612 3300031250 Bacteria 1247
859 Ga0265327_10023457 3300031251 Bacteria 3654
860 Ga0265316_10209861 3300031344 Bacteria 1441
861 Ga0265316_10317948 3300031344 Bacteria 1131
862 Ga0307509_10153689 3300031507 Bacteria 2211
863 Ga0307509_10484231 3300031507 Bacteria 924
864 Ga0307509_10693014 3300031507 Bacteria 685
865 Ga0307408_100144864 3300031548 Bacteria 1869
866 Ga0265313_10231007 3300031595 Bacteria 760
867 Ga0307508_10000105 3300031616 Bacteria 99107
868 Ga0307508_10239342 3300031616 Bacteria 1412
869 Ga0307508_10432899 3300031616 Bacteria 907
870 Ga0265314_10130504 3300031711 Bacteria 1568
871 Ga0265314_10193618 3300031711 Bacteria 1208
872 Ga0265342_10140469 3300031712 Bacteria 1347
873 Ga0316578_10334185 3300031728 Bacteria 903
874 Ga0307516_10670925 3300031730 Bacteria 692
875 Ga0307405_10237908 3300031731 Bacteria 1347
876 Ga0307413_11211737 3300031824 Bacteria 657
877 Ga0307406_10579121 3300031901 Bacteria 922
878 Ga0307416_100346498 3300032002 Bacteria 1501
879 Ga0307411_11982867 3300032005 Bacteria 543
880 Ga0307415_102194505 3300032126 Bacteria 540
881 Ga0307510_10303858 3300033180 Bacteria 1057
882 Ga0316215_1016362 3300033544 Bacteria 746
883 Ga0373950_0063721 3300034818 Bacteria 744
884 Ga0373959_0125493 3300034820 Bacteria 631
885 Ga0373938_0002387 3300034957 Bacteria 3024
886 Ga0373938_0115185 3300034957 Bacteria 688
887 Ga0373926_0026586 3300035083 Bacteria 2025
888 Ga0373928_0067222 3300035084 Bacteria 879
889 Ga0373929_0029597 3300035085 Bacteria 1163
890 Ga0373929_0146869 3300035085 Bacteria 630
891 Ga0373929_0188123 3300035085 Bacteria 573
892 Ga0373934_0015167 3300035086 Bacteria 2921
893 Ga0373934_0135409 3300035086 Bacteria 1006
894 Ga0373940_0336563 3300035088 Bacteria 527
895 Ga0373944_0018895 3300035089 Bacteria 1973
896 Ga0373949_0050956 3300035090 Bacteria 1043
897 Ga0373951_0030626 3300035091 Bacteria 1267
898 Ga0373951_0134474 3300035091 Bacteria 682
899 Ga0373952_0215162 3300035092 Bacteria 568
900 Ga0373923_0029232 3300035111 Bacteria 2208
901 Ga0373923_0103330 3300035111 Bacteria 1259
902 Ga0373923_0234032 3300035111 Bacteria 856
903 Ga0373932_0273949 3300035112 Bacteria 622
904 Ga0373936_0076639 3300035113 Bacteria 1386
905 Ga0373936_0087248 3300035113 Bacteria 1305
906 Ga0373936_0127000 3300035113 Bacteria 1093
907 Ga0373936_0160980 3300035113 Bacteria 978
908 Ga0373936_0200801 3300035113 Bacteria 880
909 Ga0373939_0062831 3300035114 Bacteria 1188
910 Ga0373939_0166417 3300035114 Bacteria 813
911 Ga0373939_0185760 3300035114 Bacteria 778
912 Ga0373941_0069709 3300035115 Bacteria 1164
913 Ga0373941_0079932 3300035115 Bacteria 1102
914 Ga0373941_0138650 3300035115 Bacteria 883
915 Ga0373941_0434345 3300035115 Bacteria 548
916 Ga0373945_0135627 3300035116 Bacteria 989
917 Ga0373945_0185044 3300035116 Bacteria 859
918 Ga0373953_0104021 3300035117 Bacteria 1197
919 Ga0373953_0183285 3300035117 Bacteria 903
920 Ga0373954_0034467 3300035118 Bacteria 2345
921 Ga0373954_0053703 3300035118 Bacteria 1894
922 Ga0373954_0676560 3300035118 Bacteria 512
923 Ga0373956_0107278 3300035119 Bacteria 1298
924 Ga0373956_0121293 3300035119 Bacteria 1221
925 Ga0373957_0301896 3300035120 Bacteria 679
926 Ga0373957_0353780 3300035120 Bacteria 628
927 Ga0373960_0052412 3300035121 Bacteria 1214
928 Ga0373960_0351672 3300035121 Bacteria 559
929 Ga0373943_0056320 3300035170 Bacteria 1951
930 Ga0373943_0121832 3300035170 Bacteria 1386
931 Ga0373943_0310015 3300035170 Bacteria 898
932 Ga0373946_0047551 3300035171 Bacteria 1782
933 Ga0373946_0283397 3300035171 Bacteria 816
934 Ga0373955_0059090 3300035172 Bacteria 2111
935 Ga0373942_0386317 3300035207 Bacteria 500
936 Ga0373961_0011686 3300035241 Bacteria 2182
937 Ga0373961_0013644 3300035241 Bacteria 2052
938 Ga0373961_0069950 3300035241 Bacteria 1084
939 Ga0373962_0022174 3300035242 Bacteria 1681
940 Ga0373962_0028668 3300035242 Bacteria 1512
941 Ga0373924_0306384 3300035410 Bacteria 705
942 Ga0373931_0000317 3300035691 Bacteria 20240
943 Ga0373931_0004056 3300035691 Bacteria 6640
944 Ga0373931_0193823 3300035691 Bacteria 1210
945 Ga0373931_0223543 3300035691 Bacteria 1135
946 Ga0373931_0496027 3300035691 Bacteria 787
947 Ga0373931_0517315 3300035691 Bacteria 772
948 Ga0373935_0101455 3300035692 Bacteria 1898
949 Ga0373935_0136231 3300035692 Bacteria 1654
950 Ga0373935_0166266 3300035692 Bacteria 1506
951 Ga0373935_0544927 3300035692 Bacteria 845
952 Ga0373935_0614359 3300035692 Bacteria 796
953 Ga0373935_0948113 3300035692 Bacteria 638
954 Ga0373935_1096472 3300035692 Bacteria 592
955 Ga0373927_0024147 3300035695 Bacteria 3977
956 Ga0373927_0116454 3300035695 Bacteria 1743
957 Ga0373927_0153953 3300035695 Bacteria 1505
958 Ga0373927_0292335 3300035695 Bacteria 1072
959 Ga0373927_0312442 3300035695 Bacteria 1034
960 Ga0373927_0578213 3300035695 Bacteria 742
961 Ga0373927_0858655 3300035695 Bacteria 599
962 Ga0373933_0017280 3300035724 Bacteria 4045
963 Ga0373933_0087473 3300035724 Bacteria 1919
964 Ga0373933_0884186 3300035724 Bacteria 588
965 Ga0373947_0024091 3300035725 Bacteria 3544
966 Ga0373947_0038743 3300035725 Unclassified 2834
967 Ga0373947_0052625 3300035725 Bacteria 2453
968 Ga0373947_0086745 3300035725 Bacteria 1946
969 Ga0373947_0356324 3300035725 Bacteria 982
970 Ga0373947_0664591 3300035725 Bacteria 711
971 Ga0373937_0108821 3300036401 Bacteria 2577
972 Ga0373937_0118391 3300036401 Bacteria 2467
973 Ga0373937_0162129 3300036401 Bacteria 2096
974 Ga0373937_0227375 3300036401 Bacteria 1756
975 Ga0372808_001897 3300036459 Bacteria 2298
976 Ga0373925_0042688 3300037068 Bacteria 3365
977 Ga0373925_0075212 3300037068 Bacteria 2559
978 Ga0373925_0077433 3300037068 Bacteria 2524
979 Ga0373925_0079553 3300037068 Bacteria 2491
980 Ga0373925_0112578 3300037068 Bacteria 2104
981 Ga0373925_0491133 3300037068 Bacteria 1007
982 Ga0373925_0708989 3300037068 Bacteria 829
983 Ga0373925_0845393 3300037068 Bacteria 754
984 Ga0395899_0002162 3300037312 Bacteria 16144
985 Ga0395899_0021402 3300037312 Bacteria 4904
986 Ga0395899_0302544 3300037312 Bacteria 1082
987 Ga0395900_0004853 3300037418 Bacteria 14164
988 Ga0395900_0005904 3300037418 Bacteria 12783
989 Ga0395900_0064978 3300037418 Bacteria 3748
990 Ga0395900_0240772 3300037418 Bacteria 1815
991 Ga0395900_1047689 3300037418 Bacteria 734
992 Ga0395898_0012089 3300037466 Bacteria 8938
993 Ga0395898_0149599 3300037466 Bacteria 2234
994 Ga0395898_0162409 3300037466 Bacteria 2137
995 Ga0395905_0180874 3300037471 Bacteria 1980
996 Ga0436364_0574078 3300037853 Bacteria 808
997 Ga0436364_1015918 3300037853 Bacteria 632
998 Ga0395901_0040678 3300038443 Bacteria 4815
999 Ga0395901_0139607 3300038443 Bacteria 2547
1000 Ga0395901_0148919 3300038443 Bacteria 2460
1001 Ga0395901_0195047 3300038443 Bacteria 2123
1002 Ga0395901_0381956 3300038443 Bacteria 1449
1003 Ga0436365_0368730 3300039437 Bacteria 2426
1004 Ga0436365_0622183 3300039437 Bacteria 2404
1005 Ga0436365_0820984 3300039437 Bacteria 1334
1006 Ga0436365_0869883 3300039437 Bacteria 610
1007 Ga0436365_0920296 3300039437 Bacteria 719
1008 Ga0436365_1044564 3300039437 Bacteria 888
1009 Ga0436365_1545720 3300039437 Bacteria 804
1010 Ga0436365_1547297 3300039437 Bacteria 2194
1011 Ga0436365_1649599 3300039437 Bacteria 1272
1012 Ga0436365_1722483 3300039437 Bacteria 826
1013 Ga0436360_0542064 3300039438 Bacteria 900
1014 Ga0436360_0826367 3300039438 Bacteria 502
1015 Ga0436360_1024581 3300039438 Bacteria 573
1016 Ga0436360_1144799 3300039438 Bacteria 2164
1017 Ga0436361_0035526 3300039447 Bacteria 683
1018 Ga0436361_0175551 3300039447 Bacteria 3548
1019 Ga0436361_0683077 3300039447 Bacteria 969
1020 Ga0436361_0984910 3300039447 Unclassified 636
1021 Ga0436361_1160036 3300039447 Bacteria 961
1022 Ga0436363_0402227 3300039450 Bacteria 660
1023 Ga0436363_0461653 3300039450 Bacteria 4929
1024 Ga0436363_1236422 3300039450 Bacteria 1639
1025 Ga0436363_1265235 3300039450 Bacteria 1084
1026 Ga0436362_0026859 3300039453 Bacteria 692
1027 Ga0436362_0272131 3300039453 Bacteria 877
1028 Ga0436362_0339798 3300039453 Bacteria 615
1029 Ga0436362_0965633 3300039453 Bacteria 626
1030 Ga0439447_053466 3300041407 Bacteria 960
1031 Ga0439466_0108367 3300041411 Bacteria 863
1032 Ga0439465_0072857 3300041413 Bacteria 1153
1033 Ga0451789_1040744 3300041443 Bacteria 1076
1034 Ga0451793_1111873 3300041452 Bacteria 766
1035 Ga0451797_1343343 3300041453 Bacteria 597
1036 Ga0451795_1639049 3300041456 Bacteria 737
1037 Ga0451800_0546300 3300041459 Bacteria 591
1038 Ga0451804_0238532 3300041463 Bacteria 605
1039 Ga0451807_1577102 3300041486 Bacteria 511
1040 Ga0451807_1819751 3300041486 Bacteria 603
1041 Ga0451839_0668696 3300041496 Bacteria 550
1042 Ga0451849_0120354 3300041505 Bacteria 597
1043 Ga0451849_0905281 3300041505 Bacteria 961
1044 Ga0451853_1687619 3300041512 Bacteria 504
1045 Ga0451853_2022784 3300041512 Bacteria 653
1046 Ga0439441_078718 3300042001 Bacteria 715
1047 Ga0439442_110396 3300042002 Bacteria 599
1048 Ga0439442_144014 3300042002 Bacteria 528
1049 Ga0439445_0094973 3300042004 Bacteria 842
1050 Ga0439432_209705 3300042006 Bacteria 564
1051 Ga0439434_0269612 3300042435 Bacteria 585
1052 Ga0439435_0075194 3300042436 Bacteria 1006
1053 Ga0439459_0003070 3300042438 Bacteria 2623
1054 Ga0439459_0062672 3300042438 Bacteria 843
1055 Ga0439464_0163929 3300042439 Bacteria 699
1056 Ga0450893_0099443 3300042532 Bacteria 591
1057 Ga0451577_0000001 3300042876 Bacteria 2461803
1058 Ga0451577_0132183 3300042876 Bacteria 2239
1059 Ga0451577_0193602 3300042876 Bacteria 1834
1060 Ga0451577_0209539 3300042876 Bacteria 1760
1061 Ga0451577_0292611 3300042876 Bacteria 1476
1062 Ga0466972_0506264 3300044658 Bacteria 569
1063 Ga0453683_0006182 3300044673 Bacteria 8240
1064 Ga0453683_0015557 3300044673 Bacteria 4924
1065 Ga0466966_0894995 3300044684 Bacteria 535
1066 Ga0466961_0086598 3300044693 Bacteria 1980
1067 Ga0466963_0021148 3300044694 Bacteria 4100
1068 Ga0466963_0080570 3300044694 Bacteria 2204
1069 Ga0466963_0728197 3300044694 Bacteria 700
1070 Ga0466964_0242465 3300044706 Bacteria 885
1071 Ga0453684_0000015 3300044712 Bacteria 969198
1072 Ga0453684_0000020 3300044712 Bacteria 879938
1073 Ga0453684_0020836 3300044712 Bacteria 9849
1074 Ga0453684_0517058 3300044712 Bacteria 1319
1075 Ga0466968_0312566 3300044735 Bacteria 758
1076 Ga0466968_0409195 3300044735 Bacteria 666
1077 Ga0466968_0640833 3300044735 Bacteria 539
1078 Ga0466957_0019808 3300044842 Bacteria 3960
1079 Ga0451576_0000203 3300045051 Bacteria 149655
1080 Ga0451576_0000863 3300045051 Bacteria 58426
1081 Ga0451576_0003091 3300045051 Bacteria 23347
1082 Ga0451576_0352313 3300045051 Bacteria 1541
1083 Ga0451576_0514088 3300045051 Bacteria 1258
1084 Ga0451576_2281211 3300045051 Bacteria 555
1085 Ga0451576_2683832 3300045051 Bacteria 507
1086 Ga0466967_0002809 3300045976 Bacteria 11043
1087 Ga0466967_0444622 3300045976 Bacteria 1266
1088 Ga0466967_0943300 3300045976 Bacteria 859
1089 Ga0466967_1480479 3300045976 Bacteria 676
1090 Ga0466967_1543262 3300045976 Bacteria 661
1091 Ga0466967_2140231 3300045976 Bacteria 556
1092 Ga0466967_2334817 3300045976 Bacteria 530
1093 Ga0495603_0100902 3300046455 Bacteria 1685
1094 Ga0495590_0130756 3300046457 Bacteria 903
1095 Ga0495629_0104690 3300046459 Bacteria 1974
1096 Ga0495629_0624215 3300046459 Bacteria 719
1097 Ga0495638_0177511 3300046460 Bacteria 1218
1098 Ga0495638_0306213 3300046460 Bacteria 854
1099 Ga0495638_0312985 3300046460 Bacteria 842
1100 Ga0495651_0742602 3300046462 Bacteria 609
1101 Ga0495653_0101144 3300046463 Bacteria 2089
1102 Ga0495653_0165483 3300046463 Bacteria 1531
1103 Ga0495580_0013706 3300046472 Bacteria 6175
1104 Ga0495580_0329207 3300046472 Bacteria 1037
1105 Ga0495580_0884977 3300046472 Bacteria 575
1106 Ga0495580_0941935 3300046472 Bacteria 553
1107 Ga0495580_1013166 3300046472 Bacteria 529
1108 Ga0495582_0046171 3300046473 Bacteria 2399
1109 Ga0495582_0310633 3300046473 Bacteria 907
1110 Ga0495605_0392253 3300046474 Bacteria 578
1111 Ga0495639_0110802 3300046475 Bacteria 1302
1112 Ga0495662_0010302 3300046476 Bacteria 4582
1113 Ga0495662_0382379 3300046476 Bacteria 691
1114 Ga0495664_0014771 3300046477 Bacteria 4432
1115 Ga0495664_0113036 3300046477 Bacteria 1640
1116 Ga0495664_0201077 3300046477 Bacteria 1207
1117 Ga0495664_0383713 3300046477 Bacteria 844
1118 Ga0495584_0381930 3300046491 Bacteria 716
1119 Ga0495594_0255209 3300046499 Bacteria 999
1120 Ga0495606_0105987 3300046507 Bacteria 1703
1121 Ga0495618_0274332 3300046514 Bacteria 1053
1122 Ga0495628_0509100 3300046516 Bacteria 868
1123 Ga0495630_0040788 3300046517 Bacteria 3468
1124 Ga0495630_0608366 3300046517 Bacteria 838
1125 Ga0495630_0711827 3300046517 Bacteria 768
1126 Ga0495630_0909152 3300046517 Bacteria 670
1127 Ga0495630_0987330 3300046517 Bacteria 640
1128 Ga0495643_0140317 3300046522 Bacteria 1206
1129 Ga0495644_0320088 3300046523 Bacteria 608
1130 Ga0495666_0092268 3300046526 Bacteria 1429
1131 Ga0495652_0105267 3300046529 Bacteria 2280
1132 Ga0495665_0087128 3300046531 Bacteria 1641
1133 Ga0495665_0102077 3300046531 Bacteria 1505
1134 Ga0495640_0041700 3300046533 Bacteria 3206
1135 Ga0495640_0334793 3300046533 Bacteria 936
1136 Ga0495640_0967864 3300046533 Bacteria 502
1137 Ga0495640_0967887 3300046533 Bacteria 502
1138 Ga0495586_0051611 3300046535 Bacteria 2226
1139 Ga0495586_0479206 3300046535 Bacteria 718
1140 Ga0495587_0454348 3300046536 Bacteria 710
1141 Ga0495645_0027722 3300046543 Bacteria 4115
1142 Ga0495645_0069587 3300046543 Bacteria 2540
1143 Ga0495645_0560322 3300046543 Bacteria 707
1144 Ga0495622_0068342 3300046557 Bacteria 1641
1145 Ga0495667_0040028 3300046559 Bacteria 3114
1146 Ga0495667_0255806 3300046559 Bacteria 1114
1147 Ga0495668_0055967 3300046616 Bacteria 2178
1148 Ga0495634_0124638 3300046642 Bacteria 1647
1149 Ga0495634_0249724 3300046642 Bacteria 1086
1150 Ga0495634_0371248 3300046642 Bacteria 854
1151 Ga0495634_0644864 3300046642 Unclassified 612
1152 Ga0495634_0789494 3300046642 Bacteria 542
1153 Ga0495611_0302797 3300046648 Bacteria 737
1154 Ga0495635_0000082 3300046663 Bacteria 58319
1155 Ga0495635_0007858 3300046663 Bacteria 7449
1156 Ga0495635_0418785 3300046663 Bacteria 888
1157 Ga0495657_0029197 3300046675 Bacteria 3870
1158 Ga0495657_0357251 3300046675 Bacteria 864
1159 Ga0495599_0211052 3300046678 Bacteria 1190
1160 Ga0495599_0524964 3300046678 Bacteria 695
1161 Ga0495599_0771340 3300046678 Bacteria 551
1162 Ga0495623_0427013 3300046679 Bacteria 709
1163 Ga0495623_0509093 3300046679 Bacteria 634
1164 Ga0495646_0201999 3300046680 Bacteria 1082
1165 Ga0495647_0126736 3300046681 Bacteria 1078
1166 Ga0495647_0221857 3300046681 Bacteria 835
1167 Ga0495647_0533491 3300046681 Bacteria 548
1168 Ga0495658_0018744 3300046683 Bacteria 3603
1169 Ga0495613_0107356 3300046689 Bacteria 2014
1170 Ga0495613_0167055 3300046689 Bacteria 1563
1171 Ga0495613_0248223 3300046689 Bacteria 1243
1172 Ga0495624_0043952 3300046690 Bacteria 2849
1173 Ga0495624_0170757 3300046690 Bacteria 1327
1174 Ga0495624_0457305 3300046690 Bacteria 765
1175 Ga0495624_0519326 3300046690 Bacteria 712
1176 Ga0495624_0762580 3300046690 Bacteria 573
1177 Ga0495671_0200171 3300046692 Bacteria 969
1178 Ga0495671_0558766 3300046692 Bacteria 545
1179 Ga0495600_0044373 3300046809 Bacteria 2900
1180 Ga0495581_0078431 3300047315 Bacteria 1911
1181 Ga0495581_0171710 3300047315 Bacteria 1268
1182 Ga0495604_0047067 3300047317 Bacteria 3361
1183 Ga0495604_0536057 3300047317 Bacteria 756
1184 Ga0495604_0851316 3300047317 Bacteria 572
1185 Ga0495674_0004477 3300047319 Bacteria 13445
1186 Ga0495674_0313533 3300047319 Bacteria 1279
1187 Ga0495674_0400956 3300047319 Bacteria 1107
1188 Ga0495674_0588326 3300047319 Bacteria 883
1189 Ga0495674_0627840 3300047319 Bacteria 849
1190 Ga0495676_0414621 3300047321 Bacteria 892
1191 Ga0495676_0624935 3300047321 Bacteria 700
1192 Ga0495680_0000053 3300047322 Bacteria 94237
1193 Ga0495680_0176291 3300047322 Bacteria 1546
1194 Ga0495680_0528785 3300047322 Bacteria 797
1195 Ga0495675_0039762 3300047444 Bacteria 2996
1196 Ga0495675_0164407 3300047444 Bacteria 1366
1197 Ga0495675_0762373 3300047444 Bacteria 538
1198 Ga0495684_0004775 3300047471 Bacteria 10588
1199 Ga0495684_0017082 3300047471 Bacteria 5589
1200 Ga0495684_0064085 3300047471 Bacteria 2793
1201 Ga0495684_0389357 3300047471 Bacteria 981
1202 Ga0495684_0469339 3300047471 Bacteria 871
1203 Ga0495593_0222643 3300047673 Bacteria 947
1204 Ga0495593_0251714 3300047673 Bacteria 884
1205 Ga0495602_0127031 3300048088 Bacteria 2041
1206 Ga0495614_0638168 3300048089 Bacteria 513
1207 Ga0496101_0719796 3300048904 Bacteria 788
1208 Ga0496102_0125174 3300048905 Bacteria 2402
1209 Ga0496102_0789570 3300048905 Bacteria 872
1210 Ga0496102_0858763 3300048905 Bacteria 830
1211 Ga0496102_1175772 3300048905 Bacteria 687
1212 Ga0496102_1778335 3300048905 Bacteria 534
1213 Ga0496103_0012360 3300048906 Bacteria 5064
1214 Ga0496104_0232656 3300048907 Bacteria 1755
1215 Ga0496104_0407065 3300048907 Bacteria 1273
1216 Ga0496104_0666642 3300048907 Bacteria 949
1217 Ga0496106_0008099 3300048909 Bacteria 7764
1218 Ga0496108_0347601 3300048911 Bacteria 1294
1219 Ga0496108_0608052 3300048911 Bacteria 952
1220 Ga0496108_0674340 3300048911 Bacteria 898
1221 Ga0496109_0185900 3300048912 Bacteria 1952
1222 Ga0496109_0417709 3300048912 Bacteria 1267
1223 Ga0496109_0500653 3300048912 Bacteria 1147
1224 Ga0496109_0557691 3300048912 Bacteria 1081
1225 Ga0496109_1539534 3300048912 Bacteria 600
1226 Ga0496109_1596625 3300048912 Bacteria 587
1227 Ga0496110_0075010 3300048913 Bacteria 3005
1228 Ga0496110_0263698 3300048913 Bacteria 1568
1229 Ga0496111_0876394 3300048914 Bacteria 647
1230 Ga0496111_1327911 3300048914 Bacteria 506
1231 Ga0496112_0024268 3300048915 Bacteria 5804
1232 Ga0496112_0478293 3300048915 Bacteria 1182
1233 Ga0496112_0847901 3300048915 Bacteria 837
1234 Ga0496112_1167960 3300048915 Bacteria 687
1235 Ga0496113_0023534 3300048916 Bacteria 4368
1236 Ga0496113_0601457 3300048916 Bacteria 881
1237 Ga0496114_0313535 3300048917 Bacteria 1386
1238 Ga0496114_1319172 3300048917 Bacteria 609
1239 Ga0496115_0042673 3300048918 Bacteria 3614
1240 Ga0496115_0258938 3300048918 Bacteria 1431
1241 Ga0496115_0994423 3300048918 Bacteria 641
1242 Ga0496117_0054306 3300048920 Bacteria 2807
1243 Ga0496118_0002057 3300048921 Bacteria 28367
1244 Ga0496121_0000077 3300048924 Bacteria 235293
1245 Ga0496121_0032758 3300048924 Bacteria 4717
1246 Ga0496121_0053767 3300048924 Bacteria 3371
1247 Ga0496124_0006148 3300048927 Bacteria 13170
1248 Ga0496125_0044761 3300048928 Bacteria 3736
1249 Ga0496126_0009366 3300048929 Bacteria 10408
1250 Ga0496126_0018937 3300048929 Bacteria 6800
1251 Ga0496126_0150968 3300048929 Bacteria 1991
1252 Ga0496126_0318929 3300048929 Bacteria 1278
1253 Ga0496126_0376505 3300048929 Bacteria 1156
1254 Ga0501309_006054 3300049129 Bacteria 1463
1255 Ga0501310_010792 3300049130 Bacteria 1025
1256 Ga0501307_044908 3300049162 Bacteria 651
1257 Ga0501032_0390118 3300049569 Bacteria 895
1258 Ga0501033_0187960 3300049570 Bacteria 1479
1259 Ga0501033_0775583 3300049570 Bacteria 649
1260 Ga0501034_0000109 3300049571 Bacteria 151550
1261 Ga0501034_0001751 3300049571 Bacteria 27824
1262 Ga0501034_0053875 3300049571 Bacteria 4050
1263 Ga0501034_0115699 3300049571 Bacteria 2670
1264 Ga0501034_0574374 3300049571 Bacteria 1035
1265 Ga0501036_0383455 3300049572 Bacteria 1173
1266 Ga0501037_0287677 3300049573 Bacteria 1144
1267 Ga0501038_0397428 3300049574 Bacteria 1067
1268 Ga0501038_0719954 3300049574 Bacteria 746
1269 Ga0501039_0614442 3300049575 Bacteria 852
1270 Ga0501041_1107385 3300049577 Unclassified 510
1271 Ga0501043_0125279 3300049579 Bacteria 2014
1272 Ga0501046_0116625 3300049580 Bacteria 2035
1273 Ga0501048_0297614 3300049582 Bacteria 1148
1274 Ga0501048_0543739 3300049582 Bacteria 833
1275 Ga0501067_0280248 3300049583 Bacteria 928
1276 Ga0501067_0382168 3300049583 Bacteria 785
1277 Ga0501067_0685041 3300049583 Bacteria 576
1278 Ga0501068_0252362 3300049584 Bacteria 1124
1279 Ga0501069_0923060 3300049585 Bacteria 532
1280 Ga0501070_0136672 3300049586 Bacteria 2024
1281 Ga0501070_0203456 3300049586 Bacteria 1626
1282 Ga0501070_0685443 3300049586 Bacteria 811
1283 Ga0501070_1237674 3300049586 Bacteria 572
1284 Ga0501071_0577730 3300049587 Bacteria 864
1285 Ga0501072_0307215 3300049588 Bacteria 1261
1286 Ga0501072_0601028 3300049588 Bacteria 867
1287 Ga0501073_0223858 3300049589 Bacteria 1300
1288 Ga0501073_0384093 3300049589 Bacteria 970
1289 Ga0501073_0413478 3300049589 Bacteria 932
1290 Ga0501076_0297973 3300049592 Unclassified 1322
1291 Ga0501076_1041855 3300049592 Bacteria 674
1292 Ga0501079_0411430 3300049741 Bacteria 1061
1293 Ga0501079_0865511 3300049741 Bacteria 712
1294 Ga0501080_0299923 3300049742 Bacteria 1458
1295 Ga0501080_0906495 3300049742 Bacteria 768
1296 Ga0501080_1068868 3300049742 Bacteria 698
1297 Ga0501080_1204437 3300049742 Bacteria 651
1298 Ga0501080_1804565 3300049742 Bacteria 514
1299 Ga0501081_0278248 3300049743 Bacteria 1225
1300 Ga0501035_0889832 3300049822 Bacteria 706
1301 Ga0501044_0235998 3300049823 Bacteria 1774
1302 Ga0501045_0359472 3300049824 Bacteria 1083
1303 Ga0501045_0419115 3300049824 Bacteria 996
1304 nmdc:mga03683_132101_c1 3300050489 Bacteria 1117
1305 nmdc:mga03683_148518_c1 3300050489 Bacteria 1057
1306 nmdc:mga03683_15481_c1 3300050489 Bacteria 2847
1307 nmdc:mga03683_169568_c1 3300050489 Bacteria 991
1308 nmdc:mga03683_1825_c1 3300050489 Bacteria 6461
1309 nmdc:mga03683_22746_c1 3300050489 Bacteria 2433
1310 nmdc:mga03683_32482_c1 3300050489 Bacteria 2100
1311 nmdc:mga03683_32979_c1 3300050489 Bacteria 2086
1312 nmdc:mga03683_397443_c1 3300050489 Bacteria 658
1313 nmdc:mga03683_461697_c1 3300050489 Bacteria 612
1314 nmdc:mga03683_76855_c1 3300050489 Bacteria 986
1315 nmdc:mga03n38_102713_c1 3300050490 Bacteria 1381
1316 nmdc:mga03n38_951783_c1 3300050490 Bacteria 507
1317 nmdc:mga00v17_207477_c1 3300050491 Bacteria 1267
1318 nmdc:mga00v17_39264_c1 3300050491 Bacteria 2834
1319 nmdc:mga0yw44_129575_c1 3300050492 Bacteria 1632
1320 nmdc:mga0yw44_22312_c1 3300050492 Bacteria 3549
1321 nmdc:mga0yw44_38472_c1 3300050492 Bacteria 2831
1322 nmdc:mga0yw44_446005_c1 3300050492 Bacteria 877
1323 nmdc:mga0yw44_467214_c1 3300050492 Bacteria 855
1324 nmdc:mga0yw44_730278_c1 3300050492 Bacteria 673
1325 nmdc:mga0k408_107710_c1 3300050493 Bacteria 1646
1326 nmdc:mga0k408_162678_c1 3300050493 Bacteria 1330
1327 nmdc:mga0k408_343354_c1 3300050493 Bacteria 890
1328 nmdc:mga0k408_5567_c1 3300050493 Bacteria 6701
1329 nmdc:mga0k408_609334_c1 3300050493 Bacteria 644
1330 nmdc:mga06z11_101549_c1 3300050494 Bacteria 991
1331 nmdc:mga06z11_127247_c1 3300050494 Bacteria 1427
1332 nmdc:mga06z11_174175_c1 3300050494 Bacteria 1237
1333 nmdc:mga06z11_261579_c1 3300050494 Bacteria 1021
1334 nmdc:mga06z11_305409_c1 3300050494 Bacteria 947
1335 nmdc:mga06z11_358863_c1 3300050494 Bacteria 873
1336 nmdc:mga06z11_43471_c1 3300050494 Bacteria 2260
1337 nmdc:mga06z11_5646_c1 3300050494 Bacteria 5039
1338 nmdc:mga06z11_571794_c1 3300050494 Bacteria 687
1339 nmdc:mga04h51_136829_c1 3300050495 Bacteria 926
1340 nmdc:mga07m45_367567_c1 3300050496 Bacteria 836
1341 nmdc:mga07m45_402050_c1 3300050496 Bacteria 795
1342 nmdc:mga07m45_424909_c1 3300050496 Bacteria 771
1343 nmdc:mga07m45_56464_c1 3300050496 Bacteria 2219
1344 nmdc:mga07m45_760326_c1 3300050496 Bacteria 556
1345 nmdc:mga07m45_803591_c1 3300050496 Bacteria 539
1346 nmdc:mga05p37_733444_c1 3300050507 Bacteria 1092
1347 nmdc:mga05p37_8689_c1 3300050507 Bacteria 12002
1348 nmdc:mga09592_1156863_c1 3300050508 Bacteria 641
1349 nmdc:mga09592_207576_c1 3300050508 Bacteria 1697
1350 nmdc:mga09592_2383_c1 3300050508 Bacteria 15174
1351 nmdc:mga0qj67_32605_c1 3300050509 Bacteria 4064
1352 nmdc:mga0qj67_59574_c1 3300050509 Bacteria 3028
1353 nmdc:mga0qj67_606036_c1 3300050509 Unclassified 876
1354 nmdc:mga06r32_7094_c1 3300050510 Bacteria 10088
1355 nmdc:mga06r32_96109_c1 3300050510 Bacteria 2901
1356 nmdc:mga08y16_122656_c1 3300050511 Bacteria 2704
1357 nmdc:mga08y16_13156_c1 3300050511 Bacteria 8706
1358 nmdc:mga08y16_20207_c1 3300050511 Bacteria 7030
1359 nmdc:mga08y16_245174_c1 3300050511 Bacteria 1851
1360 nmdc:mga08y16_295626_c1 3300050511 Bacteria 1670
1361 nmdc:mga08y16_996516_c1 3300050511 Bacteria 818
1362 nmdc:mga0n895_1248009_c1 3300050512 Bacteria 716
1363 nmdc:mga0n895_1346942_c1 3300050512 Unclassified 683
1364 nmdc:mga0n895_17745_c1 3300050512 Bacteria 6567
1365 nmdc:mga0n895_237294_c1 3300050512 Bacteria 1850
1366 nmdc:mga0n895_293958_c1 3300050512 Bacteria 1647
1367 nmdc:mga0n895_329968_c1 3300050512 Bacteria 1546
1368 nmdc:mga0n895_40414_c1 3300050512 Bacteria 4530
1369 nmdc:mga0n895_413359_c1 3300050512 Bacteria 1364
1370 nmdc:mga0n895_64973_c1 3300050512 Bacteria 3611
1371 nmdc:mga0rr50_549627_c1 3300050513 Bacteria 983
1372 nmdc:mga0rr50_954746_c1 3300050513 Bacteria 731
1373 nmdc:mga08x19_1063571_c1 3300050514 Bacteria 574
1374 nmdc:mga08x19_1158850_c1 3300050514 Bacteria 548
1375 nmdc:mga08x19_175174_c1 3300050514 Bacteria 1462
1376 nmdc:mga08x19_463128_c1 3300050514 Bacteria 893
1377 nmdc:mga08x19_916772_c1 3300050514 Unclassified 622
1378 nmdc:mga0a205_36569_c1 3300050515 Bacteria 4718
1379 nmdc:mga0a205_678075_c1 3300050515 Bacteria 881
1380 nmdc:mga0a205_72159_c1 3300050515 Bacteria 3335
1381 nmdc:mga0a205_803235_c1 3300050515 Bacteria 788
1382 nmdc:mga0sz30_175604_c1 3300050516 Bacteria 950
1383 nmdc:mga0sz30_239_c1 3300050516 Bacteria 21056
1384 nmdc:mga0sz30_36367_c1 3300050516 Bacteria 2058
1385 nmdc:mga0sz30_424010_c1 3300050516 Bacteria 597
1386 nmdc:mga0sz30_486680_c1 3300050516 Bacteria 555
1387 nmdc:mga0sz30_5231_c1 3300050516 Bacteria 577
1388 Ga0495601_0084629 3300053077 Bacteria 2037
1389 Ga0495601_0098753 3300053077 Bacteria 1884
1390 Ga0495601_0236563 3300053077 Bacteria 1193
1391 Ga0495601_0284716 3300053077 Bacteria 1078
1392 Ga0495601_0347852 3300053077 Bacteria 964
1393 Ga0495601_0470982 3300053077 Bacteria 812
1394 Ga0495612_0028179 3300053078 Bacteria 2261
1395 Ga0495612_0045922 3300053078 Bacteria 1788
1396 Ga0495612_0147855 3300053078 Bacteria 1021
1397 Ga0500610_0230325 3300053079 Bacteria 870
1398 Ga0500610_0367761 3300053079 Bacteria 600
1399 Ga0500635_0003286 3300053080 Bacteria 4058
1400 Ga0495655_0066366 3300053083 Bacteria 998
1401 Ga0495595_0233573 3300053084 Bacteria 919
1402 Ga0495595_0283669 3300053084 Bacteria 832
1403 Ga0495595_0652117 3300053084 Bacteria 539
1404 Ga0495595_0711475 3300053084 Bacteria 515
1405 Ga0495619_0020222 3300053085 Bacteria 4238
1406 Ga0495619_0112948 3300053085 Bacteria 1857
1407 Ga0495619_0229266 3300053085 Bacteria 1287
1408 Ga0500643_019179 3300053087 Bacteria 2257
1409 Ga0500643_157092 3300053087 Bacteria 610
1410 Ga0500644_0007897 3300053088 Bacteria 2788
1411 Ga0500644_0363605 3300053088 Bacteria 627
1412 Ga0500647_0234975 3300053091 Bacteria 813
1413 Ga0500583_0480932 3300053092 Bacteria 586
1414 Ga0500583_0508775 3300053092 Bacteria 565
1415 Ga0500651_0016352 3300053093 Bacteria 4563
1416 Ga0500651_0731053 3300053093 Bacteria 527
1417 Ga0500566_0071146 3300053094 Bacteria 1952
1418 Ga0500566_0191433 3300053094 Bacteria 1041
1419 Ga0500641_0000244 3300053096 Bacteria 20427
1420 Ga0500555_078586 3300053103 Bacteria 861
1421 Ga0500557_123515 3300053105 Bacteria 859
1422 Ga0500558_162861 3300053106 Bacteria 816
1423 Ga0500594_0108816 3300053118 Bacteria 860
1424 Ga0500595_027620 3300053119 Bacteria 1942
1425 Ga0500595_071275 3300053119 Bacteria 1031
1426 Ga0500595_159895 3300053119 Bacteria 628
1427 Ga0500597_244030 3300053120 Bacteria 738
1428 Ga0500614_066050 3300053123 Bacteria 983
1429 Ga0500642_0126365 3300053130 Bacteria 1198
1430 Ga0500642_0143929 3300053130 Bacteria 1119
1431 Ga0500642_0515829 3300053130 Bacteria 502
1432 Ga0500652_216897 3300053131 Bacteria 771
1433 Ga0500559_0104030 3300053136 Bacteria 1310
1434 Ga0500577_0069185 3300053142 Bacteria 1380
1435 Ga0500577_0182992 3300053142 Bacteria 900
1436 Ga0500577_0218436 3300053142 Bacteria 825
1437 Ga0500588_0175088 3300053146 Bacteria 787
1438 Ga0500590_080916 3300053148 Bacteria 1595
1439 Ga0500590_179822 3300053148 Bacteria 920
1440 Ga0500590_258878 3300053148 Bacteria 685
1441 Ga0500603_018179 3300053150 Bacteria 1690
1442 Ga0500616_0000925 3300053153 Bacteria 32079
1443 Ga0500616_0149582 3300053153 Bacteria 1082
1444 Ga0500620_019185 3300053155 Bacteria 2005
1445 Ga0500627_0155211 3300053158 Bacteria 1034
1446 Ga0500638_285809 3300053162 Bacteria 644
1447 Ga0500639_253271 3300053163 Bacteria 703
1448 Ga0500636_0086777 3300053177 Bacteria 1796
1449 Ga0500657_128973 3300053728 Bacteria 985
1450 Ga0500609_025225 3300053731 Bacteria 814
1451 Ga0500552_007586 3300053733 Bacteria 1257
1452 Ga0500552_018616 3300053733 Bacteria 964
1453 Ga0500596_005014 3300053735 Bacteria 2370
1454 Ga0587115_033509 3300059626 Bacteria 774
1455 Ga0587067_231921 3300059640 Bacteria 505
1456 Ga0501082_1064267 3300060353 Bacteria 707
1457 Ga0530510_0221050 3300061734 Unclassified 1408
1458 Ga0530510_0974321 3300061734 Bacteria 649
1459 2513692969 2513237101 Bacteria 7952346
1460 2513911411 2513237144 Bacteria 7530820
1461 2824707025 2824704595 Bacteria 9667483
1462 2824757193 2824753945 Bacteria 9787441
1463 2824766791 2824763712 Bacteria 9792355
1464 2838080529 2838074704 Bacteria 6785777
1465 2904720910 2904711408 Bacteria 9771557
1466 Ga0495608_0055390
1467 JGI24737J22298_10019519
1468 JGI25406J46586_10000940
1469 JGI25406J46586_10021547
1470 JGI25406J46586_10030719
1471 JGI25153J46596_10002123
1472 rootH2_10190176
1473 JGI25404J52841_10013369
1474 JGI25405J52794_10090595
1475 Ga0058862_12858404
1476 Ga0065712_10185320
1477 Ga0065715_10216814
1478 Ga0065715_10874724
1479 Ga0070658_10006980
1480 Ga0070658_10131935
1481 Ga0070676_10251595
1482 Ga0070676_11003826
1483 Ga0070683_100004443
1484 Ga0070683_100033923
1485 Ga0070683_100035249
1486 Ga0070683_100066371
1487 Ga0070683_100803745
1488 Ga0070683_100912673
1489 Ga0070690_100434208
1490 Ga0070690_100482699
1491 Ga0070690_100706536
1492 Ga0070670_100027724
1493 Ga0070670_100162620
1494 Ga0070670_100430999
1495 Ga0070670_100440685
1496 Ga0070670_100610163
1497 Ga0070677_10871200
1498 Ga0068869_100000708
1499 Ga0070666_10016127
1500 Ga0070680_100274888
1501 Ga0070680_101621571
1502 Ga0070680_101713781
1503 Ga0070682_100039976
1504 Ga0070682_100094786
1505 Ga0070682_100162503
1506 Ga0070682_101020341
1507 Ga0068868_100251129
1508 Ga0068868_101340941
1509 Ga0068868_102038785
1510 Ga0068868_102378353
1511 Ga0068868_102390218
1512 Ga0070660_100103462
1513 Ga0070660_100187370
1514 Ga0070660_101891519
1515 Ga0070689_100147781
1516 Ga0070689_100242355
1517 Ga0070689_100293898
1518 Ga0070691_10124334
1519 Ga0070691_10365617
1520 Ga0070687_101140673
1521 Ga0070661_100043611
1522 Ga0070661_100056480
1523 Ga0070661_100669555
1524 Ga0070661_101067422
1525 Ga0070692_10100582
1526 Ga0070692_10388411
1527 Ga0070692_11316610
1528 Ga0070668_100009348
1529 Ga0070668_100120941
1530 Ga0070668_100429687
1531 Ga0070668_101055912
1532 Ga0070668_101784614
1533 Ga0070668_101953501
1534 Ga0070669_100021100
1535 Ga0070669_100034441
1536 Ga0070669_100050479
1537 Ga0070669_100426557
1538 Ga0070669_100778364
1539 Ga0070669_101457439
1540 Ga0070669_101569385
1541 Ga0070675_100066680
1542 Ga0070675_100306306
1543 Ga0070671_100628595
1544 Ga0070671_101430619
1545 Ga0070671_101661487
1546 Ga0070674_100290609
1547 Ga0070674_101038574
1548 Ga0070673_100050408
1549 Ga0070673_100176614
1550 Ga0070673_100452159
1551 Ga0070673_101620520
1552 Ga0070688_100384736
1553 Ga0070688_100398958
1554 Ga0070688_100873219
1555 Ga0070659_100110611
1556 Ga0070659_102041878
1557 Ga0070667_100005347
1558 Ga0070667_100031455
1559 Ga0070667_100263592
1560 Ga0070667_100630757
1561 Ga0070667_100772708
1562 Ga0070667_101973085
1563 Ga0070667_102266512
1564 Ga0070709_10112676
1565 Ga0070709_10243301
1566 Ga0070709_10273829
1567 Ga0070709_10293176
1568 Ga0070714_100006563
1569 Ga0070714_100073056
1570 Ga0070714_100102355
1571 Ga0070714_100660723
1572 Ga0070714_100865746
1573 Ga0070713_100027835
1574 Ga0070713_100031740
1575 Ga0070713_100047532
1576 Ga0070713_100060357
1577 Ga0070713_100216314
1578 Ga0070713_100227269
1579 Ga0070710_10077434
1580 Ga0070710_10196582
1581 Ga0070710_11222692
1582 Ga0070701_10809268
1583 Ga0070701_11207723
1584 Ga0070711_101028427
1585 Ga0070711_101118662
1586 Ga0070711_101947352
1587 Ga0070705_100672043
1588 Ga0070705_101437375
1589 Ga0070700_100888587
1590 Ga0070700_100958214
1591 Ga0070708_100252458
1592 Ga0070708_100270417
1593 Ga0070708_101540875
1594 Ga0070663_101250849
1595 Ga0070678_100038096
1596 Ga0070678_100343831
1597 Ga0070678_100496516
1598 Ga0070678_100566086
1599 Ga0070678_101876861
1600 Ga0070662_100161909
1601 Ga0070662_100334207
1602 Ga0070681_10048012
1603 Ga0070681_10052271
1604 Ga0070681_11164486
1605 Ga0070681_11432511
1606 Ga0070681_11505719
1607 Ga0068867_100026445
1608 Ga0068867_100086826
1609 Ga0068867_100192548
1610 Ga0068867_100617106
1611 Ga0068867_101875773
1612 Ga0070685_10342578
1613 Ga0070685_10413731
1614 Ga0070685_10654335
1615 Ga0070685_11123310
1616 Ga0070706_100065125
1617 Ga0070707_100065107
1618 Ga0070707_101370156
1619 Ga0070698_100058117
1620 Ga0070698_100090301
1621 Ga0070698_101609126
1622 Ga0070699_100059857
1623 Ga0070679_100059679
1624 Ga0070679_100382826
1625 Ga0070679_100392092
1626 Ga0070679_100444240
1627 Ga0070679_101038979
1628 Ga0070679_101304261
1629 Ga0070684_100007463
1630 Ga0070684_100012697
1631 Ga0070684_100029010
1632 Ga0070684_100106264
1633 Ga0070684_100967433
1634 Ga0070684_101395147
1635 Ga0070697_100020437
1636 Ga0070697_100508271
1637 Ga0068853_100174646
1638 Ga0068853_100239099
1639 Ga0068853_100301289
1640 Ga0068853_100478387
1641 Ga0068853_100533732
1642 Ga0068853_100637485
1643 Ga0068853_101071634
1644 Ga0068853_101948537
1645 Ga0068853_101982387
1646 Ga0070672_100010053
1647 Ga0070672_100334253
1648 Ga0070672_100538371
1649 Ga0070672_101073380
1650 Ga0070686_101810100
1651 Ga0070686_101841928
1652 Ga0070695_101293325
1653 Ga0070696_100310212
1654 Ga0070696_101611494
1655 Ga0070693_100181407
1656 Ga0070693_100465017
1657 Ga0070693_100969406
1658 Ga0070693_100976858
1659 Ga0070665_100020492
1660 Ga0070665_100271847
1661 Ga0070665_100385356
1662 Ga0070665_100783324
1663 Ga0070665_101504249
1664 Ga0070704_100216017
1665 Ga0068855_100025340
1666 Ga0068855_100168944
1667 Ga0068855_100187077
1668 Ga0068855_100713535
1669 Ga0068855_101178465
1670 Ga0068855_101303329
1671 Ga0068855_101603565
1672 Ga0070664_100064589
1673 Ga0070664_100090167
1674 Ga0070664_100316783
1675 Ga0070664_100375151
1676 Ga0070664_100423770
1677 Ga0070664_101261183
1678 Ga0068857_100041668
1679 Ga0068857_100096366
1680 Ga0068857_100541876
1681 Ga0068857_101286352
1682 Ga0068854_100219364
1683 Ga0068854_100740106
1684 Ga0068854_101699283
1685 Ga0068856_100113034
1686 Ga0068856_100212884
1687 Ga0068856_100722067
1688 Ga0068856_101044042
1689 Ga0068856_102147685
1690 Ga0070702_100019857
1691 Ga0070702_100485335
1692 Ga0070702_101062416
1693 Ga0068852_100032353
1694 Ga0068852_100422225
1695 Ga0068852_100814121
1696 Ga0068852_101030749
1697 Ga0068852_101324341
1698 Ga0068859_100001245
1699 Ga0068859_100184715
1700 Ga0068859_102411696
1701 Ga0068864_100008273
1702 Ga0068864_100042879
1703 Ga0068864_102020404
1704 Ga0068864_102266430
1705 Ga0068866_10059936
1706 Ga0068866_10295868
1707 Ga0068866_10833761
1708 Ga0068861_100006169
1709 Ga0068861_100749385
1710 Ga0068861_100948810
1711 Ga0068861_101210984
1712 Ga0068851_10234929
1713 Ga0068870_10002331
1714 Ga0068870_10488874
1715 Ga0068870_10661408
1716 Ga0068870_11124370
1717 Ga0068870_11242674
1718 Ga0068863_100000873
1719 Ga0068863_100086250
1720 Ga0068863_100302684
1721 Ga0068863_101154561
1722 Ga0068863_101478691
1723 Ga0068858_100002812
1724 Ga0068858_100143105
1725 Ga0068858_100870038
1726 Ga0068858_100949509
1727 Ga0068858_100992624
1728 Ga0068858_101085492
1729 Ga0068858_101988129
1730 Ga0068860_100000149
1731 Ga0068860_100012312
1732 Ga0068860_100521163
1733 Ga0068860_100792664
1734 Ga0068860_101365343
1735 Ga0068860_101617533
1736 Ga0068860_101762671
1737 Ga0068862_100012163
1738 Ga0068862_100131633
1739 Ga0068862_100222846
1740 Ga0068862_100371395
1741 Ga0068862_100406614
1742 Ga0068862_100559699
1743 Ga0068862_101773246
1744 Ga0068862_102369173
1745 Ga0081455_10001001
1746 Ga0081455_10007427
1747 Ga0081455_10090302
1748 Ga0081455_10091268
1749 Ga0081455_10128235
1750 Ga0081455_10910420
1751 Ga0081538_10138715
1752 Ga0081540_1000003
1753 Ga0081540_1003189
1754 Ga0081540_1035955
1755 Ga0081540_1186596
1756 Ga0081539_10000191
1757 Ga0081539_10001452
1758 Ga0081539_10001574
1759 Ga0081539_10007767
1760 Ga0070717_10002484
1761 Ga0070717_10003662
1762 Ga0070717_10060928
1763 Ga0070717_11202793
1764 Ga0075365_10005466
1765 Ga0075365_10169119
1766 Ga0075365_10207547
1767 Ga0075365_10558838
1768 Ga0075365_10597471
1769 Ga0075365_10630465
1770 Ga0075365_10675477
1771 Ga0075368_10110543
1772 Ga0075368_10374334
1773 Ga0075363_100067216
1774 Ga0075363_100141991
1775 Ga0075364_10035360
1776 Ga0075364_10174371
1777 Ga0075364_10503654
1778 Ga0075432_10085982
1779 Ga0075432_10383668
1780 Ga0070715_10410531
1781 Ga0070715_10647226
1782 Ga0070715_11047873
1783 Ga0070716_100092196
1784 Ga0070716_100174999
1785 Ga0070716_101256805
1786 Ga0070716_101463376
1787 Ga0070712_100051865
1788 Ga0070712_100729473
1789 Ga0075362_10002622
1790 Ga0075362_10003948
1791 Ga0075362_10004980
1792 Ga0075362_10067150
1793 Ga0075362_10104884
1794 Ga0075362_10527718
1795 Ga0075367_10006371
1796 Ga0075367_10081795
1797 Ga0075367_10372777
1798 Ga0075367_10484337
1799 Ga0075369_10001306
1800 Ga0075369_10075756
1801 Ga0075369_10149250
1802 Ga0075366_10000880
1803 Ga0075366_10157169
1804 Ga0075366_10187591
1805 Ga0075366_10190723
1806 Ga0075366_10425519
1807 Ga0097621_100278535
1808 Ga0097621_100663585
1809 Ga0097621_100862381
1810 Ga0097621_101373661
1811 Ga0075370_10045498
1812 Ga0075370_10078629
1813 Ga0075370_10224866
1814 Ga0075370_10346164
1815 Ga0075370_10435715
1816 Ga0068871_100385436
1817 Ga0068871_100705272
1818 Ga0075428_100045105
1819 Ga0075428_100080803
1820 Ga0075428_100561180
1821 Ga0075428_101171392
1822 Ga0075428_102272686
1823 Ga0075430_100084875
1824 Ga0075430_100118025
1825 Ga0075430_100812322
1826 Ga0075431_100014415
1827 Ga0075431_100034312
1828 Ga0075431_102136570
1829 Ga0075433_10003359
1830 Ga0075433_10018901
1831 Ga0075434_100017326
1832 Ga0075434_100020139
1833 Ga0075434_100067222
1834 Ga0075434_100193791
1835 Ga0075434_100522982
1836 Ga0075434_100525994
1837 Ga0075434_100866084
1838 Ga0075434_100870128
1839 Ga0075434_101077628
1840 Ga0075429_100047982
1841 Ga0075429_100222872
1842 Ga0075429_100437713
1843 Ga0075429_100609623
1844 Ga0068865_100266213
1845 Ga0075436_100270712
1846 Ga0075436_100921172
1847 Ga0097620_100001245
1848 Ga0097620_100184722
1849 Ga0097620_102411355
1850 Ga0075435_100235203
1851 Ga0075435_100531957
1852 Ga0075435_100619304
1853 Ga0099794_10017466
1854 Ga0099795_10104454
1855 Ga0099795_10106440
1856 Ga0099795_10473198
1857 Ga0105250_10108891
1858 Ga0105240_10075127
1859 Ga0105240_10357095
1860 Ga0105240_10822753
1861 Ga0105240_11779767
1862 Ga0105240_11879762
1863 Ga0111539_10015625
1864 Ga0111539_10046064
1865 Ga0111539_10068483
1866 Ga0111539_10089231
1867 Ga0111539_10645809
1868 Ga0111539_12192369
1869 Ga0105245_10257845
1870 Ga0105245_10575581
1871 Ga0105245_10593084
1872 Ga0105245_11669470
1873 Ga0105245_11764188
1874 Ga0105245_11818477
1875 Ga0105245_12994096
1876 Ga0105245_13258386
1877 Ga0105247_10041211
1878 Ga0105247_10070694
1879 Ga0105247_10324994
1880 Ga0105247_10464790
1881 Ga0105247_10515367
1882 Ga0105247_10562553
1883 Ga0105247_11345847
1884 Ga0105247_11452821
1885 Ga0114129_10761458
1886 Ga0114129_11558884
1887 Ga0114129_13123651
1888 Ga0105243_10188988
1889 Ga0105243_11152555
1890 Ga0105243_11241130
1891 Ga0105243_11378026
1892 Ga0105243_12463319
1893 Ga0105241_10128324
1894 Ga0105241_10304189
1895 Ga0105241_11754185
1896 Ga0105241_11767469
1897 Ga0105241_11931794
1898 Ga0105241_11989951
1899 Ga0105242_11835702
1900 Ga0105242_12797035
1901 Ga0105248_10002517
1902 Ga0105248_10049520
1903 Ga0105248_11398025
1904 Ga0105248_11404553
1905 Ga0105248_12667761
1906 Ga0105248_13334491
1907 Ga0105237_10053338
1908 Ga0105237_10055453
1909 Ga0105237_10149240
1910 Ga0105237_10229785
1911 Ga0105237_10363524
1912 Ga0105237_10876228
1913 Ga0105237_11547053
1914 Ga0105237_11926353
1915 Ga0105238_10257663
1916 Ga0105238_10345144
1917 Ga0105238_10793711
1918 Ga0105238_11280213
1919 Ga0105249_10117602
1920 Ga0105249_11197395
1921 Ga0105249_11326698
1922 Ga0105249_11365889
1923 Ga0105249_12128511
1924 Ga0105035_116424
1925 Ga0099796_10095363
1926 Ga0099796_10119314
1927 Ga0099796_10533419
1928 Ga0105239_10085772
1929 Ga0105239_10207156
1930 Ga0105239_10644134
1931 Ga0105239_12092602
1932 Ga0105239_12483287
1933 Ga0105239_12680615
1934 Ga0105246_10225045
1935 Ga0105246_10772466
1936 Ga0105246_10811141
1937 Ga0157321_1017925
1938 Ga0157373_10304337
1939 Ga0157373_10445422
1940 Ga0157371_10037740
1941 Ga0157371_10202736
1942 Ga0157371_10806974
1943 Ga0157370_10240766
1944 Ga0157370_10598302
1945 Ga0157370_10676620
1946 Ga0157370_10728503
1947 Ga0157370_10742744
1948 Ga0157370_11861012
1949 Ga0157370_12027016
1950 Ga0157369_10059379
1951 Ga0157369_10273787
1952 Ga0157369_10288107
1953 Ga0157369_10484948
1954 Ga0157369_10524350
1955 Ga0157369_11040671
1956 Ga0157374_10194493
1957 Ga0157374_10202392
1958 Ga0157374_10782565
1959 Ga0157374_10797268
1960 Ga0157374_11170581
1961 Ga0157374_12908873
1962 Ga0157378_10016126
1963 Ga0157378_10180605
1964 Ga0157378_10395136
1965 Ga0157378_10716397
1966 Ga0157378_11194236
1967 Ga0157378_12561561
1968 Ga0163162_10082452
1969 Ga0163162_10096960
1970 Ga0163162_10354072
1971 Ga0163162_10395900
1972 Ga0163162_11056463
1973 Ga0163162_11410211
1974 Ga0163162_12087887
1975 Ga0163162_13246855
1976 Ga0163162_13334989
1977 Ga0157372_10044917
1978 Ga0157372_10237973
1979 Ga0157372_10538562
1980 Ga0157372_11478237
1981 Ga0157372_12429284
1982 Ga0157375_10222455
1983 Ga0157375_11454833
1984 Ga0163163_10000812
1985 Ga0163163_10113227
1986 Ga0163163_10490016
1987 Ga0163163_11050982
1988 Ga0163163_12660334
1989 Ga0157380_11695684
1990 Ga0157380_11916092
1991 Ga0157380_12261617
1992 Ga0182008_10244091
1993 Ga0182008_10566222
1994 Ga0182008_10846232
1995 Ga0157377_10540151
1996 Ga0157377_10888734
1997 Ga0157377_11295171
1998 Ga0157379_10000401
1999 Ga0157379_10398503
2000 Ga0157379_10666434
2001 Ga0157379_10926495
2002 Ga0157379_11014445
2003 Ga0157379_11747140
2004 Ga0157376_10058405
2005 Ga0157376_10452778
2006 Ga0157376_10596257
2007 Ga0157376_11840955
2008 Ga0157376_12196332
2009 Ga0157376_12687351
2010 Ga0157376_13008035
2011 Ga0163161_10229479
2012 Ga0163161_10572716
2013 Ga0197907_11200871
2014 Ga0206356_10599982
2015 Ga0206356_11246173
2016 Ga0206349_1682998
2017 Ga0206355_1179373
2018 Ga0206350_10626026
2019 Ga0206354_11293970
2020 Ga0206353_10193602
2021 Ga0154015_1702973
2022 Ga0213873_10263288
2023 Ga0213872_10400673
2024 Ga0213874_10022748
2025 Ga0213876_10204990
2026 Ga0213871_10023878
2027 Ga0224712_10011865
2028 Ga0224712_10361874
2029 Ga0209758_1000183
2030 Ga0209758_1022536
2031 Ga0209758_1064599
2032 Ga0207426_1102116
2033 Ga0207697_10113298
2034 Ga0207697_10136582
2035 Ga0207656_10080629
2036 Ga0207656_10269096
2037 Ga0207653_10038324
2038 Ga0207682_10283279
2039 Ga0207692_10107183
2040 Ga0207692_10195267
2041 Ga0207692_10304093
2042 Ga0207692_10457524
2043 Ga0207692_10731483
2044 Ga0207642_10030849
2045 Ga0207642_10468464
2046 Ga0207710_10059715
2047 Ga0207710_10152875
2048 Ga0207710_10241257
2049 Ga0207710_10441552
2050 Ga0207710_10503179
2051 Ga0207688_10264866
2052 Ga0207688_10465756
2053 Ga0207688_10855520
2054 Ga0207680_11004005
2055 Ga0207685_10191741
2056 Ga0207685_10574958
2057 Ga0207699_10025581
2058 Ga0207699_10199589
2059 Ga0207699_10284276
2060 Ga0207699_10679423
2061 Ga0207699_10870700
2062 Ga0207699_11357232
2063 Ga0207699_11370861
2064 Ga0207699_11423756
2065 Ga0207645_10074238
2066 Ga0207645_10214199
2067 Ga0207645_10291619
2068 Ga0207645_10321812
2069 Ga0207643_10022986
2070 Ga0207643_10147552
2071 Ga0207643_11093598
2072 Ga0207643_11103461
2073 Ga0207705_10087806
2074 Ga0207684_10057054
2075 Ga0207654_10276160
2076 Ga0207654_10284125
2077 Ga0207707_10019814
2078 Ga0207707_10027775
2079 Ga0207707_11157195
2080 Ga0207707_11525684
2081 Ga0207695_10054576
2082 Ga0207695_10340223
2083 Ga0207695_11330962
2084 Ga0207671_10099942
2085 Ga0207671_10099958
2086 Ga0207671_10103991
2087 Ga0207671_10174515
2088 Ga0207671_10292548
2089 Ga0207671_10397523
2090 Ga0207693_10008445
2091 Ga0207693_10223615
2092 Ga0207663_10337156
2093 Ga0207663_10385522
2094 Ga0207663_10554305
2095 Ga0207663_10953971
2096 Ga0207663_10982780
2097 Ga0207660_10017576
2098 Ga0207660_10263412
2099 Ga0207660_10742314
2100 Ga0207657_10099624
2101 Ga0207657_10381680
2102 Ga0207649_10143932
2103 Ga0207649_10280444
2104 Ga0207649_10295375
2105 Ga0207649_10781425
2106 Ga0207649_10966266
2107 Ga0207652_10223971
2108 Ga0207652_10407074
2109 Ga0207652_10654237
2110 Ga0207652_11076474
2111 Ga0207652_11767678
2112 Ga0207646_10020117
2113 Ga0207646_10223738
2114 Ga0207646_10624543
2115 Ga0207681_10065491
2116 Ga0207681_10108734
2117 Ga0207681_10462411
2118 Ga0207681_10918781
2119 Ga0207694_10168517
2120 Ga0207694_10426931
2121 Ga0207694_10437989
2122 Ga0207694_10712461
2123 Ga0207650_10019282
2124 Ga0207650_10160698
2125 Ga0207650_10374865
2126 Ga0207650_10382323
2127 Ga0207650_10500076
2128 Ga0207650_10670211
2129 Ga0207659_10051717
2130 Ga0207687_10984439
2131 Ga0207687_11779417
2132 Ga0207700_10011883
2133 Ga0207700_10050788
2134 Ga0207700_10099449
2135 Ga0207700_10117337
2136 Ga0207700_10233831
2137 Ga0207700_10249064
2138 Ga0207664_10018321
2139 Ga0207664_10104239
2140 Ga0207664_10145841
2141 Ga0207664_10231379
2142 Ga0207664_10725311
2143 Ga0207644_10414810
2144 Ga0207644_10881724
2145 Ga0207690_10019600
2146 Ga0207690_10695748
2147 Ga0207706_10047908
2148 Ga0207706_10358299
2149 Ga0207706_11574436
2150 Ga0207686_10230613
2151 Ga0207686_10308337
2152 Ga0207709_10071831
2153 Ga0207709_10506401
2154 Ga0207709_11820810
2155 Ga0207670_10058725
2156 Ga0207670_10115792
2157 Ga0207670_10173635
2158 Ga0207670_10223015
2159 Ga0207670_10393335
2160 Ga0207670_11664827
2161 Ga0207669_10153160
2162 Ga0207669_10253231
2163 Ga0207669_11961854
2164 Ga0207704_10548350
2165 Ga0207704_10963653
2166 Ga0207704_11566462
2167 Ga0207665_10519596
2168 Ga0207665_11231095
2169 Ga0207691_10022379
2170 Ga0207691_10048272
2171 Ga0207691_10943404
2172 Ga0207691_10952283
2173 Ga0207711_10012928
2174 Ga0207711_10243288
2175 Ga0207711_12015424
2176 Ga0207689_10000171
2177 Ga0207689_10676285
2178 Ga0207661_10012723
2179 Ga0207661_10164372
2180 Ga0207661_10481810
2181 Ga0207661_10490613
2182 Ga0207661_10583060
2183 Ga0207661_10939988
2184 Ga0207661_11011652
2185 Ga0207661_12063635
2186 Ga0207679_10034445
2187 Ga0207679_10244466
2188 Ga0207679_10249924
2189 Ga0207679_10349056
2190 Ga0207679_10695184
2191 Ga0207667_10109147
2192 Ga0207667_10119359
2193 Ga0207667_10242401
2194 Ga0207667_10351611
2195 Ga0207667_10697254
2196 Ga0207651_10230043
2197 Ga0207651_10323237
2198 Ga0207651_11298725
2199 Ga0207651_11465163
2200 Ga0207651_11666480
2201 Ga0207712_10238114
2202 Ga0207712_11345480
2203 Ga0207668_10175746
2204 Ga0207668_10662468
2205 Ga0207668_11229596
2206 Ga0207668_11542490
2207 Ga0207668_11905472
2208 Ga0207640_10121501
2209 Ga0207640_10404867
2210 Ga0207640_11457509
2211 Ga0207658_10036473
2212 Ga0207658_10461656
2213 Ga0207658_10569621
2214 Ga0207677_10165314
2215 Ga0207677_10977633
2216 Ga0207677_11645097
2217 Ga0207703_10000464
2218 Ga0207703_10461782
2219 Ga0207703_10480171
2220 Ga0207703_10495105
2221 Ga0207703_10583978
2222 Ga0207703_11657165
2223 Ga0207703_11948419
2224 Ga0207703_12285119
2225 Ga0207639_10079336
2226 Ga0207639_10156367
2227 Ga0207639_10225846
2228 Ga0207639_10496085
2229 Ga0207639_10662177
2230 Ga0207639_11338573
2231 Ga0207678_11015145
2232 Ga0207708_10456892
2233 Ga0207708_11873678
2234 Ga0207702_10086799
2235 Ga0207702_10248372
2236 Ga0207702_10510534
2237 Ga0207702_10933250
2238 Ga0207702_11711522
2239 Ga0207702_12170194
2240 Ga0207641_10032716
2241 Ga0207641_10033949
2242 Ga0207641_11589305
2243 Ga0207641_11887704
2244 Ga0207648_10004075
2245 Ga0207648_10244203
2246 Ga0207648_10321347
2247 Ga0207648_10384967
2248 Ga0207648_10817150
2249 Ga0207676_10016916
2250 Ga0207676_10785895
2251 Ga0207676_10840074
2252 Ga0207676_11028923
2253 Ga0207676_11782465
2254 Ga0207674_10003778
2255 Ga0207674_10009315
2256 Ga0207674_10019754
2257 Ga0207674_10122256
2258 Ga0207674_10540826
2259 Ga0207674_10965182
2260 Ga0207674_12226465
2261 Ga0207675_100013122
2262 Ga0207675_100640535
2263 Ga0207675_100661262
2264 Ga0207675_100745497
2265 Ga0207675_101118784
2266 Ga0207675_102121635
2267 Ga0207675_102568518
2268 Ga0207683_10064958
2269 Ga0207683_10177746
2270 Ga0207683_10557105
2271 Ga0207683_10762643
2272 Ga0207698_10018429
2273 Ga0207698_10103163
2274 Ga0207698_11308132
2275 Ga0207698_11684942
2276 Ga0207698_12005545
2277 Ga0207698_12343020
2278 Ga0207698_12527861
2279 Ga0209588_1033693
2280 Ga0209588_1075701
2281 Ga0209813_10238556
2282 Ga0207428_10016765
2283 Ga0207428_10021763
2284 Ga0207428_10031923
2285 Ga0207428_10526169
2286 Ga0207428_10851416
2287 Ga0268266_10005904
2288 Ga0268266_10066473
2289 Ga0268266_10092860
2290 Ga0268266_10538458
2291 Ga0268266_11217490
2292 Ga0268266_11788426
2293 Ga0268266_12350540
2294 Ga0268265_10011945
2295 Ga0268265_10220537
2296 Ga0268265_10303297
2297 Ga0268265_10465074
2298 Ga0268265_10488372
2299 Ga0268265_12412420
2300 Ga0268265_12585260
2301 Ga0268264_10000084
2302 Ga0268264_10001515
2303 Ga0268264_10642713
2304 Ga0268264_11413595
2305 Ga0268264_11735814
2306 Ga0268264_11892679
2307 Ga0307517_10578289
2308 Ga0265338_10114917
2309 Ga0265338_10613556
2310 Ga0265338_10668674
2311 Ga0265324_10006763
2312 Ga0307511_10052815
2313 Ga0265328_10003733
2314 Ga0265328_10098047
2315 Ga0265325_10024269
2316 Ga0265325_10095155
2317 Ga0265325_10111380
2318 Ga0265340_10303826
2319 Ga0265339_10044955
2320 Ga0265339_10226916
2321 Ga0265331_10000247
2322 Ga0265331_10036305
2323 Ga0265331_10112612
2324 Ga0265327_10023457
2325 Ga0265316_10209861
2326 Ga0265316_10317948
2327 Ga0307509_10153689
2328 Ga0307509_10484231
2329 Ga0307509_10693014
2330 Ga0307408_100144864
2331 Ga0265313_10231007
2332 Ga0307508_10000105
2333 Ga0307508_10239342
2334 Ga0307508_10432899
2335 Ga0265314_10130504
2336 Ga0265314_10193618
2337 Ga0265342_10140469
2338 Ga0316578_10334185
2339 Ga0307516_10670925
2340 Ga0307405_10237908
2341 Ga0307413_11211737
2342 Ga0307406_10579121
2343 Ga0307416_100346498
2344 Ga0307411_11982867
2345 Ga0307415_102194505
2346 Ga0307510_10303858
2347 Ga0316215_1016362
2348 Ga0373950_0063721
2349 Ga0373959_0125493
2350 Ga0373938_0002387
2351 Ga0373938_0115185
2352 Ga0373926_0026586
2353 Ga0373928_0067222
2354 Ga0373929_0029597
2355 Ga0373929_0146869
2356 Ga0373929_0188123
2357 Ga0373934_0015167
2358 Ga0373934_0135409
2359 Ga0373940_0336563
2360 Ga0373944_0018895
2361 Ga0373949_0050956
2362 Ga0373951_0030626
2363 Ga0373951_0134474
2364 Ga0373952_0215162
2365 Ga0373923_0029232
2366 Ga0373923_0103330
2367 Ga0373923_0234032
2368 Ga0373932_0273949
2369 Ga0373936_0076639
2370 Ga0373936_0087248
2371 Ga0373936_0127000
2372 Ga0373936_0160980
2373 Ga0373936_0200801
2374 Ga0373939_0062831
2375 Ga0373939_0166417
2376 Ga0373939_0185760
2377 Ga0373941_0069709
2378 Ga0373941_0079932
2379 Ga0373941_0138650
2380 Ga0373941_0434345
2381 Ga0373945_0135627
2382 Ga0373945_0185044
2383 Ga0373953_0104021
2384 Ga0373953_0183285
2385 Ga0373954_0034467
2386 Ga0373954_0053703
2387 Ga0373954_0676560
2388 Ga0373956_0107278
2389 Ga0373956_0121293
2390 Ga0373957_0301896
2391 Ga0373957_0353780
2392 Ga0373960_0052412
2393 Ga0373960_0351672
2394 Ga0373943_0056320
2395 Ga0373943_0121832
2396 Ga0373943_0310015
2397 Ga0373946_0047551
2398 Ga0373946_0283397
2399 Ga0373955_0059090
2400 Ga0373942_0386317
2401 Ga0373961_0011686
2402 Ga0373961_0013644
2403 Ga0373961_0069950
2404 Ga0373962_0022174
2405 Ga0373962_0028668
2406 Ga0373924_0306384
2407 Ga0373931_0000317
2408 Ga0373931_0004056
2409 Ga0373931_0193823
2410 Ga0373931_0223543
2411 Ga0373931_0496027
2412 Ga0373931_0517315
2413 Ga0373935_0101455
2414 Ga0373935_0136231
2415 Ga0373935_0166266
2416 Ga0373935_0544927
2417 Ga0373935_0614359
2418 Ga0373935_0948113
2419 Ga0373935_1096472
2420 Ga0373927_0024147
2421 Ga0373927_0116454
2422 Ga0373927_0153953
2423 Ga0373927_0292335
2424 Ga0373927_0312442
2425 Ga0373927_0578213
2426 Ga0373927_0858655
2427 Ga0373933_0017280
2428 Ga0373933_0087473
2429 Ga0373933_0884186
2430 Ga0373947_0024091
2431 Ga0373947_0038743
2432 Ga0373947_0052625
2433 Ga0373947_0086745
2434 Ga0373947_0356324
2435 Ga0373947_0664591
2436 Ga0373937_0108821
2437 Ga0373937_0118391
2438 Ga0373937_0162129
2439 Ga0373937_0227375
2440 Ga0372808_001897
2441 Ga0373925_0042688
2442 Ga0373925_0075212
2443 Ga0373925_0077433
2444 Ga0373925_0079553
2445 Ga0373925_0112578
2446 Ga0373925_0491133
2447 Ga0373925_0708989
2448 Ga0373925_0845393
2449 Ga0395899_0002162
2450 Ga0395899_0021402
2451 Ga0395899_0302544
2452 Ga0395900_0004853
2453 Ga0395900_0005904
2454 Ga0395900_0064978
2455 Ga0395900_0240772
2456 Ga0395900_1047689
2457 Ga0395898_0012089
2458 Ga0395898_0149599
2459 Ga0395898_0162409
2460 Ga0395905_0180874
2461 Ga0436364_0574078
2462 Ga0436364_1015918
2463 Ga0395901_0040678
2464 Ga0395901_0139607
2465 Ga0395901_0148919
2466 Ga0395901_0195047
2467 Ga0395901_0381956
2468 Ga0436365_0368730
2469 Ga0436365_0622183
2470 Ga0436365_0820984
2471 Ga0436365_0869883
2472 Ga0436365_0920296
2473 Ga0436365_1044564
2474 Ga0436365_1545720
2475 Ga0436365_1547297
2476 Ga0436365_1649599
2477 Ga0436365_1722483
2478 Ga0436360_0542064
2479 Ga0436360_0826367
2480 Ga0436360_1024581
2481 Ga0436360_1144799
2482 Ga0436361_0035526
2483 Ga0436361_0175551
2484 Ga0436361_0683077
2485 Ga0436361_0984910
2486 Ga0436361_1160036
2487 Ga0436363_0402227
2488 Ga0436363_0461653
2489 Ga0436363_1236422
2490 Ga0436363_1265235
2491 Ga0436362_0026859
2492 Ga0436362_0272131
2493 Ga0436362_0339798
2494 Ga0436362_0965633
2495 Ga0439447_053466
2496 Ga0439466_0108367
2497 Ga0439465_0072857
2498 Ga0451789_1040744
2499 Ga0451793_1111873
2500 Ga0451797_1343343
2501 Ga0451795_1639049
2502 Ga0451800_0546300
2503 Ga0451804_0238532
2504 Ga0451807_1577102
2505 Ga0451807_1819751
2506 Ga0451839_0668696
2507 Ga0451849_0120354
2508 Ga0451849_0905281
2509 Ga0451853_1687619
2510 Ga0451853_2022784
2511 Ga0439441_078718
2512 Ga0439442_110396
2513 Ga0439442_144014
2514 Ga0439445_0094973
2515 Ga0439432_209705
2516 Ga0439434_0269612
2517 Ga0439435_0075194
2518 Ga0439459_0003070
2519 Ga0439459_0062672
2520 Ga0439464_0163929
2521 Ga0450893_0099443
2522 Ga0451577_0000001
2523 Ga0451577_0132183
2524 Ga0451577_0193602
2525 Ga0451577_0209539
2526 Ga0451577_0292611
2527 Ga0466972_0506264
2528 Ga0453683_0006182
2529 Ga0453683_0015557
2530 Ga0466966_0894995
2531 Ga0466961_0086598
2532 Ga0466963_0021148
2533 Ga0466963_0080570
2534 Ga0466963_0728197
2535 Ga0466964_0242465
2536 Ga0453684_0000015
2537 Ga0453684_0000020
2538 Ga0453684_0020836
2539 Ga0453684_0517058
2540 Ga0466968_0312566
2541 Ga0466968_0409195
2542 Ga0466968_0640833
2543 Ga0466957_0019808
2544 Ga0451576_0000203
2545 Ga0451576_0000863
2546 Ga0451576_0003091
2547 Ga0451576_0352313
2548 Ga0451576_0514088
2549 Ga0451576_2281211
2550 Ga0451576_2683832
2551 Ga0466967_0002809
2552 Ga0466967_0444622
2553 Ga0466967_0943300
2554 Ga0466967_1480479
2555 Ga0466967_1543262
2556 Ga0466967_2140231
2557 Ga0466967_2334817
2558 Ga0495603_0100902
2559 Ga0495590_0130756
2560 Ga0495629_0104690
2561 Ga0495629_0624215
2562 Ga0495638_0177511
2563 Ga0495638_0306213
2564 Ga0495638_0312985
2565 Ga0495651_0742602
2566 Ga0495653_0101144
2567 Ga0495653_0165483
2568 Ga0495580_0013706
2569 Ga0495580_0329207
2570 Ga0495580_0884977
2571 Ga0495580_0941935
2572 Ga0495580_1013166
2573 Ga0495582_0046171
2574 Ga0495582_0310633
2575 Ga0495605_0392253
2576 Ga0495639_0110802
2577 Ga0495662_0010302
2578 Ga0495662_0382379
2579 Ga0495664_0014771
2580 Ga0495664_0113036
2581 Ga0495664_0201077
2582 Ga0495664_0383713
2583 Ga0495584_0381930
2584 Ga0495594_0255209
2585 Ga0495606_0105987
2586 Ga0495618_0274332
2587 Ga0495628_0509100
2588 Ga0495630_0040788
2589 Ga0495630_0608366
2590 Ga0495630_0711827
2591 Ga0495630_0909152
2592 Ga0495630_0987330
2593 Ga0495643_0140317
2594 Ga0495644_0320088
2595 Ga0495666_0092268
2596 Ga0495652_0105267
2597 Ga0495665_0087128
2598 Ga0495665_0102077
2599 Ga0495640_0041700
2600 Ga0495640_0334793
2601 Ga0495640_0967864
2602 Ga0495640_0967887
2603 Ga0495586_0051611
2604 Ga0495586_0479206
2605 Ga0495587_0454348
2606 Ga0495645_0027722
2607 Ga0495645_0069587
2608 Ga0495645_0560322
2609 Ga0495622_0068342
2610 Ga0495667_0040028
2611 Ga0495667_0255806
2612 Ga0495668_0055967
2613 Ga0495634_0124638
2614 Ga0495634_0249724
2615 Ga0495634_0371248
2616 Ga0495634_0644864
2617 Ga0495634_0789494
2618 Ga0495611_0302797
2619 Ga0495635_0000082
2620 Ga0495635_0007858
2621 Ga0495635_0418785
2622 Ga0495657_0029197
2623 Ga0495657_0357251
2624 Ga0495599_0211052
2625 Ga0495599_0524964
2626 Ga0495599_0771340
2627 Ga0495623_0427013
2628 Ga0495623_0509093
2629 Ga0495646_0201999
2630 Ga0495647_0126736
2631 Ga0495647_0221857
2632 Ga0495647_0533491
2633 Ga0495658_0018744
2634 Ga0495613_0107356
2635 Ga0495613_0167055
2636 Ga0495613_0248223
2637 Ga0495624_0043952
2638 Ga0495624_0170757
2639 Ga0495624_0457305
2640 Ga0495624_0519326
2641 Ga0495624_0762580
2642 Ga0495671_0200171
2643 Ga0495671_0558766
2644 Ga0495600_0044373
2645 Ga0495581_0078431
2646 Ga0495581_0171710
2647 Ga0495604_0047067
2648 Ga0495604_0536057
2649 Ga0495604_0851316
2650 Ga0495674_0004477
2651 Ga0495674_0313533
2652 Ga0495674_0400956
2653 Ga0495674_0588326
2654 Ga0495674_0627840
2655 Ga0495676_0414621
2656 Ga0495676_0624935
2657 Ga0495680_0000053
2658 Ga0495680_0176291
2659 Ga0495680_0528785
2660 Ga0495675_0039762
2661 Ga0495675_0164407
2662 Ga0495675_0762373
2663 Ga0495684_0004775
2664 Ga0495684_0017082
2665 Ga0495684_0064085
2666 Ga0495684_0389357
2667 Ga0495684_0469339
2668 Ga0495593_0222643
2669 Ga0495593_0251714
2670 Ga0495602_0127031
2671 Ga0495614_0638168
2672 Ga0496101_0719796
2673 Ga0496102_0125174
2674 Ga0496102_0789570
2675 Ga0496102_0858763
2676 Ga0496102_1175772
2677 Ga0496102_1778335
2678 Ga0496103_0012360
2679 Ga0496104_0232656
2680 Ga0496104_0407065
2681 Ga0496104_0666642
2682 Ga0496106_0008099
2683 Ga0496108_0347601
2684 Ga0496108_0608052
2685 Ga0496108_0674340
2686 Ga0496109_0185900
2687 Ga0496109_0417709
2688 Ga0496109_0500653
2689 Ga0496109_0557691
2690 Ga0496109_1539534
2691 Ga0496109_1596625
2692 Ga0496110_0075010
2693 Ga0496110_0263698
2694 Ga0496111_0876394
2695 Ga0496111_1327911
2696 Ga0496112_0024268
2697 Ga0496112_0478293
2698 Ga0496112_0847901
2699 Ga0496112_1167960
2700 Ga0496113_0023534
2701 Ga0496113_0601457
2702 Ga0496114_0313535
2703 Ga0496114_1319172
2704 Ga0496115_0042673
2705 Ga0496115_0258938
2706 Ga0496115_0994423
2707 Ga0496117_0054306
2708 Ga0496118_0002057
2709 Ga0496121_0000077
2710 Ga0496121_0032758
2711 Ga0496121_0053767
2712 Ga0496124_0006148
2713 Ga0496125_0044761
2714 Ga0496126_0009366
2715 Ga0496126_0018937
2716 Ga0496126_0150968
2717 Ga0496126_0318929
2718 Ga0496126_0376505
2719 Ga0501309_006054
2720 Ga0501310_010792
2721 Ga0501307_044908
2722 Ga0501032_0390118
2723 Ga0501033_0187960
2724 Ga0501033_0775583
2725 Ga0501034_0000109
2726 Ga0501034_0001751
2727 Ga0501034_0053875
2728 Ga0501034_0115699
2729 Ga0501034_0574374
2730 Ga0501036_0383455
2731 Ga0501037_0287677
2732 Ga0501038_0397428
2733 Ga0501038_0719954
2734 Ga0501039_0614442
2735 Ga0501041_1107385
2736 Ga0501043_0125279
2737 Ga0501046_0116625
2738 Ga0501048_0297614
2739 Ga0501048_0543739
2740 Ga0501067_0280248
2741 Ga0501067_0382168
2742 Ga0501067_0685041
2743 Ga0501068_0252362
2744 Ga0501069_0923060
2745 Ga0501070_0136672
2746 Ga0501070_0203456
2747 Ga0501070_0685443
2748 Ga0501070_1237674
2749 Ga0501071_0577730
2750 Ga0501072_0307215
2751 Ga0501072_0601028
2752 Ga0501073_0223858
2753 Ga0501073_0384093
2754 Ga0501073_0413478
2755 Ga0501076_0297973
2756 Ga0501076_1041855
2757 Ga0501079_0411430
2758 Ga0501079_0865511
2759 Ga0501080_0299923
2760 Ga0501080_0906495
2761 Ga0501080_1068868
2762 Ga0501080_1204437
2763 Ga0501080_1804565
2764 Ga0501081_0278248
2765 Ga0501035_0889832
2766 Ga0501044_0235998
2767 Ga0501045_0359472
2768 Ga0501045_0419115
2769 nmdc:mga03683_132101_c1
2770 nmdc:mga03683_148518_c1
2771 nmdc:mga03683_15481_c1
2772 nmdc:mga03683_169568_c1
2773 nmdc:mga03683_1825_c1
2774 nmdc:mga03683_22746_c1
2775 nmdc:mga03683_32482_c1
2776 nmdc:mga03683_32979_c1
2777 nmdc:mga03683_397443_c1
2778 nmdc:mga03683_461697_c1
2779 nmdc:mga03683_76855_c1
2780 nmdc:mga03n38_102713_c1
2781 nmdc:mga03n38_951783_c1
2782 nmdc:mga00v17_207477_c1
2783 nmdc:mga00v17_39264_c1
2784 nmdc:mga0yw44_129575_c1
2785 nmdc:mga0yw44_22312_c1
2786 nmdc:mga0yw44_38472_c1
2787 nmdc:mga0yw44_446005_c1
2788 nmdc:mga0yw44_467214_c1
2789 nmdc:mga0yw44_730278_c1
2790 nmdc:mga0k408_107710_c1
2791 nmdc:mga0k408_162678_c1
2792 nmdc:mga0k408_343354_c1
2793 nmdc:mga0k408_5567_c1
2794 nmdc:mga0k408_609334_c1
2795 nmdc:mga06z11_101549_c1
2796 nmdc:mga06z11_127247_c1
2797 nmdc:mga06z11_174175_c1
2798 nmdc:mga06z11_261579_c1
2799 nmdc:mga06z11_305409_c1
2800 nmdc:mga06z11_358863_c1
2801 nmdc:mga06z11_43471_c1
2802 nmdc:mga06z11_5646_c1
2803 nmdc:mga06z11_571794_c1
2804 nmdc:mga04h51_136829_c1
2805 nmdc:mga07m45_367567_c1
2806 nmdc:mga07m45_402050_c1
2807 nmdc:mga07m45_424909_c1
2808 nmdc:mga07m45_56464_c1
2809 nmdc:mga07m45_760326_c1
2810 nmdc:mga07m45_803591_c1
2811 nmdc:mga05p37_733444_c1
2812 nmdc:mga05p37_8689_c1
2813 nmdc:mga09592_1156863_c1
2814 nmdc:mga09592_207576_c1
2815 nmdc:mga09592_2383_c1
2816 nmdc:mga0qj67_32605_c1
2817 nmdc:mga0qj67_59574_c1
2818 nmdc:mga0qj67_606036_c1
2819 nmdc:mga06r32_7094_c1
2820 nmdc:mga06r32_96109_c1
2821 nmdc:mga08y16_122656_c1
2822 nmdc:mga08y16_13156_c1
2823 nmdc:mga08y16_20207_c1
2824 nmdc:mga08y16_245174_c1
2825 nmdc:mga08y16_295626_c1
2826 nmdc:mga08y16_996516_c1
2827 nmdc:mga0n895_1248009_c1
2828 nmdc:mga0n895_1346942_c1
2829 nmdc:mga0n895_17745_c1
2830 nmdc:mga0n895_237294_c1
2831 nmdc:mga0n895_293958_c1
2832 nmdc:mga0n895_329968_c1
2833 nmdc:mga0n895_40414_c1
2834 nmdc:mga0n895_413359_c1
2835 nmdc:mga0n895_64973_c1
2836 nmdc:mga0rr50_549627_c1
2837 nmdc:mga0rr50_954746_c1
2838 nmdc:mga08x19_1063571_c1
2839 nmdc:mga08x19_1158850_c1
2840 nmdc:mga08x19_175174_c1
2841 nmdc:mga08x19_463128_c1
2842 nmdc:mga08x19_916772_c1
2843 nmdc:mga0a205_36569_c1
2844 nmdc:mga0a205_678075_c1
2845 nmdc:mga0a205_72159_c1
2846 nmdc:mga0a205_803235_c1
2847 nmdc:mga0sz30_175604_c1
2848 nmdc:mga0sz30_239_c1
2849 nmdc:mga0sz30_36367_c1
2850 nmdc:mga0sz30_424010_c1
2851 nmdc:mga0sz30_486680_c1
2852 nmdc:mga0sz30_5231_c1
2853 Ga0495601_0084629
2854 Ga0495601_0098753
2855 Ga0495601_0236563
2856 Ga0495601_0284716
2857 Ga0495601_0347852
2858 Ga0495601_0470982
2859 Ga0495612_0028179
2860 Ga0495612_0045922
2861 Ga0495612_0147855
2862 Ga0500610_0230325
2863 Ga0500610_0367761
2864 Ga0500635_0003286
2865 Ga0495655_0066366
2866 Ga0495595_0233573
2867 Ga0495595_0283669
2868 Ga0495595_0652117
2869 Ga0495595_0711475
2870 Ga0495619_0020222
2871 Ga0495619_0112948
2872 Ga0495619_0229266
2873 Ga0500643_019179
2874 Ga0500643_157092
2875 Ga0500644_0007897
2876 Ga0500644_0363605
2877 Ga0500647_0234975
2878 Ga0500583_0480932
2879 Ga0500583_0508775
2880 Ga0500651_0016352
2881 Ga0500651_0731053
2882 Ga0500566_0071146
2883 Ga0500566_0191433
2884 Ga0500641_0000244
2885 Ga0500555_078586
2886 Ga0500557_123515
2887 Ga0500558_162861
2888 Ga0500594_0108816
2889 Ga0500595_027620
2890 Ga0500595_071275
2891 Ga0500595_159895
2892 Ga0500597_244030
2893 Ga0500614_066050
2894 Ga0500642_0126365
2895 Ga0500642_0143929
2896 Ga0500642_0515829
2897 Ga0500652_216897
2898 Ga0500559_0104030
2899 Ga0500577_0069185
2900 Ga0500577_0182992
2901 Ga0500577_0218436
2902 Ga0500588_0175088
2903 Ga0500590_080916
2904 Ga0500590_179822
2905 Ga0500590_258878
2906 Ga0500603_018179
2907 Ga0500616_0000925
2908 Ga0500616_0149582
2909 Ga0500620_019185
2910 Ga0500627_0155211
2911 Ga0500638_285809
2912 Ga0500639_253271
2913 Ga0500636_0086777
2914 Ga0500657_128973
2915 Ga0500609_025225
2916 Ga0500552_007586
2917 Ga0500552_018616
2918 Ga0500596_005014
2919 Ga0587115_033509
2920 Ga0587067_231921
2921 Ga0501082_1064267
2922 Ga0530510_0221050
2923 Ga0530510_0974321
2924 2513692969
2925 2513911411
2926 2824707025
2927 2824757193
2928 2824766791
2929 2838080529
2930 2904720910

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19451

DUF5989

Family of unknown function (DUF5989)

2

48

0.98

Map