F494162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1465 | 525 | 2930 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0001039|Ga0495610_0001039_11472_12479 |
| Length | 335 |
| Sequence | MGSHHAANARCALSCGFIFHVDPGMSELILHHYPTSPFAEKARLLLGFKGLSWHSVHISPVMPKPDLTALTGGYRKTPVLQVGADIYCDTALIARRLEQEKNAPALFPLGQEMITQTFATWADSVVFAHAVSLVFQPESVAVRFGKLPPEAIKAFLADRAALFSGGTASKLPAELAKHQWPAIMARLEQQLQRESGDFLFGEPSIADFAMAHPLWFLKATPVTAPLVDAYPAVSAWLGRVLGFGHGTASQMTAEQALAIAHDATPAALPDEVFEDLNGFKAGQQVTISAIDYGVDPVAGELLFAGREELILRRTDPRAGTVHVHFPRFGFRLQAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 45 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 64 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 80 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 113 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 121 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 123 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 124 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 137 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 138 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 139 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 140 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 141 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 142 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 143 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 144 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 145 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 146 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 147 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 148 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 149 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 150 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 151 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 152 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 153 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 154 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 155 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 156 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 157 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 158 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 159 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 160 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 161 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 162 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 163 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 164 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 165 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 166 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 167 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 168 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 169 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 170 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 171 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 172 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 173 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 174 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 175 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 176 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 177 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 178 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 179 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 180 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 185 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 276 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 277 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 289 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 293 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 295 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 296 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 297 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 298 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 301 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 302 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 303 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 304 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 305 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 306 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 307 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 308 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 309 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 310 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 311 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 312 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 313 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 314 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 315 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 316 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 317 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 318 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 319 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 320 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 321 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 322 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 323 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 324 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 325 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 326 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 327 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 328 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 329 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 330 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 331 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 332 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 333 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 334 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 335 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 336 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 337 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 338 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 339 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 340 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 341 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 342 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 343 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 344 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 345 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 346 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 347 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 348 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 349 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 350 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 351 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 352 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 353 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 354 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 355 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 356 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 357 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 358 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 359 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 360 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 361 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 362 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 363 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 364 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 365 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 366 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 367 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 368 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 369 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 370 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 371 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 372 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 373 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 374 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 375 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 376 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 377 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 378 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 379 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 380 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 381 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 382 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 383 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 384 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 385 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 386 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 387 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 388 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 389 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 390 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 391 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 392 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 393 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 394 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 395 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 396 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 397 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 398 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 399 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 400 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 401 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 402 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 403 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 404 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 405 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 406 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 407 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 408 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 409 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 410 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 411 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 412 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 413 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 414 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 415 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 416 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 417 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 418 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 419 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 420 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 421 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 422 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 423 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 424 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 425 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 426 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 427 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 428 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 429 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 430 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 431 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 432 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 433 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 434 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 435 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 436 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 437 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 438 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 439 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 440 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 441 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 442 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 443 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 444 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 445 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 446 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 447 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 448 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 449 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 450 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 451 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 452 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 453 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 454 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 455 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 456 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 457 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 458 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 459 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 460 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 461 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 462 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 463 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 464 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 465 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 466 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 467 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 468 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 469 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 470 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 471 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 472 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 473 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 474 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 475 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 476 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 477 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 478 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 479 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 480 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 481 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 482 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 483 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 484 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 485 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 486 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 487 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 488 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 489 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 490 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 491 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 492 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 493 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 494 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 495 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 496 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 497 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 498 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 499 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 500 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 501 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 502 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 503 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 504 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 505 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 506 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 507 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 508 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 509 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 510 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 511 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 512 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 513 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 514 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 515 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 516 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 517 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 518 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 519 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 520 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 521 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 522 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 523 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 524 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 525 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.3 |
| Metatranscriptomes | 0.27 |
| Isolates | 15.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.87 |
| Nodule | 1.91 |
| Rhizoplane | 5.26 |
| Rhizosphere | 76.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495610_0001039 | 3300046512 | Bacteria | 25481 |
| 2 | MRS2a_Contig_63 | 2124908027 | Bacteria | 63450 |
| 3 | MRS2a_Contig_7600 | 2124908027 | Bacteria | 2011 |
| 4 | MRS2a_Contig_8476 | 2124908027 | Bacteria | 2660 |
| 5 | MRS2a_Contig_9215 | 2124908027 | Bacteria | 2179 |
| 6 | SwRhRL2b_contig_2219553 | 2162886007 | Bacteria | 1822 |
| 7 | MRS1b_contig_129378 | 2162886011 | Bacteria | 2264 |
| 8 | JGI24740J21852_10001732 | 3300001979 | Bacteria | 10022 |
| 9 | JGI24740J21852_10002050 | 3300001979 | Bacteria | 9220 |
| 10 | JGI25156J39149_1001376 | 3300002705 | Bacteria | 10403 |
| 11 | JGI25162J39368_1000101 | 3300002737 | Bacteria | 94481 |
| 12 | JGI25162J39368_1000200 | 3300002737 | Bacteria | 63130 |
| 13 | JGI25154J39366_1000385 | 3300002738 | Bacteria | 24073 |
| 14 | JGI25163J39215_1000804 | 3300002771 | Bacteria | 7561 |
| 15 | JGI25163J39215_1000908 | 3300002771 | Bacteria | 6844 |
| 16 | JGI25164J39214_1000097 | 3300002772 | Bacteria | 87008 |
| 17 | JGI25164J39214_1000162 | 3300002772 | Bacteria | 63130 |
| 18 | JGI25165J46597_1000184 | 3300003214 | Bacteria | 94481 |
| 19 | JGI25165J46597_1000294 | 3300003214 | Bacteria | 63130 |
| 20 | Ga0055539_1000071 | 3300003752 | Bacteria | 131539 |
| 21 | Ga0055533_1000904 | 3300003756 | Bacteria | 8895 |
| 22 | Ga0055533_1003773 | 3300003756 | Bacteria | 2924 |
| 23 | Ga0055533_1009276 | 3300003756 | Bacteria | 1181 |
| 24 | Ga0055532_1000019 | 3300003758 | Bacteria | 286358 |
| 25 | Ga0055525_1000403 | 3300003759 | Bacteria | 27199 |
| 26 | Ga0055527_1000991 | 3300003760 | Bacteria | 6896 |
| 27 | Ga0055535_1000014 | 3300003761 | Bacteria | 286358 |
| 28 | Ga0055542_1000924 | 3300003762 | Bacteria | 19632 |
| 29 | Ga0055529_1000096 | 3300003763 | Bacteria | 133329 |
| 30 | Ga0055536_1000062 | 3300003781 | Bacteria | 99169 |
| 31 | Ga0055536_1001861 | 3300003781 | Bacteria | 12310 |
| 32 | Ga0055536_1001903 | 3300003781 | Bacteria | 12104 |
| 33 | Ga0055530_10000489 | 3300003791 | Bacteria | 34449 |
| 34 | Ga0055530_10004633 | 3300003791 | Bacteria | 6992 |
| 35 | Ga0055530_10004650 | 3300003791 | Bacteria | 6969 |
| 36 | Ga0055540_1000517 | 3300003792 | Bacteria | 29219 |
| 37 | Ga0055540_1001945 | 3300003792 | Bacteria | 11559 |
| 38 | Ga0055540_1001985 | 3300003792 | Bacteria | 11435 |
| 39 | Ga0055531_10003116 | 3300003794 | Bacteria | 10703 |
| 40 | Ga0055541_1000242 | 3300003841 | Bacteria | 20463 |
| 41 | Ga0055541_1004405 | 3300003841 | Bacteria | 2556 |
| 42 | Ga0055541_1012093 | 3300003841 | Bacteria | 1246 |
| 43 | Ga0055541_1012407 | 3300003841 | Bacteria | 1223 |
| 44 | Ga0065714_10008671 | 3300005288 | Bacteria | 2572 |
| 45 | Ga0065714_10031591 | 3300005288 | Bacteria | 1044 |
| 46 | Ga0065714_10066928 | 3300005288 | Bacteria | 6088 |
| 47 | Ga0065714_10068668 | 3300005288 | Bacteria | 4601 |
| 48 | Ga0065714_10072823 | 3300005288 | Bacteria | 3295 |
| 49 | Ga0065704_10074287 | 3300005289 | Bacteria | 6381 |
| 50 | Ga0065712_10001642 | 3300005290 | Bacteria | 5479 |
| 51 | Ga0065712_10068146 | 3300005290 | Bacteria | 13871 |
| 52 | Ga0065715_10117220 | 3300005293 | Bacteria | 2355 |
| 53 | Ga0070670_100015268 | 3300005331 | Bacteria | 6592 |
| 54 | Ga0070661_100000268 | 3300005344 | Bacteria | 42166 |
| 55 | Ga0070661_100019768 | 3300005344 | Bacteria | 4800 |
| 56 | Ga0070669_100000159 | 3300005353 | Bacteria | 60857 |
| 57 | Ga0070669_100010573 | 3300005353 | Bacteria | 6552 |
| 58 | Ga0070659_100001771 | 3300005366 | Bacteria | 15514 |
| 59 | Ga0070662_100000135 | 3300005457 | Bacteria | 41642 |
| 60 | Ga0068853_100007167 | 3300005539 | Bacteria | 8924 |
| 61 | Ga0070664_100000005 | 3300005564 | Bacteria | 222746 |
| 62 | Ga0070664_100026608 | 3300005564 | Bacteria | 4800 |
| 63 | Ga0070664_100220303 | 3300005564 | Bacteria | 1698 |
| 64 | Ga0068857_100002560 | 3300005577 | Bacteria | 14892 |
| 65 | Ga0068854_100000076 | 3300005578 | Bacteria | 70578 |
| 66 | Ga0068854_100062350 | 3300005578 | Bacteria | 2703 |
| 67 | Ga0068856_100000531 | 3300005614 | Bacteria | 42028 |
| 68 | Ga0068851_10000006 | 3300005834 | Bacteria | 258116 |
| 69 | Ga0075364_10079847 | 3300006051 | Bacteria | 2162 |
| 70 | Ga0075432_10002347 | 3300006058 | Bacteria | 6308 |
| 71 | Ga0075432_10002845 | 3300006058 | Bacteria | 5808 |
| 72 | Ga0075432_10029007 | 3300006058 | Bacteria | 1909 |
| 73 | Ga0075432_10037104 | 3300006058 | Bacteria | 1695 |
| 74 | Ga0075432_10087029 | 3300006058 | Bacteria | 1139 |
| 75 | Ga0075432_10093955 | 3300006058 | Bacteria | 1101 |
| 76 | Ga0075362_10019688 | 3300006177 | Bacteria | 2810 |
| 77 | Ga0075436_100059652 | 3300006914 | Bacteria | 2635 |
| 78 | Ga0075436_100190920 | 3300006914 | Bacteria | 1449 |
| 79 | Ga0075436_100268586 | 3300006914 | Bacteria | 1218 |
| 80 | Ga0079104_1000168 | 3300006946 | Bacteria | 93546 |
| 81 | Ga0079104_1002966 | 3300006946 | Bacteria | 8361 |
| 82 | Ga0099826_10020343 | 3300006948 | Bacteria | 4980 |
| 83 | Ga0105251_10000012 | 3300009011 | Bacteria | 167614 |
| 84 | Ga0105251_10000767 | 3300009011 | Bacteria | 29225 |
| 85 | Ga0105251_10002979 | 3300009011 | Bacteria | 12671 |
| 86 | Ga0105251_10008214 | 3300009011 | Bacteria | 6310 |
| 87 | Ga0105251_10010191 | 3300009011 | Bacteria | 5475 |
| 88 | Ga0105251_10047851 | 3300009011 | Bacteria | 2053 |
| 89 | Ga0105251_10090853 | 3300009011 | Bacteria | 1403 |
| 90 | Ga0105251_10128043 | 3300009011 | Bacteria | 1152 |
| 91 | Ga0105251_10143315 | 3300009011 | Bacteria | 1081 |
| 92 | Ga0105244_10001581 | 3300009036 | Bacteria | 18092 |
| 93 | Ga0105244_10013121 | 3300009036 | Bacteria | 4857 |
| 94 | Ga0105244_10014063 | 3300009036 | Bacteria | 4645 |
| 95 | Ga0105244_10017288 | 3300009036 | Bacteria | 4080 |
| 96 | Ga0105244_10022697 | 3300009036 | Bacteria | 3451 |
| 97 | Ga0105244_10024063 | 3300009036 | Bacteria | 3329 |
| 98 | Ga0105244_10042057 | 3300009036 | Bacteria | 2365 |
| 99 | Ga0105244_10051806 | 3300009036 | Bacteria | 2091 |
| 100 | Ga0105244_10058560 | 3300009036 | Bacteria | 1944 |
| 101 | Ga0105244_10072796 | 3300009036 | Bacteria | 1711 |
| 102 | Ga0105244_10092013 | 3300009036 | Bacteria | 1491 |
| 103 | Ga0105244_10093355 | 3300009036 | Bacteria | 1478 |
| 104 | Ga0105244_10153023 | 3300009036 | Bacteria | 1104 |
| 105 | Ga0105244_10153089 | 3300009036 | Bacteria | 1104 |
| 106 | Ga0105250_10000356 | 3300009092 | Bacteria | 34837 |
| 107 | Ga0105250_10000928 | 3300009092 | Bacteria | 17247 |
| 108 | Ga0105250_10004354 | 3300009092 | Bacteria | 6526 |
| 109 | Ga0105250_10011113 | 3300009092 | Bacteria | 3739 |
| 110 | Ga0105250_10034045 | 3300009092 | Bacteria | 2045 |
| 111 | Ga0105250_10058531 | 3300009092 | Bacteria | 1547 |
| 112 | Ga0105250_10075130 | 3300009092 | Bacteria | 1367 |
| 113 | Ga0105240_10051969 | 3300009093 | Bacteria | 5153 |
| 114 | Ga0105243_10000183 | 3300009148 | Bacteria | 73056 |
| 115 | Ga0105243_10000459 | 3300009148 | Bacteria | 42362 |
| 116 | Ga0105243_10006410 | 3300009148 | Bacteria | 9093 |
| 117 | Ga0105243_10026002 | 3300009148 | Bacteria | 4479 |
| 118 | Ga0105243_10063503 | 3300009148 | Bacteria | 2959 |
| 119 | Ga0105243_10130031 | 3300009148 | Bacteria | 2135 |
| 120 | Ga0105248_10139144 | 3300009177 | Bacteria | 2738 |
| 121 | Ga0105237_10008757 | 3300009545 | Bacteria | 10919 |
| 122 | Ga0105246_10000832 | 3300011119 | Bacteria | 17573 |
| 123 | Ga0105246_10005266 | 3300011119 | Bacteria | 7868 |
| 124 | Ga0105246_10028754 | 3300011119 | Bacteria | 3654 |
| 125 | Ga0105246_10043300 | 3300011119 | Bacteria | 3054 |
| 126 | Ga0157336_1000928 | 3300012477 | Bacteria | 1433 |
| 127 | Ga0157373_10001669 | 3300013100 | Bacteria | 16941 |
| 128 | Ga0157373_10001920 | 3300013100 | Bacteria | 15794 |
| 129 | Ga0157373_10003849 | 3300013100 | Bacteria | 11341 |
| 130 | Ga0157373_10004545 | 3300013100 | Bacteria | 10431 |
| 131 | Ga0157373_10006350 | 3300013100 | Bacteria | 8827 |
| 132 | Ga0157373_10009214 | 3300013100 | Bacteria | 7299 |
| 133 | Ga0157373_10010034 | 3300013100 | Bacteria | 6978 |
| 134 | Ga0157373_10013519 | 3300013100 | Bacteria | 5986 |
| 135 | Ga0157373_10060853 | 3300013100 | Bacteria | 2675 |
| 136 | Ga0157373_10126130 | 3300013100 | Bacteria | 1800 |
| 137 | Ga0157373_10131730 | 3300013100 | Bacteria | 1758 |
| 138 | Ga0157371_10000171 | 3300013102 | Bacteria | 94501 |
| 139 | Ga0157371_10000319 | 3300013102 | Bacteria | 62459 |
| 140 | Ga0157371_10005255 | 3300013102 | Bacteria | 10987 |
| 141 | Ga0157371_10011855 | 3300013102 | Bacteria | 6691 |
| 142 | Ga0157370_10000052 | 3300013104 | Bacteria | 122634 |
| 143 | Ga0157370_10000109 | 3300013104 | Bacteria | 95051 |
| 144 | Ga0157370_10044723 | 3300013104 | Bacteria | 4253 |
| 145 | Ga0157370_10045775 | 3300013104 | Bacteria | 4197 |
| 146 | Ga0157370_10060110 | 3300013104 | Bacteria | 3609 |
| 147 | Ga0157370_10140016 | 3300013104 | Bacteria | 2254 |
| 148 | Ga0157370_10165217 | 3300013104 | Bacteria | 2058 |
| 149 | Ga0157370_10209017 | 3300013104 | Bacteria | 1809 |
| 150 | Ga0157370_10262393 | 3300013104 | Bacteria | 1596 |
| 151 | Ga0157370_10281180 | 3300013104 | Bacteria | 1538 |
| 152 | Ga0157370_10451913 | 3300013104 | Bacteria | 1181 |
| 153 | Ga0157369_10002842 | 3300013105 | Bacteria | 20669 |
| 154 | Ga0157369_10003903 | 3300013105 | Bacteria | 17684 |
| 155 | Ga0157369_10014888 | 3300013105 | Bacteria | 8779 |
| 156 | Ga0157369_10021855 | 3300013105 | Bacteria | 7151 |
| 157 | Ga0157369_10034317 | 3300013105 | Bacteria | 5569 |
| 158 | Ga0157369_10045551 | 3300013105 | Bacteria | 4770 |
| 159 | Ga0157369_10120909 | 3300013105 | Bacteria | 2779 |
| 160 | Ga0163162_10007494 | 3300013306 | Bacteria | 10620 |
| 161 | Ga0163162_10015463 | 3300013306 | Bacteria | 7457 |
| 162 | Ga0163162_10212716 | 3300013306 | Bacteria | 2063 |
| 163 | Ga0157372_10000089 | 3300013307 | Bacteria | 94457 |
| 164 | Ga0157372_10031504 | 3300013307 | Bacteria | 5806 |
| 165 | Ga0157375_10004512 | 3300013308 | Bacteria | 12103 |
| 166 | Ga0157375_10067676 | 3300013308 | Bacteria | 3569 |
| 167 | Ga0157375_10077803 | 3300013308 | Bacteria | 3348 |
| 168 | Ga0157375_10169166 | 3300013308 | Bacteria | 2332 |
| 169 | Ga0157375_10216421 | 3300013308 | Bacteria | 2074 |
| 170 | Ga0182008_10001175 | 3300014497 | Bacteria | 18058 |
| 171 | Ga0182008_10001436 | 3300014497 | Bacteria | 15937 |
| 172 | Ga0182008_10002061 | 3300014497 | Bacteria | 12877 |
| 173 | Ga0182008_10003202 | 3300014497 | Bacteria | 10000 |
| 174 | Ga0182008_10005740 | 3300014497 | Bacteria | 7027 |
| 175 | Ga0182008_10010035 | 3300014497 | Bacteria | 5084 |
| 176 | Ga0182008_10010843 | 3300014497 | Bacteria | 4866 |
| 177 | Ga0182008_10038834 | 3300014497 | Bacteria | 2380 |
| 178 | Ga0182008_10100536 | 3300014497 | Bacteria | 1429 |
| 179 | Ga0182006_1000892 | 3300015261 | Bacteria | 20009 |
| 180 | Ga0182006_1003207 | 3300015261 | Bacteria | 8509 |
| 181 | Ga0182006_1004435 | 3300015261 | Bacteria | 6928 |
| 182 | Ga0182006_1010630 | 3300015261 | Bacteria | 4083 |
| 183 | Ga0182006_1010926 | 3300015261 | Bacteria | 4015 |
| 184 | Ga0182006_1014708 | 3300015261 | Bacteria | 3369 |
| 185 | Ga0182006_1057469 | 3300015261 | Bacteria | 1479 |
| 186 | Ga0182007_10000649 | 3300015262 | Bacteria | 19996 |
| 187 | Ga0182007_10003856 | 3300015262 | Bacteria | 6969 |
| 188 | Ga0182007_10029382 | 3300015262 | Bacteria | 1882 |
| 189 | Ga0182007_10079365 | 3300015262 | Bacteria | 1076 |
| 190 | Ga0182005_1002339 | 3300015265 | Bacteria | 6846 |
| 191 | Ga0182005_1006257 | 3300015265 | Bacteria | 3653 |
| 192 | Ga0182005_1017402 | 3300015265 | Bacteria | 1990 |
| 193 | Ga0182005_1019952 | 3300015265 | Bacteria | 1845 |
| 194 | Ga0182005_1032439 | 3300015265 | Bacteria | 1421 |
| 195 | Ga0163161_10006251 | 3300017792 | Bacteria | 8248 |
| 196 | Ga0163161_10024484 | 3300017792 | Bacteria | 4264 |
| 197 | Ga0163161_10025309 | 3300017792 | Bacteria | 4199 |
| 198 | Ga0163161_10032439 | 3300017792 | Bacteria | 3729 |
| 199 | Ga0163161_10063338 | 3300017792 | Bacteria | 2695 |
| 200 | Ga0163161_10065959 | 3300017792 | Bacteria | 2642 |
| 201 | Ga0163161_10109035 | 3300017792 | Bacteria | 2068 |
| 202 | Ga0163161_10134110 | 3300017792 | Bacteria | 1870 |
| 203 | Ga0206351_10843817 | 3300020077 | Bacteria | 3515 |
| 204 | Ga0154015_1646313 | 3300020610 | Bacteria | 9200 |
| 205 | Ga0209760_100124 | 3300025207 | Bacteria | 51804 |
| 206 | Ga0209760_100204 | 3300025207 | Bacteria | 27867 |
| 207 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 208 | Ga0209784_101415 | 3300025224 | Bacteria | 3246 |
| 209 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 210 | Ga0209566_100819 | 3300025225 | Bacteria | 15933 |
| 211 | Ga0209566_103211 | 3300025225 | Bacteria | 2607 |
| 212 | Ga0209566_106905 | 3300025225 | Bacteria | 1309 |
| 213 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 214 | Ga0209674_100245 | 3300025226 | Bacteria | 45941 |
| 215 | Ga0209674_107875 | 3300025226 | Bacteria | 1308 |
| 216 | Ga0209672_100154 | 3300025228 | Bacteria | 60377 |
| 217 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 218 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 219 | Ga0209563_112611 | 3300025230 | Bacteria | 1149 |
| 220 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 221 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 222 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 223 | Ga0209437_100028 | 3300025233 | Bacteria | 540136 |
| 224 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 225 | Ga0209646_1000194 | 3300025246 | Bacteria | 74630 |
| 226 | Ga0209026_1004619 | 3300025250 | Bacteria | 4013 |
| 227 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 228 | Ga0209677_103004 | 3300025253 | Bacteria | 5833 |
| 229 | Ga0209148_1000350 | 3300025254 | Bacteria | 59964 |
| 230 | Ga0209148_1003157 | 3300025254 | Bacteria | 4750 |
| 231 | Ga0209759_1001877 | 3300025256 | Bacteria | 10427 |
| 232 | Ga0209759_1013151 | 3300025256 | Bacteria | 2253 |
| 233 | Ga0209759_1030935 | 3300025256 | Bacteria | 1049 |
| 234 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 235 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 236 | Ga0209455_1000076 | 3300025272 | Bacteria | 284092 |
| 237 | Ga0209675_1024800 | 3300025291 | Bacteria | 1525 |
| 238 | Ga0209676_1000056 | 3300025292 | Bacteria | 361329 |
| 239 | Ga0209676_1000078 | 3300025292 | Bacteria | 296293 |
| 240 | Ga0209676_1000101 | 3300025292 | Bacteria | 227976 |
| 241 | Ga0209676_1005061 | 3300025292 | Bacteria | 7046 |
| 242 | Ga0209676_1018079 | 3300025292 | Bacteria | 2469 |
| 243 | Ga0209050_1000027 | 3300025298 | Bacteria | 483261 |
| 244 | Ga0209050_1000041 | 3300025298 | Bacteria | 408004 |
| 245 | Ga0209050_1000181 | 3300025298 | Bacteria | 142533 |
| 246 | Ga0209050_1000425 | 3300025298 | Bacteria | 77756 |
| 247 | Ga0209051_1000061 | 3300025303 | Bacteria | 253485 |
| 248 | Ga0209051_1000065 | 3300025303 | Bacteria | 231445 |
| 249 | Ga0209051_1000085 | 3300025303 | Bacteria | 189973 |
| 250 | Ga0209051_1008386 | 3300025303 | Bacteria | 5476 |
| 251 | Ga0209257_1000105 | 3300025304 | Bacteria | 243729 |
| 252 | Ga0209257_1005448 | 3300025304 | Bacteria | 8931 |
| 253 | Ga0207656_10000023 | 3300025321 | Bacteria | 98957 |
| 254 | Ga0207696_1000032 | 3300025711 | Bacteria | 380071 |
| 255 | Ga0207696_1000112 | 3300025711 | Bacteria | 154384 |
| 256 | Ga0207696_1000121 | 3300025711 | Bacteria | 143687 |
| 257 | Ga0207696_1003278 | 3300025711 | Bacteria | 7473 |
| 258 | Ga0207696_1008719 | 3300025711 | Bacteria | 3847 |
| 259 | Ga0207696_1034466 | 3300025711 | Bacteria | 1511 |
| 260 | Ga0207696_1046593 | 3300025711 | Bacteria | 1250 |
| 261 | Ga0207655_1000021 | 3300025728 | Bacteria | 518596 |
| 262 | Ga0207655_1000086 | 3300025728 | Bacteria | 206068 |
| 263 | Ga0207655_1000204 | 3300025728 | Bacteria | 103596 |
| 264 | Ga0207655_1001245 | 3300025728 | Bacteria | 24279 |
| 265 | Ga0207655_1010222 | 3300025728 | Bacteria | 5713 |
| 266 | Ga0207655_1010903 | 3300025728 | Bacteria | 5465 |
| 267 | Ga0207655_1013474 | 3300025728 | Bacteria | 4692 |
| 268 | Ga0207655_1023894 | 3300025728 | Bacteria | 3014 |
| 269 | Ga0207655_1027084 | 3300025728 | Bacteria | 2739 |
| 270 | Ga0207655_1028286 | 3300025728 | Bacteria | 2647 |
| 271 | Ga0207655_1041284 | 3300025728 | Bacteria | 1979 |
| 272 | Ga0207655_1041617 | 3300025728 | Bacteria | 1967 |
| 273 | Ga0207655_1059943 | 3300025728 | Bacteria | 1478 |
| 274 | Ga0207655_1070185 | 3300025728 | Bacteria | 1306 |
| 275 | Ga0207713_1000068 | 3300025735 | Bacteria | 192415 |
| 276 | Ga0207713_1000080 | 3300025735 | Bacteria | 168403 |
| 277 | Ga0207713_1000404 | 3300025735 | Bacteria | 46130 |
| 278 | Ga0207713_1002781 | 3300025735 | Bacteria | 12366 |
| 279 | Ga0207713_1007775 | 3300025735 | Bacteria | 6259 |
| 280 | Ga0207713_1007795 | 3300025735 | Bacteria | 6249 |
| 281 | Ga0207713_1010571 | 3300025735 | Bacteria | 5099 |
| 282 | Ga0207713_1014869 | 3300025735 | Bacteria | 4016 |
| 283 | Ga0207713_1016486 | 3300025735 | Bacteria | 3747 |
| 284 | Ga0207713_1024803 | 3300025735 | Bacteria | 2784 |
| 285 | Ga0207713_1030196 | 3300025735 | Bacteria | 2416 |
| 286 | Ga0207713_1032680 | 3300025735 | Bacteria | 2281 |
| 287 | Ga0207713_1032783 | 3300025735 | Bacteria | 2277 |
| 288 | Ga0207713_1084583 | 3300025735 | Bacteria | 1132 |
| 289 | Ga0207695_10000558 | 3300025913 | Bacteria | 76735 |
| 290 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 291 | Ga0207649_10000004 | 3300025920 | Bacteria | 360726 |
| 292 | Ga0207649_10000313 | 3300025920 | Bacteria | 37020 |
| 293 | Ga0207649_10135599 | 3300025920 | Bacteria | 1678 |
| 294 | Ga0207681_10000282 | 3300025923 | Bacteria | 37709 |
| 295 | Ga0207681_10022116 | 3300025923 | Bacteria | 4051 |
| 296 | Ga0207650_10000183 | 3300025925 | Bacteria | 72930 |
| 297 | Ga0207650_10000263 | 3300025925 | Bacteria | 56000 |
| 298 | Ga0207690_10001333 | 3300025932 | Bacteria | 15533 |
| 299 | Ga0207706_10000330 | 3300025933 | Bacteria | 51468 |
| 300 | Ga0207686_10001886 | 3300025934 | Bacteria | 11619 |
| 301 | Ga0207709_10000067 | 3300025935 | Bacteria | 189188 |
| 302 | Ga0207709_10000396 | 3300025935 | Bacteria | 42765 |
| 303 | Ga0207709_10003458 | 3300025935 | Bacteria | 9374 |
| 304 | Ga0207709_10011283 | 3300025935 | Bacteria | 4928 |
| 305 | Ga0207709_10191129 | 3300025935 | Bacteria | 1454 |
| 306 | Ga0207711_10101268 | 3300025941 | Bacteria | 2549 |
| 307 | Ga0207679_10000019 | 3300025945 | Bacteria | 230270 |
| 308 | Ga0207679_10000020 | 3300025945 | Bacteria | 225727 |
| 309 | Ga0207712_10018559 | 3300025961 | Bacteria | 4531 |
| 310 | Ga0207640_10000017 | 3300025981 | Bacteria | 208145 |
| 311 | Ga0207640_10123021 | 3300025981 | Bacteria | 1863 |
| 312 | Ga0207639_10103592 | 3300026041 | Bacteria | 2306 |
| 313 | Ga0207678_10000008 | 3300026067 | Bacteria | 168926 |
| 314 | Ga0207702_10000017 | 3300026078 | Bacteria | 222964 |
| 315 | Ga0207674_10012829 | 3300026116 | Bacteria | 9353 |
| 316 | Ga0209281_1000015 | 3300027111 | Bacteria | 590084 |
| 317 | Ga0209281_1000049 | 3300027111 | Bacteria | 322274 |
| 318 | Ga0209281_1015626 | 3300027111 | Bacteria | 1578 |
| 319 | Ga0209281_1015629 | 3300027111 | Bacteria | 1578 |
| 320 | Ga0209371_1001949 | 3300027312 | Bacteria | 12529 |
| 321 | Ga0209983_1000877 | 3300027665 | Bacteria | 6629 |
| 322 | Ga0209282_1028825 | 3300027666 | Bacteria | 3435 |
| 323 | Ga0209971_1000680 | 3300027682 | Bacteria | 8808 |
| 324 | Ga0209974_10001542 | 3300027876 | Bacteria | 8361 |
| 325 | Ga0207428_10005554 | 3300027907 | Bacteria | 11744 |
| 326 | Ga0207428_10011978 | 3300027907 | Bacteria | 7634 |
| 327 | Ga0207428_10035455 | 3300027907 | Bacteria | 4078 |
| 328 | Ga0207428_10039252 | 3300027907 | Bacteria | 3844 |
| 329 | Ga0207428_10104670 | 3300027907 | Bacteria | 2184 |
| 330 | Ga0207428_10209697 | 3300027907 | Bacteria | 1464 |
| 331 | Ga0268266_10023410 | 3300028379 | Bacteria | 5260 |
| 332 | Ga0307517_10102932 | 3300028786 | Bacteria | 2234 |
| 333 | Ga0268256_1004045 | 3300030500 | Bacteria | 6299 |
| 334 | Ga0307511_10041531 | 3300030521 | Bacteria | 3882 |
| 335 | Ga0316178_1042169 | 3300030735 | Bacteria | 25762 |
| 336 | Ga0316181_1063451 | 3300030744 | Bacteria | 5498 |
| 337 | Ga0265316_10214884 | 3300031344 | Bacteria | 1421 |
| 338 | Ga0307408_100020283 | 3300031548 | Bacteria | 4484 |
| 339 | Ga0307408_100026113 | 3300031548 | Bacteria | 4006 |
| 340 | Ga0307408_100106380 | 3300031548 | Bacteria | 2146 |
| 341 | Ga0307405_10000212 | 3300031731 | Bacteria | 21011 |
| 342 | Ga0307405_10018714 | 3300031731 | Bacteria | 3828 |
| 343 | Ga0307405_10050264 | 3300031731 | Bacteria | 2580 |
| 344 | Ga0307413_10115518 | 3300031824 | Bacteria | 1806 |
| 345 | Ga0307406_10010340 | 3300031901 | Bacteria | 5259 |
| 346 | Ga0307407_10036621 | 3300031903 | Bacteria | 2705 |
| 347 | Ga0307407_10127854 | 3300031903 | Bacteria | 1621 |
| 348 | Ga0307412_10001040 | 3300031911 | Bacteria | 15856 |
| 349 | Ga0307412_10011645 | 3300031911 | Bacteria | 5100 |
| 350 | Ga0307412_10013075 | 3300031911 | Bacteria | 4855 |
| 351 | Ga0307412_10017203 | 3300031911 | Bacteria | 4324 |
| 352 | Ga0307412_10203987 | 3300031911 | Bacteria | 1503 |
| 353 | Ga0307412_10357038 | 3300031911 | Bacteria | 1175 |
| 354 | Ga0307409_100024432 | 3300031995 | Bacteria | 4214 |
| 355 | Ga0307416_100146784 | 3300032002 | Bacteria | 2155 |
| 356 | Ga0307416_100170010 | 3300032002 | Bacteria | 2027 |
| 357 | Ga0307414_10131360 | 3300032004 | Bacteria | 1944 |
| 358 | Ga0307414_10199126 | 3300032004 | Bacteria | 1627 |
| 359 | Ga0307414_10221958 | 3300032004 | Bacteria | 1552 |
| 360 | Ga0307414_10237599 | 3300032004 | Bacteria | 1506 |
| 361 | Ga0307411_10007338 | 3300032005 | Bacteria | 5604 |
| 362 | Ga0307510_10056944 | 3300033180 | Bacteria | 4064 |
| 363 | Ga0307510_10057442 | 3300033180 | Bacteria | 4038 |
| 364 | Ga0439438_001121 | 3300041405 | Bacteria | 11922 |
| 365 | Ga0439438_001828 | 3300041405 | Bacteria | 9317 |
| 366 | Ga0439438_002832 | 3300041405 | Bacteria | 7238 |
| 367 | Ga0439438_003232 | 3300041405 | Bacteria | 6665 |
| 368 | Ga0439438_003588 | 3300041405 | Bacteria | 6215 |
| 369 | Ga0439438_004154 | 3300041405 | Bacteria | 5644 |
| 370 | Ga0439438_007172 | 3300041405 | Bacteria | 3841 |
| 371 | Ga0439438_019612 | 3300041405 | Bacteria | 1909 |
| 372 | Ga0439447_002588 | 3300041407 | Bacteria | 6573 |
| 373 | Ga0439447_002664 | 3300041407 | Bacteria | 6466 |
| 374 | Ga0439447_003104 | 3300041407 | Bacteria | 5932 |
| 375 | Ga0439447_008054 | 3300041407 | Bacteria | 3291 |
| 376 | Ga0439447_008080 | 3300041407 | Bacteria | 3282 |
| 377 | Ga0439447_014393 | 3300041407 | Bacteria | 2220 |
| 378 | Ga0439447_030459 | 3300041407 | Bacteria | 1360 |
| 379 | Ga0439466_0001533 | 3300041411 | Bacteria | 9035 |
| 380 | Ga0439466_0004091 | 3300041411 | Bacteria | 5635 |
| 381 | Ga0439466_0004898 | 3300041411 | Bacteria | 5146 |
| 382 | Ga0439466_0009457 | 3300041411 | Bacteria | 3640 |
| 383 | Ga0439466_0009614 | 3300041411 | Bacteria | 3613 |
| 384 | Ga0439466_0012866 | 3300041411 | Bacteria | 3069 |
| 385 | Ga0439466_0013922 | 3300041411 | Bacteria | 2937 |
| 386 | Ga0439466_0018521 | 3300041411 | Bacteria | 2496 |
| 387 | Ga0439466_0023515 | 3300041411 | Bacteria | 2166 |
| 388 | Ga0439466_0029613 | 3300041411 | Bacteria | 1882 |
| 389 | Ga0439466_0034057 | 3300041411 | Bacteria | 1728 |
| 390 | Ga0439466_0038307 | 3300041411 | Bacteria | 1610 |
| 391 | Ga0439465_0005299 | 3300041413 | Bacteria | 4124 |
| 392 | Ga0439431_0000967 | 3300041997 | Bacteria | 6233 |
| 393 | Ga0439437_000266 | 3300042000 | Bacteria | 4804 |
| 394 | Ga0439445_0006028 | 3300042004 | Bacteria | 2778 |
| 395 | Ga0439445_0012411 | 3300042004 | Bacteria | 2047 |
| 396 | Ga0439432_000106 | 3300042006 | Bacteria | 26742 |
| 397 | Ga0439432_001165 | 3300042006 | Bacteria | 9954 |
| 398 | Ga0439432_009624 | 3300042006 | Bacteria | 3368 |
| 399 | Ga0439432_011350 | 3300042006 | Bacteria | 3070 |
| 400 | Ga0439432_011753 | 3300042006 | Bacteria | 3009 |
| 401 | Ga0439432_040609 | 3300042006 | Bacteria | 1475 |
| 402 | Ga0439451_001256 | 3300042009 | Bacteria | 5018 |
| 403 | Ga0439451_001861 | 3300042009 | Bacteria | 4214 |
| 404 | Ga0439451_008649 | 3300042009 | Bacteria | 2063 |
| 405 | Ga0439451_011339 | 3300042009 | Bacteria | 1798 |
| 406 | Ga0439452_000784 | 3300042010 | Bacteria | 15084 |
| 407 | Ga0439452_000955 | 3300042010 | Bacteria | 12977 |
| 408 | Ga0439452_001029 | 3300042010 | Bacteria | 12346 |
| 409 | Ga0439452_001826 | 3300042010 | Bacteria | 8263 |
| 410 | Ga0439452_002239 | 3300042010 | Bacteria | 7257 |
| 411 | Ga0439452_002905 | 3300042010 | Bacteria | 6139 |
| 412 | Ga0439452_003204 | 3300042010 | Bacteria | 5786 |
| 413 | Ga0439452_004464 | 3300042010 | Bacteria | 4687 |
| 414 | Ga0439456_007591 | 3300042013 | Bacteria | 2230 |
| 415 | Ga0439456_022403 | 3300042013 | Bacteria | 1338 |
| 416 | Ga0439456_033552 | 3300042013 | Bacteria | 1104 |
| 417 | Ga0439463_000269 | 3300042016 | Bacteria | 14305 |
| 418 | Ga0439463_001421 | 3300042016 | Bacteria | 6355 |
| 419 | Ga0439463_003108 | 3300042016 | Bacteria | 4211 |
| 420 | Ga0439463_003879 | 3300042016 | Bacteria | 3769 |
| 421 | Ga0439463_005159 | 3300042016 | Bacteria | 3246 |
| 422 | Ga0439463_006998 | 3300042016 | Bacteria | 2782 |
| 423 | Ga0439463_046562 | 3300042016 | Bacteria | 1104 |
| 424 | Ga0450911_000005 | 3300042115 | Bacteria | 233469 |
| 425 | Ga0450911_000880 | 3300042115 | Bacteria | 8120 |
| 426 | Ga0450911_001080 | 3300042115 | Bacteria | 6846 |
| 427 | Ga0450911_001265 | 3300042115 | Bacteria | 6042 |
| 428 | Ga0450919_001359 | 3300042121 | Bacteria | 3194 |
| 429 | Ga0450920_005488 | 3300042122 | Bacteria | 2254 |
| 430 | Ga0450922_000342 | 3300042124 | Bacteria | 4942 |
| 431 | Ga0450923_003840 | 3300042125 | Bacteria | 2309 |
| 432 | Ga0450890_000192 | 3300042127 | Bacteria | 9265 |
| 433 | Ga0450894_002988 | 3300042131 | Bacteria | 2233 |
| 434 | Ga0450898_011921 | 3300042134 | Bacteria | 1429 |
| 435 | Ga0450902_006140 | 3300042137 | Bacteria | 1833 |
| 436 | Ga0450902_008484 | 3300042137 | Bacteria | 1607 |
| 437 | Ga0450903_000296 | 3300042138 | Bacteria | 10931 |
| 438 | Ga0450903_003862 | 3300042138 | Bacteria | 2581 |
| 439 | Ga0450903_004164 | 3300042138 | Bacteria | 2476 |
| 440 | Ga0450903_007199 | 3300042138 | Bacteria | 1837 |
| 441 | Ga0450903_008766 | 3300042138 | Bacteria | 1652 |
| 442 | Ga0450903_009409 | 3300042138 | Bacteria | 1593 |
| 443 | Ga0450904_000094 | 3300042139 | Bacteria | 19949 |
| 444 | Ga0450904_003142 | 3300042139 | Bacteria | 1823 |
| 445 | Ga0450905_017127 | 3300042142 | Bacteria | 1049 |
| 446 | Ga0450906_000913 | 3300042145 | Bacteria | 6449 |
| 447 | Ga0450906_001507 | 3300042145 | Bacteria | 5082 |
| 448 | Ga0450906_001865 | 3300042145 | Bacteria | 4611 |
| 449 | Ga0450907_000898 | 3300042146 | Bacteria | 7096 |
| 450 | Ga0450907_003481 | 3300042146 | Bacteria | 2804 |
| 451 | Ga0450907_017801 | 3300042146 | Bacteria | 1186 |
| 452 | Ga0450910_003370 | 3300042147 | Bacteria | 2118 |
| 453 | Ga0439446_0002380 | 3300042156 | Bacteria | 4506 |
| 454 | Ga0439446_0015633 | 3300042156 | Bacteria | 2106 |
| 455 | Ga0439446_0031521 | 3300042156 | Bacteria | 1534 |
| 456 | Ga0450908_014756 | 3300042184 | Bacteria | 1403 |
| 457 | Ga0450909_000121 | 3300042185 | Bacteria | 7889 |
| 458 | Ga0450909_001076 | 3300042185 | Bacteria | 3762 |
| 459 | Ga0439434_0001528 | 3300042435 | Bacteria | 6657 |
| 460 | Ga0439434_0020920 | 3300042435 | Bacteria | 1965 |
| 461 | Ga0439434_0056306 | 3300042435 | Bacteria | 1225 |
| 462 | Ga0439459_0000354 | 3300042438 | Bacteria | 5656 |
| 463 | Ga0439464_0000592 | 3300042439 | Bacteria | 7617 |
| 464 | Ga0439464_0017580 | 3300042439 | Bacteria | 1940 |
| 465 | Ga0439464_0027980 | 3300042439 | Bacteria | 1569 |
| 466 | Ga0439460_0000258 | 3300042461 | Bacteria | 10905 |
| 467 | Ga0439460_0015655 | 3300042461 | Bacteria | 2010 |
| 468 | Ga0450916_001870 | 3300042530 | Bacteria | 2160 |
| 469 | Ga0450918_001258 | 3300042531 | Bacteria | 5147 |
| 470 | Ga0450918_015999 | 3300042531 | Bacteria | 1303 |
| 471 | Ga0450918_025713 | 3300042531 | Bacteria | 1032 |
| 472 | Ga0450893_0002244 | 3300042532 | Bacteria | 3007 |
| 473 | Ga0450893_0006047 | 3300042532 | Bacteria | 1951 |
| 474 | Ga0450893_0006113 | 3300042532 | Bacteria | 1943 |
| 475 | Ga0450901_001259 | 3300042533 | Bacteria | 2924 |
| 476 | Ga0439440_0000483 | 3300042993 | Bacteria | 6653 |
| 477 | Ga0439440_0008172 | 3300042993 | Bacteria | 2143 |
| 478 | Ga0466986_0190082 | 3300044650 | Bacteria | 1356 |
| 479 | Ga0466969_0040195 | 3300044656 | Bacteria | 2344 |
| 480 | Ga0466972_0099286 | 3300044658 | Bacteria | 1378 |
| 481 | Ga0466978_0173802 | 3300044671 | Bacteria | 1301 |
| 482 | Ga0466982_0142029 | 3300044672 | Bacteria | 1473 |
| 483 | Ga0466965_0105241 | 3300044683 | Bacteria | 1446 |
| 484 | Ga0466961_0000059 | 3300044693 | Bacteria | 65381 |
| 485 | Ga0466964_0073366 | 3300044706 | Bacteria | 1452 |
| 486 | Ga0466968_0019088 | 3300044735 | Bacteria | 2756 |
| 487 | Ga0466970_0009239 | 3300044765 | Bacteria | 4976 |
| 488 | Ga0466959_0002989 | 3300045049 | Bacteria | 10926 |
| 489 | Ga0495617_001779 | 3300046452 | Bacteria | 9195 |
| 490 | Ga0495617_003182 | 3300046452 | Bacteria | 6248 |
| 491 | Ga0495617_005694 | 3300046452 | Bacteria | 4405 |
| 492 | Ga0495617_005982 | 3300046452 | Bacteria | 4291 |
| 493 | Ga0495617_019715 | 3300046452 | Bacteria | 2279 |
| 494 | Ga0495617_021852 | 3300046452 | Bacteria | 2162 |
| 495 | Ga0495617_038252 | 3300046452 | Bacteria | 1605 |
| 496 | Ga0495617_039800 | 3300046452 | Bacteria | 1572 |
| 497 | Ga0495617_047275 | 3300046452 | Bacteria | 1432 |
| 498 | Ga0495627_000047 | 3300046453 | Bacteria | 170068 |
| 499 | Ga0495627_001232 | 3300046453 | Bacteria | 15941 |
| 500 | Ga0495627_001589 | 3300046453 | Bacteria | 12802 |
| 501 | Ga0495627_002170 | 3300046453 | Bacteria | 9805 |
| 502 | Ga0495627_005510 | 3300046453 | Bacteria | 5085 |
| 503 | Ga0495627_006328 | 3300046453 | Bacteria | 4650 |
| 504 | Ga0495627_006555 | 3300046453 | Bacteria | 4552 |
| 505 | Ga0495627_007036 | 3300046453 | Bacteria | 4362 |
| 506 | Ga0495592_0138460 | 3300046454 | Bacteria | 1695 |
| 507 | Ga0495603_0012608 | 3300046455 | Bacteria | 5114 |
| 508 | Ga0495603_0015660 | 3300046455 | Bacteria | 4587 |
| 509 | Ga0495590_0003955 | 3300046457 | Bacteria | 6022 |
| 510 | Ga0495590_0004327 | 3300046457 | Bacteria | 5738 |
| 511 | Ga0495590_0004645 | 3300046457 | Bacteria | 5517 |
| 512 | Ga0495590_0009320 | 3300046457 | Bacteria | 3723 |
| 513 | Ga0495590_0029979 | 3300046457 | Bacteria | 1906 |
| 514 | Ga0495590_0040533 | 3300046457 | Bacteria | 1624 |
| 515 | Ga0495590_0051313 | 3300046457 | Bacteria | 1440 |
| 516 | Ga0495590_0061195 | 3300046457 | Bacteria | 1318 |
| 517 | Ga0495591_000019 | 3300046458 | Bacteria | 223010 |
| 518 | Ga0495591_000570 | 3300046458 | Bacteria | 28243 |
| 519 | Ga0495591_000681 | 3300046458 | Bacteria | 24804 |
| 520 | Ga0495591_000843 | 3300046458 | Bacteria | 21618 |
| 521 | Ga0495591_001827 | 3300046458 | Bacteria | 12580 |
| 522 | Ga0495591_002514 | 3300046458 | Bacteria | 10137 |
| 523 | Ga0495591_002858 | 3300046458 | Bacteria | 9278 |
| 524 | Ga0495591_003534 | 3300046458 | Bacteria | 8009 |
| 525 | Ga0495591_004567 | 3300046458 | Bacteria | 6709 |
| 526 | Ga0495591_004583 | 3300046458 | Bacteria | 6688 |
| 527 | Ga0495591_005863 | 3300046458 | Bacteria | 5573 |
| 528 | Ga0495591_006486 | 3300046458 | Bacteria | 5168 |
| 529 | Ga0495591_009324 | 3300046458 | Bacteria | 3910 |
| 530 | Ga0495591_010033 | 3300046458 | Bacteria | 3709 |
| 531 | Ga0495591_010358 | 3300046458 | Bacteria | 3621 |
| 532 | Ga0495591_011899 | 3300046458 | Bacteria | 3267 |
| 533 | Ga0495591_016365 | 3300046458 | Bacteria | 2584 |
| 534 | Ga0495591_020438 | 3300046458 | Bacteria | 2187 |
| 535 | Ga0495591_029759 | 3300046458 | Bacteria | 1655 |
| 536 | Ga0495638_0001864 | 3300046460 | Bacteria | 18240 |
| 537 | Ga0495638_0003969 | 3300046460 | Bacteria | 11394 |
| 538 | Ga0495638_0010064 | 3300046460 | Bacteria | 6591 |
| 539 | Ga0495638_0010914 | 3300046460 | Bacteria | 6282 |
| 540 | Ga0495638_0011016 | 3300046460 | Bacteria | 6248 |
| 541 | Ga0495638_0013866 | 3300046460 | Bacteria | 5467 |
| 542 | Ga0495638_0017765 | 3300046460 | Bacteria | 4736 |
| 543 | Ga0495638_0019625 | 3300046460 | Bacteria | 4471 |
| 544 | Ga0495638_0028737 | 3300046460 | Bacteria | 3588 |
| 545 | Ga0495638_0074568 | 3300046460 | Bacteria | 2069 |
| 546 | Ga0495638_0074627 | 3300046460 | Bacteria | 2068 |
| 547 | Ga0495638_0082033 | 3300046460 | Bacteria | 1956 |
| 548 | Ga0495653_0011147 | 3300046463 | Bacteria | 7351 |
| 549 | Ga0495653_0016061 | 3300046463 | Bacteria | 6102 |
| 550 | Ga0495653_0018482 | 3300046463 | Bacteria | 5659 |
| 551 | Ga0495653_0021284 | 3300046463 | Bacteria | 5253 |
| 552 | Ga0495653_0040945 | 3300046463 | Bacteria | 3618 |
| 553 | Ga0495650_0000346 | 3300046471 | Bacteria | 82519 |
| 554 | Ga0495650_0003892 | 3300046471 | Bacteria | 10561 |
| 555 | Ga0495650_0004844 | 3300046471 | Bacteria | 9002 |
| 556 | Ga0495650_0006270 | 3300046471 | Bacteria | 7448 |
| 557 | Ga0495650_0008165 | 3300046471 | Bacteria | 6158 |
| 558 | Ga0495650_0008551 | 3300046471 | Bacteria | 5953 |
| 559 | Ga0495650_0009161 | 3300046471 | Bacteria | 5669 |
| 560 | Ga0495650_0009888 | 3300046471 | Bacteria | 5378 |
| 561 | Ga0495650_0010656 | 3300046471 | Bacteria | 5111 |
| 562 | Ga0495650_0016786 | 3300046471 | Bacteria | 3692 |
| 563 | Ga0495650_0032772 | 3300046471 | Bacteria | 2320 |
| 564 | Ga0495650_0035652 | 3300046471 | Bacteria | 2187 |
| 565 | Ga0495650_0103339 | 3300046471 | Bacteria | 1067 |
| 566 | Ga0495582_0008121 | 3300046473 | Bacteria | 5795 |
| 567 | Ga0495605_0000014 | 3300046474 | Bacteria | 305393 |
| 568 | Ga0495605_0000030 | 3300046474 | Bacteria | 213339 |
| 569 | Ga0495605_0001397 | 3300046474 | Bacteria | 15878 |
| 570 | Ga0495605_0001660 | 3300046474 | Bacteria | 14304 |
| 571 | Ga0495605_0002018 | 3300046474 | Bacteria | 12814 |
| 572 | Ga0495605_0006312 | 3300046474 | Bacteria | 6831 |
| 573 | Ga0495605_0007118 | 3300046474 | Bacteria | 6370 |
| 574 | Ga0495605_0011520 | 3300046474 | Bacteria | 4924 |
| 575 | Ga0495605_0013104 | 3300046474 | Bacteria | 4581 |
| 576 | Ga0495605_0025251 | 3300046474 | Bacteria | 3097 |
| 577 | Ga0495605_0034586 | 3300046474 | Bacteria | 2558 |
| 578 | Ga0495605_0085292 | 3300046474 | Bacteria | 1471 |
| 579 | Ga0495605_0114225 | 3300046474 | Bacteria | 1229 |
| 580 | Ga0495605_0118113 | 3300046474 | Bacteria | 1204 |
| 581 | Ga0495639_0001317 | 3300046475 | Bacteria | 11151 |
| 582 | Ga0495584_0003304 | 3300046491 | Bacteria | 8935 |
| 583 | Ga0495584_0004589 | 3300046491 | Bacteria | 7401 |
| 584 | Ga0495584_0004810 | 3300046491 | Bacteria | 7213 |
| 585 | Ga0495584_0005395 | 3300046491 | Bacteria | 6772 |
| 586 | Ga0495584_0006599 | 3300046491 | Bacteria | 6064 |
| 587 | Ga0495584_0007687 | 3300046491 | Bacteria | 5613 |
| 588 | Ga0495584_0012688 | 3300046491 | Bacteria | 4300 |
| 589 | Ga0495584_0014898 | 3300046491 | Bacteria | 3960 |
| 590 | Ga0495584_0015531 | 3300046491 | Bacteria | 3880 |
| 591 | Ga0495584_0016467 | 3300046491 | Bacteria | 3769 |
| 592 | Ga0495584_0038875 | 3300046491 | Bacteria | 2404 |
| 593 | Ga0495584_0041807 | 3300046491 | Bacteria | 2313 |
| 594 | Ga0495584_0046818 | 3300046491 | Bacteria | 2181 |
| 595 | Ga0495584_0063249 | 3300046491 | Bacteria | 1860 |
| 596 | Ga0495584_0104375 | 3300046491 | Bacteria | 1433 |
| 597 | Ga0495584_0230489 | 3300046491 | Bacteria | 941 |
| 598 | Ga0495585_0002784 | 3300046492 | Bacteria | 12189 |
| 599 | Ga0495585_0005886 | 3300046492 | Bacteria | 7676 |
| 600 | Ga0495585_0006685 | 3300046492 | Bacteria | 7124 |
| 601 | Ga0495585_0007781 | 3300046492 | Bacteria | 6529 |
| 602 | Ga0495585_0007881 | 3300046492 | Bacteria | 6478 |
| 603 | Ga0495585_0009007 | 3300046492 | Bacteria | 6015 |
| 604 | Ga0495585_0009029 | 3300046492 | Bacteria | 6006 |
| 605 | Ga0495585_0012525 | 3300046492 | Bacteria | 4995 |
| 606 | Ga0495585_0016057 | 3300046492 | Bacteria | 4341 |
| 607 | Ga0495585_0050408 | 3300046492 | Bacteria | 2309 |
| 608 | Ga0495585_0059965 | 3300046492 | Bacteria | 2095 |
| 609 | Ga0495585_0115609 | 3300046492 | Bacteria | 1423 |
| 610 | Ga0495585_0161959 | 3300046492 | Bacteria | 1160 |
| 611 | Ga0495594_0003265 | 3300046499 | Bacteria | 8404 |
| 612 | Ga0495594_0008450 | 3300046499 | Bacteria | 5305 |
| 613 | Ga0495594_0014824 | 3300046499 | Bacteria | 4089 |
| 614 | Ga0495594_0015019 | 3300046499 | Bacteria | 4063 |
| 615 | Ga0495594_0015459 | 3300046499 | Bacteria | 4009 |
| 616 | Ga0495596_0002692 | 3300046500 | Bacteria | 9368 |
| 617 | Ga0495596_0003606 | 3300046500 | Bacteria | 7781 |
| 618 | Ga0495607_0000393 | 3300046501 | Bacteria | 44415 |
| 619 | Ga0495607_0001642 | 3300046501 | Bacteria | 19379 |
| 620 | Ga0495607_0002564 | 3300046501 | Bacteria | 14675 |
| 621 | Ga0495607_0002577 | 3300046501 | Bacteria | 14625 |
| 622 | Ga0495607_0005672 | 3300046501 | Bacteria | 8890 |
| 623 | Ga0495607_0005848 | 3300046501 | Bacteria | 8744 |
| 624 | Ga0495607_0007337 | 3300046501 | Bacteria | 7642 |
| 625 | Ga0495607_0007535 | 3300046501 | Bacteria | 7516 |
| 626 | Ga0495607_0007896 | 3300046501 | Bacteria | 7319 |
| 627 | Ga0495607_0008266 | 3300046501 | Bacteria | 7121 |
| 628 | Ga0495607_0009095 | 3300046501 | Bacteria | 6753 |
| 629 | Ga0495607_0010156 | 3300046501 | Bacteria | 6334 |
| 630 | Ga0495607_0011587 | 3300046501 | Bacteria | 5862 |
| 631 | Ga0495607_0013370 | 3300046501 | Bacteria | 5380 |
| 632 | Ga0495607_0019462 | 3300046501 | Bacteria | 4313 |
| 633 | Ga0495607_0037150 | 3300046501 | Bacteria | 2927 |
| 634 | Ga0495607_0041795 | 3300046501 | Bacteria | 2721 |
| 635 | Ga0495607_0042340 | 3300046501 | Bacteria | 2699 |
| 636 | Ga0495607_0056394 | 3300046501 | Bacteria | 2256 |
| 637 | Ga0495607_0060419 | 3300046501 | Bacteria | 2157 |
| 638 | Ga0495607_0067853 | 3300046501 | Bacteria | 2002 |
| 639 | Ga0495607_0085822 | 3300046501 | Bacteria | 1718 |
| 640 | Ga0495607_0086193 | 3300046501 | Bacteria | 1713 |
| 641 | Ga0495583_0000066 | 3300046506 | Bacteria | 191372 |
| 642 | Ga0495583_0001212 | 3300046506 | Bacteria | 27499 |
| 643 | Ga0495583_0002340 | 3300046506 | Bacteria | 16438 |
| 644 | Ga0495583_0002432 | 3300046506 | Bacteria | 15930 |
| 645 | Ga0495583_0003113 | 3300046506 | Bacteria | 13117 |
| 646 | Ga0495583_0003288 | 3300046506 | Bacteria | 12540 |
| 647 | Ga0495583_0004266 | 3300046506 | Bacteria | 10358 |
| 648 | Ga0495583_0007586 | 3300046506 | Bacteria | 6782 |
| 649 | Ga0495583_0024403 | 3300046506 | Bacteria | 3038 |
| 650 | Ga0495583_0028804 | 3300046506 | Bacteria | 2725 |
| 651 | Ga0495583_0058249 | 3300046506 | Bacteria | 1734 |
| 652 | Ga0495606_0000086 | 3300046507 | Bacteria | 156764 |
| 653 | Ga0495606_0000700 | 3300046507 | Bacteria | 51952 |
| 654 | Ga0495606_0002176 | 3300046507 | Bacteria | 23553 |
| 655 | Ga0495606_0002418 | 3300046507 | Bacteria | 21757 |
| 656 | Ga0495606_0003245 | 3300046507 | Bacteria | 17452 |
| 657 | Ga0495606_0004082 | 3300046507 | Bacteria | 14844 |
| 658 | Ga0495606_0004561 | 3300046507 | Bacteria | 13761 |
| 659 | Ga0495606_0009036 | 3300046507 | Bacteria | 8512 |
| 660 | Ga0495606_0011104 | 3300046507 | Bacteria | 7386 |
| 661 | Ga0495606_0012863 | 3300046507 | Bacteria | 6667 |
| 662 | Ga0495606_0013431 | 3300046507 | Bacteria | 6467 |
| 663 | Ga0495606_0014339 | 3300046507 | Bacteria | 6195 |
| 664 | Ga0495606_0021865 | 3300046507 | Bacteria | 4677 |
| 665 | Ga0495606_0027532 | 3300046507 | Bacteria | 4028 |
| 666 | Ga0495606_0056444 | 3300046507 | Bacteria | 2535 |
| 667 | Ga0495606_0076381 | 3300046507 | Bacteria | 2094 |
| 668 | Ga0495606_0111761 | 3300046507 | Bacteria | 1647 |
| 669 | Ga0495606_0156761 | 3300046507 | Bacteria | 1331 |
| 670 | Ga0495610_0003257 | 3300046512 | Bacteria | 12814 |
| 671 | Ga0495610_0003324 | 3300046512 | Bacteria | 12628 |
| 672 | Ga0495610_0007864 | 3300046512 | Bacteria | 7010 |
| 673 | Ga0495610_0010242 | 3300046512 | Bacteria | 5844 |
| 674 | Ga0495610_0010433 | 3300046512 | Bacteria | 5771 |
| 675 | Ga0495610_0013656 | 3300046512 | Bacteria | 4816 |
| 676 | Ga0495610_0014647 | 3300046512 | Bacteria | 4598 |
| 677 | Ga0495610_0014863 | 3300046512 | Bacteria | 4552 |
| 678 | Ga0495610_0028145 | 3300046512 | Bacteria | 2976 |
| 679 | Ga0495610_0075760 | 3300046512 | Bacteria | 1557 |
| 680 | Ga0495610_0108125 | 3300046512 | Bacteria | 1235 |
| 681 | Ga0495610_0111047 | 3300046512 | Bacteria | 1214 |
| 682 | Ga0495616_0001528 | 3300046513 | Bacteria | 15941 |
| 683 | Ga0495616_0008273 | 3300046513 | Bacteria | 6174 |
| 684 | Ga0495616_0008728 | 3300046513 | Bacteria | 5974 |
| 685 | Ga0495616_0008742 | 3300046513 | Bacteria | 5968 |
| 686 | Ga0495616_0008937 | 3300046513 | Bacteria | 5887 |
| 687 | Ga0495616_0015883 | 3300046513 | Bacteria | 4174 |
| 688 | Ga0495616_0016830 | 3300046513 | Bacteria | 4040 |
| 689 | Ga0495616_0031112 | 3300046513 | Bacteria | 2797 |
| 690 | Ga0495616_0058701 | 3300046513 | Bacteria | 1894 |
| 691 | Ga0495616_0066383 | 3300046513 | Bacteria | 1755 |
| 692 | Ga0495616_0068448 | 3300046513 | Bacteria | 1723 |
| 693 | Ga0495616_0073200 | 3300046513 | Bacteria | 1653 |
| 694 | Ga0495616_0110357 | 3300046513 | Bacteria | 1278 |
| 695 | Ga0495616_0152519 | 3300046513 | Bacteria | 1044 |
| 696 | Ga0495616_0161618 | 3300046513 | Bacteria | 1007 |
| 697 | Ga0495620_0000100 | 3300046515 | Bacteria | 68610 |
| 698 | Ga0495620_0001131 | 3300046515 | Bacteria | 16268 |
| 699 | Ga0495620_0001879 | 3300046515 | Bacteria | 12349 |
| 700 | Ga0495620_0002082 | 3300046515 | Bacteria | 11629 |
| 701 | Ga0495620_0002823 | 3300046515 | Bacteria | 9982 |
| 702 | Ga0495620_0005339 | 3300046515 | Bacteria | 7186 |
| 703 | Ga0495620_0006205 | 3300046515 | Bacteria | 6586 |
| 704 | Ga0495620_0014150 | 3300046515 | Bacteria | 4063 |
| 705 | Ga0495620_0015037 | 3300046515 | Bacteria | 3916 |
| 706 | Ga0495620_0018397 | 3300046515 | Bacteria | 3461 |
| 707 | Ga0495620_0018474 | 3300046515 | Bacteria | 3451 |
| 708 | Ga0495620_0022888 | 3300046515 | Bacteria | 2998 |
| 709 | Ga0495620_0055537 | 3300046515 | Bacteria | 1668 |
| 710 | Ga0495620_0077360 | 3300046515 | Bacteria | 1351 |
| 711 | Ga0495630_0004946 | 3300046517 | Bacteria | 9371 |
| 712 | Ga0495630_0174707 | 3300046517 | Bacteria | 1637 |
| 713 | Ga0495631_0001639 | 3300046518 | Bacteria | 13330 |
| 714 | Ga0495631_0001654 | 3300046518 | Bacteria | 13260 |
| 715 | Ga0495631_0003624 | 3300046518 | Bacteria | 8426 |
| 716 | Ga0495631_0006102 | 3300046518 | Bacteria | 6252 |
| 717 | Ga0495631_0007478 | 3300046518 | Bacteria | 5553 |
| 718 | Ga0495631_0009213 | 3300046518 | Bacteria | 4943 |
| 719 | Ga0495631_0012070 | 3300046518 | Bacteria | 4232 |
| 720 | Ga0495631_0035128 | 3300046518 | Bacteria | 2244 |
| 721 | Ga0495631_0059471 | 3300046518 | Bacteria | 1660 |
| 722 | Ga0495632_0002127 | 3300046519 | Bacteria | 15430 |
| 723 | Ga0495632_0002473 | 3300046519 | Bacteria | 14041 |
| 724 | Ga0495632_0004354 | 3300046519 | Bacteria | 9638 |
| 725 | Ga0495632_0006055 | 3300046519 | Bacteria | 7848 |
| 726 | Ga0495632_0006212 | 3300046519 | Bacteria | 7729 |
| 727 | Ga0495632_0012913 | 3300046519 | Bacteria | 4791 |
| 728 | Ga0495632_0014162 | 3300046519 | Bacteria | 4523 |
| 729 | Ga0495632_0015030 | 3300046519 | Bacteria | 4354 |
| 730 | Ga0495632_0017643 | 3300046519 | Bacteria | 3934 |
| 731 | Ga0495632_0022244 | 3300046519 | Bacteria | 3400 |
| 732 | Ga0495632_0042310 | 3300046519 | Bacteria | 2283 |
| 733 | Ga0495632_0045642 | 3300046519 | Bacteria | 2181 |
| 734 | Ga0495637_0000024 | 3300046520 | Bacteria | 169477 |
| 735 | Ga0495637_0000780 | 3300046520 | Bacteria | 21471 |
| 736 | Ga0495637_0001915 | 3300046520 | Bacteria | 11827 |
| 737 | Ga0495637_0003908 | 3300046520 | Bacteria | 7817 |
| 738 | Ga0495637_0004000 | 3300046520 | Bacteria | 7691 |
| 739 | Ga0495637_0004673 | 3300046520 | Bacteria | 7071 |
| 740 | Ga0495637_0004949 | 3300046520 | Bacteria | 6858 |
| 741 | Ga0495637_0009241 | 3300046520 | Bacteria | 4812 |
| 742 | Ga0495637_0011150 | 3300046520 | Bacteria | 4324 |
| 743 | Ga0495637_0012279 | 3300046520 | Bacteria | 4100 |
| 744 | Ga0495637_0018972 | 3300046520 | Bacteria | 3185 |
| 745 | Ga0495637_0042516 | 3300046520 | Bacteria | 1943 |
| 746 | Ga0495637_0048804 | 3300046520 | Bacteria | 1781 |
| 747 | Ga0495637_0058468 | 3300046520 | Bacteria | 1589 |
| 748 | Ga0495637_0059032 | 3300046520 | Bacteria | 1579 |
| 749 | Ga0495637_0062771 | 3300046520 | Bacteria | 1519 |
| 750 | Ga0495637_0067868 | 3300046520 | Bacteria | 1446 |
| 751 | Ga0495643_0000445 | 3300046522 | Bacteria | 53349 |
| 752 | Ga0495643_0003410 | 3300046522 | Bacteria | 11678 |
| 753 | Ga0495643_0008577 | 3300046522 | Bacteria | 6455 |
| 754 | Ga0495643_0009960 | 3300046522 | Bacteria | 5870 |
| 755 | Ga0495643_0012074 | 3300046522 | Bacteria | 5224 |
| 756 | Ga0495643_0018810 | 3300046522 | Bacteria | 4003 |
| 757 | Ga0495643_0032955 | 3300046522 | Bacteria | 2870 |
| 758 | Ga0495643_0044303 | 3300046522 | Bacteria | 2418 |
| 759 | Ga0495643_0066721 | 3300046522 | Bacteria | 1897 |
| 760 | Ga0495643_0067724 | 3300046522 | Bacteria | 1880 |
| 761 | Ga0495643_0073661 | 3300046522 | Bacteria | 1789 |
| 762 | Ga0495643_0075199 | 3300046522 | Bacteria | 1767 |
| 763 | Ga0495643_0090945 | 3300046522 | Bacteria | 1574 |
| 764 | Ga0495643_0131451 | 3300046522 | Bacteria | 1256 |
| 765 | Ga0495644_0003299 | 3300046523 | Bacteria | 6385 |
| 766 | Ga0495644_0004182 | 3300046523 | Bacteria | 5675 |
| 767 | Ga0495644_0004776 | 3300046523 | Bacteria | 5322 |
| 768 | Ga0495644_0005027 | 3300046523 | Bacteria | 5172 |
| 769 | Ga0495644_0021429 | 3300046523 | Bacteria | 2466 |
| 770 | Ga0495644_0050933 | 3300046523 | Bacteria | 1554 |
| 771 | Ga0495648_0005461 | 3300046524 | Bacteria | 10552 |
| 772 | Ga0495648_0010159 | 3300046524 | Bacteria | 7201 |
| 773 | Ga0495648_0010448 | 3300046524 | Bacteria | 7069 |
| 774 | Ga0495648_0010671 | 3300046524 | Bacteria | 6981 |
| 775 | Ga0495648_0016167 | 3300046524 | Bacteria | 5385 |
| 776 | Ga0495648_0020465 | 3300046524 | Bacteria | 4613 |
| 777 | Ga0495648_0023587 | 3300046524 | Bacteria | 4208 |
| 778 | Ga0495648_0025524 | 3300046524 | Bacteria | 3998 |
| 779 | Ga0495648_0039792 | 3300046524 | Bacteria | 2987 |
| 780 | Ga0495648_0051554 | 3300046524 | Bacteria | 2506 |
| 781 | Ga0495648_0057219 | 3300046524 | Bacteria | 2340 |
| 782 | Ga0495648_0085952 | 3300046524 | Bacteria | 1775 |
| 783 | Ga0495648_0107473 | 3300046524 | Bacteria | 1525 |
| 784 | Ga0495648_0117609 | 3300046524 | Bacteria | 1434 |
| 785 | Ga0495666_0006538 | 3300046526 | Bacteria | 5863 |
| 786 | Ga0495666_0019398 | 3300046526 | Bacteria | 3374 |
| 787 | Ga0495666_0064475 | 3300046526 | Bacteria | 1748 |
| 788 | Ga0495642_0002796 | 3300046528 | Bacteria | 6986 |
| 789 | Ga0495642_0003063 | 3300046528 | Bacteria | 6648 |
| 790 | Ga0495642_0003489 | 3300046528 | Bacteria | 6196 |
| 791 | Ga0495652_0218609 | 3300046529 | Bacteria | 1433 |
| 792 | Ga0495654_0000650 | 3300046530 | Bacteria | 27356 |
| 793 | Ga0495654_0001846 | 3300046530 | Bacteria | 14118 |
| 794 | Ga0495654_0002233 | 3300046530 | Bacteria | 12547 |
| 795 | Ga0495654_0003575 | 3300046530 | Bacteria | 9461 |
| 796 | Ga0495654_0004115 | 3300046530 | Bacteria | 8727 |
| 797 | Ga0495654_0004291 | 3300046530 | Bacteria | 8505 |
| 798 | Ga0495654_0004950 | 3300046530 | Bacteria | 7830 |
| 799 | Ga0495654_0006036 | 3300046530 | Bacteria | 6951 |
| 800 | Ga0495654_0006189 | 3300046530 | Bacteria | 6831 |
| 801 | Ga0495654_0007200 | 3300046530 | Bacteria | 6241 |
| 802 | Ga0495654_0007223 | 3300046530 | Bacteria | 6229 |
| 803 | Ga0495654_0008121 | 3300046530 | Bacteria | 5815 |
| 804 | Ga0495654_0011347 | 3300046530 | Bacteria | 4824 |
| 805 | Ga0495654_0014981 | 3300046530 | Bacteria | 4120 |
| 806 | Ga0495654_0022255 | 3300046530 | Bacteria | 3292 |
| 807 | Ga0495654_0035952 | 3300046530 | Bacteria | 2491 |
| 808 | Ga0495654_0047138 | 3300046530 | Bacteria | 2119 |
| 809 | Ga0495654_0052946 | 3300046530 | Bacteria | 1974 |
| 810 | Ga0495654_0068980 | 3300046530 | Bacteria | 1679 |
| 811 | Ga0495654_0082918 | 3300046530 | Bacteria | 1499 |
| 812 | Ga0495587_0017511 | 3300046536 | Bacteria | 4452 |
| 813 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 814 | Ga0495609_0000024 | 3300046538 | Bacteria | 264100 |
| 815 | Ga0495609_0000040 | 3300046538 | Bacteria | 177058 |
| 816 | Ga0495609_0003829 | 3300046538 | Bacteria | 8464 |
| 817 | Ga0495609_0005854 | 3300046538 | Bacteria | 6377 |
| 818 | Ga0495609_0007930 | 3300046538 | Bacteria | 5247 |
| 819 | Ga0495609_0008020 | 3300046538 | Bacteria | 5208 |
| 820 | Ga0495597_0000010 | 3300046542 | Bacteria | 222418 |
| 821 | Ga0495597_0005703 | 3300046542 | Bacteria | 6550 |
| 822 | Ga0495597_0008036 | 3300046542 | Bacteria | 5308 |
| 823 | Ga0495597_0008574 | 3300046542 | Bacteria | 5113 |
| 824 | Ga0495597_0009557 | 3300046542 | Bacteria | 4782 |
| 825 | Ga0495597_0020003 | 3300046542 | Bacteria | 3123 |
| 826 | Ga0495597_0020915 | 3300046542 | Bacteria | 3043 |
| 827 | Ga0495597_0032223 | 3300046542 | Bacteria | 2379 |
| 828 | Ga0495597_0033358 | 3300046542 | Bacteria | 2331 |
| 829 | Ga0495597_0057841 | 3300046542 | Bacteria | 1695 |
| 830 | Ga0495597_0072754 | 3300046542 | Bacteria | 1478 |
| 831 | Ga0495597_0078271 | 3300046542 | Bacteria | 1416 |
| 832 | Ga0495645_0063200 | 3300046543 | Bacteria | 2681 |
| 833 | Ga0495645_0132275 | 3300046543 | Bacteria | 1747 |
| 834 | Ga0495622_0003446 | 3300046557 | Bacteria | 7453 |
| 835 | Ga0495622_0004248 | 3300046557 | Bacteria | 6671 |
| 836 | Ga0495622_0004639 | 3300046557 | Bacteria | 6365 |
| 837 | Ga0495622_0006279 | 3300046557 | Bacteria | 5517 |
| 838 | Ga0495622_0025355 | 3300046557 | Bacteria | 2770 |
| 839 | Ga0495622_0025705 | 3300046557 | Bacteria | 2750 |
| 840 | Ga0495633_0000030 | 3300046558 | Bacteria | 197184 |
| 841 | Ga0495633_0004335 | 3300046558 | Bacteria | 9058 |
| 842 | Ga0495633_0008322 | 3300046558 | Bacteria | 5858 |
| 843 | Ga0495633_0013515 | 3300046558 | Bacteria | 4298 |
| 844 | Ga0495633_0056321 | 3300046558 | Bacteria | 1847 |
| 845 | Ga0495656_0006278 | 3300046615 | Bacteria | 4163 |
| 846 | Ga0495656_0006407 | 3300046615 | Bacteria | 4128 |
| 847 | Ga0495668_0008646 | 3300046616 | Bacteria | 6329 |
| 848 | Ga0495668_0010057 | 3300046616 | Bacteria | 5756 |
| 849 | Ga0495668_0012252 | 3300046616 | Bacteria | 5090 |
| 850 | Ga0495668_0025052 | 3300046616 | Bacteria | 3391 |
| 851 | Ga0495668_0027930 | 3300046616 | Bacteria | 3195 |
| 852 | Ga0495668_0034352 | 3300046616 | Bacteria | 2845 |
| 853 | Ga0495668_0056139 | 3300046616 | Bacteria | 2174 |
| 854 | Ga0495668_0059860 | 3300046616 | Bacteria | 2101 |
| 855 | Ga0495634_0007980 | 3300046642 | Bacteria | 7895 |
| 856 | Ga0495634_0205535 | 3300046642 | Bacteria | 1221 |
| 857 | Ga0495611_0001090 | 3300046648 | Bacteria | 14300 |
| 858 | Ga0495611_0001126 | 3300046648 | Bacteria | 14008 |
| 859 | Ga0495611_0002823 | 3300046648 | Bacteria | 7769 |
| 860 | Ga0495611_0008442 | 3300046648 | Bacteria | 4361 |
| 861 | Ga0495611_0055297 | 3300046648 | Bacteria | 1795 |
| 862 | Ga0495611_0065085 | 3300046648 | Bacteria | 1661 |
| 863 | Ga0495611_0123325 | 3300046648 | Bacteria | 1208 |
| 864 | Ga0495625_0000111 | 3300046660 | Bacteria | 124977 |
| 865 | Ga0495625_0008363 | 3300046660 | Bacteria | 8834 |
| 866 | Ga0495625_0011517 | 3300046660 | Bacteria | 7203 |
| 867 | Ga0495625_0012022 | 3300046660 | Bacteria | 7026 |
| 868 | Ga0495625_0016649 | 3300046660 | Bacteria | 5775 |
| 869 | Ga0495625_0043696 | 3300046660 | Bacteria | 3248 |
| 870 | Ga0495625_0057271 | 3300046660 | Bacteria | 2772 |
| 871 | Ga0495625_0073813 | 3300046660 | Bacteria | 2390 |
| 872 | Ga0495625_0143804 | 3300046660 | Bacteria | 1607 |
| 873 | Ga0495635_0012706 | 3300046663 | Bacteria | 5906 |
| 874 | Ga0495635_0046774 | 3300046663 | Bacteria | 2984 |
| 875 | Ga0495659_0001193 | 3300046664 | Bacteria | 9028 |
| 876 | Ga0495659_0018069 | 3300046664 | Bacteria | 2345 |
| 877 | Ga0495661_0000015 | 3300046665 | Bacteria | 223740 |
| 878 | Ga0495661_0000019 | 3300046665 | Bacteria | 200606 |
| 879 | Ga0495661_0000034 | 3300046665 | Bacteria | 165606 |
| 880 | Ga0495661_0000054 | 3300046665 | Bacteria | 138979 |
| 881 | Ga0495661_0000985 | 3300046665 | Bacteria | 25704 |
| 882 | Ga0495661_0001307 | 3300046665 | Bacteria | 21216 |
| 883 | Ga0495661_0023997 | 3300046665 | Bacteria | 3951 |
| 884 | Ga0495661_0041407 | 3300046665 | Bacteria | 2850 |
| 885 | Ga0495661_0049138 | 3300046665 | Bacteria | 2559 |
| 886 | Ga0495661_0068134 | 3300046665 | Bacteria | 2088 |
| 887 | Ga0495661_0073470 | 3300046665 | Bacteria | 1992 |
| 888 | Ga0495661_0080516 | 3300046665 | Bacteria | 1879 |
| 889 | Ga0495661_0116085 | 3300046665 | Bacteria | 1485 |
| 890 | Ga0495661_0142355 | 3300046665 | Bacteria | 1303 |
| 891 | Ga0495588_0004938 | 3300046674 | Bacteria | 5916 |
| 892 | Ga0495588_0024850 | 3300046674 | Bacteria | 2979 |
| 893 | Ga0495588_0025580 | 3300046674 | Bacteria | 2942 |
| 894 | Ga0495588_0267736 | 3300046674 | Bacteria | 900 |
| 895 | Ga0495623_0015098 | 3300046679 | Bacteria | 4993 |
| 896 | Ga0495623_0056962 | 3300046679 | Bacteria | 2459 |
| 897 | Ga0495646_0007931 | 3300046680 | Bacteria | 6746 |
| 898 | Ga0495646_0012063 | 3300046680 | Bacteria | 5496 |
| 899 | Ga0495646_0033467 | 3300046680 | Bacteria | 3194 |
| 900 | Ga0495669_0026042 | 3300046684 | Bacteria | 2554 |
| 901 | Ga0495669_0095729 | 3300046684 | Bacteria | 1375 |
| 902 | Ga0495669_0100887 | 3300046684 | Bacteria | 1340 |
| 903 | Ga0495613_0023738 | 3300046689 | Bacteria | 4570 |
| 904 | Ga0495613_0151173 | 3300046689 | Bacteria | 1655 |
| 905 | Ga0495624_0002451 | 3300046690 | Bacteria | 14071 |
| 906 | Ga0495670_0001357 | 3300046691 | Bacteria | 11950 |
| 907 | Ga0495670_0003514 | 3300046691 | Bacteria | 7688 |
| 908 | Ga0495670_0004098 | 3300046691 | Bacteria | 7150 |
| 909 | Ga0495670_0005713 | 3300046691 | Bacteria | 6100 |
| 910 | Ga0495670_0006929 | 3300046691 | Bacteria | 5581 |
| 911 | Ga0495670_0016702 | 3300046691 | Bacteria | 3609 |
| 912 | Ga0495670_0025015 | 3300046691 | Bacteria | 2952 |
| 913 | Ga0495670_0034532 | 3300046691 | Bacteria | 2519 |
| 914 | Ga0495670_0066198 | 3300046691 | Bacteria | 1822 |
| 915 | Ga0495670_0102117 | 3300046691 | Bacteria | 1477 |
| 916 | Ga0495670_0102261 | 3300046691 | Bacteria | 1476 |
| 917 | Ga0495671_0001174 | 3300046692 | Bacteria | 17935 |
| 918 | Ga0495671_0005735 | 3300046692 | Bacteria | 7237 |
| 919 | Ga0495671_0007083 | 3300046692 | Bacteria | 6420 |
| 920 | Ga0495671_0007371 | 3300046692 | Bacteria | 6275 |
| 921 | Ga0495671_0015344 | 3300046692 | Bacteria | 4107 |
| 922 | Ga0495671_0015520 | 3300046692 | Bacteria | 4079 |
| 923 | Ga0495671_0016464 | 3300046692 | Bacteria | 3948 |
| 924 | Ga0495671_0019651 | 3300046692 | Bacteria | 3566 |
| 925 | Ga0495671_0027487 | 3300046692 | Bacteria | 2939 |
| 926 | Ga0495671_0035985 | 3300046692 | Bacteria | 2511 |
| 927 | Ga0495671_0046199 | 3300046692 | Bacteria | 2177 |
| 928 | Ga0495671_0049940 | 3300046692 | Bacteria | 2084 |
| 929 | Ga0495671_0053786 | 3300046692 | Bacteria | 1997 |
| 930 | Ga0495671_0077889 | 3300046692 | Bacteria | 1625 |
| 931 | Ga0495671_0096821 | 3300046692 | Bacteria | 1443 |
| 932 | Ga0495671_0126801 | 3300046692 | Bacteria | 1244 |
| 933 | Ga0495671_0127006 | 3300046692 | Bacteria | 1243 |
| 934 | Ga0495671_0189216 | 3300046692 | Bacteria | 999 |
| 935 | Ga0495649_0002197 | 3300046694 | Bacteria | 13930 |
| 936 | Ga0495649_0002728 | 3300046694 | Bacteria | 12290 |
| 937 | Ga0495649_0003170 | 3300046694 | Bacteria | 11244 |
| 938 | Ga0495649_0003479 | 3300046694 | Bacteria | 10611 |
| 939 | Ga0495649_0006752 | 3300046694 | Bacteria | 7110 |
| 940 | Ga0495649_0007534 | 3300046694 | Bacteria | 6624 |
| 941 | Ga0495649_0008867 | 3300046694 | Bacteria | 6021 |
| 942 | Ga0495649_0010854 | 3300046694 | Bacteria | 5363 |
| 943 | Ga0495649_0012591 | 3300046694 | Bacteria | 4910 |
| 944 | Ga0495649_0025585 | 3300046694 | Bacteria | 3287 |
| 945 | Ga0495649_0028003 | 3300046694 | Bacteria | 3124 |
| 946 | Ga0495649_0054399 | 3300046694 | Bacteria | 2164 |
| 947 | Ga0495649_0099808 | 3300046694 | Bacteria | 1543 |
| 948 | Ga0495649_0130307 | 3300046694 | Bacteria | 1327 |
| 949 | Ga0495649_0176881 | 3300046694 | Bacteria | 1114 |
| 950 | Ga0495649_0179958 | 3300046694 | Bacteria | 1103 |
| 951 | Ga0495649_0200159 | 3300046694 | Bacteria | 1037 |
| 952 | Ga0495589_0000638 | 3300046794 | Bacteria | 22926 |
| 953 | Ga0495589_0001755 | 3300046794 | Bacteria | 12348 |
| 954 | Ga0495589_0002005 | 3300046794 | Bacteria | 11531 |
| 955 | Ga0495589_0004755 | 3300046794 | Bacteria | 7210 |
| 956 | Ga0495589_0005944 | 3300046794 | Bacteria | 6442 |
| 957 | Ga0495589_0006301 | 3300046794 | Bacteria | 6265 |
| 958 | Ga0495589_0008127 | 3300046794 | Bacteria | 5485 |
| 959 | Ga0495589_0011277 | 3300046794 | Bacteria | 4639 |
| 960 | Ga0495589_0021659 | 3300046794 | Bacteria | 3284 |
| 961 | Ga0495589_0024742 | 3300046794 | Bacteria | 3050 |
| 962 | Ga0495589_0025507 | 3300046794 | Bacteria | 2999 |
| 963 | Ga0495589_0041395 | 3300046794 | Bacteria | 2299 |
| 964 | Ga0495600_0006126 | 3300046809 | Bacteria | 7286 |
| 965 | Ga0495660_0002064 | 3300046810 | Bacteria | 13046 |
| 966 | Ga0495660_0004800 | 3300046810 | Bacteria | 8156 |
| 967 | Ga0495660_0014000 | 3300046810 | Bacteria | 4650 |
| 968 | Ga0495660_0020319 | 3300046810 | Bacteria | 3805 |
| 969 | Ga0495660_0021167 | 3300046810 | Bacteria | 3725 |
| 970 | Ga0495660_0022042 | 3300046810 | Bacteria | 3641 |
| 971 | Ga0495660_0024682 | 3300046810 | Bacteria | 3424 |
| 972 | Ga0495660_0041505 | 3300046810 | Bacteria | 2546 |
| 973 | Ga0495660_0043108 | 3300046810 | Bacteria | 2490 |
| 974 | Ga0495660_0078253 | 3300046810 | Bacteria | 1739 |
| 975 | Ga0495660_0079554 | 3300046810 | Bacteria | 1721 |
| 976 | Ga0495660_0094912 | 3300046810 | Bacteria | 1543 |
| 977 | Ga0495660_0100973 | 3300046810 | Bacteria | 1485 |
| 978 | Ga0495660_0101175 | 3300046810 | Bacteria | 1483 |
| 979 | Ga0495660_0136290 | 3300046810 | Bacteria | 1226 |
| 980 | Ga0495660_0138717 | 3300046810 | Bacteria | 1212 |
| 981 | Ga0495581_0010373 | 3300047315 | Bacteria | 5390 |
| 982 | Ga0495581_0017516 | 3300047315 | Bacteria | 4162 |
| 983 | Ga0495604_0007388 | 3300047317 | Bacteria | 8707 |
| 984 | Ga0495604_0066686 | 3300047317 | Bacteria | 2737 |
| 985 | Ga0495604_0090439 | 3300047317 | Bacteria | 2273 |
| 986 | Ga0495636_0005927 | 3300047318 | Bacteria | 4794 |
| 987 | Ga0495636_0043098 | 3300047318 | Bacteria | 1876 |
| 988 | Ga0495674_0068007 | 3300047319 | Bacteria | 3084 |
| 989 | Ga0495674_0166911 | 3300047319 | Bacteria | 1839 |
| 990 | Ga0495672_0003669 | 3300047320 | Bacteria | 12976 |
| 991 | Ga0495672_0006378 | 3300047320 | Bacteria | 9163 |
| 992 | Ga0495672_0007327 | 3300047320 | Bacteria | 8319 |
| 993 | Ga0495672_0009064 | 3300047320 | Bacteria | 7255 |
| 994 | Ga0495672_0010619 | 3300047320 | Bacteria | 6542 |
| 995 | Ga0495672_0011466 | 3300047320 | Bacteria | 6254 |
| 996 | Ga0495672_0013984 | 3300047320 | Bacteria | 5515 |
| 997 | Ga0495672_0014163 | 3300047320 | Bacteria | 5472 |
| 998 | Ga0495672_0018142 | 3300047320 | Bacteria | 4683 |
| 999 | Ga0495672_0021215 | 3300047320 | Bacteria | 4240 |
| 1000 | Ga0495672_0023300 | 3300047320 | Bacteria | 4008 |
| 1001 | Ga0495672_0025071 | 3300047320 | Bacteria | 3826 |
| 1002 | Ga0495672_0027416 | 3300047320 | Bacteria | 3620 |
| 1003 | Ga0495672_0036992 | 3300047320 | Bacteria | 2991 |
| 1004 | Ga0495672_0056960 | 3300047320 | Bacteria | 2271 |
| 1005 | Ga0495672_0121884 | 3300047320 | Bacteria | 1384 |
| 1006 | Ga0495676_0000010 | 3300047321 | Bacteria | 242637 |
| 1007 | Ga0495676_0016987 | 3300047321 | Bacteria | 6443 |
| 1008 | Ga0495676_0124770 | 3300047321 | Bacteria | 1867 |
| 1009 | Ga0495676_0178142 | 3300047321 | Bacteria | 1491 |
| 1010 | Ga0495676_0269979 | 3300047321 | Bacteria | 1154 |
| 1011 | Ga0495680_0027725 | 3300047322 | Bacteria | 4648 |
| 1012 | Ga0495680_0035540 | 3300047322 | Bacteria | 4012 |
| 1013 | Ga0495680_0110419 | 3300047322 | Bacteria | 2038 |
| 1014 | Ga0495680_0326211 | 3300047322 | Bacteria | 1073 |
| 1015 | Ga0495683_0000142 | 3300047323 | Bacteria | 70985 |
| 1016 | Ga0495683_0000265 | 3300047323 | Bacteria | 46674 |
| 1017 | Ga0495683_0001827 | 3300047323 | Bacteria | 13384 |
| 1018 | Ga0495683_0001998 | 3300047323 | Bacteria | 12682 |
| 1019 | Ga0495683_0004135 | 3300047323 | Bacteria | 8301 |
| 1020 | Ga0495683_0009059 | 3300047323 | Bacteria | 5304 |
| 1021 | Ga0495683_0009623 | 3300047323 | Bacteria | 5144 |
| 1022 | Ga0495683_0013105 | 3300047323 | Bacteria | 4341 |
| 1023 | Ga0495683_0020012 | 3300047323 | Bacteria | 3453 |
| 1024 | Ga0495683_0051275 | 3300047323 | Bacteria | 2064 |
| 1025 | Ga0495683_0052351 | 3300047323 | Bacteria | 2038 |
| 1026 | Ga0495683_0057771 | 3300047323 | Bacteria | 1927 |
| 1027 | Ga0495683_0148360 | 3300047323 | Bacteria | 1094 |
| 1028 | Ga0495683_0156983 | 3300047323 | Bacteria | 1054 |
| 1029 | Ga0495687_002882 | 3300047443 | Bacteria | 13135 |
| 1030 | Ga0495687_009065 | 3300047443 | Bacteria | 5605 |
| 1031 | Ga0495687_015127 | 3300047443 | Bacteria | 3936 |
| 1032 | Ga0495675_0167155 | 3300047444 | Bacteria | 1352 |
| 1033 | Ga0495677_0004199 | 3300047445 | Bacteria | 5555 |
| 1034 | Ga0495679_000201 | 3300047446 | Bacteria | 52238 |
| 1035 | Ga0495679_000698 | 3300047446 | Bacteria | 21818 |
| 1036 | Ga0495679_000968 | 3300047446 | Bacteria | 17712 |
| 1037 | Ga0495679_002746 | 3300047446 | Bacteria | 8762 |
| 1038 | Ga0495679_009280 | 3300047446 | Bacteria | 3947 |
| 1039 | Ga0495679_009797 | 3300047446 | Bacteria | 3806 |
| 1040 | Ga0495679_012754 | 3300047446 | Bacteria | 3183 |
| 1041 | Ga0495679_015441 | 3300047446 | Bacteria | 2793 |
| 1042 | Ga0495679_016731 | 3300047446 | Bacteria | 2646 |
| 1043 | Ga0495679_017993 | 3300047446 | Bacteria | 2518 |
| 1044 | Ga0495685_017612 | 3300047447 | Bacteria | 2448 |
| 1045 | Ga0495685_021566 | 3300047447 | Bacteria | 2216 |
| 1046 | Ga0495673_0002428 | 3300047469 | Bacteria | 13122 |
| 1047 | Ga0495673_0002568 | 3300047469 | Bacteria | 12633 |
| 1048 | Ga0495673_0002623 | 3300047469 | Bacteria | 12461 |
| 1049 | Ga0495673_0002633 | 3300047469 | Bacteria | 12430 |
| 1050 | Ga0495673_0003141 | 3300047469 | Bacteria | 11060 |
| 1051 | Ga0495673_0003253 | 3300047469 | Bacteria | 10817 |
| 1052 | Ga0495673_0003319 | 3300047469 | Bacteria | 10669 |
| 1053 | Ga0495673_0004143 | 3300047469 | Bacteria | 9174 |
| 1054 | Ga0495673_0004949 | 3300047469 | Bacteria | 8200 |
| 1055 | Ga0495673_0005325 | 3300047469 | Bacteria | 7805 |
| 1056 | Ga0495673_0005851 | 3300047469 | Bacteria | 7351 |
| 1057 | Ga0495673_0005906 | 3300047469 | Bacteria | 7309 |
| 1058 | Ga0495673_0006988 | 3300047469 | Bacteria | 6558 |
| 1059 | Ga0495673_0007571 | 3300047469 | Bacteria | 6215 |
| 1060 | Ga0495673_0010534 | 3300047469 | Bacteria | 5019 |
| 1061 | Ga0495673_0017221 | 3300047469 | Bacteria | 3676 |
| 1062 | Ga0495673_0027058 | 3300047469 | Bacteria | 2733 |
| 1063 | Ga0495673_0030396 | 3300047469 | Bacteria | 2536 |
| 1064 | Ga0495673_0031811 | 3300047469 | Bacteria | 2467 |
| 1065 | Ga0495673_0036236 | 3300047469 | Bacteria | 2265 |
| 1066 | Ga0495673_0040140 | 3300047469 | Bacteria | 2117 |
| 1067 | Ga0495681_0001820 | 3300047470 | Bacteria | 15682 |
| 1068 | Ga0495681_0007339 | 3300047470 | Bacteria | 7058 |
| 1069 | Ga0495681_0007505 | 3300047470 | Bacteria | 6954 |
| 1070 | Ga0495681_0009531 | 3300047470 | Bacteria | 5967 |
| 1071 | Ga0495681_0009589 | 3300047470 | Bacteria | 5947 |
| 1072 | Ga0495681_0011929 | 3300047470 | Bacteria | 5135 |
| 1073 | Ga0495681_0012563 | 3300047470 | Bacteria | 4968 |
| 1074 | Ga0495681_0012805 | 3300047470 | Bacteria | 4906 |
| 1075 | Ga0495681_0013163 | 3300047470 | Bacteria | 4818 |
| 1076 | Ga0495681_0013203 | 3300047470 | Bacteria | 4807 |
| 1077 | Ga0495681_0013376 | 3300047470 | Bacteria | 4764 |
| 1078 | Ga0495681_0035873 | 3300047470 | Bacteria | 2458 |
| 1079 | Ga0495681_0036743 | 3300047470 | Bacteria | 2419 |
| 1080 | Ga0495681_0039884 | 3300047470 | Bacteria | 2289 |
| 1081 | Ga0495681_0042904 | 3300047470 | Bacteria | 2185 |
| 1082 | Ga0495681_0065030 | 3300047470 | Bacteria | 1668 |
| 1083 | Ga0495681_0087743 | 3300047470 | Bacteria | 1378 |
| 1084 | Ga0495684_0003966 | 3300047471 | Bacteria | 11538 |
| 1085 | Ga0495686_0009836 | 3300047472 | Bacteria | 6856 |
| 1086 | Ga0495686_0011330 | 3300047472 | Bacteria | 6287 |
| 1087 | Ga0495686_0017973 | 3300047472 | Bacteria | 4754 |
| 1088 | Ga0495686_0019100 | 3300047472 | Bacteria | 4583 |
| 1089 | Ga0495686_0038882 | 3300047472 | Bacteria | 3041 |
| 1090 | Ga0495686_0066371 | 3300047472 | Bacteria | 2229 |
| 1091 | Ga0495686_0275729 | 3300047472 | Bacteria | 936 |
| 1092 | Ga0495593_0001723 | 3300047673 | Bacteria | 12950 |
| 1093 | Ga0495593_0016845 | 3300047673 | Bacteria | 4115 |
| 1094 | Ga0495593_0064105 | 3300047673 | Bacteria | 1918 |
| 1095 | Ga0495593_0079586 | 3300047673 | Bacteria | 1696 |
| 1096 | Ga0495593_0118381 | 3300047673 | Bacteria | 1349 |
| 1097 | Ga0495602_0016643 | 3300048088 | Bacteria | 7390 |
| 1098 | Ga0495614_0027427 | 3300048089 | Bacteria | 2456 |
| 1099 | Ga0495626_0000013 | 3300048091 | Bacteria | 248164 |
| 1100 | Ga0495626_0001651 | 3300048091 | Bacteria | 17249 |
| 1101 | Ga0495626_0001999 | 3300048091 | Bacteria | 15048 |
| 1102 | Ga0495626_0002685 | 3300048091 | Bacteria | 12022 |
| 1103 | Ga0495626_0004287 | 3300048091 | Bacteria | 8803 |
| 1104 | Ga0495626_0004989 | 3300048091 | Bacteria | 7938 |
| 1105 | Ga0495626_0006596 | 3300048091 | Bacteria | 6579 |
| 1106 | Ga0495626_0008701 | 3300048091 | Bacteria | 5533 |
| 1107 | Ga0495626_0012595 | 3300048091 | Bacteria | 4424 |
| 1108 | Ga0495626_0021575 | 3300048091 | Bacteria | 3194 |
| 1109 | Ga0495626_0023023 | 3300048091 | Bacteria | 3071 |
| 1110 | Ga0495626_0026139 | 3300048091 | Bacteria | 2848 |
| 1111 | Ga0495626_0044996 | 3300048091 | Bacteria | 2062 |
| 1112 | Ga0496102_0016921 | 3300048905 | Bacteria | 6380 |
| 1113 | Ga0496102_0212840 | 3300048905 | Bacteria | 1822 |
| 1114 | Ga0496102_0279281 | 3300048905 | Bacteria | 1574 |
| 1115 | Ga0496103_0008171 | 3300048906 | Bacteria | 6211 |
| 1116 | Ga0496106_0481556 | 3300048909 | Bacteria | 997 |
| 1117 | Ga0496110_0024167 | 3300048913 | Bacteria | 5176 |
| 1118 | Ga0496110_0092561 | 3300048913 | Bacteria | 2705 |
| 1119 | Ga0496111_0090448 | 3300048914 | Bacteria | 2242 |
| 1120 | Ga0496112_0241331 | 3300048915 | Bacteria | 1760 |
| 1121 | Ga0496116_0000528 | 3300048919 | Bacteria | 51520 |
| 1122 | Ga0496116_0009118 | 3300048919 | Bacteria | 8505 |
| 1123 | Ga0496116_0010681 | 3300048919 | Bacteria | 7673 |
| 1124 | Ga0496116_0015217 | 3300048919 | Bacteria | 6093 |
| 1125 | Ga0496116_0015285 | 3300048919 | Bacteria | 6071 |
| 1126 | Ga0496116_0044432 | 3300048919 | Bacteria | 3017 |
| 1127 | Ga0496116_0117582 | 3300048919 | Bacteria | 1547 |
| 1128 | Ga0496117_0001491 | 3300048920 | Bacteria | 33545 |
| 1129 | Ga0496117_0001958 | 3300048920 | Bacteria | 27397 |
| 1130 | Ga0496117_0003682 | 3300048920 | Bacteria | 17606 |
| 1131 | Ga0496117_0014819 | 3300048920 | Bacteria | 6689 |
| 1132 | Ga0496117_0015448 | 3300048920 | Bacteria | 6510 |
| 1133 | Ga0496117_0018056 | 3300048920 | Bacteria | 5865 |
| 1134 | Ga0496117_0028407 | 3300048920 | Bacteria | 4333 |
| 1135 | Ga0496117_0053042 | 3300048920 | Bacteria | 2852 |
| 1136 | Ga0496117_0065851 | 3300048920 | Bacteria | 2460 |
| 1137 | Ga0496117_0198574 | 3300048920 | Bacteria | 1135 |
| 1138 | Ga0496118_0016801 | 3300048921 | Bacteria | 6689 |
| 1139 | Ga0496118_0023939 | 3300048921 | Bacteria | 5286 |
| 1140 | Ga0496118_0033439 | 3300048921 | Bacteria | 4218 |
| 1141 | Ga0496118_0042880 | 3300048921 | Bacteria | 3564 |
| 1142 | Ga0496118_0059610 | 3300048921 | Bacteria | 2840 |
| 1143 | Ga0496118_0131133 | 3300048921 | Bacteria | 1609 |
| 1144 | Ga0496118_0168757 | 3300048921 | Bacteria | 1340 |
| 1145 | Ga0496118_0296244 | 3300048921 | Bacteria | 891 |
| 1146 | Ga0496119_0002684 | 3300048922 | Bacteria | 19220 |
| 1147 | Ga0496119_0003088 | 3300048922 | Bacteria | 17569 |
| 1148 | Ga0496119_0050934 | 3300048922 | Bacteria | 2548 |
| 1149 | Ga0496120_0002021 | 3300048923 | Bacteria | 22053 |
| 1150 | Ga0496120_0002665 | 3300048923 | Bacteria | 17589 |
| 1151 | Ga0496120_0023163 | 3300048923 | Bacteria | 3891 |
| 1152 | Ga0496120_0030156 | 3300048923 | Bacteria | 3301 |
| 1153 | Ga0496121_0001448 | 3300048924 | Bacteria | 40036 |
| 1154 | Ga0496121_0005918 | 3300048924 | Bacteria | 15474 |
| 1155 | Ga0496121_0017408 | 3300048924 | Bacteria | 7344 |
| 1156 | Ga0496121_0022992 | 3300048924 | Bacteria | 6023 |
| 1157 | Ga0496121_0032004 | 3300048924 | Bacteria | 4791 |
| 1158 | Ga0496121_0116248 | 3300048924 | Bacteria | 2029 |
| 1159 | Ga0496121_0116667 | 3300048924 | Bacteria | 2024 |
| 1160 | Ga0496122_0000297 | 3300048925 | Bacteria | 110041 |
| 1161 | Ga0496122_0005458 | 3300048925 | Bacteria | 15134 |
| 1162 | Ga0496122_0006316 | 3300048925 | Bacteria | 13648 |
| 1163 | Ga0496122_0017963 | 3300048925 | Bacteria | 6563 |
| 1164 | Ga0496122_0036923 | 3300048925 | Bacteria | 3942 |
| 1165 | Ga0496122_0099757 | 3300048925 | Bacteria | 1945 |
| 1166 | Ga0496122_0139037 | 3300048925 | Bacteria | 1523 |
| 1167 | Ga0496122_0143144 | 3300048925 | Bacteria | 1491 |
| 1168 | Ga0496123_0001365 | 3300048926 | Bacteria | 34358 |
| 1169 | Ga0496123_0003902 | 3300048926 | Bacteria | 16211 |
| 1170 | Ga0496123_0011662 | 3300048926 | Bacteria | 7586 |
| 1171 | Ga0496123_0014222 | 3300048926 | Bacteria | 6615 |
| 1172 | Ga0496123_0048994 | 3300048926 | Bacteria | 2836 |
| 1173 | Ga0496123_0071469 | 3300048926 | Bacteria | 2164 |
| 1174 | Ga0496123_0104278 | 3300048926 | Bacteria | 1640 |
| 1175 | Ga0496124_0000051 | 3300048927 | Bacteria | 255802 |
| 1176 | Ga0496124_0002170 | 3300048927 | Bacteria | 26288 |
| 1177 | Ga0496124_0008997 | 3300048927 | Bacteria | 10331 |
| 1178 | Ga0496124_0009753 | 3300048927 | Bacteria | 9828 |
| 1179 | Ga0496124_0009861 | 3300048927 | Bacteria | 9767 |
| 1180 | Ga0496124_0015687 | 3300048927 | Bacteria | 7247 |
| 1181 | Ga0496124_0031973 | 3300048927 | Bacteria | 4654 |
| 1182 | Ga0496124_0077693 | 3300048927 | Bacteria | 2737 |
| 1183 | Ga0496124_0168815 | 3300048927 | Bacteria | 1697 |
| 1184 | Ga0496124_0213870 | 3300048927 | Bacteria | 1456 |
| 1185 | Ga0496124_0238885 | 3300048927 | Bacteria | 1352 |
| 1186 | Ga0496125_0002244 | 3300048928 | Bacteria | 25670 |
| 1187 | Ga0496125_0003064 | 3300048928 | Bacteria | 20867 |
| 1188 | Ga0496125_0004004 | 3300048928 | Bacteria | 17327 |
| 1189 | Ga0496125_0008231 | 3300048928 | Bacteria | 10962 |
| 1190 | Ga0496125_0008371 | 3300048928 | Bacteria | 10844 |
| 1191 | Ga0496125_0015946 | 3300048928 | Bacteria | 7237 |
| 1192 | Ga0496125_0019886 | 3300048928 | Bacteria | 6315 |
| 1193 | Ga0496125_0026825 | 3300048928 | Bacteria | 5235 |
| 1194 | Ga0496125_0090963 | 3300048928 | Bacteria | 2288 |
| 1195 | Ga0496126_0004493 | 3300048929 | Bacteria | 16641 |
| 1196 | Ga0495678_000063 | 3300049459 | Bacteria | 140183 |
| 1197 | Ga0495678_000127 | 3300049459 | Bacteria | 89660 |
| 1198 | Ga0495678_003317 | 3300049459 | Bacteria | 10035 |
| 1199 | Ga0495678_005393 | 3300049459 | Bacteria | 7074 |
| 1200 | Ga0495678_005525 | 3300049459 | Bacteria | 6953 |
| 1201 | Ga0495678_006348 | 3300049459 | Bacteria | 6304 |
| 1202 | Ga0495678_006555 | 3300049459 | Bacteria | 6179 |
| 1203 | Ga0495678_006629 | 3300049459 | Bacteria | 6133 |
| 1204 | Ga0495678_007779 | 3300049459 | Bacteria | 5516 |
| 1205 | Ga0495678_009177 | 3300049459 | Bacteria | 4922 |
| 1206 | Ga0495678_011113 | 3300049459 | Bacteria | 4326 |
| 1207 | Ga0495678_012254 | 3300049459 | Bacteria | 4070 |
| 1208 | Ga0495678_012374 | 3300049459 | Bacteria | 4048 |
| 1209 | Ga0495678_028943 | 3300049459 | Bacteria | 2331 |
| 1210 | Ga0495678_029599 | 3300049459 | Bacteria | 2298 |
| 1211 | Ga0495678_044142 | 3300049459 | Bacteria | 1765 |
| 1212 | Ga0495678_046390 | 3300049459 | Bacteria | 1708 |
| 1213 | Ga0495678_055823 | 3300049459 | Bacteria | 1505 |
| 1214 | Ga0495682_0000635 | 3300049460 | Bacteria | 23482 |
| 1215 | Ga0495682_0001628 | 3300049460 | Bacteria | 11558 |
| 1216 | Ga0495682_0003886 | 3300049460 | Bacteria | 6533 |
| 1217 | Ga0495682_0004726 | 3300049460 | Bacteria | 5758 |
| 1218 | Ga0495682_0004955 | 3300049460 | Bacteria | 5602 |
| 1219 | Ga0495682_0007598 | 3300049460 | Bacteria | 4305 |
| 1220 | Ga0495682_0056386 | 3300049460 | Bacteria | 1424 |
| 1221 | Ga0495682_0079384 | 3300049460 | Bacteria | 1180 |
| 1222 | Ga0495682_0109432 | 3300049460 | Bacteria | 990 |
| 1223 | Ga0501032_0066331 | 3300049569 | Bacteria | 2412 |
| 1224 | Ga0501034_0038632 | 3300049571 | Bacteria | 4834 |
| 1225 | Ga0501034_0509350 | 3300049571 | Bacteria | 1116 |
| 1226 | Ga0501227_008651 | 3300049665 | Bacteria | 2183 |
| 1227 | Ga0501241_002676 | 3300049758 | Bacteria | 3429 |
| 1228 | nmdc:mga03683_36987_c1 | 3300050489 | Bacteria | 1988 |
| 1229 | nmdc:mga03683_59708_c1 | 3300050489 | Bacteria | 1609 |
| 1230 | nmdc:mga00v17_17827_c1 | 3300050491 | Bacteria | 4027 |
| 1231 | nmdc:mga08x19_357311_c1 | 3300050514 | Bacteria | 1021 |
| 1232 | Ga0500572_001606 | 3300053111 | Bacteria | 5970 |
| 1233 | Ga0500618_005220 | 3300053125 | Bacteria | 3991 |
| 1234 | Ga0500573_0003859 | 3300053140 | Bacteria | 7819 |
| 1235 | Ga0500577_0054949 | 3300053142 | Bacteria | 1510 |
| 1236 | Ga0500586_042887 | 3300053145 | Bacteria | 1540 |
| 1237 | Ga0500634_0000306 | 3300053161 | Bacteria | 15570 |
| 1238 | Ga0587067_001233 | 3300059640 | Bacteria | 2702 |
| 1239 | Ga0587072_000037 | 3300059643 | Bacteria | 8879 |
| 1240 | 2511257386 | 2511231004 | Bacteria | 6669789 |
| 1241 | 2511268756 | 2511231006 | Bacteria | 6794709 |
| 1242 | 2511270797 | 2511231007 | Bacteria | 6306603 |
| 1243 | 2511277018 | 2511231008 | Bacteria | 6624100 |
| 1244 | 2511291505 | 2511231010 | Bacteria | 6373152 |
| 1245 | 2511296172 | 2511231011 | Bacteria | 6149768 |
| 1246 | 2511300608 | 2511231012 | Bacteria | 6738011 |
| 1247 | 2511315584 | 2511231014 | Bacteria | 6462302 |
| 1248 | 2511320503 | 2511231015 | Bacteria | 6598026 |
| 1249 | 2511323534 | 2511231016 | Bacteria | 6704427 |
| 1250 | 2511332388 | 2511231017 | Bacteria | 6503007 |
| 1251 | 2511337173 | 2511231018 | Bacteria | 6436256 |
| 1252 | 2511346123 | 2511231019 | Bacteria | 6520662 |
| 1253 | 2511352755 | 2511231020 | Bacteria | 6115223 |
| 1254 | 2511355022 | 2511231021 | Bacteria | 7302637 |
| 1255 | 2511363156 | 2511231022 | Bacteria | 6719296 |
| 1256 | 2511370163 | 2511231023 | Bacteria | 6808468 |
| 1257 | 2511411138 | 2511231031 | Bacteria | 6558529 |
| 1258 | 2511826722 | 2511231156 | Bacteria | 6845832 |
| 1259 | 2512328289 | 2512047018 | Bacteria | 6663241 |
| 1260 | 2555668019 | 2554235341 | Bacteria | 6867980 |
| 1261 | 2583790462 | 2582580891 | Bacteria | 6800976 |
| 1262 | 2597028380 | 2596583598 | Bacteria | 5251611 |
| 1263 | 2597856235 | 2597489887 | Bacteria | 6666321 |
| 1264 | 2597862282 | 2597489888 | Bacteria | 6179543 |
| 1265 | 2599328189 | 2599185155 | Bacteria | 5827168 |
| 1266 | 2599355019 | 2599185160 | Bacteria | 6844013 |
| 1267 | 2599361157 | 2599185161 | Bacteria | 6960462 |
| 1268 | 2599367479 | 2599185162 | Bacteria | 6957254 |
| 1269 | 2599374269 | 2599185163 | Bacteria | 6995158 |
| 1270 | 2599380125 | 2599185164 | Bacteria | 6841688 |
| 1271 | 2599386572 | 2599185165 | Bacteria | 6843250 |
| 1272 | 2599393127 | 2599185166 | Bacteria | 6959206 |
| 1273 | 2599397107 | 2599185167 | Bacteria | 6353609 |
| 1274 | 2599404894 | 2599185168 | Bacteria | 6997636 |
| 1275 | 2599444388 | 2599185178 | Bacteria | 5365746 |
| 1276 | 2599449099 | 2599185179 | Bacteria | 6611171 |
| 1277 | 2599461853 | 2599185181 | Bacteria | 6844519 |
| 1278 | 2599467104 | 2599185182 | Bacteria | 6883168 |
| 1279 | 2599483509 | 2599185185 | Bacteria | 6652270 |
| 1280 | 2599491054 | 2599185186 | Bacteria | 6831633 |
| 1281 | 2599502925 | 2599185188 | Bacteria | 6164180 |
| 1282 | 2599511157 | 2599185190 | Bacteria | 6285678 |
| 1283 | 2599519353 | 2599185191 | Bacteria | 6297582 |
| 1284 | 2599615047 | 2599185212 | Bacteria | 6765997 |
| 1285 | 2599771244 | 2599185248 | Bacteria | 6696816 |
| 1286 | 2599805415 | 2599185257 | Bacteria | 6492581 |
| 1287 | 2599879604 | 2599185288 | Bacteria | 6666191 |
| 1288 | 2599885984 | 2599185289 | Bacteria | 6778765 |
| 1289 | 2599890531 | 2599185290 | Bacteria | 6289611 |
| 1290 | 2599897698 | 2599185291 | Bacteria | 6775623 |
| 1291 | 2599930047 | 2599185300 | Bacteria | 6062622 |
| 1292 | 2599945425 | 2599185302 | Bacteria | 5954930 |
| 1293 | 2599948104 | 2599185303 | Bacteria | 6512725 |
| 1294 | 2599955697 | 2599185304 | Bacteria | 5951361 |
| 1295 | 2599961066 | 2599185305 | Bacteria | 6748700 |
| 1296 | 2599967246 | 2599185306 | Bacteria | 6637356 |
| 1297 | 2599974630 | 2599185307 | Bacteria | 6194719 |
| 1298 | 2599980357 | 2599185308 | Bacteria | 6621546 |
| 1299 | 2599985809 | 2599185309 | Bacteria | 5969593 |
| 1300 | 2599990703 | 2599185310 | Bacteria | 6014457 |
| 1301 | 2599996023 | 2599185311 | Bacteria | 6354990 |
| 1302 | 2600001911 | 2599185312 | Bacteria | 5912071 |
| 1303 | 2600005636 | 2599185313 | Bacteria | 6658188 |
| 1304 | 2600014200 | 2599185314 | Bacteria | 6621749 |
| 1305 | 2600019118 | 2599185315 | Bacteria | 6771107 |
| 1306 | 2600025594 | 2599185316 | Bacteria | 6320029 |
| 1307 | 2600027791 | 2599185317 | Bacteria | 6435722 |
| 1308 | 2600033493 | 2599185318 | Bacteria | 6961590 |
| 1309 | 2600040221 | 2599185319 | Bacteria | 6637840 |
| 1310 | 2600049408 | 2599185320 | Bacteria | 5963263 |
| 1311 | 2600055701 | 2599185321 | Bacteria | 6764560 |
| 1312 | 2600061676 | 2599185322 | Bacteria | 6763055 |
| 1313 | 2600064295 | 2599185323 | Bacteria | 6688755 |
| 1314 | 2600073535 | 2599185324 | Bacteria | 6590677 |
| 1315 | 2600077257 | 2599185325 | Bacteria | 6324919 |
| 1316 | 2600214475 | 2599185356 | Bacteria | 6843884 |
| 1317 | 2600356958 | 2600254930 | Bacteria | 6431253 |
| 1318 | 2600364121 | 2600254931 | Bacteria | 6734225 |
| 1319 | 2600442547 | 2600254954 | Bacteria | 5100516 |
| 1320 | 2601625990 | 2600255283 | Bacteria | 6061572 |
| 1321 | 2601690871 | 2600255296 | Bacteria | 5784754 |
| 1322 | 2601774820 | 2600255313 | Bacteria | 6842543 |
| 1323 | 2601800052 | 2600255318 | Bacteria | 6383414 |
| 1324 | 2602012494 | 2600255389 | Bacteria | 5275336 |
| 1325 | 2606074684 | 2603880185 | Bacteria | 6379190 |
| 1326 | 2606127547 | 2603880199 | Bacteria | 6377649 |
| 1327 | 2621301580 | 2619619299 | Bacteria | 6649820 |
| 1328 | 2624478799 | 2623620443 | Bacteria | 6427864 |
| 1329 | 2624494153 | 2623620446 | Bacteria | 6500345 |
| 1330 | 2643842476 | 2643221565 | Bacteria | 6216018 |
| 1331 | 2643955339 | 2643221589 | Bacteria | 6250934 |
| 1332 | 2644023691 | 2643221602 | Bacteria | 6249926 |
| 1333 | 2644188311 | 2643221633 | Bacteria | 6733554 |
| 1334 | 2644282451 | 2643221650 | Bacteria | 7029547 |
| 1335 | 2644623962 | 2643221713 | Bacteria | 6554480 |
| 1336 | 2652545886 | 2651869719 | Bacteria | 6047974 |
| 1337 | 2671089793 | 2667528170 | Bacteria | 6786960 |
| 1338 | 2671097620 | 2667528171 | Bacteria | 6900659 |
| 1339 | 2671125577 | 2667528176 | Bacteria | 6724917 |
| 1340 | 2671767849 | 2671180172 | Bacteria | 6495783 |
| 1341 | 2677897462 | 2675903420 | Bacteria | 6247433 |
| 1342 | 2678265087 | 2675903515 | Bacteria | 6580491 |
| 1343 | 2715750837 | 2713897148 | Bacteria | 5883533 |
| 1344 | 2715757516 | 2713897149 | Bacteria | 6506249 |
| 1345 | 2718632684 | 2718217725 | Bacteria | 5758958 |
| 1346 | 2729147827 | 2728369097 | Bacteria | 4333476 |
| 1347 | 2738673800 | 2738541265 | Bacteria | 6594665 |
| 1348 | 2738689482 | 2738541271 | Bacteria | 5657310 |
| 1349 | 2738752193 | 2738541282 | Bacteria | 6593925 |
| 1350 | 2738809062 | 2738541294 | Bacteria | 6925949 |
| 1351 | 2738861234 | 2738541303 | Bacteria | 6591772 |
| 1352 | 2738896422 | 2738541309 | Bacteria | 6926455 |
| 1353 | 2739196569 | 2738543004 | Bacteria | 6381073 |
| 1354 | 2739257547 | 2738543015 | Bacteria | 6750701 |
| 1355 | 2739265256 | 2738543016 | Bacteria | 5657564 |
| 1356 | 2739286848 | 2738543020 | Bacteria | 5718238 |
| 1357 | 2739292161 | 2738543021 | Bacteria | 5718241 |
| 1358 | 2739314867 | 2738543025 | Bacteria | 6600348 |
| 1359 | 2743735644 | 2740892503 | Bacteria | 6855563 |
| 1360 | 2745005544 | 2744054620 | Bacteria | 6551379 |
| 1361 | 2774122143 | 2773857670 | Bacteria | 6407454 |
| 1362 | 2774136725 | 2773857673 | Bacteria | 6513460 |
| 1363 | 2784260477 | 2784132063 | Bacteria | 6262788 |
| 1364 | 2784314388 | 2784132072 | Bacteria | 6596533 |
| 1365 | 2794595604 | 2791355520 | Bacteria | 5948615 |
| 1366 | 2808855892 | 2808606361 | Bacteria | 6136259 |
| 1367 | 2808921901 | 2808606376 | Bacteria | 6248667 |
| 1368 | 2808928776 | 2808606377 | Bacteria | 6646337 |
| 1369 | 2808935972 | 2808606378 | Bacteria | 6177535 |
| 1370 | 2808941051 | 2808606379 | Bacteria | 5022697 |
| 1371 | 2808944022 | 2808606380 | Bacteria | 6248705 |
| 1372 | 2808950897 | 2808606381 | Bacteria | 6646461 |
| 1373 | 2808959742 | 2808606382 | Bacteria | 6841132 |
| 1374 | 2808964235 | 2808606383 | Bacteria | 6138645 |
| 1375 | 2808975200 | 2808606385 | Bacteria | 6711065 |
| 1376 | 2808991161 | 2808606388 | Bacteria | 6706662 |
| 1377 | 2808999123 | 2808606389 | Bacteria | 6138126 |
| 1378 | 2809215737 | 2808606445 | Bacteria | 6057339 |
| 1379 | 2812370812 | 2811994881 | Bacteria | 6298475 |
| 1380 | 2817489061 | 2816332298 | Bacteria | 6852809 |
| 1381 | 2819658354 | 2818991456 | Bacteria | 6123676 |
| 1382 | 2819702703 | 2818991464 | Bacteria | 6907494 |
| 1383 | 2823422458 | 2823421272 | Bacteria | 5372474 |
| 1384 | 2825656015 | 2825651385 | Bacteria | 6715909 |
| 1385 | 2826583779 | 2826581358 | Bacteria | 5963467 |
| 1386 | 2834028962 | 2834028612 | Bacteria | 6354979 |
| 1387 | 2842808051 | 2842805378 | Bacteria | 5385175 |
| 1388 | 2842821042 | 2842815866 | Bacteria | 5947510 |
| 1389 | 2842835733 | 2842832357 | Bacteria | 5959113 |
| 1390 | 2842847480 | 2842843487 | Bacteria | 6004777 |
| 1391 | 2842853442 | 2842849001 | Bacteria | 5924277 |
| 1392 | 2842856419 | 2842854478 | Bacteria | 6143501 |
| 1393 | 2844668521 | 2844665904 | Bacteria | 6817974 |
| 1394 | 2852615551 | 2852612431 | Bacteria | 6885235 |
| 1395 | 2852662845 | 2852657418 | Bacteria | 6472974 |
| 1396 | 2852670519 | 2852667396 | Bacteria | 6885555 |
| 1397 | 2860340658 | 2860339153 | Bacteria | 6846989 |
| 1398 | 2878030763 | 2878029506 | Bacteria | 6418441 |
| 1399 | 2880231675 | 2880230671 | Bacteria | 6140320 |
| 1400 | 2885268583 | 2885266251 | Bacteria | 4796748 |
| 1401 | 2904520710 | 2904518522 | Bacteria | 6068986 |
| 1402 | 2904553065 | 2904550169 | Bacteria | 6221258 |
| 1403 | 2913041699 | 2913036834 | Bacteria | 6704877 |
| 1404 | 2917071781 | 2917070673 | Bacteria | 6868303 |
| 1405 | 2919067287 | 2919063839 | Bacteria | 6302690 |
| 1406 | 2919385813 | 2919385768 | Bacteria | 5897293 |
| 1407 | 2919458368 | 2919456309 | Bacteria | 6586567 |
| 1408 | 2919484637 | 2919481497 | Bacteria | 6907839 |
| 1409 | 2919492809 | 2919487758 | Bacteria | 5929766 |
| 1410 | 2919505147 | 2919501602 | Bacteria | 5286340 |
| 1411 | 2919699930 | 2919697872 | Bacteria | 6553725 |
| 1412 | 2923154652 | 2923153595 | Bacteria | 6870622 |
| 1413 | 2923524917 | 2923519811 | Bacteria | 6298479 |
| 1414 | 2923590346 | 2923586266 | Bacteria | 6565975 |
| 1415 | 2926066824 | 2926063275 | Bacteria | 5285848 |
| 1416 | 2928063131 | 2928058823 | Bacteria | 5520022 |
| 1417 | 2929149019 | 2929144301 | Bacteria | 6622272 |
| 1418 | 2929190988 | 2929189879 | Bacteria | 5930554 |
| 1419 | 2931373559 | 2931369376 | Bacteria | 6847892 |
| 1420 | 2931391994 | 2931390751 | Bacteria | 6273349 |
| 1421 | 2931399440 | 2931396565 | Bacteria | 7251677 |
| 1422 | 2935353954 | 2935353572 | Unclassified | 6955622 |
| 1423 | 2939637034 | 2939636861 | Bacteria | 6297853 |
| 1424 | 2945929588 | 2945928738 | Bacteria | 6053221 |
| 1425 | 2945965838 | 2945961074 | Bacteria | 7342064 |
| 1426 | 2946029235 | 2946027586 | Bacteria | 6049274 |
| 1427 | 2969305585 | 2969304461 | Bacteria | 6601805 |
| 1428 | 2974292784 | 2974289157 | Bacteria | 6080362 |
| 1429 | 2984291378 | 2984286254 | Bacteria | 6702062 |
| 1430 | 2988730617 | 2988728565 | Bacteria | 6124362 |
| 1431 | 2990200718 | 2990196909 | Bacteria | 4054280 |
| 1432 | 2998141026 | 2998139840 | Bacteria | 6073514 |
| 1433 | 3007256056 | 3007252601 | Bacteria | 4559114 |
| 1434 | 3007319869 | 3007315729 | Bacteria | 5076637 |
| 1435 | 3007400183 | 3007395558 | Bacteria | 6755444 |
| 1436 | 3007516356 | 3007511990 | Bacteria | 6481491 |
| 1437 | 3007616510 | 3007614139 | Bacteria | 6053559 |
| 1438 | 3007623217 | 3007619802 | Bacteria | 6411688 |
| 1439 | 3007719772 | 3007718800 | Bacteria | 5971527 |
| 1440 | 3007860912 | 3007855910 | Bacteria | 5637581 |
| 1441 | 3007863751 | 3007861166 | Bacteria | 6045338 |
| 1442 | 3007867635 | 3007866637 | Bacteria | 5899198 |
| 1443 | 637318398 | 637000220 | Bacteria | 7074893 |
| 1444 | 640489017 | 640427133 | Bacteria | 4567418 |
| 1445 | 651177107 | 651053060 | Bacteria | 4689946 |
| 1446 | 8011353765 | 8011350971 | Bacteria | 6158957 |
| 1447 | 8015688888 | 8015687852 | Bacteria | 6613826 |
| 1448 | 8019772427 | 8019769354 | Bacteria | 6924660 |
| 1449 | 8019776596 | 8019775933 | Bacteria | 6858656 |
| 1450 | 8029999735 | 8029995093 | Bacteria | 5990776 |
| 1451 | 8034964262 | 8034962539 | Bacteria | 4884839 |
| 1452 | 8054290476 | 8054285046 | Bacteria | 6919322 |
| 1453 | 8054504571 | 8054503363 | Bacteria | 6101651 |
| 1454 | 8055772006 | 8055770955 | Bacteria | 6827675 |
| 1455 | 8055819011 | 8055817908 | Bacteria | 6609162 |
| 1456 | 8056130810 | 8056125926 | Bacteria | 6228218 |
| 1457 | 8056132882 | 8056131705 | Bacteria | 6107031 |
| 1458 | 8056144374 | 8056143049 | Bacteria | 6307666 |
| 1459 | 8056155613 | 8056155041 | Bacteria | 6486948 |
| 1460 | 8056161241 | 8056161164 | Bacteria | 6106669 |
| 1461 | 8056170026 | 8056166840 | Bacteria | 5820959 |
| 1462 | 8056176157 | 8056172158 | Bacteria | 6133900 |
| 1463 | 8056183425 | 8056177738 | Bacteria | 6748268 |
| 1464 | 8056569677 | 8056569372 | Bacteria | 5997322 |
| 1465 | 8057803295 | 8057798959 | Bacteria | 6713499 |
| 1466 | Ga0495610_0001039 | |||
| 1467 | MRS2a_Contig_63 | |||
| 1468 | MRS2a_Contig_7600 | |||
| 1469 | MRS2a_Contig_8476 | |||
| 1470 | MRS2a_Contig_9215 | |||
| 1471 | SwRhRL2b_contig_2219553 | |||
| 1472 | MRS1b_contig_129378 | |||
| 1473 | JGI24740J21852_10001732 | |||
| 1474 | JGI24740J21852_10002050 | |||
| 1475 | JGI25156J39149_1001376 | |||
| 1476 | JGI25162J39368_1000101 | |||
| 1477 | JGI25162J39368_1000200 | |||
| 1478 | JGI25154J39366_1000385 | |||
| 1479 | JGI25163J39215_1000804 | |||
| 1480 | JGI25163J39215_1000908 | |||
| 1481 | JGI25164J39214_1000097 | |||
| 1482 | JGI25164J39214_1000162 | |||
| 1483 | JGI25165J46597_1000184 | |||
| 1484 | JGI25165J46597_1000294 | |||
| 1485 | Ga0055539_1000071 | |||
| 1486 | Ga0055533_1000904 | |||
| 1487 | Ga0055533_1003773 | |||
| 1488 | Ga0055533_1009276 | |||
| 1489 | Ga0055532_1000019 | |||
| 1490 | Ga0055525_1000403 | |||
| 1491 | Ga0055527_1000991 | |||
| 1492 | Ga0055535_1000014 | |||
| 1493 | Ga0055542_1000924 | |||
| 1494 | Ga0055529_1000096 | |||
| 1495 | Ga0055536_1000062 | |||
| 1496 | Ga0055536_1001861 | |||
| 1497 | Ga0055536_1001903 | |||
| 1498 | Ga0055530_10000489 | |||
| 1499 | Ga0055530_10004633 | |||
| 1500 | Ga0055530_10004650 | |||
| 1501 | Ga0055540_1000517 | |||
| 1502 | Ga0055540_1001945 | |||
| 1503 | Ga0055540_1001985 | |||
| 1504 | Ga0055531_10003116 | |||
| 1505 | Ga0055541_1000242 | |||
| 1506 | Ga0055541_1004405 | |||
| 1507 | Ga0055541_1012093 | |||
| 1508 | Ga0055541_1012407 | |||
| 1509 | Ga0065714_10008671 | |||
| 1510 | Ga0065714_10031591 | |||
| 1511 | Ga0065714_10066928 | |||
| 1512 | Ga0065714_10068668 | |||
| 1513 | Ga0065714_10072823 | |||
| 1514 | Ga0065704_10074287 | |||
| 1515 | Ga0065712_10001642 | |||
| 1516 | Ga0065712_10068146 | |||
| 1517 | Ga0065715_10117220 | |||
| 1518 | Ga0070670_100015268 | |||
| 1519 | Ga0070661_100000268 | |||
| 1520 | Ga0070661_100019768 | |||
| 1521 | Ga0070669_100000159 | |||
| 1522 | Ga0070669_100010573 | |||
| 1523 | Ga0070659_100001771 | |||
| 1524 | Ga0070662_100000135 | |||
| 1525 | Ga0068853_100007167 | |||
| 1526 | Ga0070664_100000005 | |||
| 1527 | Ga0070664_100026608 | |||
| 1528 | Ga0070664_100220303 | |||
| 1529 | Ga0068857_100002560 | |||
| 1530 | Ga0068854_100000076 | |||
| 1531 | Ga0068854_100062350 | |||
| 1532 | Ga0068856_100000531 | |||
| 1533 | Ga0068851_10000006 | |||
| 1534 | Ga0075364_10079847 | |||
| 1535 | Ga0075432_10002347 | |||
| 1536 | Ga0075432_10002845 | |||
| 1537 | Ga0075432_10029007 | |||
| 1538 | Ga0075432_10037104 | |||
| 1539 | Ga0075432_10087029 | |||
| 1540 | Ga0075432_10093955 | |||
| 1541 | Ga0075362_10019688 | |||
| 1542 | Ga0075436_100059652 | |||
| 1543 | Ga0075436_100190920 | |||
| 1544 | Ga0075436_100268586 | |||
| 1545 | Ga0079104_1000168 | |||
| 1546 | Ga0079104_1002966 | |||
| 1547 | Ga0099826_10020343 | |||
| 1548 | Ga0105251_10000012 | |||
| 1549 | Ga0105251_10000767 | |||
| 1550 | Ga0105251_10002979 | |||
| 1551 | Ga0105251_10008214 | |||
| 1552 | Ga0105251_10010191 | |||
| 1553 | Ga0105251_10047851 | |||
| 1554 | Ga0105251_10090853 | |||
| 1555 | Ga0105251_10128043 | |||
| 1556 | Ga0105251_10143315 | |||
| 1557 | Ga0105244_10001581 | |||
| 1558 | Ga0105244_10013121 | |||
| 1559 | Ga0105244_10014063 | |||
| 1560 | Ga0105244_10017288 | |||
| 1561 | Ga0105244_10022697 | |||
| 1562 | Ga0105244_10024063 | |||
| 1563 | Ga0105244_10042057 | |||
| 1564 | Ga0105244_10051806 | |||
| 1565 | Ga0105244_10058560 | |||
| 1566 | Ga0105244_10072796 | |||
| 1567 | Ga0105244_10092013 | |||
| 1568 | Ga0105244_10093355 | |||
| 1569 | Ga0105244_10153023 | |||
| 1570 | Ga0105244_10153089 | |||
| 1571 | Ga0105250_10000356 | |||
| 1572 | Ga0105250_10000928 | |||
| 1573 | Ga0105250_10004354 | |||
| 1574 | Ga0105250_10011113 | |||
| 1575 | Ga0105250_10034045 | |||
| 1576 | Ga0105250_10058531 | |||
| 1577 | Ga0105250_10075130 | |||
| 1578 | Ga0105240_10051969 | |||
| 1579 | Ga0105243_10000183 | |||
| 1580 | Ga0105243_10000459 | |||
| 1581 | Ga0105243_10006410 | |||
| 1582 | Ga0105243_10026002 | |||
| 1583 | Ga0105243_10063503 | |||
| 1584 | Ga0105243_10130031 | |||
| 1585 | Ga0105248_10139144 | |||
| 1586 | Ga0105237_10008757 | |||
| 1587 | Ga0105246_10000832 | |||
| 1588 | Ga0105246_10005266 | |||
| 1589 | Ga0105246_10028754 | |||
| 1590 | Ga0105246_10043300 | |||
| 1591 | Ga0157336_1000928 | |||
| 1592 | Ga0157373_10001669 | |||
| 1593 | Ga0157373_10001920 | |||
| 1594 | Ga0157373_10003849 | |||
| 1595 | Ga0157373_10004545 | |||
| 1596 | Ga0157373_10006350 | |||
| 1597 | Ga0157373_10009214 | |||
| 1598 | Ga0157373_10010034 | |||
| 1599 | Ga0157373_10013519 | |||
| 1600 | Ga0157373_10060853 | |||
| 1601 | Ga0157373_10126130 | |||
| 1602 | Ga0157373_10131730 | |||
| 1603 | Ga0157371_10000171 | |||
| 1604 | Ga0157371_10000319 | |||
| 1605 | Ga0157371_10005255 | |||
| 1606 | Ga0157371_10011855 | |||
| 1607 | Ga0157370_10000052 | |||
| 1608 | Ga0157370_10000109 | |||
| 1609 | Ga0157370_10044723 | |||
| 1610 | Ga0157370_10045775 | |||
| 1611 | Ga0157370_10060110 | |||
| 1612 | Ga0157370_10140016 | |||
| 1613 | Ga0157370_10165217 | |||
| 1614 | Ga0157370_10209017 | |||
| 1615 | Ga0157370_10262393 | |||
| 1616 | Ga0157370_10281180 | |||
| 1617 | Ga0157370_10451913 | |||
| 1618 | Ga0157369_10002842 | |||
| 1619 | Ga0157369_10003903 | |||
| 1620 | Ga0157369_10014888 | |||
| 1621 | Ga0157369_10021855 | |||
| 1622 | Ga0157369_10034317 | |||
| 1623 | Ga0157369_10045551 | |||
| 1624 | Ga0157369_10120909 | |||
| 1625 | Ga0163162_10007494 | |||
| 1626 | Ga0163162_10015463 | |||
| 1627 | Ga0163162_10212716 | |||
| 1628 | Ga0157372_10000089 | |||
| 1629 | Ga0157372_10031504 | |||
| 1630 | Ga0157375_10004512 | |||
| 1631 | Ga0157375_10067676 | |||
| 1632 | Ga0157375_10077803 | |||
| 1633 | Ga0157375_10169166 | |||
| 1634 | Ga0157375_10216421 | |||
| 1635 | Ga0182008_10001175 | |||
| 1636 | Ga0182008_10001436 | |||
| 1637 | Ga0182008_10002061 | |||
| 1638 | Ga0182008_10003202 | |||
| 1639 | Ga0182008_10005740 | |||
| 1640 | Ga0182008_10010035 | |||
| 1641 | Ga0182008_10010843 | |||
| 1642 | Ga0182008_10038834 | |||
| 1643 | Ga0182008_10100536 | |||
| 1644 | Ga0182006_1000892 | |||
| 1645 | Ga0182006_1003207 | |||
| 1646 | Ga0182006_1004435 | |||
| 1647 | Ga0182006_1010630 | |||
| 1648 | Ga0182006_1010926 | |||
| 1649 | Ga0182006_1014708 | |||
| 1650 | Ga0182006_1057469 | |||
| 1651 | Ga0182007_10000649 | |||
| 1652 | Ga0182007_10003856 | |||
| 1653 | Ga0182007_10029382 | |||
| 1654 | Ga0182007_10079365 | |||
| 1655 | Ga0182005_1002339 | |||
| 1656 | Ga0182005_1006257 | |||
| 1657 | Ga0182005_1017402 | |||
| 1658 | Ga0182005_1019952 | |||
| 1659 | Ga0182005_1032439 | |||
| 1660 | Ga0163161_10006251 | |||
| 1661 | Ga0163161_10024484 | |||
| 1662 | Ga0163161_10025309 | |||
| 1663 | Ga0163161_10032439 | |||
| 1664 | Ga0163161_10063338 | |||
| 1665 | Ga0163161_10065959 | |||
| 1666 | Ga0163161_10109035 | |||
| 1667 | Ga0163161_10134110 | |||
| 1668 | Ga0206351_10843817 | |||
| 1669 | Ga0154015_1646313 | |||
| 1670 | Ga0209760_100124 | |||
| 1671 | Ga0209760_100204 | |||
| 1672 | Ga0209784_100003 | |||
| 1673 | Ga0209784_101415 | |||
| 1674 | Ga0209566_100002 | |||
| 1675 | Ga0209566_100819 | |||
| 1676 | Ga0209566_103211 | |||
| 1677 | Ga0209566_106905 | |||
| 1678 | Ga0209674_100008 | |||
| 1679 | Ga0209674_100245 | |||
| 1680 | Ga0209674_107875 | |||
| 1681 | Ga0209672_100154 | |||
| 1682 | Ga0209147_100002 | |||
| 1683 | Ga0209563_100004 | |||
| 1684 | Ga0209563_112611 | |||
| 1685 | Ga0207427_100001 | |||
| 1686 | Ga0207427_100004 | |||
| 1687 | Ga0209437_100003 | |||
| 1688 | Ga0209437_100028 | |||
| 1689 | Ga0209258_100002 | |||
| 1690 | Ga0209646_1000194 | |||
| 1691 | Ga0209026_1004619 | |||
| 1692 | Ga0209677_100009 | |||
| 1693 | Ga0209677_103004 | |||
| 1694 | Ga0209148_1000350 | |||
| 1695 | Ga0209148_1003157 | |||
| 1696 | Ga0209759_1001877 | |||
| 1697 | Ga0209759_1013151 | |||
| 1698 | Ga0209759_1030935 | |||
| 1699 | Ga0209233_1000007 | |||
| 1700 | Ga0209233_1000008 | |||
| 1701 | Ga0209455_1000076 | |||
| 1702 | Ga0209675_1024800 | |||
| 1703 | Ga0209676_1000056 | |||
| 1704 | Ga0209676_1000078 | |||
| 1705 | Ga0209676_1000101 | |||
| 1706 | Ga0209676_1005061 | |||
| 1707 | Ga0209676_1018079 | |||
| 1708 | Ga0209050_1000027 | |||
| 1709 | Ga0209050_1000041 | |||
| 1710 | Ga0209050_1000181 | |||
| 1711 | Ga0209050_1000425 | |||
| 1712 | Ga0209051_1000061 | |||
| 1713 | Ga0209051_1000065 | |||
| 1714 | Ga0209051_1000085 | |||
| 1715 | Ga0209051_1008386 | |||
| 1716 | Ga0209257_1000105 | |||
| 1717 | Ga0209257_1005448 | |||
| 1718 | Ga0207656_10000023 | |||
| 1719 | Ga0207696_1000032 | |||
| 1720 | Ga0207696_1000112 | |||
| 1721 | Ga0207696_1000121 | |||
| 1722 | Ga0207696_1003278 | |||
| 1723 | Ga0207696_1008719 | |||
| 1724 | Ga0207696_1034466 | |||
| 1725 | Ga0207696_1046593 | |||
| 1726 | Ga0207655_1000021 | |||
| 1727 | Ga0207655_1000086 | |||
| 1728 | Ga0207655_1000204 | |||
| 1729 | Ga0207655_1001245 | |||
| 1730 | Ga0207655_1010222 | |||
| 1731 | Ga0207655_1010903 | |||
| 1732 | Ga0207655_1013474 | |||
| 1733 | Ga0207655_1023894 | |||
| 1734 | Ga0207655_1027084 | |||
| 1735 | Ga0207655_1028286 | |||
| 1736 | Ga0207655_1041284 | |||
| 1737 | Ga0207655_1041617 | |||
| 1738 | Ga0207655_1059943 | |||
| 1739 | Ga0207655_1070185 | |||
| 1740 | Ga0207713_1000068 | |||
| 1741 | Ga0207713_1000080 | |||
| 1742 | Ga0207713_1000404 | |||
| 1743 | Ga0207713_1002781 | |||
| 1744 | Ga0207713_1007775 | |||
| 1745 | Ga0207713_1007795 | |||
| 1746 | Ga0207713_1010571 | |||
| 1747 | Ga0207713_1014869 | |||
| 1748 | Ga0207713_1016486 | |||
| 1749 | Ga0207713_1024803 | |||
| 1750 | Ga0207713_1030196 | |||
| 1751 | Ga0207713_1032680 | |||
| 1752 | Ga0207713_1032783 | |||
| 1753 | Ga0207713_1084583 | |||
| 1754 | Ga0207695_10000558 | |||
| 1755 | Ga0207671_10000019 | |||
| 1756 | Ga0207649_10000004 | |||
| 1757 | Ga0207649_10000313 | |||
| 1758 | Ga0207649_10135599 | |||
| 1759 | Ga0207681_10000282 | |||
| 1760 | Ga0207681_10022116 | |||
| 1761 | Ga0207650_10000183 | |||
| 1762 | Ga0207650_10000263 | |||
| 1763 | Ga0207690_10001333 | |||
| 1764 | Ga0207706_10000330 | |||
| 1765 | Ga0207686_10001886 | |||
| 1766 | Ga0207709_10000067 | |||
| 1767 | Ga0207709_10000396 | |||
| 1768 | Ga0207709_10003458 | |||
| 1769 | Ga0207709_10011283 | |||
| 1770 | Ga0207709_10191129 | |||
| 1771 | Ga0207711_10101268 | |||
| 1772 | Ga0207679_10000019 | |||
| 1773 | Ga0207679_10000020 | |||
| 1774 | Ga0207712_10018559 | |||
| 1775 | Ga0207640_10000017 | |||
| 1776 | Ga0207640_10123021 | |||
| 1777 | Ga0207639_10103592 | |||
| 1778 | Ga0207678_10000008 | |||
| 1779 | Ga0207702_10000017 | |||
| 1780 | Ga0207674_10012829 | |||
| 1781 | Ga0209281_1000015 | |||
| 1782 | Ga0209281_1000049 | |||
| 1783 | Ga0209281_1015626 | |||
| 1784 | Ga0209281_1015629 | |||
| 1785 | Ga0209371_1001949 | |||
| 1786 | Ga0209983_1000877 | |||
| 1787 | Ga0209282_1028825 | |||
| 1788 | Ga0209971_1000680 | |||
| 1789 | Ga0209974_10001542 | |||
| 1790 | Ga0207428_10005554 | |||
| 1791 | Ga0207428_10011978 | |||
| 1792 | Ga0207428_10035455 | |||
| 1793 | Ga0207428_10039252 | |||
| 1794 | Ga0207428_10104670 | |||
| 1795 | Ga0207428_10209697 | |||
| 1796 | Ga0268266_10023410 | |||
| 1797 | Ga0307517_10102932 | |||
| 1798 | Ga0268256_1004045 | |||
| 1799 | Ga0307511_10041531 | |||
| 1800 | Ga0316178_1042169 | |||
| 1801 | Ga0316181_1063451 | |||
| 1802 | Ga0265316_10214884 | |||
| 1803 | Ga0307408_100020283 | |||
| 1804 | Ga0307408_100026113 | |||
| 1805 | Ga0307408_100106380 | |||
| 1806 | Ga0307405_10000212 | |||
| 1807 | Ga0307405_10018714 | |||
| 1808 | Ga0307405_10050264 | |||
| 1809 | Ga0307413_10115518 | |||
| 1810 | Ga0307406_10010340 | |||
| 1811 | Ga0307407_10036621 | |||
| 1812 | Ga0307407_10127854 | |||
| 1813 | Ga0307412_10001040 | |||
| 1814 | Ga0307412_10011645 | |||
| 1815 | Ga0307412_10013075 | |||
| 1816 | Ga0307412_10017203 | |||
| 1817 | Ga0307412_10203987 | |||
| 1818 | Ga0307412_10357038 | |||
| 1819 | Ga0307409_100024432 | |||
| 1820 | Ga0307416_100146784 | |||
| 1821 | Ga0307416_100170010 | |||
| 1822 | Ga0307414_10131360 | |||
| 1823 | Ga0307414_10199126 | |||
| 1824 | Ga0307414_10221958 | |||
| 1825 | Ga0307414_10237599 | |||
| 1826 | Ga0307411_10007338 | |||
| 1827 | Ga0307510_10056944 | |||
| 1828 | Ga0307510_10057442 | |||
| 1829 | Ga0439438_001121 | |||
| 1830 | Ga0439438_001828 | |||
| 1831 | Ga0439438_002832 | |||
| 1832 | Ga0439438_003232 | |||
| 1833 | Ga0439438_003588 | |||
| 1834 | Ga0439438_004154 | |||
| 1835 | Ga0439438_007172 | |||
| 1836 | Ga0439438_019612 | |||
| 1837 | Ga0439447_002588 | |||
| 1838 | Ga0439447_002664 | |||
| 1839 | Ga0439447_003104 | |||
| 1840 | Ga0439447_008054 | |||
| 1841 | Ga0439447_008080 | |||
| 1842 | Ga0439447_014393 | |||
| 1843 | Ga0439447_030459 | |||
| 1844 | Ga0439466_0001533 | |||
| 1845 | Ga0439466_0004091 | |||
| 1846 | Ga0439466_0004898 | |||
| 1847 | Ga0439466_0009457 | |||
| 1848 | Ga0439466_0009614 | |||
| 1849 | Ga0439466_0012866 | |||
| 1850 | Ga0439466_0013922 | |||
| 1851 | Ga0439466_0018521 | |||
| 1852 | Ga0439466_0023515 | |||
| 1853 | Ga0439466_0029613 | |||
| 1854 | Ga0439466_0034057 | |||
| 1855 | Ga0439466_0038307 | |||
| 1856 | Ga0439465_0005299 | |||
| 1857 | Ga0439431_0000967 | |||
| 1858 | Ga0439437_000266 | |||
| 1859 | Ga0439445_0006028 | |||
| 1860 | Ga0439445_0012411 | |||
| 1861 | Ga0439432_000106 | |||
| 1862 | Ga0439432_001165 | |||
| 1863 | Ga0439432_009624 | |||
| 1864 | Ga0439432_011350 | |||
| 1865 | Ga0439432_011753 | |||
| 1866 | Ga0439432_040609 | |||
| 1867 | Ga0439451_001256 | |||
| 1868 | Ga0439451_001861 | |||
| 1869 | Ga0439451_008649 | |||
| 1870 | Ga0439451_011339 | |||
| 1871 | Ga0439452_000784 | |||
| 1872 | Ga0439452_000955 | |||
| 1873 | Ga0439452_001029 | |||
| 1874 | Ga0439452_001826 | |||
| 1875 | Ga0439452_002239 | |||
| 1876 | Ga0439452_002905 | |||
| 1877 | Ga0439452_003204 | |||
| 1878 | Ga0439452_004464 | |||
| 1879 | Ga0439456_007591 | |||
| 1880 | Ga0439456_022403 | |||
| 1881 | Ga0439456_033552 | |||
| 1882 | Ga0439463_000269 | |||
| 1883 | Ga0439463_001421 | |||
| 1884 | Ga0439463_003108 | |||
| 1885 | Ga0439463_003879 | |||
| 1886 | Ga0439463_005159 | |||
| 1887 | Ga0439463_006998 | |||
| 1888 | Ga0439463_046562 | |||
| 1889 | Ga0450911_000005 | |||
| 1890 | Ga0450911_000880 | |||
| 1891 | Ga0450911_001080 | |||
| 1892 | Ga0450911_001265 | |||
| 1893 | Ga0450919_001359 | |||
| 1894 | Ga0450920_005488 | |||
| 1895 | Ga0450922_000342 | |||
| 1896 | Ga0450923_003840 | |||
| 1897 | Ga0450890_000192 | |||
| 1898 | Ga0450894_002988 | |||
| 1899 | Ga0450898_011921 | |||
| 1900 | Ga0450902_006140 | |||
| 1901 | Ga0450902_008484 | |||
| 1902 | Ga0450903_000296 | |||
| 1903 | Ga0450903_003862 | |||
| 1904 | Ga0450903_004164 | |||
| 1905 | Ga0450903_007199 | |||
| 1906 | Ga0450903_008766 | |||
| 1907 | Ga0450903_009409 | |||
| 1908 | Ga0450904_000094 | |||
| 1909 | Ga0450904_003142 | |||
| 1910 | Ga0450905_017127 | |||
| 1911 | Ga0450906_000913 | |||
| 1912 | Ga0450906_001507 | |||
| 1913 | Ga0450906_001865 | |||
| 1914 | Ga0450907_000898 | |||
| 1915 | Ga0450907_003481 | |||
| 1916 | Ga0450907_017801 | |||
| 1917 | Ga0450910_003370 | |||
| 1918 | Ga0439446_0002380 | |||
| 1919 | Ga0439446_0015633 | |||
| 1920 | Ga0439446_0031521 | |||
| 1921 | Ga0450908_014756 | |||
| 1922 | Ga0450909_000121 | |||
| 1923 | Ga0450909_001076 | |||
| 1924 | Ga0439434_0001528 | |||
| 1925 | Ga0439434_0020920 | |||
| 1926 | Ga0439434_0056306 | |||
| 1927 | Ga0439459_0000354 | |||
| 1928 | Ga0439464_0000592 | |||
| 1929 | Ga0439464_0017580 | |||
| 1930 | Ga0439464_0027980 | |||
| 1931 | Ga0439460_0000258 | |||
| 1932 | Ga0439460_0015655 | |||
| 1933 | Ga0450916_001870 | |||
| 1934 | Ga0450918_001258 | |||
| 1935 | Ga0450918_015999 | |||
| 1936 | Ga0450918_025713 | |||
| 1937 | Ga0450893_0002244 | |||
| 1938 | Ga0450893_0006047 | |||
| 1939 | Ga0450893_0006113 | |||
| 1940 | Ga0450901_001259 | |||
| 1941 | Ga0439440_0000483 | |||
| 1942 | Ga0439440_0008172 | |||
| 1943 | Ga0466986_0190082 | |||
| 1944 | Ga0466969_0040195 | |||
| 1945 | Ga0466972_0099286 | |||
| 1946 | Ga0466978_0173802 | |||
| 1947 | Ga0466982_0142029 | |||
| 1948 | Ga0466965_0105241 | |||
| 1949 | Ga0466961_0000059 | |||
| 1950 | Ga0466964_0073366 | |||
| 1951 | Ga0466968_0019088 | |||
| 1952 | Ga0466970_0009239 | |||
| 1953 | Ga0466959_0002989 | |||
| 1954 | Ga0495617_001779 | |||
| 1955 | Ga0495617_003182 | |||
| 1956 | Ga0495617_005694 | |||
| 1957 | Ga0495617_005982 | |||
| 1958 | Ga0495617_019715 | |||
| 1959 | Ga0495617_021852 | |||
| 1960 | Ga0495617_038252 | |||
| 1961 | Ga0495617_039800 | |||
| 1962 | Ga0495617_047275 | |||
| 1963 | Ga0495627_000047 | |||
| 1964 | Ga0495627_001232 | |||
| 1965 | Ga0495627_001589 | |||
| 1966 | Ga0495627_002170 | |||
| 1967 | Ga0495627_005510 | |||
| 1968 | Ga0495627_006328 | |||
| 1969 | Ga0495627_006555 | |||
| 1970 | Ga0495627_007036 | |||
| 1971 | Ga0495592_0138460 | |||
| 1972 | Ga0495603_0012608 | |||
| 1973 | Ga0495603_0015660 | |||
| 1974 | Ga0495590_0003955 | |||
| 1975 | Ga0495590_0004327 | |||
| 1976 | Ga0495590_0004645 | |||
| 1977 | Ga0495590_0009320 | |||
| 1978 | Ga0495590_0029979 | |||
| 1979 | Ga0495590_0040533 | |||
| 1980 | Ga0495590_0051313 | |||
| 1981 | Ga0495590_0061195 | |||
| 1982 | Ga0495591_000019 | |||
| 1983 | Ga0495591_000570 | |||
| 1984 | Ga0495591_000681 | |||
| 1985 | Ga0495591_000843 | |||
| 1986 | Ga0495591_001827 | |||
| 1987 | Ga0495591_002514 | |||
| 1988 | Ga0495591_002858 | |||
| 1989 | Ga0495591_003534 | |||
| 1990 | Ga0495591_004567 | |||
| 1991 | Ga0495591_004583 | |||
| 1992 | Ga0495591_005863 | |||
| 1993 | Ga0495591_006486 | |||
| 1994 | Ga0495591_009324 | |||
| 1995 | Ga0495591_010033 | |||
| 1996 | Ga0495591_010358 | |||
| 1997 | Ga0495591_011899 | |||
| 1998 | Ga0495591_016365 | |||
| 1999 | Ga0495591_020438 | |||
| 2000 | Ga0495591_029759 | |||
| 2001 | Ga0495638_0001864 | |||
| 2002 | Ga0495638_0003969 | |||
| 2003 | Ga0495638_0010064 | |||
| 2004 | Ga0495638_0010914 | |||
| 2005 | Ga0495638_0011016 | |||
| 2006 | Ga0495638_0013866 | |||
| 2007 | Ga0495638_0017765 | |||
| 2008 | Ga0495638_0019625 | |||
| 2009 | Ga0495638_0028737 | |||
| 2010 | Ga0495638_0074568 | |||
| 2011 | Ga0495638_0074627 | |||
| 2012 | Ga0495638_0082033 | |||
| 2013 | Ga0495653_0011147 | |||
| 2014 | Ga0495653_0016061 | |||
| 2015 | Ga0495653_0018482 | |||
| 2016 | Ga0495653_0021284 | |||
| 2017 | Ga0495653_0040945 | |||
| 2018 | Ga0495650_0000346 | |||
| 2019 | Ga0495650_0003892 | |||
| 2020 | Ga0495650_0004844 | |||
| 2021 | Ga0495650_0006270 | |||
| 2022 | Ga0495650_0008165 | |||
| 2023 | Ga0495650_0008551 | |||
| 2024 | Ga0495650_0009161 | |||
| 2025 | Ga0495650_0009888 | |||
| 2026 | Ga0495650_0010656 | |||
| 2027 | Ga0495650_0016786 | |||
| 2028 | Ga0495650_0032772 | |||
| 2029 | Ga0495650_0035652 | |||
| 2030 | Ga0495650_0103339 | |||
| 2031 | Ga0495582_0008121 | |||
| 2032 | Ga0495605_0000014 | |||
| 2033 | Ga0495605_0000030 | |||
| 2034 | Ga0495605_0001397 | |||
| 2035 | Ga0495605_0001660 | |||
| 2036 | Ga0495605_0002018 | |||
| 2037 | Ga0495605_0006312 | |||
| 2038 | Ga0495605_0007118 | |||
| 2039 | Ga0495605_0011520 | |||
| 2040 | Ga0495605_0013104 | |||
| 2041 | Ga0495605_0025251 | |||
| 2042 | Ga0495605_0034586 | |||
| 2043 | Ga0495605_0085292 | |||
| 2044 | Ga0495605_0114225 | |||
| 2045 | Ga0495605_0118113 | |||
| 2046 | Ga0495639_0001317 | |||
| 2047 | Ga0495584_0003304 | |||
| 2048 | Ga0495584_0004589 | |||
| 2049 | Ga0495584_0004810 | |||
| 2050 | Ga0495584_0005395 | |||
| 2051 | Ga0495584_0006599 | |||
| 2052 | Ga0495584_0007687 | |||
| 2053 | Ga0495584_0012688 | |||
| 2054 | Ga0495584_0014898 | |||
| 2055 | Ga0495584_0015531 | |||
| 2056 | Ga0495584_0016467 | |||
| 2057 | Ga0495584_0038875 | |||
| 2058 | Ga0495584_0041807 | |||
| 2059 | Ga0495584_0046818 | |||
| 2060 | Ga0495584_0063249 | |||
| 2061 | Ga0495584_0104375 | |||
| 2062 | Ga0495584_0230489 | |||
| 2063 | Ga0495585_0002784 | |||
| 2064 | Ga0495585_0005886 | |||
| 2065 | Ga0495585_0006685 | |||
| 2066 | Ga0495585_0007781 | |||
| 2067 | Ga0495585_0007881 | |||
| 2068 | Ga0495585_0009007 | |||
| 2069 | Ga0495585_0009029 | |||
| 2070 | Ga0495585_0012525 | |||
| 2071 | Ga0495585_0016057 | |||
| 2072 | Ga0495585_0050408 | |||
| 2073 | Ga0495585_0059965 | |||
| 2074 | Ga0495585_0115609 | |||
| 2075 | Ga0495585_0161959 | |||
| 2076 | Ga0495594_0003265 | |||
| 2077 | Ga0495594_0008450 | |||
| 2078 | Ga0495594_0014824 | |||
| 2079 | Ga0495594_0015019 | |||
| 2080 | Ga0495594_0015459 | |||
| 2081 | Ga0495596_0002692 | |||
| 2082 | Ga0495596_0003606 | |||
| 2083 | Ga0495607_0000393 | |||
| 2084 | Ga0495607_0001642 | |||
| 2085 | Ga0495607_0002564 | |||
| 2086 | Ga0495607_0002577 | |||
| 2087 | Ga0495607_0005672 | |||
| 2088 | Ga0495607_0005848 | |||
| 2089 | Ga0495607_0007337 | |||
| 2090 | Ga0495607_0007535 | |||
| 2091 | Ga0495607_0007896 | |||
| 2092 | Ga0495607_0008266 | |||
| 2093 | Ga0495607_0009095 | |||
| 2094 | Ga0495607_0010156 | |||
| 2095 | Ga0495607_0011587 | |||
| 2096 | Ga0495607_0013370 | |||
| 2097 | Ga0495607_0019462 | |||
| 2098 | Ga0495607_0037150 | |||
| 2099 | Ga0495607_0041795 | |||
| 2100 | Ga0495607_0042340 | |||
| 2101 | Ga0495607_0056394 | |||
| 2102 | Ga0495607_0060419 | |||
| 2103 | Ga0495607_0067853 | |||
| 2104 | Ga0495607_0085822 | |||
| 2105 | Ga0495607_0086193 | |||
| 2106 | Ga0495583_0000066 | |||
| 2107 | Ga0495583_0001212 | |||
| 2108 | Ga0495583_0002340 | |||
| 2109 | Ga0495583_0002432 | |||
| 2110 | Ga0495583_0003113 | |||
| 2111 | Ga0495583_0003288 | |||
| 2112 | Ga0495583_0004266 | |||
| 2113 | Ga0495583_0007586 | |||
| 2114 | Ga0495583_0024403 | |||
| 2115 | Ga0495583_0028804 | |||
| 2116 | Ga0495583_0058249 | |||
| 2117 | Ga0495606_0000086 | |||
| 2118 | Ga0495606_0000700 | |||
| 2119 | Ga0495606_0002176 | |||
| 2120 | Ga0495606_0002418 | |||
| 2121 | Ga0495606_0003245 | |||
| 2122 | Ga0495606_0004082 | |||
| 2123 | Ga0495606_0004561 | |||
| 2124 | Ga0495606_0009036 | |||
| 2125 | Ga0495606_0011104 | |||
| 2126 | Ga0495606_0012863 | |||
| 2127 | Ga0495606_0013431 | |||
| 2128 | Ga0495606_0014339 | |||
| 2129 | Ga0495606_0021865 | |||
| 2130 | Ga0495606_0027532 | |||
| 2131 | Ga0495606_0056444 | |||
| 2132 | Ga0495606_0076381 | |||
| 2133 | Ga0495606_0111761 | |||
| 2134 | Ga0495606_0156761 | |||
| 2135 | Ga0495610_0003257 | |||
| 2136 | Ga0495610_0003324 | |||
| 2137 | Ga0495610_0007864 | |||
| 2138 | Ga0495610_0010242 | |||
| 2139 | Ga0495610_0010433 | |||
| 2140 | Ga0495610_0013656 | |||
| 2141 | Ga0495610_0014647 | |||
| 2142 | Ga0495610_0014863 | |||
| 2143 | Ga0495610_0028145 | |||
| 2144 | Ga0495610_0075760 | |||
| 2145 | Ga0495610_0108125 | |||
| 2146 | Ga0495610_0111047 | |||
| 2147 | Ga0495616_0001528 | |||
| 2148 | Ga0495616_0008273 | |||
| 2149 | Ga0495616_0008728 | |||
| 2150 | Ga0495616_0008742 | |||
| 2151 | Ga0495616_0008937 | |||
| 2152 | Ga0495616_0015883 | |||
| 2153 | Ga0495616_0016830 | |||
| 2154 | Ga0495616_0031112 | |||
| 2155 | Ga0495616_0058701 | |||
| 2156 | Ga0495616_0066383 | |||
| 2157 | Ga0495616_0068448 | |||
| 2158 | Ga0495616_0073200 | |||
| 2159 | Ga0495616_0110357 | |||
| 2160 | Ga0495616_0152519 | |||
| 2161 | Ga0495616_0161618 | |||
| 2162 | Ga0495620_0000100 | |||
| 2163 | Ga0495620_0001131 | |||
| 2164 | Ga0495620_0001879 | |||
| 2165 | Ga0495620_0002082 | |||
| 2166 | Ga0495620_0002823 | |||
| 2167 | Ga0495620_0005339 | |||
| 2168 | Ga0495620_0006205 | |||
| 2169 | Ga0495620_0014150 | |||
| 2170 | Ga0495620_0015037 | |||
| 2171 | Ga0495620_0018397 | |||
| 2172 | Ga0495620_0018474 | |||
| 2173 | Ga0495620_0022888 | |||
| 2174 | Ga0495620_0055537 | |||
| 2175 | Ga0495620_0077360 | |||
| 2176 | Ga0495630_0004946 | |||
| 2177 | Ga0495630_0174707 | |||
| 2178 | Ga0495631_0001639 | |||
| 2179 | Ga0495631_0001654 | |||
| 2180 | Ga0495631_0003624 | |||
| 2181 | Ga0495631_0006102 | |||
| 2182 | Ga0495631_0007478 | |||
| 2183 | Ga0495631_0009213 | |||
| 2184 | Ga0495631_0012070 | |||
| 2185 | Ga0495631_0035128 | |||
| 2186 | Ga0495631_0059471 | |||
| 2187 | Ga0495632_0002127 | |||
| 2188 | Ga0495632_0002473 | |||
| 2189 | Ga0495632_0004354 | |||
| 2190 | Ga0495632_0006055 | |||
| 2191 | Ga0495632_0006212 | |||
| 2192 | Ga0495632_0012913 | |||
| 2193 | Ga0495632_0014162 | |||
| 2194 | Ga0495632_0015030 | |||
| 2195 | Ga0495632_0017643 | |||
| 2196 | Ga0495632_0022244 | |||
| 2197 | Ga0495632_0042310 | |||
| 2198 | Ga0495632_0045642 | |||
| 2199 | Ga0495637_0000024 | |||
| 2200 | Ga0495637_0000780 | |||
| 2201 | Ga0495637_0001915 | |||
| 2202 | Ga0495637_0003908 | |||
| 2203 | Ga0495637_0004000 | |||
| 2204 | Ga0495637_0004673 | |||
| 2205 | Ga0495637_0004949 | |||
| 2206 | Ga0495637_0009241 | |||
| 2207 | Ga0495637_0011150 | |||
| 2208 | Ga0495637_0012279 | |||
| 2209 | Ga0495637_0018972 | |||
| 2210 | Ga0495637_0042516 | |||
| 2211 | Ga0495637_0048804 | |||
| 2212 | Ga0495637_0058468 | |||
| 2213 | Ga0495637_0059032 | |||
| 2214 | Ga0495637_0062771 | |||
| 2215 | Ga0495637_0067868 | |||
| 2216 | Ga0495643_0000445 | |||
| 2217 | Ga0495643_0003410 | |||
| 2218 | Ga0495643_0008577 | |||
| 2219 | Ga0495643_0009960 | |||
| 2220 | Ga0495643_0012074 | |||
| 2221 | Ga0495643_0018810 | |||
| 2222 | Ga0495643_0032955 | |||
| 2223 | Ga0495643_0044303 | |||
| 2224 | Ga0495643_0066721 | |||
| 2225 | Ga0495643_0067724 | |||
| 2226 | Ga0495643_0073661 | |||
| 2227 | Ga0495643_0075199 | |||
| 2228 | Ga0495643_0090945 | |||
| 2229 | Ga0495643_0131451 | |||
| 2230 | Ga0495644_0003299 | |||
| 2231 | Ga0495644_0004182 | |||
| 2232 | Ga0495644_0004776 | |||
| 2233 | Ga0495644_0005027 | |||
| 2234 | Ga0495644_0021429 | |||
| 2235 | Ga0495644_0050933 | |||
| 2236 | Ga0495648_0005461 | |||
| 2237 | Ga0495648_0010159 | |||
| 2238 | Ga0495648_0010448 | |||
| 2239 | Ga0495648_0010671 | |||
| 2240 | Ga0495648_0016167 | |||
| 2241 | Ga0495648_0020465 | |||
| 2242 | Ga0495648_0023587 | |||
| 2243 | Ga0495648_0025524 | |||
| 2244 | Ga0495648_0039792 | |||
| 2245 | Ga0495648_0051554 | |||
| 2246 | Ga0495648_0057219 | |||
| 2247 | Ga0495648_0085952 | |||
| 2248 | Ga0495648_0107473 | |||
| 2249 | Ga0495648_0117609 | |||
| 2250 | Ga0495666_0006538 | |||
| 2251 | Ga0495666_0019398 | |||
| 2252 | Ga0495666_0064475 | |||
| 2253 | Ga0495642_0002796 | |||
| 2254 | Ga0495642_0003063 | |||
| 2255 | Ga0495642_0003489 | |||
| 2256 | Ga0495652_0218609 | |||
| 2257 | Ga0495654_0000650 | |||
| 2258 | Ga0495654_0001846 | |||
| 2259 | Ga0495654_0002233 | |||
| 2260 | Ga0495654_0003575 | |||
| 2261 | Ga0495654_0004115 | |||
| 2262 | Ga0495654_0004291 | |||
| 2263 | Ga0495654_0004950 | |||
| 2264 | Ga0495654_0006036 | |||
| 2265 | Ga0495654_0006189 | |||
| 2266 | Ga0495654_0007200 | |||
| 2267 | Ga0495654_0007223 | |||
| 2268 | Ga0495654_0008121 | |||
| 2269 | Ga0495654_0011347 | |||
| 2270 | Ga0495654_0014981 | |||
| 2271 | Ga0495654_0022255 | |||
| 2272 | Ga0495654_0035952 | |||
| 2273 | Ga0495654_0047138 | |||
| 2274 | Ga0495654_0052946 | |||
| 2275 | Ga0495654_0068980 | |||
| 2276 | Ga0495654_0082918 | |||
| 2277 | Ga0495587_0017511 | |||
| 2278 | Ga0495609_0000006 | |||
| 2279 | Ga0495609_0000024 | |||
| 2280 | Ga0495609_0000040 | |||
| 2281 | Ga0495609_0003829 | |||
| 2282 | Ga0495609_0005854 | |||
| 2283 | Ga0495609_0007930 | |||
| 2284 | Ga0495609_0008020 | |||
| 2285 | Ga0495597_0000010 | |||
| 2286 | Ga0495597_0005703 | |||
| 2287 | Ga0495597_0008036 | |||
| 2288 | Ga0495597_0008574 | |||
| 2289 | Ga0495597_0009557 | |||
| 2290 | Ga0495597_0020003 | |||
| 2291 | Ga0495597_0020915 | |||
| 2292 | Ga0495597_0032223 | |||
| 2293 | Ga0495597_0033358 | |||
| 2294 | Ga0495597_0057841 | |||
| 2295 | Ga0495597_0072754 | |||
| 2296 | Ga0495597_0078271 | |||
| 2297 | Ga0495645_0063200 | |||
| 2298 | Ga0495645_0132275 | |||
| 2299 | Ga0495622_0003446 | |||
| 2300 | Ga0495622_0004248 | |||
| 2301 | Ga0495622_0004639 | |||
| 2302 | Ga0495622_0006279 | |||
| 2303 | Ga0495622_0025355 | |||
| 2304 | Ga0495622_0025705 | |||
| 2305 | Ga0495633_0000030 | |||
| 2306 | Ga0495633_0004335 | |||
| 2307 | Ga0495633_0008322 | |||
| 2308 | Ga0495633_0013515 | |||
| 2309 | Ga0495633_0056321 | |||
| 2310 | Ga0495656_0006278 | |||
| 2311 | Ga0495656_0006407 | |||
| 2312 | Ga0495668_0008646 | |||
| 2313 | Ga0495668_0010057 | |||
| 2314 | Ga0495668_0012252 | |||
| 2315 | Ga0495668_0025052 | |||
| 2316 | Ga0495668_0027930 | |||
| 2317 | Ga0495668_0034352 | |||
| 2318 | Ga0495668_0056139 | |||
| 2319 | Ga0495668_0059860 | |||
| 2320 | Ga0495634_0007980 | |||
| 2321 | Ga0495634_0205535 | |||
| 2322 | Ga0495611_0001090 | |||
| 2323 | Ga0495611_0001126 | |||
| 2324 | Ga0495611_0002823 | |||
| 2325 | Ga0495611_0008442 | |||
| 2326 | Ga0495611_0055297 | |||
| 2327 | Ga0495611_0065085 | |||
| 2328 | Ga0495611_0123325 | |||
| 2329 | Ga0495625_0000111 | |||
| 2330 | Ga0495625_0008363 | |||
| 2331 | Ga0495625_0011517 | |||
| 2332 | Ga0495625_0012022 | |||
| 2333 | Ga0495625_0016649 | |||
| 2334 | Ga0495625_0043696 | |||
| 2335 | Ga0495625_0057271 | |||
| 2336 | Ga0495625_0073813 | |||
| 2337 | Ga0495625_0143804 | |||
| 2338 | Ga0495635_0012706 | |||
| 2339 | Ga0495635_0046774 | |||
| 2340 | Ga0495659_0001193 | |||
| 2341 | Ga0495659_0018069 | |||
| 2342 | Ga0495661_0000015 | |||
| 2343 | Ga0495661_0000019 | |||
| 2344 | Ga0495661_0000034 | |||
| 2345 | Ga0495661_0000054 | |||
| 2346 | Ga0495661_0000985 | |||
| 2347 | Ga0495661_0001307 | |||
| 2348 | Ga0495661_0023997 | |||
| 2349 | Ga0495661_0041407 | |||
| 2350 | Ga0495661_0049138 | |||
| 2351 | Ga0495661_0068134 | |||
| 2352 | Ga0495661_0073470 | |||
| 2353 | Ga0495661_0080516 | |||
| 2354 | Ga0495661_0116085 | |||
| 2355 | Ga0495661_0142355 | |||
| 2356 | Ga0495588_0004938 | |||
| 2357 | Ga0495588_0024850 | |||
| 2358 | Ga0495588_0025580 | |||
| 2359 | Ga0495588_0267736 | |||
| 2360 | Ga0495623_0015098 | |||
| 2361 | Ga0495623_0056962 | |||
| 2362 | Ga0495646_0007931 | |||
| 2363 | Ga0495646_0012063 | |||
| 2364 | Ga0495646_0033467 | |||
| 2365 | Ga0495669_0026042 | |||
| 2366 | Ga0495669_0095729 | |||
| 2367 | Ga0495669_0100887 | |||
| 2368 | Ga0495613_0023738 | |||
| 2369 | Ga0495613_0151173 | |||
| 2370 | Ga0495624_0002451 | |||
| 2371 | Ga0495670_0001357 | |||
| 2372 | Ga0495670_0003514 | |||
| 2373 | Ga0495670_0004098 | |||
| 2374 | Ga0495670_0005713 | |||
| 2375 | Ga0495670_0006929 | |||
| 2376 | Ga0495670_0016702 | |||
| 2377 | Ga0495670_0025015 | |||
| 2378 | Ga0495670_0034532 | |||
| 2379 | Ga0495670_0066198 | |||
| 2380 | Ga0495670_0102117 | |||
| 2381 | Ga0495670_0102261 | |||
| 2382 | Ga0495671_0001174 | |||
| 2383 | Ga0495671_0005735 | |||
| 2384 | Ga0495671_0007083 | |||
| 2385 | Ga0495671_0007371 | |||
| 2386 | Ga0495671_0015344 | |||
| 2387 | Ga0495671_0015520 | |||
| 2388 | Ga0495671_0016464 | |||
| 2389 | Ga0495671_0019651 | |||
| 2390 | Ga0495671_0027487 | |||
| 2391 | Ga0495671_0035985 | |||
| 2392 | Ga0495671_0046199 | |||
| 2393 | Ga0495671_0049940 | |||
| 2394 | Ga0495671_0053786 | |||
| 2395 | Ga0495671_0077889 | |||
| 2396 | Ga0495671_0096821 | |||
| 2397 | Ga0495671_0126801 | |||
| 2398 | Ga0495671_0127006 | |||
| 2399 | Ga0495671_0189216 | |||
| 2400 | Ga0495649_0002197 | |||
| 2401 | Ga0495649_0002728 | |||
| 2402 | Ga0495649_0003170 | |||
| 2403 | Ga0495649_0003479 | |||
| 2404 | Ga0495649_0006752 | |||
| 2405 | Ga0495649_0007534 | |||
| 2406 | Ga0495649_0008867 | |||
| 2407 | Ga0495649_0010854 | |||
| 2408 | Ga0495649_0012591 | |||
| 2409 | Ga0495649_0025585 | |||
| 2410 | Ga0495649_0028003 | |||
| 2411 | Ga0495649_0054399 | |||
| 2412 | Ga0495649_0099808 | |||
| 2413 | Ga0495649_0130307 | |||
| 2414 | Ga0495649_0176881 | |||
| 2415 | Ga0495649_0179958 | |||
| 2416 | Ga0495649_0200159 | |||
| 2417 | Ga0495589_0000638 | |||
| 2418 | Ga0495589_0001755 | |||
| 2419 | Ga0495589_0002005 | |||
| 2420 | Ga0495589_0004755 | |||
| 2421 | Ga0495589_0005944 | |||
| 2422 | Ga0495589_0006301 | |||
| 2423 | Ga0495589_0008127 | |||
| 2424 | Ga0495589_0011277 | |||
| 2425 | Ga0495589_0021659 | |||
| 2426 | Ga0495589_0024742 | |||
| 2427 | Ga0495589_0025507 | |||
| 2428 | Ga0495589_0041395 | |||
| 2429 | Ga0495600_0006126 | |||
| 2430 | Ga0495660_0002064 | |||
| 2431 | Ga0495660_0004800 | |||
| 2432 | Ga0495660_0014000 | |||
| 2433 | Ga0495660_0020319 | |||
| 2434 | Ga0495660_0021167 | |||
| 2435 | Ga0495660_0022042 | |||
| 2436 | Ga0495660_0024682 | |||
| 2437 | Ga0495660_0041505 | |||
| 2438 | Ga0495660_0043108 | |||
| 2439 | Ga0495660_0078253 | |||
| 2440 | Ga0495660_0079554 | |||
| 2441 | Ga0495660_0094912 | |||
| 2442 | Ga0495660_0100973 | |||
| 2443 | Ga0495660_0101175 | |||
| 2444 | Ga0495660_0136290 | |||
| 2445 | Ga0495660_0138717 | |||
| 2446 | Ga0495581_0010373 | |||
| 2447 | Ga0495581_0017516 | |||
| 2448 | Ga0495604_0007388 | |||
| 2449 | Ga0495604_0066686 | |||
| 2450 | Ga0495604_0090439 | |||
| 2451 | Ga0495636_0005927 | |||
| 2452 | Ga0495636_0043098 | |||
| 2453 | Ga0495674_0068007 | |||
| 2454 | Ga0495674_0166911 | |||
| 2455 | Ga0495672_0003669 | |||
| 2456 | Ga0495672_0006378 | |||
| 2457 | Ga0495672_0007327 | |||
| 2458 | Ga0495672_0009064 | |||
| 2459 | Ga0495672_0010619 | |||
| 2460 | Ga0495672_0011466 | |||
| 2461 | Ga0495672_0013984 | |||
| 2462 | Ga0495672_0014163 | |||
| 2463 | Ga0495672_0018142 | |||
| 2464 | Ga0495672_0021215 | |||
| 2465 | Ga0495672_0023300 | |||
| 2466 | Ga0495672_0025071 | |||
| 2467 | Ga0495672_0027416 | |||
| 2468 | Ga0495672_0036992 | |||
| 2469 | Ga0495672_0056960 | |||
| 2470 | Ga0495672_0121884 | |||
| 2471 | Ga0495676_0000010 | |||
| 2472 | Ga0495676_0016987 | |||
| 2473 | Ga0495676_0124770 | |||
| 2474 | Ga0495676_0178142 | |||
| 2475 | Ga0495676_0269979 | |||
| 2476 | Ga0495680_0027725 | |||
| 2477 | Ga0495680_0035540 | |||
| 2478 | Ga0495680_0110419 | |||
| 2479 | Ga0495680_0326211 | |||
| 2480 | Ga0495683_0000142 | |||
| 2481 | Ga0495683_0000265 | |||
| 2482 | Ga0495683_0001827 | |||
| 2483 | Ga0495683_0001998 | |||
| 2484 | Ga0495683_0004135 | |||
| 2485 | Ga0495683_0009059 | |||
| 2486 | Ga0495683_0009623 | |||
| 2487 | Ga0495683_0013105 | |||
| 2488 | Ga0495683_0020012 | |||
| 2489 | Ga0495683_0051275 | |||
| 2490 | Ga0495683_0052351 | |||
| 2491 | Ga0495683_0057771 | |||
| 2492 | Ga0495683_0148360 | |||
| 2493 | Ga0495683_0156983 | |||
| 2494 | Ga0495687_002882 | |||
| 2495 | Ga0495687_009065 | |||
| 2496 | Ga0495687_015127 | |||
| 2497 | Ga0495675_0167155 | |||
| 2498 | Ga0495677_0004199 | |||
| 2499 | Ga0495679_000201 | |||
| 2500 | Ga0495679_000698 | |||
| 2501 | Ga0495679_000968 | |||
| 2502 | Ga0495679_002746 | |||
| 2503 | Ga0495679_009280 | |||
| 2504 | Ga0495679_009797 | |||
| 2505 | Ga0495679_012754 | |||
| 2506 | Ga0495679_015441 | |||
| 2507 | Ga0495679_016731 | |||
| 2508 | Ga0495679_017993 | |||
| 2509 | Ga0495685_017612 | |||
| 2510 | Ga0495685_021566 | |||
| 2511 | Ga0495673_0002428 | |||
| 2512 | Ga0495673_0002568 | |||
| 2513 | Ga0495673_0002623 | |||
| 2514 | Ga0495673_0002633 | |||
| 2515 | Ga0495673_0003141 | |||
| 2516 | Ga0495673_0003253 | |||
| 2517 | Ga0495673_0003319 | |||
| 2518 | Ga0495673_0004143 | |||
| 2519 | Ga0495673_0004949 | |||
| 2520 | Ga0495673_0005325 | |||
| 2521 | Ga0495673_0005851 | |||
| 2522 | Ga0495673_0005906 | |||
| 2523 | Ga0495673_0006988 | |||
| 2524 | Ga0495673_0007571 | |||
| 2525 | Ga0495673_0010534 | |||
| 2526 | Ga0495673_0017221 | |||
| 2527 | Ga0495673_0027058 | |||
| 2528 | Ga0495673_0030396 | |||
| 2529 | Ga0495673_0031811 | |||
| 2530 | Ga0495673_0036236 | |||
| 2531 | Ga0495673_0040140 | |||
| 2532 | Ga0495681_0001820 | |||
| 2533 | Ga0495681_0007339 | |||
| 2534 | Ga0495681_0007505 | |||
| 2535 | Ga0495681_0009531 | |||
| 2536 | Ga0495681_0009589 | |||
| 2537 | Ga0495681_0011929 | |||
| 2538 | Ga0495681_0012563 | |||
| 2539 | Ga0495681_0012805 | |||
| 2540 | Ga0495681_0013163 | |||
| 2541 | Ga0495681_0013203 | |||
| 2542 | Ga0495681_0013376 | |||
| 2543 | Ga0495681_0035873 | |||
| 2544 | Ga0495681_0036743 | |||
| 2545 | Ga0495681_0039884 | |||
| 2546 | Ga0495681_0042904 | |||
| 2547 | Ga0495681_0065030 | |||
| 2548 | Ga0495681_0087743 | |||
| 2549 | Ga0495684_0003966 | |||
| 2550 | Ga0495686_0009836 | |||
| 2551 | Ga0495686_0011330 | |||
| 2552 | Ga0495686_0017973 | |||
| 2553 | Ga0495686_0019100 | |||
| 2554 | Ga0495686_0038882 | |||
| 2555 | Ga0495686_0066371 | |||
| 2556 | Ga0495686_0275729 | |||
| 2557 | Ga0495593_0001723 | |||
| 2558 | Ga0495593_0016845 | |||
| 2559 | Ga0495593_0064105 | |||
| 2560 | Ga0495593_0079586 | |||
| 2561 | Ga0495593_0118381 | |||
| 2562 | Ga0495602_0016643 | |||
| 2563 | Ga0495614_0027427 | |||
| 2564 | Ga0495626_0000013 | |||
| 2565 | Ga0495626_0001651 | |||
| 2566 | Ga0495626_0001999 | |||
| 2567 | Ga0495626_0002685 | |||
| 2568 | Ga0495626_0004287 | |||
| 2569 | Ga0495626_0004989 | |||
| 2570 | Ga0495626_0006596 | |||
| 2571 | Ga0495626_0008701 | |||
| 2572 | Ga0495626_0012595 | |||
| 2573 | Ga0495626_0021575 | |||
| 2574 | Ga0495626_0023023 | |||
| 2575 | Ga0495626_0026139 | |||
| 2576 | Ga0495626_0044996 | |||
| 2577 | Ga0496102_0016921 | |||
| 2578 | Ga0496102_0212840 | |||
| 2579 | Ga0496102_0279281 | |||
| 2580 | Ga0496103_0008171 | |||
| 2581 | Ga0496106_0481556 | |||
| 2582 | Ga0496110_0024167 | |||
| 2583 | Ga0496110_0092561 | |||
| 2584 | Ga0496111_0090448 | |||
| 2585 | Ga0496112_0241331 | |||
| 2586 | Ga0496116_0000528 | |||
| 2587 | Ga0496116_0009118 | |||
| 2588 | Ga0496116_0010681 | |||
| 2589 | Ga0496116_0015217 | |||
| 2590 | Ga0496116_0015285 | |||
| 2591 | Ga0496116_0044432 | |||
| 2592 | Ga0496116_0117582 | |||
| 2593 | Ga0496117_0001491 | |||
| 2594 | Ga0496117_0001958 | |||
| 2595 | Ga0496117_0003682 | |||
| 2596 | Ga0496117_0014819 | |||
| 2597 | Ga0496117_0015448 | |||
| 2598 | Ga0496117_0018056 | |||
| 2599 | Ga0496117_0028407 | |||
| 2600 | Ga0496117_0053042 | |||
| 2601 | Ga0496117_0065851 | |||
| 2602 | Ga0496117_0198574 | |||
| 2603 | Ga0496118_0016801 | |||
| 2604 | Ga0496118_0023939 | |||
| 2605 | Ga0496118_0033439 | |||
| 2606 | Ga0496118_0042880 | |||
| 2607 | Ga0496118_0059610 | |||
| 2608 | Ga0496118_0131133 | |||
| 2609 | Ga0496118_0168757 | |||
| 2610 | Ga0496118_0296244 | |||
| 2611 | Ga0496119_0002684 | |||
| 2612 | Ga0496119_0003088 | |||
| 2613 | Ga0496119_0050934 | |||
| 2614 | Ga0496120_0002021 | |||
| 2615 | Ga0496120_0002665 | |||
| 2616 | Ga0496120_0023163 | |||
| 2617 | Ga0496120_0030156 | |||
| 2618 | Ga0496121_0001448 | |||
| 2619 | Ga0496121_0005918 | |||
| 2620 | Ga0496121_0017408 | |||
| 2621 | Ga0496121_0022992 | |||
| 2622 | Ga0496121_0032004 | |||
| 2623 | Ga0496121_0116248 | |||
| 2624 | Ga0496121_0116667 | |||
| 2625 | Ga0496122_0000297 | |||
| 2626 | Ga0496122_0005458 | |||
| 2627 | Ga0496122_0006316 | |||
| 2628 | Ga0496122_0017963 | |||
| 2629 | Ga0496122_0036923 | |||
| 2630 | Ga0496122_0099757 | |||
| 2631 | Ga0496122_0139037 | |||
| 2632 | Ga0496122_0143144 | |||
| 2633 | Ga0496123_0001365 | |||
| 2634 | Ga0496123_0003902 | |||
| 2635 | Ga0496123_0011662 | |||
| 2636 | Ga0496123_0014222 | |||
| 2637 | Ga0496123_0048994 | |||
| 2638 | Ga0496123_0071469 | |||
| 2639 | Ga0496123_0104278 | |||
| 2640 | Ga0496124_0000051 | |||
| 2641 | Ga0496124_0002170 | |||
| 2642 | Ga0496124_0008997 | |||
| 2643 | Ga0496124_0009753 | |||
| 2644 | Ga0496124_0009861 | |||
| 2645 | Ga0496124_0015687 | |||
| 2646 | Ga0496124_0031973 | |||
| 2647 | Ga0496124_0077693 | |||
| 2648 | Ga0496124_0168815 | |||
| 2649 | Ga0496124_0213870 | |||
| 2650 | Ga0496124_0238885 | |||
| 2651 | Ga0496125_0002244 | |||
| 2652 | Ga0496125_0003064 | |||
| 2653 | Ga0496125_0004004 | |||
| 2654 | Ga0496125_0008231 | |||
| 2655 | Ga0496125_0008371 | |||
| 2656 | Ga0496125_0015946 | |||
| 2657 | Ga0496125_0019886 | |||
| 2658 | Ga0496125_0026825 | |||
| 2659 | Ga0496125_0090963 | |||
| 2660 | Ga0496126_0004493 | |||
| 2661 | Ga0495678_000063 | |||
| 2662 | Ga0495678_000127 | |||
| 2663 | Ga0495678_003317 | |||
| 2664 | Ga0495678_005393 | |||
| 2665 | Ga0495678_005525 | |||
| 2666 | Ga0495678_006348 | |||
| 2667 | Ga0495678_006555 | |||
| 2668 | Ga0495678_006629 | |||
| 2669 | Ga0495678_007779 | |||
| 2670 | Ga0495678_009177 | |||
| 2671 | Ga0495678_011113 | |||
| 2672 | Ga0495678_012254 | |||
| 2673 | Ga0495678_012374 | |||
| 2674 | Ga0495678_028943 | |||
| 2675 | Ga0495678_029599 | |||
| 2676 | Ga0495678_044142 | |||
| 2677 | Ga0495678_046390 | |||
| 2678 | Ga0495678_055823 | |||
| 2679 | Ga0495682_0000635 | |||
| 2680 | Ga0495682_0001628 | |||
| 2681 | Ga0495682_0003886 | |||
| 2682 | Ga0495682_0004726 | |||
| 2683 | Ga0495682_0004955 | |||
| 2684 | Ga0495682_0007598 | |||
| 2685 | Ga0495682_0056386 | |||
| 2686 | Ga0495682_0079384 | |||
| 2687 | Ga0495682_0109432 | |||
| 2688 | Ga0501032_0066331 | |||
| 2689 | Ga0501034_0038632 | |||
| 2690 | Ga0501034_0509350 | |||
| 2691 | Ga0501227_008651 | |||
| 2692 | Ga0501241_002676 | |||
| 2693 | nmdc:mga03683_36987_c1 | |||
| 2694 | nmdc:mga03683_59708_c1 | |||
| 2695 | nmdc:mga00v17_17827_c1 | |||
| 2696 | nmdc:mga08x19_357311_c1 | |||
| 2697 | Ga0500572_001606 | |||
| 2698 | Ga0500618_005220 | |||
| 2699 | Ga0500573_0003859 | |||
| 2700 | Ga0500577_0054949 | |||
| 2701 | Ga0500586_042887 | |||
| 2702 | Ga0500634_0000306 | |||
| 2703 | Ga0587067_001233 | |||
| 2704 | Ga0587072_000037 | |||
| 2705 | 2511257386 | |||
| 2706 | 2511268756 | |||
| 2707 | 2511270797 | |||
| 2708 | 2511277018 | |||
| 2709 | 2511291505 | |||
| 2710 | 2511296172 | |||
| 2711 | 2511300608 | |||
| 2712 | 2511315584 | |||
| 2713 | 2511320503 | |||
| 2714 | 2511323534 | |||
| 2715 | 2511332388 | |||
| 2716 | 2511337173 | |||
| 2717 | 2511346123 | |||
| 2718 | 2511352755 | |||
| 2719 | 2511355022 | |||
| 2720 | 2511363156 | |||
| 2721 | 2511370163 | |||
| 2722 | 2511411138 | |||
| 2723 | 2511826722 | |||
| 2724 | 2512328289 | |||
| 2725 | 2555668019 | |||
| 2726 | 2583790462 | |||
| 2727 | 2597028380 | |||
| 2728 | 2597856235 | |||
| 2729 | 2597862282 | |||
| 2730 | 2599328189 | |||
| 2731 | 2599355019 | |||
| 2732 | 2599361157 | |||
| 2733 | 2599367479 | |||
| 2734 | 2599374269 | |||
| 2735 | 2599380125 | |||
| 2736 | 2599386572 | |||
| 2737 | 2599393127 | |||
| 2738 | 2599397107 | |||
| 2739 | 2599404894 | |||
| 2740 | 2599444388 | |||
| 2741 | 2599449099 | |||
| 2742 | 2599461853 | |||
| 2743 | 2599467104 | |||
| 2744 | 2599483509 | |||
| 2745 | 2599491054 | |||
| 2746 | 2599502925 | |||
| 2747 | 2599511157 | |||
| 2748 | 2599519353 | |||
| 2749 | 2599615047 | |||
| 2750 | 2599771244 | |||
| 2751 | 2599805415 | |||
| 2752 | 2599879604 | |||
| 2753 | 2599885984 | |||
| 2754 | 2599890531 | |||
| 2755 | 2599897698 | |||
| 2756 | 2599930047 | |||
| 2757 | 2599945425 | |||
| 2758 | 2599948104 | |||
| 2759 | 2599955697 | |||
| 2760 | 2599961066 | |||
| 2761 | 2599967246 | |||
| 2762 | 2599974630 | |||
| 2763 | 2599980357 | |||
| 2764 | 2599985809 | |||
| 2765 | 2599990703 | |||
| 2766 | 2599996023 | |||
| 2767 | 2600001911 | |||
| 2768 | 2600005636 | |||
| 2769 | 2600014200 | |||
| 2770 | 2600019118 | |||
| 2771 | 2600025594 | |||
| 2772 | 2600027791 | |||
| 2773 | 2600033493 | |||
| 2774 | 2600040221 | |||
| 2775 | 2600049408 | |||
| 2776 | 2600055701 | |||
| 2777 | 2600061676 | |||
| 2778 | 2600064295 | |||
| 2779 | 2600073535 | |||
| 2780 | 2600077257 | |||
| 2781 | 2600214475 | |||
| 2782 | 2600356958 | |||
| 2783 | 2600364121 | |||
| 2784 | 2600442547 | |||
| 2785 | 2601625990 | |||
| 2786 | 2601690871 | |||
| 2787 | 2601774820 | |||
| 2788 | 2601800052 | |||
| 2789 | 2602012494 | |||
| 2790 | 2606074684 | |||
| 2791 | 2606127547 | |||
| 2792 | 2621301580 | |||
| 2793 | 2624478799 | |||
| 2794 | 2624494153 | |||
| 2795 | 2643842476 | |||
| 2796 | 2643955339 | |||
| 2797 | 2644023691 | |||
| 2798 | 2644188311 | |||
| 2799 | 2644282451 | |||
| 2800 | 2644623962 | |||
| 2801 | 2652545886 | |||
| 2802 | 2671089793 | |||
| 2803 | 2671097620 | |||
| 2804 | 2671125577 | |||
| 2805 | 2671767849 | |||
| 2806 | 2677897462 | |||
| 2807 | 2678265087 | |||
| 2808 | 2715750837 | |||
| 2809 | 2715757516 | |||
| 2810 | 2718632684 | |||
| 2811 | 2729147827 | |||
| 2812 | 2738673800 | |||
| 2813 | 2738689482 | |||
| 2814 | 2738752193 | |||
| 2815 | 2738809062 | |||
| 2816 | 2738861234 | |||
| 2817 | 2738896422 | |||
| 2818 | 2739196569 | |||
| 2819 | 2739257547 | |||
| 2820 | 2739265256 | |||
| 2821 | 2739286848 | |||
| 2822 | 2739292161 | |||
| 2823 | 2739314867 | |||
| 2824 | 2743735644 | |||
| 2825 | 2745005544 | |||
| 2826 | 2774122143 | |||
| 2827 | 2774136725 | |||
| 2828 | 2784260477 | |||
| 2829 | 2784314388 | |||
| 2830 | 2794595604 | |||
| 2831 | 2808855892 | |||
| 2832 | 2808921901 | |||
| 2833 | 2808928776 | |||
| 2834 | 2808935972 | |||
| 2835 | 2808941051 | |||
| 2836 | 2808944022 | |||
| 2837 | 2808950897 | |||
| 2838 | 2808959742 | |||
| 2839 | 2808964235 | |||
| 2840 | 2808975200 | |||
| 2841 | 2808991161 | |||
| 2842 | 2808999123 | |||
| 2843 | 2809215737 | |||
| 2844 | 2812370812 | |||
| 2845 | 2817489061 | |||
| 2846 | 2819658354 | |||
| 2847 | 2819702703 | |||
| 2848 | 2823422458 | |||
| 2849 | 2825656015 | |||
| 2850 | 2826583779 | |||
| 2851 | 2834028962 | |||
| 2852 | 2842808051 | |||
| 2853 | 2842821042 | |||
| 2854 | 2842835733 | |||
| 2855 | 2842847480 | |||
| 2856 | 2842853442 | |||
| 2857 | 2842856419 | |||
| 2858 | 2844668521 | |||
| 2859 | 2852615551 | |||
| 2860 | 2852662845 | |||
| 2861 | 2852670519 | |||
| 2862 | 2860340658 | |||
| 2863 | 2878030763 | |||
| 2864 | 2880231675 | |||
| 2865 | 2885268583 | |||
| 2866 | 2904520710 | |||
| 2867 | 2904553065 | |||
| 2868 | 2913041699 | |||
| 2869 | 2917071781 | |||
| 2870 | 2919067287 | |||
| 2871 | 2919385813 | |||
| 2872 | 2919458368 | |||
| 2873 | 2919484637 | |||
| 2874 | 2919492809 | |||
| 2875 | 2919505147 | |||
| 2876 | 2919699930 | |||
| 2877 | 2923154652 | |||
| 2878 | 2923524917 | |||
| 2879 | 2923590346 | |||
| 2880 | 2926066824 | |||
| 2881 | 2928063131 | |||
| 2882 | 2929149019 | |||
| 2883 | 2929190988 | |||
| 2884 | 2931373559 | |||
| 2885 | 2931391994 | |||
| 2886 | 2931399440 | |||
| 2887 | 2935353954 | |||
| 2888 | 2939637034 | |||
| 2889 | 2945929588 | |||
| 2890 | 2945965838 | |||
| 2891 | 2946029235 | |||
| 2892 | 2969305585 | |||
| 2893 | 2974292784 | |||
| 2894 | 2984291378 | |||
| 2895 | 2988730617 | |||
| 2896 | 2990200718 | |||
| 2897 | 2998141026 | |||
| 2898 | 3007256056 | |||
| 2899 | 3007319869 | |||
| 2900 | 3007400183 | |||
| 2901 | 3007516356 | |||
| 2902 | 3007616510 | |||
| 2903 | 3007623217 | |||
| 2904 | 3007719772 | |||
| 2905 | 3007860912 | |||
| 2906 | 3007863751 | |||
| 2907 | 3007867635 | |||
| 2908 | 637318398 | |||
| 2909 | 640489017 | |||
| 2910 | 651177107 | |||
| 2911 | 8011353765 | |||
| 2912 | 8015688888 | |||
| 2913 | 8019772427 | |||
| 2914 | 8019776596 | |||
| 2915 | 8029999735 | |||
| 2916 | 8034964262 | |||
| 2917 | 8054290476 | |||
| 2918 | 8054504571 | |||
| 2919 | 8055772006 | |||
| 2920 | 8055819011 | |||
| 2921 | 8056130810 | |||
| 2922 | 8056132882 | |||
| 2923 | 8056144374 | |||
| 2924 | 8056155613 | |||
| 2925 | 8056161241 | |||
| 2926 | 8056170026 | |||
| 2927 | 8056176157 | |||
| 2928 | 8056183425 | |||
| 2929 | 8056569677 | |||
| 2930 | 8057803295 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kf9-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from ralstonia solanacearum, target efi-501780, with bound gsh coordinated to a zinc ion, ordered active site | 0.9415 | 29 | 327 |
| 3ic8-assembly2.cif.gz_B | the crystal structure of a gst-like protein from pseudomonas syringae to 2.4a | 0.9384 | 29 | 327 |
| 3ic8-assembly3.cif.gz_C | the crystal structure of a gst-like protein from pseudomonas syringae to 2.4a | 0.9368 | 25 | 327 |
| 3ic8-assembly2.cif.gz_A | the crystal structure of a gst-like protein from pseudomonas syringae to 2.4a | 0.9349 | 29 | 327 |
| 3ic8-assembly3.cif.gz_D | the crystal structure of a gst-like protein from pseudomonas syringae to 2.4a | 0.9299 | 25 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ic8B02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.966 | 102 | 234 | 1.20.1050.10 |
| 3ic8B02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9565 | 102 | 234 | 1.20.1050.10 |
| 4kf9A02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9484 | 103 | 234 | 1.20.1050.10 |
| 3ic8D02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9421 | 102 | 234 | 1.20.1050.10 |
| 3ic8C02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9417 | 102 | 234 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V0QQG9-F1-model_v4 | Glutathione S-transferase | 0.985 | 95 | 327 |
GO:0016740
|
| AF-F3CG35-F1-model_v4 | Putative glutathione S-transferase-related protein | 0.9808 | 253 | 327 |
GO:0016740
|
| AF-A0A2V0QQG9-F1-model_v4 | Glutathione S-transferase | 0.9808 | 95 | 327 |
GO:0016740
|
| AF-A0A3M5W199-F1-model_v4 | Uncharacterized protein | 0.9779 | 260 | 327 |
|
| AF-A0A3M5DYX2-F1-model_v4 | Glutathione S-transferase | 0.9763 | 177 | 327 |
|