F494178

General Info

Members Datasets Scaffolds Average Seq Length
1467 544 1415 125

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_11118759|Ga0105243_111187592
Length 140
Sequence MAGSSTKAPKVKRMSTNPVQTVGTSGDKLKVTLAVCAAIAGVVAFYFLSDKPTPVRAAALVAGLILAIALAWTSMTGRDFINFSKEAVRETKKVVWPTRKEAMQITAIVFGFVLIMALFLFGTDKLLEFLLYDLILGWKK

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
7 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
8 2643221556 Massilia sp. Root1485 Isolate Unclassified
9 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
10 2643221645 Massilia sp. Root351 Isolate Unclassified
11 2643221664 Massilia sp. Root418 Isolate Unclassified
12 2643221684 Massilia sp. Root133 Isolate Unclassified
13 2738541280 Massilia sp. GV090 Isolate Unclassified
14 2738541297 Duganella sp. GV083 Isolate Unclassified
15 2738541300 Massilia sp. GV016 Isolate Unclassified
16 2738541357 Duganella sp. GV053 Isolate Unclassified
17 2738543003 Duganella sp. GV066 Isolate Unclassified
18 2738543018 Massilia sp. GV045 Isolate Unclassified
19 2738543026 Duganella sp. GV089 Isolate Unclassified
20 2738543029 Duganella sp. GV039 Isolate Unclassified
21 2738543030 Massilia sp. GV097 Isolate Unclassified
22 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
23 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
24 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
25 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
26 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
27 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
28 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
29 2821131069 Duganella sp. 1224 Isolate Unclassified
30 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
31 2842711865 Duganella sp. R-73148 Isolate Unclassified
32 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
33 2857558681 Duganella sp. R-74565 Isolate Unclassified
34 2857564685 Duganella sp. R-74599 Isolate Unclassified
35 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
36 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
37 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
38 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
39 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
40 2904424332 Duganella sp. 1411 Isolate Rhizosphere
41 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
42 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
43 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
44 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
45 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
46 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
47 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
48 2919476304 Duganella sp. 3397 Isolate Unclassified
49 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
50 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
51 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
52 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
53 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
57 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
59 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
60 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
61 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
62 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003288 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_44 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
67 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
68 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
69 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
70 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
71 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
74 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
75 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
76 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
77 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
78 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
79 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
80 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
81 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
82 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
84 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
85 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
86 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
87 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
88 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
89 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
90 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
91 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
92 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
93 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
94 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
95 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
96 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
97 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
98 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
99 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
100 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
101 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
102 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
105 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
107 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
108 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
109 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
110 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
111 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
112 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
113 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
114 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
115 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
116 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
117 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
118 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
119 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
122 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
123 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
124 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
125 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
128 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
129 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
130 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
131 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
132 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
133 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
134 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
137 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
141 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
142 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
155 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
171 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
172 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
175 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
179 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
180 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
181 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
189 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
191 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
192 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
193 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
196 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
197 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
201 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
205 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
208 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
246 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
248 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
249 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
250 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
251 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
252 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
258 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
259 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
264 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
265 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
277 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
278 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
279 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
280 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
281 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
282 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
283 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
284 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
285 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
286 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
287 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
288 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
289 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
295 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
296 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
297 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
305 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
308 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
309 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
310 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
311 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
312 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
313 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
314 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
318 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
319 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
320 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
321 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
322 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
323 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
324 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
325 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
326 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
327 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
328 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
329 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
330 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
331 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
332 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
333 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
334 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
335 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
336 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
337 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
338 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
339 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
340 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
341 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
342 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
343 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
347 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
348 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
349 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
350 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
351 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
352 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
353 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
354 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
355 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
356 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
363 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
364 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
365 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
366 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
367 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
368 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
369 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
370 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
371 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
372 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
373 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
374 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
375 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
376 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
377 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
378 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
379 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
380 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
381 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
382 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
383 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
384 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
387 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
390 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
391 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
392 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
393 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
398 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
399 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
419 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
420 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
421 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
422 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
423 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
424 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
425 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
434 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
435 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
436 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
444 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
445 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
452 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
459 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
460 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
461 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
462 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
463 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
464 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
465 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
466 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
467 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
468 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
469 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
470 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
472 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
473 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
474 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
475 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
476 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
477 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
478 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
479 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
480 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
481 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
482 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
483 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
484 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
485 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
486 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
487 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
488 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
489 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
490 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
491 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
492 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
493 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
495 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
498 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
499 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
500 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
501 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
502 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
503 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
505 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
508 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
510 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
511 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
520 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
544 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.73
Metatranscriptomes 17.72
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.43
Nodule 0.34
Rhizoplane 4.16
Rhizosphere 82.48
Stem 0
Stem Tuber 0
Unclassified 5.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1001422 3300002704 Bacteria 1719
2 JGI25162J39368_1003029 3300002737 Bacteria 5487
3 JGI25162J39368_1013612 3300002737 Bacteria 893
4 JGI25154J39366_1001113 3300002738 Bacteria 10452
5 JGI25157J39369_1002793 3300002741 Bacteria 3986
6 JGI25163J39215_1004486 3300002771 Bacteria 975
7 Ga0006761J43178_107453 3300002865 Bacteria 787
8 Ga0006763J43179_103551 3300002870 Bacteria 1885
9 Ga0006762J43184_104088 3300002872 Bacteria 3536
10 Ga0006765J45826_105488 3300003161 Bacteria 3656
11 Ga0006765J45826_112366 3300003161 Bacteria 517
12 Ga0006778J45830_1013353 3300003162 Bacteria 3860
13 Ga0006778J45830_1040529 3300003162 Bacteria 1293
14 Ga0006759J45824_1008312 3300003163 Bacteria 3423
15 Ga0006759J45824_1017914 3300003163 Bacteria 783
16 Ga0006759J45824_1050895 3300003163 Bacteria 532
17 JGI25151J46595_10026667 3300003187 Bacteria 2327
18 JGI25165J46597_1001017 3300003214 Bacteria 18492
19 JGI25153J46596_10069502 3300003215 Bacteria 918
20 Ga0007428J48920_101816 3300003288 Bacteria 1673
21 Ga0007421J48921_108960 3300003291 Bacteria 985
22 Ga0006758J48902_1003362 3300003300 Bacteria 5424
23 Ga0006758J48902_1007376 3300003300 Bacteria 802
24 Ga0006758J48902_1008629 3300003300 Bacteria 4431
25 Ga0006758J48902_1013049 3300003300 Bacteria 550
26 Ga0006770J48903_1029811 3300003305 Bacteria 1264
27 Ga0006770J48903_1044284 3300003305 Bacteria 617
28 Ga0006777J48905_1023760 3300003308 Bacteria 1382
29 Ga0006777J48905_1039864 3300003308 Bacteria 1285
30 rootH2_10111913 3300003320 Bacteria 1421
31 JGI25160J50197_1016863 3300003354 Bacteria 2336
32 Ga0007417J51691_1002081 3300003544 Bacteria 10064
33 Ga0007417J51691_1010301 3300003544 Bacteria 12984
34 Ga0007417J51691_1012480 3300003544 Bacteria 3735
35 Ga0007417J51691_1047057 3300003544 Bacteria 1157
36 Ga0007427J51700_104977 3300003559 Bacteria 3786
37 Ga0006781J51513_1012464 3300003568 Bacteria 1740
38 Ga0007410J51695_1007231 3300003574 Bacteria 17470
39 Ga0007410J51695_1020989 3300003574 Bacteria 1047
40 Ga0007409J51694_1001845 3300003575 Bacteria 1222
41 Ga0007409J51694_1004205 3300003575 Bacteria 13192
42 Ga0007409J51694_1052234 3300003575 Bacteria 546
43 Ga0007416J51690_1008732 3300003577 Bacteria 13163
44 Ga0007416J51690_1012477 3300003577 Bacteria 2533
45 Ga0007416J51690_1013143 3300003577 Bacteria 3753
46 Ga0007429J51699_1009554 3300003579 Bacteria 5322
47 Ga0007429J51699_1048446 3300003579 Bacteria 4130
48 Ga0007411J51799_105052 3300003611 Bacteria 7712
49 Ga0007411J51799_105765 3300003611 Bacteria 1376
50 Ga0007415J51800_105799 3300003613 Bacteria 1906
51 Ga0007415J51800_107921 3300003613 Bacteria 564
52 Ga0032354_1003507 3300003693 Bacteria 1535
53 Ga0032354_1011615 3300003693 Bacteria 13713
54 Ga0032354_1050188 3300003693 Bacteria 946
55 Ga0032354_1055041 3300003693 Bacteria 1008
56 Ga0006780_1004575 3300003735 Bacteria 5394
57 Ga0006780_1014123 3300003735 Bacteria 1224
58 Ga0055538_1000375 3300003751 Bacteria 18492
59 Ga0055538_1002307 3300003751 Bacteria 2880
60 Ga0055539_1000377 3300003752 Bacteria 18492
61 Ga0055539_1002407 3300003752 Bacteria 2880
62 Ga0055533_1000371 3300003756 Bacteria 18492
63 Ga0055533_1003837 3300003756 Bacteria 2880
64 Ga0055532_1000420 3300003758 Bacteria 20446
65 Ga0055525_1000147 3300003759 Bacteria 96457
66 Ga0055525_1000523 3300003759 Bacteria 18492
67 Ga0055525_1001833 3300003759 Bacteria 2880
68 Ga0055535_1005381 3300003761 Bacteria 2823
69 Ga0055529_1000375 3300003763 Bacteria 48263
70 Ga0055526_1021258 3300003771 Bacteria 2266
71 Ga0055526_1021298 3300003771 Bacteria 2261
72 Ga0055537_1007354 3300003773 Bacteria 2661
73 Ga0055537_1012735 3300003773 Bacteria 1621
74 Ga0055524_1035570 3300003775 Bacteria 1356
75 Ga0055524_1039973 3300003775 Bacteria 1203
76 Ga0055534_1006810 3300003784 Bacteria 2819
77 Ga0055534_1023815 3300003784 Bacteria 998
78 Ga0055528_1007975 3300003790 Bacteria 4609
79 Ga0055528_1012187 3300003790 Bacteria 3355
80 Ga0055530_10034470 3300003791 Bacteria 1293
81 Ga0055540_1071237 3300003792 Bacteria 678
82 Ga0055531_10055730 3300003794 Bacteria 1003
83 Ga0055541_1000262 3300003841 Bacteria 18492
84 Ga0055541_1003620 3300003841 Bacteria 2880
85 Ga0055543_1028398 3300004625 Bacteria 985
86 Ga0055543_1061760 3300004625 Bacteria 599
87 Ga0058859_11830236 3300004798 Bacteria 602
88 Ga0058863_10053884 3300004799 Bacteria 1211
89 Ga0058861_10192042 3300004800 Bacteria 1266
90 Ga0058860_12202994 3300004801 Bacteria 531
91 Ga0058862_10285807 3300004803 Bacteria 831
92 Ga0065165_1003318 3300005262 Bacteria 11513
93 Ga0065165_1131124 3300005262 Bacteria 599
94 Ga0065714_10039928 3300005288 Bacteria 728
95 Ga0065714_10228053 3300005288 Bacteria 822
96 Ga0065714_10510726 3300005288 Bacteria 518
97 Ga0065704_10158451 3300005289 Bacteria 1373
98 Ga0065715_10965565 3300005293 Bacteria 555
99 Ga0070676_10119214 3300005328 Bacteria 1654
100 Ga0070670_100067314 3300005331 Bacteria 3073
101 Ga0070670_100670173 3300005331 Bacteria 931
102 Ga0068869_100160311 3300005334 Bacteria 1751
103 Ga0070680_100212917 3300005336 Bacteria 1630
104 Ga0070680_100331491 3300005336 Bacteria 1293
105 Ga0070682_100049501 3300005337 Bacteria 2620
106 Ga0070682_100139754 3300005337 Bacteria 1649
107 Ga0070660_100054384 3300005339 Bacteria 3091
108 Ga0070661_100103030 3300005344 Bacteria 2125
109 Ga0070671_101904447 3300005355 Bacteria 529
110 Ga0070659_100022490 3300005366 Bacteria 4814
111 Ga0070663_100229308 3300005455 Bacteria 1462
112 Ga0070662_100788233 3300005457 Bacteria 807
113 Ga0070681_10693651 3300005458 Bacteria 934
114 Ga0068867_100247809 3300005459 Bacteria 1447
115 Ga0070684_100335993 3300005535 Bacteria 1388
116 Ga0068853_100254548 3300005539 Bacteria 1612
117 Ga0070672_100523242 3300005543 Bacteria 1028
118 Ga0068855_100434090 3300005563 Bacteria 1435
119 Ga0068855_100593288 3300005563 Bacteria 1195
120 Ga0068855_101125821 3300005563 Bacteria 819
121 Ga0070664_100139315 3300005564 Bacteria 2135
122 Ga0070664_100796478 3300005564 Bacteria 883
123 Ga0068857_100025716 3300005577 Bacteria 5183
124 Ga0068854_100377989 3300005578 Bacteria 1166
125 Ga0068854_100576719 3300005578 Bacteria 957
126 Ga0068856_100085286 3300005614 Bacteria 3137
127 Ga0068856_100087143 3300005614 Bacteria 3103
128 Ga0068852_100062072 3300005616 Bacteria 3249
129 Ga0068851_10071502 3300005834 Bacteria 1795
130 Ga0068851_10112534 3300005834 Bacteria 1454
131 Ga0068851_10405320 3300005834 Bacteria 803
132 Ga0068862_101121132 3300005844 Bacteria 782
133 Ga0075363_100016273 3300006048 Bacteria 3672
134 Ga0075364_10849286 3300006051 Bacteria 622
135 Ga0070712_100507328 3300006175 Bacteria 1012
136 Ga0097621_100018618 3300006237 Bacteria 5310
137 Ga0068871_100137146 3300006358 Bacteria 2078
138 Ga0068865_100044877 3300006881 Bacteria 3027
139 Ga0099823_1087981 3300006944 Bacteria 1097
140 Ga0099794_10479873 3300007265 Bacteria 653
141 Ga0105251_10078126 3300009011 Bacteria 1533
142 Ga0105244_10015476 3300009036 Bacteria 4374
143 Ga0105244_10019926 3300009036 Bacteria 3729
144 Ga0105244_10039890 3300009036 Bacteria 2441
145 Ga0105250_10141157 3300009092 Bacteria 999
146 Ga0105250_10339321 3300009092 Bacteria 656
147 Ga0105240_10021815 3300009093 Bacteria 8510
148 Ga0105240_10209527 3300009093 Bacteria 2279
149 Ga0105240_10307686 3300009093 Bacteria 1811
150 Ga0105245_10043502 3300009098 Bacteria 4006
151 Ga0105243_10016441 3300009148 Bacteria 5595
152 Ga0105243_11118759 3300009148 Bacteria 797
153 Ga0105243_11533616 3300009148 Bacteria 691
154 Ga0105243_13037755 3300009148 Bacteria 509
155 Ga0105241_10173179 3300009174 Bacteria 1784
156 Ga0105242_10156388 3300009176 Bacteria 1992
157 Ga0105248_10786239 3300009177 Bacteria 1074
158 Ga0105248_10951637 3300009177 Bacteria 970
159 Ga0105237_10140721 3300009545 Bacteria 2407
160 Ga0105237_10176405 3300009545 Bacteria 2137
161 Ga0105238_10002020 3300009551 Bacteria 20484
162 Ga0105238_10313151 3300009551 Bacteria 1555
163 Ga0105238_10953002 3300009551 Bacteria 878
164 Ga0105249_11042875 3300009553 Bacteria 887
165 Ga0130086_1005042 3300009829 Bacteria 2342
166 Ga0130086_1075241 3300009829 Bacteria 2349
167 Ga0130086_1091490 3300009829 Bacteria 2006
168 Ga0130085_1017480 3300009850 Bacteria 2342
169 Ga0130085_1078041 3300009850 Bacteria 2349
170 Ga0130085_1107450 3300009850 Bacteria 2006
171 Ga0105239_10030541 3300010375 Bacteria 5924
172 Ga0105239_10138610 3300010375 Bacteria 2710
173 Ga0105239_10177507 3300010375 Bacteria 2382
174 Ga0105239_11227710 3300010375 Bacteria 864
175 Ga0105246_10340845 3300011119 Bacteria 1225
176 Ga0105246_10866596 3300011119 Bacteria 807
177 Ga0157325_1004116 3300012485 Bacteria 838
178 Ga0157373_10261474 3300013100 Bacteria 1225
179 Ga0157373_10718048 3300013100 Bacteria 733
180 Ga0157371_10000710 3300013102 Bacteria 39002
181 Ga0157370_10290342 3300013104 Bacteria 1510
182 Ga0157370_10955217 3300013104 Bacteria 777
183 Ga0157369_10404300 3300013105 Bacteria 1416
184 Ga0157378_12462498 3300013297 Bacteria 572
185 Ga0163162_10719007 3300013306 Bacteria 1119
186 Ga0157372_11159304 3300013307 Bacteria 893
187 Ga0157372_12979912 3300013307 Bacteria 541
188 Ga0157375_11086602 3300013308 Bacteria 936
189 Ga0182008_10004539 3300014497 Bacteria 8101
190 Ga0182008_10005790 3300014497 Bacteria 6992
191 Ga0182008_10171183 3300014497 Bacteria 1096
192 Ga0182008_10393084 3300014497 Bacteria 743
193 Ga0157377_10226863 3300014745 Bacteria 1199
194 Ga0157376_10163721 3300014969 Bacteria 2019
195 Ga0157376_11695674 3300014969 Bacteria 667
196 Ga0182006_1000186 3300015261 Bacteria 64784
197 Ga0182006_1010089 3300015261 Bacteria 4210
198 Ga0182006_1013810 3300015261 Bacteria 3494
199 Ga0182007_10000202 3300015262 Bacteria 40165
200 Ga0182007_10018893 3300015262 Bacteria 2488
201 Ga0182007_10031144 3300015262 Bacteria 1819
202 Ga0182007_10032705 3300015262 Bacteria 1766
203 Ga0182007_10232394 3300015262 Bacteria 655
204 Ga0182005_1001571 3300015265 Bacteria 9020
205 Ga0182005_1002884 3300015265 Bacteria 5976
206 Ga0163161_10231881 3300017792 Bacteria 1433
207 Ga0163161_10236417 3300017792 Bacteria 1419
208 Ga0163161_10238636 3300017792 Bacteria 1413
209 Ga0206355_1609219 3300020076 Bacteria 522
210 Ga0206351_10512755 3300020077 Bacteria 1607
211 Ga0206350_10480254 3300020080 Bacteria 1027
212 Ga0206354_10352477 3300020081 Bacteria 1495
213 Ga0213872_10052983 3300021361 Bacteria 1840
214 Ga0213872_10067471 3300021361 Bacteria 1614
215 Ga0209435_100186 3300025206 Bacteria 18475
216 Ga0209435_100191 3300025206 Bacteria 17985
217 Ga0209436_101414 3300025208 Bacteria 8429
218 Ga0209436_101521 3300025208 Bacteria 7947
219 Ga0209784_100010 3300025224 Bacteria 683664
220 Ga0209784_100035 3300025224 Bacteria 299760
221 Ga0209566_100008 3300025225 Bacteria 683664
222 Ga0209566_100040 3300025225 Bacteria 299760
223 Ga0209674_100019 3300025226 Bacteria 683664
224 Ga0209674_100057 3300025226 Bacteria 299760
225 Ga0209672_104073 3300025228 Bacteria 2815
226 Ga0209147_100060 3300025229 Bacteria 249588
227 Ga0209563_100011 3300025230 Bacteria 1187808
228 Ga0209563_100021 3300025230 Bacteria 683764
229 Ga0209563_100059 3300025230 Bacteria 299760
230 Ga0207427_100573 3300025231 Bacteria 18544
231 Ga0209437_100019 3300025233 Bacteria 683764
232 Ga0209437_100639 3300025233 Bacteria 20468
233 Ga0209437_118485 3300025233 Bacteria 893
234 Ga0209437_119366 3300025233 Bacteria 856
235 Ga0209258_100141 3300025242 Bacteria 166385
236 Ga0207425_1001042 3300025245 Bacteria 12856
237 Ga0207425_1022002 3300025245 Bacteria 1347
238 Ga0209646_1000246 3300025246 Bacteria 55219
239 Ga0209646_1001041 3300025246 Bacteria 8366
240 Ga0209026_1004204 3300025250 Bacteria 4388
241 Ga0209026_1007856 3300025250 Bacteria 2318
242 Ga0209677_100011 3300025253 Bacteria 683664
243 Ga0209677_100036 3300025253 Bacteria 299760
244 Ga0209677_111325 3300025253 Bacteria 1401
245 Ga0209148_1000323 3300025254 Bacteria 66396
246 Ga0209148_1011865 3300025254 Bacteria 1608
247 Ga0209759_1015039 3300025256 Bacteria 2016
248 Ga0209233_1000025 3300025261 Bacteria 683764
249 Ga0209565_1006443 3300025263 Bacteria 3290
250 Ga0209565_1010529 3300025263 Bacteria 2289
251 Ga0209565_1026547 3300025263 Bacteria 1160
252 Ga0209565_1048209 3300025263 Bacteria 772
253 Ga0209565_1067964 3300025263 Bacteria 606
254 Ga0209455_1000303 3300025272 Bacteria 50385
255 Ga0209455_1005403 3300025272 Bacteria 3955
256 Ga0209673_1003465 3300025273 Bacteria 9278
257 Ga0209673_1004929 3300025273 Bacteria 6945
258 Ga0209130_1002838 3300025284 Bacteria 8041
259 Ga0209675_1002952 3300025291 Bacteria 8387
260 Ga0209675_1009571 3300025291 Bacteria 3407
261 Ga0209025_1001281 3300025294 Bacteria 34537
262 Ga0209564_1000027 3300025295 Bacteria 518458
263 Ga0209564_1000230 3300025295 Bacteria 123814
264 Ga0209564_1013777 3300025295 Bacteria 3407
265 Ga0209564_1019927 3300025295 Bacteria 2482
266 Ga0209758_1011259 3300025297 Bacteria 5207
267 Ga0209050_1000292 3300025298 Bacteria 106140
268 Ga0209256_1004685 3300025299 Bacteria 8390
269 Ga0209256_1012344 3300025299 Bacteria 3290
270 Ga0207426_1002480 3300025302 Bacteria 11738
271 Ga0209051_1055224 3300025303 Bacteria 1290
272 Ga0209257_1000295 3300025304 Bacteria 109542
273 Ga0207656_10251696 3300025321 Bacteria 866
274 Ga0207656_10287302 3300025321 Bacteria 812
275 Ga0207655_1003094 3300025728 Bacteria 12643
276 Ga0207655_1027614 3300025728 Bacteria 2700
277 Ga0207655_1142968 3300025728 Bacteria 766
278 Ga0207713_1130135 3300025735 Bacteria 834
279 Ga0207647_10261112 3300025904 Bacteria 992
280 Ga0207645_10214311 3300025907 Bacteria 1269
281 Ga0207705_11005312 3300025909 Bacteria 644
282 Ga0207684_10913197 3300025910 Bacteria 738
283 Ga0207654_10002179 3300025911 Bacteria 10027
284 Ga0207707_10487097 3300025912 Bacteria 1053
285 Ga0207695_10003953 3300025913 Bacteria 20492
286 Ga0207695_10072393 3300025913 Bacteria 3517
287 Ga0207695_10401694 3300025913 Bacteria 1255
288 Ga0207695_10953808 3300025913 Bacteria 737
289 Ga0207671_10139299 3300025914 Bacteria 1868
290 Ga0207671_10178519 3300025914 Bacteria 1652
291 Ga0207671_10579222 3300025914 Bacteria 895
292 Ga0207693_10010110 3300025915 Bacteria 7664
293 Ga0207657_10006550 3300025919 Bacteria 12056
294 Ga0207649_10056050 3300025920 Bacteria 2459
295 Ga0207649_10350719 3300025920 Bacteria 1092
296 Ga0207694_10001435 3300025924 Bacteria 20449
297 Ga0207694_10281831 3300025924 Bacteria 1365
298 Ga0207694_10295775 3300025924 Bacteria 1332
299 Ga0207650_10088896 3300025925 Bacteria 2357
300 Ga0207659_11475330 3300025926 Bacteria 582
301 Ga0207687_10591242 3300025927 Bacteria 935
302 Ga0207690_11533167 3300025932 Bacteria 557
303 Ga0207706_10313632 3300025933 Bacteria 1365
304 Ga0207686_10112187 3300025934 Bacteria 1841
305 Ga0207709_10055004 3300025935 Bacteria 2457
306 Ga0207669_10511819 3300025937 Bacteria 962
307 Ga0207704_10095815 3300025938 Bacteria 1963
308 Ga0207691_10316183 3300025940 Bacteria 1339
309 Ga0207711_10480757 3300025941 Bacteria 1157
310 Ga0207711_10734557 3300025941 Bacteria 920
311 Ga0207689_10123864 3300025942 Bacteria 2126
312 Ga0207667_10023256 3300025949 Bacteria 6824
313 Ga0207667_10042185 3300025949 Bacteria 4851
314 Ga0207667_10143578 3300025949 Bacteria 2457
315 Ga0207640_10169293 3300025981 Bacteria 1626
316 Ga0207639_10312484 3300026041 Bacteria 1392
317 Ga0207678_10543520 3300026067 Bacteria 1015
318 Ga0207648_10531514 3300026089 Bacteria 1078
319 Ga0207674_10021420 3300026116 Bacteria 6959
320 Ga0207674_10637617 3300026116 Bacteria 1029
321 Ga0207683_10480854 3300026121 Bacteria 1146
322 Ga0207698_10012103 3300026142 Bacteria 5629
323 Ga0209281_1008175 3300027111 Bacteria 2563
324 Ga0268265_10147695 3300028380 Bacteria 1978
325 Ga0316177_1138179 3300030731 Bacteria 1552
326 Ga0316176_1045076 3300030732 Bacteria 941
327 Ga0316178_1018733 3300030735 Bacteria 1607
328 Ga0316180_1160791 3300030736 Bacteria 1307
329 Ga0316183_1020377 3300030742 Bacteria 1175
330 Ga0316182_1052816 3300030745 Bacteria 807
331 Ga0316182_1275498 3300030745 Bacteria 1503
332 Ga0307408_100144522 3300031548 Bacteria 1870
333 Ga0307408_102083828 3300031548 Bacteria 547
334 Ga0307408_102093717 3300031548 Bacteria 545
335 Ga0265314_10275927 3300031711 Bacteria 953
336 Ga0307516_10309306 3300031730 Bacteria 1254
337 Ga0307405_11287052 3300031731 Bacteria 636
338 Ga0307406_10406741 3300031901 Bacteria 1080
339 Ga0307407_11519995 3300031903 Bacteria 530
340 Ga0307412_10649115 3300031911 Bacteria 900
341 Ga0307416_100004760 3300032002 Bacteria 8239
342 Ga0307414_10006142 3300032004 Bacteria 6673
343 Ga0307411_10352971 3300032005 Bacteria 1200
344 Ga0307411_10495387 3300032005 Bacteria 1032
345 Ga0307411_10595392 3300032005 Bacteria 950
346 Ga0307411_11417131 3300032005 Bacteria 636
347 Ga0307510_10280273 3300033180 Bacteria 1138
348 Ga0373949_0294284 3300035090 Bacteria 513
349 Ga0373939_0053081 3300035114 Bacteria 1265
350 Ga0373935_0201381 3300035692 Bacteria 1376
351 Ga0395899_0000078 3300037312 Bacteria 174141
352 Ga0395899_0005833 3300037312 Bacteria 9559
353 Ga0395899_0668497 3300037312 Bacteria 654
354 Ga0395899_0683208 3300037312 Bacteria 645
355 Ga0395899_1008921 3300037312 Bacteria 501
356 Ga0395900_0082284 3300037418 Bacteria 3307
357 Ga0395900_0195712 3300037418 Bacteria 2048
358 Ga0395900_0249092 3300037418 Bacteria 1778
359 Ga0395900_0560241 3300037418 Bacteria 1086
360 Ga0395900_1850502 3300037418 Bacteria 514
361 Ga0395898_0695698 3300037466 Bacteria 958
362 Ga0395898_1601238 3300037466 Bacteria 575
363 Ga0395905_0000549 3300037471 Bacteria 51321
364 Ga0395905_0007900 3300037471 Bacteria 10523
365 Ga0395905_0011730 3300037471 Bacteria 8460
366 Ga0395905_0092664 3300037471 Bacteria 2833
367 Ga0395905_0150590 3300037471 Bacteria 2189
368 Ga0395905_0537645 3300037471 Bacteria 1069
369 Ga0395905_1906850 3300037471 Bacteria 500
370 Ga0395901_0004460 3300038443 Bacteria 14123
371 Ga0395901_0094399 3300038443 Bacteria 3133
372 Ga0395901_0164294 3300038443 Bacteria 2331
373 Ga0395901_0464144 3300038443 Bacteria 1293
374 Ga0395901_0548664 3300038443 Bacteria 1171
375 Ga0395901_1464874 3300038443 Bacteria 639
376 Ga0436361_0004974 3300039447 Bacteria 978
377 Ga0436361_0171206 3300039447 Bacteria 5353
378 Ga0436361_0578689 3300039447 Bacteria 1890
379 Ga0436361_0743577 3300039447 Bacteria 2264
380 Ga0436361_0767937 3300039447 Bacteria 874
381 Ga0436361_1038070 3300039447 Bacteria 9794
382 Ga0439465_0049368 3300041413 Bacteria 1374
383 Ga0451833_0022593 3300041491 Bacteria 603
384 Ga0451853_2414847 3300041512 Bacteria 1555
385 Ga0439442_092526 3300042002 Bacteria 651
386 Ga0439448_0261686 3300042005 Bacteria 611
387 Ga0439432_126317 3300042006 Bacteria 756
388 Ga0439449_0244662 3300042007 Bacteria 674
389 Ga0439450_013480 3300042008 Bacteria 1643
390 Ga0439450_048323 3300042008 Bacteria 1004
391 Ga0439455_0027559 3300042012 Bacteria 1393
392 Ga0439455_0069102 3300042012 Bacteria 946
393 Ga0439455_0166579 3300042012 Bacteria 631
394 Ga0450921_020664 3300042123 Bacteria 624
395 Ga0450890_033574 3300042127 Bacteria 738
396 Ga0450895_019290 3300042132 Bacteria 626
397 Ga0450898_013755 3300042134 Bacteria 1353
398 Ga0450904_004772 3300042139 Bacteria 1396
399 Ga0439446_0168394 3300042156 Bacteria 727
400 Ga0439458_0076007 3300042157 Bacteria 852
401 Ga0439434_0057775 3300042435 Bacteria 1210
402 Ga0439464_0028984 3300042439 Bacteria 1545
403 Ga0466972_0005095 3300044658 Bacteria 6583
404 Ga0466972_0052412 3300044658 Bacteria 1966
405 Ga0466965_0043592 3300044683 Bacteria 2215
406 Ga0466965_0231235 3300044683 Bacteria 987
407 Ga0466965_0247551 3300044683 Bacteria 955
408 Ga0466965_0373023 3300044683 Bacteria 784
409 Ga0466965_0595604 3300044683 Bacteria 628
410 Ga0466966_0038419 3300044684 Bacteria 3085
411 Ga0466966_0978184 3300044684 Bacteria 510
412 Ga0466964_0024210 3300044706 Bacteria 2364
413 Ga0466964_0087285 3300044706 Bacteria 1351
414 Ga0466964_0152185 3300044706 Bacteria 1073
415 Ga0466964_0242638 3300044706 Bacteria 884
416 Ga0466971_0221878 3300044719 Bacteria 896
417 Ga0466971_0240173 3300044719 Bacteria 861
418 Ga0466968_0012025 3300044735 Bacteria 3381
419 Ga0466968_0207495 3300044735 Bacteria 919
420 Ga0466968_0284188 3300044735 Bacteria 792
421 Ga0466968_0327837 3300044735 Bacteria 740
422 Ga0466970_0057746 3300044765 Bacteria 2076
423 Ga0466970_0232590 3300044765 Bacteria 1030
424 Ga0466957_0167221 3300044842 Bacteria 1431
425 Ga0466957_0233015 3300044842 Bacteria 1219
426 Ga0466957_0286206 3300044842 Bacteria 1104
427 Ga0466957_0983406 3300044842 Bacteria 605
428 Ga0466960_0943304 3300044901 Bacteria 528
429 Ga0466959_0204553 3300045049 Bacteria 1373
430 Ga0451576_1776876 3300045051 Bacteria 638
431 Ga0466958_0896361 3300045836 Bacteria 578
432 Ga0466967_0948199 3300045976 Bacteria 856
433 Ga0466967_1169271 3300045976 Bacteria 766
434 Ga0466967_1605038 3300045976 Bacteria 648
435 Ga0466967_1689390 3300045976 Bacteria 630
436 Ga0495617_001026 3300046452 Bacteria 12853
437 Ga0495617_004204 3300046452 Bacteria 5264
438 Ga0495617_197794 3300046452 Bacteria 629
439 Ga0495627_026656 3300046453 Bacteria 1861
440 Ga0495627_045406 3300046453 Bacteria 1338
441 Ga0495592_0139781 3300046454 Bacteria 1685
442 Ga0495603_0007446 3300046455 Bacteria 6583
443 Ga0495603_0066125 3300046455 Bacteria 2129
444 Ga0495603_0164238 3300046455 Bacteria 1287
445 Ga0495603_0533480 3300046455 Bacteria 672
446 Ga0495590_0000020 3300046457 Bacteria 212352
447 Ga0495590_0005309 3300046457 Bacteria 5113
448 Ga0495590_0018848 3300046457 Bacteria 2465
449 Ga0495590_0029266 3300046457 Bacteria 1931
450 Ga0495590_0037945 3300046457 Bacteria 1679
451 Ga0495590_0124562 3300046457 Bacteria 924
452 Ga0495590_0233781 3300046457 Bacteria 681
453 Ga0495590_0249208 3300046457 Bacteria 660
454 Ga0495591_008200 3300046458 Bacteria 4305
455 Ga0495591_061027 3300046458 Bacteria 1001
456 Ga0495629_0415305 3300046459 Bacteria 913
457 Ga0495638_0000408 3300046460 Bacteria 52490
458 Ga0495638_0010010 3300046460 Bacteria 6610
459 Ga0495638_0010721 3300046460 Bacteria 6343
460 Ga0495638_0069655 3300046460 Bacteria 2155
461 Ga0495638_0463668 3300046460 Bacteria 644
462 Ga0495651_0061481 3300046462 Bacteria 2874
463 Ga0495651_0108148 3300046462 Bacteria 2059
464 Ga0495653_0003544 3300046463 Bacteria 12573
465 Ga0495653_0025764 3300046463 Bacteria 4718
466 Ga0495653_0042103 3300046463 Bacteria 3559
467 Ga0495653_0504877 3300046463 Bacteria 753
468 Ga0495650_0008022 3300046471 Bacteria 6240
469 Ga0495650_0009500 3300046471 Bacteria 5522
470 Ga0495650_0017326 3300046471 Bacteria 3614
471 Ga0495650_0032252 3300046471 Bacteria 2345
472 Ga0495650_0058728 3300046471 Bacteria 1551
473 Ga0495580_0008648 3300046472 Bacteria 8072
474 Ga0495580_0245555 3300046472 Bacteria 1226
475 Ga0495580_0370728 3300046472 Bacteria 968
476 Ga0495580_0743097 3300046472 Bacteria 639
477 Ga0495582_0013331 3300046473 Bacteria 4524
478 Ga0495582_0049936 3300046473 Bacteria 2304
479 Ga0495582_0057380 3300046473 Bacteria 2146
480 Ga0495605_0003232 3300046474 Bacteria 9782
481 Ga0495605_0013410 3300046474 Bacteria 4516
482 Ga0495605_0013696 3300046474 Bacteria 4456
483 Ga0495605_0071613 3300046474 Bacteria 1636
484 Ga0495605_0082794 3300046474 Bacteria 1498
485 Ga0495605_0103420 3300046474 Bacteria 1306
486 Ga0495605_0105953 3300046474 Bacteria 1287
487 Ga0495605_0190560 3300046474 Bacteria 897
488 Ga0495605_0195503 3300046474 Bacteria 883
489 Ga0495605_0224230 3300046474 Bacteria 811
490 Ga0495639_0181988 3300046475 Bacteria 1023
491 Ga0495639_0570768 3300046475 Bacteria 580
492 Ga0495584_0002812 3300046491 Bacteria 9712
493 Ga0495584_0020283 3300046491 Bacteria 3378
494 Ga0495584_0051866 3300046491 Bacteria 2064
495 Ga0495584_0060945 3300046491 Bacteria 1896
496 Ga0495584_0075775 3300046491 Bacteria 1691
497 Ga0495584_0081139 3300046491 Bacteria 1632
498 Ga0495584_0103631 3300046491 Bacteria 1438
499 Ga0495584_0113268 3300046491 Bacteria 1372
500 Ga0495584_0120831 3300046491 Bacteria 1326
501 Ga0495584_0125919 3300046491 Bacteria 1298
502 Ga0495584_0167318 3300046491 Bacteria 1117
503 Ga0495584_0287350 3300046491 Bacteria 835
504 Ga0495584_0355186 3300046491 Bacteria 744
505 Ga0495584_0452034 3300046491 Bacteria 653
506 Ga0495584_0502519 3300046491 Bacteria 617
507 Ga0495585_0012012 3300046492 Bacteria 5110
508 Ga0495585_0015837 3300046492 Bacteria 4377
509 Ga0495585_0047201 3300046492 Bacteria 2399
510 Ga0495585_0047852 3300046492 Bacteria 2379
511 Ga0495585_0063130 3300046492 Bacteria 2033
512 Ga0495585_0137156 3300046492 Bacteria 1283
513 Ga0495585_0137334 3300046492 Bacteria 1282
514 Ga0495585_0143002 3300046492 Bacteria 1251
515 Ga0495585_0149517 3300046492 Bacteria 1218
516 Ga0495585_0159448 3300046492 Bacteria 1171
517 Ga0495585_0174673 3300046492 Bacteria 1107
518 Ga0495585_0270942 3300046492 Bacteria 841
519 Ga0495585_0290070 3300046492 Bacteria 806
520 Ga0495585_0331337 3300046492 Bacteria 742
521 Ga0495585_0357830 3300046492 Bacteria 708
522 Ga0495585_0406997 3300046492 Bacteria 654
523 Ga0495585_0436392 3300046492 Bacteria 627
524 Ga0495585_0523948 3300046492 Bacteria 561
525 Ga0495594_0020007 3300046499 Bacteria 3562
526 Ga0495594_0186729 3300046499 Bacteria 1180
527 Ga0495594_0302827 3300046499 Bacteria 910
528 Ga0495594_0330178 3300046499 Bacteria 868
529 Ga0495594_0338015 3300046499 Bacteria 857
530 Ga0495594_0660763 3300046499 Bacteria 591
531 Ga0495596_0005175 3300046500 Bacteria 6209
532 Ga0495596_0021654 3300046500 Bacteria 2621
533 Ga0495596_0040721 3300046500 Bacteria 1833
534 Ga0495596_0044056 3300046500 Bacteria 1757
535 Ga0495596_0059412 3300046500 Bacteria 1490
536 Ga0495596_0277946 3300046500 Bacteria 650
537 Ga0495596_0295666 3300046500 Bacteria 629
538 Ga0495596_0296545 3300046500 Bacteria 628
539 Ga0495607_0090940 3300046501 Bacteria 1653
540 Ga0495607_0099837 3300046501 Bacteria 1556
541 Ga0495607_0123713 3300046501 Bacteria 1354
542 Ga0495607_0141517 3300046501 Bacteria 1240
543 Ga0495607_0162714 3300046501 Bacteria 1132
544 Ga0495607_0196673 3300046501 Bacteria 1000
545 Ga0495607_0283948 3300046501 Bacteria 784
546 Ga0495607_0379756 3300046501 Bacteria 646
547 Ga0495583_0000310 3300046506 Bacteria 77200
548 Ga0495583_0006309 3300046506 Bacteria 7786
549 Ga0495583_0008959 3300046506 Bacteria 6037
550 Ga0495583_0013755 3300046506 Bacteria 4495
551 Ga0495583_0039755 3300046506 Bacteria 2213
552 Ga0495583_0041060 3300046506 Bacteria 2169
553 Ga0495583_0047710 3300046506 Bacteria 1968
554 Ga0495583_0094961 3300046506 Bacteria 1279
555 Ga0495583_0096954 3300046506 Bacteria 1262
556 Ga0495583_0122294 3300046506 Bacteria 1094
557 Ga0495583_0131777 3300046506 Bacteria 1045
558 Ga0495583_0197012 3300046506 Bacteria 819
559 Ga0495583_0251356 3300046506 Bacteria 709
560 Ga0495606_0007181 3300046507 Bacteria 10052
561 Ga0495606_0013036 3300046507 Bacteria 6605
562 Ga0495606_0019502 3300046507 Bacteria 5042
563 Ga0495606_0039988 3300046507 Bacteria 3154
564 Ga0495606_0108118 3300046507 Bacteria 1681
565 Ga0495606_0109444 3300046507 Bacteria 1668
566 Ga0495606_0148706 3300046507 Bacteria 1376
567 Ga0495606_0149612 3300046507 Bacteria 1371
568 Ga0495606_0193919 3300046507 Bacteria 1162
569 Ga0495606_0217296 3300046507 Bacteria 1079
570 Ga0495606_0284940 3300046507 Bacteria 901
571 Ga0495606_0293819 3300046507 Bacteria 883
572 Ga0495606_0313019 3300046507 Bacteria 846
573 Ga0495606_0325847 3300046507 Bacteria 823
574 Ga0495606_0379068 3300046507 Bacteria 742
575 Ga0495606_0435842 3300046507 Bacteria 674
576 Ga0495606_0526404 3300046507 Bacteria 592
577 Ga0495608_0027939 3300046511 Bacteria 3835
578 Ga0495608_0087527 3300046511 Bacteria 2017
579 Ga0495610_0003877 3300046512 Bacteria 11361
580 Ga0495610_0018155 3300046512 Bacteria 3981
581 Ga0495610_0023962 3300046512 Bacteria 3303
582 Ga0495610_0027750 3300046512 Bacteria 3003
583 Ga0495610_0198124 3300046512 Bacteria 824
584 Ga0495610_0203181 3300046512 Bacteria 810
585 Ga0495616_0002539 3300046513 Bacteria 12051
586 Ga0495616_0020539 3300046513 Bacteria 3590
587 Ga0495616_0022828 3300046513 Bacteria 3374
588 Ga0495616_0103362 3300046513 Bacteria 1333
589 Ga0495616_0160497 3300046513 Bacteria 1011
590 Ga0495616_0188240 3300046513 Bacteria 913
591 Ga0495616_0209358 3300046513 Bacteria 853
592 Ga0495616_0322294 3300046513 Bacteria 648
593 Ga0495618_0079070 3300046514 Bacteria 2097
594 Ga0495618_0606092 3300046514 Bacteria 651
595 Ga0495620_0011229 3300046515 Bacteria 4681
596 Ga0495628_0051980 3300046516 Bacteria 3237
597 Ga0495628_0153435 3300046516 Bacteria 1753
598 Ga0495630_0473133 3300046517 Bacteria 960
599 Ga0495630_0528698 3300046517 Bacteria 904
600 Ga0495631_0026738 3300046518 Bacteria 2645
601 Ga0495631_0037499 3300046518 Bacteria 2159
602 Ga0495631_0037577 3300046518 Bacteria 2156
603 Ga0495631_0073566 3300046518 Bacteria 1475
604 Ga0495631_0091500 3300046518 Bacteria 1309
605 Ga0495631_0093621 3300046518 Bacteria 1293
606 Ga0495631_0103090 3300046518 Bacteria 1227
607 Ga0495631_0106058 3300046518 Bacteria 1208
608 Ga0495631_0174114 3300046518 Bacteria 922
609 Ga0495631_0182275 3300046518 Bacteria 899
610 Ga0495631_0211047 3300046518 Bacteria 829
611 Ga0495631_0269289 3300046518 Bacteria 725
612 Ga0495632_0041954 3300046519 Bacteria 2295
613 Ga0495632_0052841 3300046519 Bacteria 1996
614 Ga0495632_0112463 3300046519 Bacteria 1277
615 Ga0495632_0154007 3300046519 Bacteria 1061
616 Ga0495632_0166880 3300046519 Bacteria 1012
617 Ga0495632_0195587 3300046519 Bacteria 922
618 Ga0495637_0001714 3300046520 Bacteria 12614
619 Ga0495637_0013614 3300046520 Bacteria 3857
620 Ga0495637_0027010 3300046520 Bacteria 2571
621 Ga0495637_0044618 3300046520 Bacteria 1886
622 Ga0495637_0074308 3300046520 Bacteria 1365
623 Ga0495637_0107325 3300046520 Bacteria 1085
624 Ga0495637_0294839 3300046520 Bacteria 576
625 Ga0495643_0010644 3300046522 Bacteria 5651
626 Ga0495643_0032093 3300046522 Bacteria 2917
627 Ga0495643_0065304 3300046522 Bacteria 1921
628 Ga0495643_0066699 3300046522 Bacteria 1897
629 Ga0495643_0078750 3300046522 Bacteria 1719
630 Ga0495643_0081093 3300046522 Bacteria 1687
631 Ga0495643_0085218 3300046522 Bacteria 1638
632 Ga0495643_0091504 3300046522 Bacteria 1568
633 Ga0495643_0118867 3300046522 Bacteria 1337
634 Ga0495643_0139286 3300046522 Bacteria 1211
635 Ga0495643_0192027 3300046522 Bacteria 985
636 Ga0495643_0221022 3300046522 Bacteria 898
637 Ga0495643_0226757 3300046522 Bacteria 883
638 Ga0495644_0027051 3300046523 Bacteria 2174
639 Ga0495644_0035051 3300046523 Bacteria 1894
640 Ga0495644_0083860 3300046523 Bacteria 1201
641 Ga0495644_0084397 3300046523 Bacteria 1197
642 Ga0495644_0088545 3300046523 Bacteria 1167
643 Ga0495644_0098570 3300046523 Bacteria 1105
644 Ga0495644_0112630 3300046523 Bacteria 1032
645 Ga0495644_0113788 3300046523 Bacteria 1027
646 Ga0495644_0120039 3300046523 Bacteria 999
647 Ga0495648_0013276 3300046524 Bacteria 6100
648 Ga0495648_0034037 3300046524 Bacteria 3321
649 Ga0495648_0042742 3300046524 Bacteria 2848
650 Ga0495648_0069259 3300046524 Bacteria 2054
651 Ga0495648_0107232 3300046524 Bacteria 1527
652 Ga0495648_0167280 3300046524 Bacteria 1130
653 Ga0495648_0175469 3300046524 Bacteria 1094
654 Ga0495648_0179256 3300046524 Bacteria 1078
655 Ga0495663_0010607 3300046525 Bacteria 2563
656 Ga0495663_0031792 3300046525 Bacteria 1569
657 Ga0495663_0093960 3300046525 Bacteria 980
658 Ga0495663_0123673 3300046525 Bacteria 868
659 Ga0495663_0150239 3300046525 Bacteria 794
660 Ga0495663_0181453 3300046525 Bacteria 729
661 Ga0495666_0087815 3300046526 Bacteria 1468
662 Ga0495666_0178036 3300046526 Bacteria 982
663 Ga0495666_0244369 3300046526 Bacteria 818
664 Ga0495666_0268240 3300046526 Bacteria 775
665 Ga0495666_0293812 3300046526 Bacteria 735
666 Ga0495642_0004349 3300046528 Bacteria 5500
667 Ga0495642_0021122 3300046528 Bacteria 2559
668 Ga0495642_0027378 3300046528 Bacteria 2268
669 Ga0495642_0048979 3300046528 Bacteria 1734
670 Ga0495642_0052249 3300046528 Bacteria 1682
671 Ga0495642_0061666 3300046528 Bacteria 1556
672 Ga0495642_0066277 3300046528 Bacteria 1504
673 Ga0495642_0067965 3300046528 Bacteria 1486
674 Ga0495642_0096136 3300046528 Bacteria 1257
675 Ga0495642_0115352 3300046528 Bacteria 1150
676 Ga0495642_0124442 3300046528 Bacteria 1107
677 Ga0495642_0127967 3300046528 Bacteria 1092
678 Ga0495642_0178962 3300046528 Bacteria 922
679 Ga0495642_0182863 3300046528 Bacteria 912
680 Ga0495642_0213288 3300046528 Bacteria 842
681 Ga0495642_0324610 3300046528 Bacteria 675
682 Ga0495652_0027829 3300046529 Bacteria 4980
683 Ga0495652_0035148 3300046529 Bacteria 4362
684 Ga0495652_0271463 3300046529 Bacteria 1246
685 Ga0495652_0314968 3300046529 Bacteria 1132
686 Ga0495652_0503440 3300046529 Bacteria 839
687 Ga0495654_0000115 3300046530 Bacteria 91440
688 Ga0495654_0065073 3300046530 Bacteria 1741
689 Ga0495654_0077712 3300046530 Bacteria 1561
690 Ga0495654_0082162 3300046530 Bacteria 1508
691 Ga0495654_0091742 3300046530 Bacteria 1408
692 Ga0495654_0115950 3300046530 Bacteria 1217
693 Ga0495654_0160159 3300046530 Bacteria 988
694 Ga0495654_0168280 3300046530 Bacteria 957
695 Ga0495665_0046360 3300046531 Bacteria 2307
696 Ga0495665_0055908 3300046531 Bacteria 2083
697 Ga0495665_0081402 3300046531 Bacteria 1702
698 Ga0495665_0192065 3300046531 Bacteria 1059
699 Ga0495665_0482052 3300046531 Bacteria 625
700 Ga0495640_0305576 3300046533 Bacteria 987
701 Ga0495640_0307279 3300046533 Bacteria 984
702 Ga0495586_0034290 3300046535 Bacteria 2725
703 Ga0495586_0052978 3300046535 Bacteria 2197
704 Ga0495586_0121477 3300046535 Bacteria 1459
705 Ga0495587_0015602 3300046536 Bacteria 4739
706 Ga0495587_0118398 3300046536 Bacteria 1517
707 Ga0495587_0246276 3300046536 Bacteria 1005
708 Ga0495587_0334153 3300046536 Bacteria 845
709 Ga0495598_0217997 3300046537 Bacteria 695
710 Ga0495598_0264374 3300046537 Bacteria 641
711 Ga0495609_0002112 3300046538 Bacteria 12496
712 Ga0495609_0003741 3300046538 Bacteria 8588
713 Ga0495609_0005231 3300046538 Bacteria 6903
714 Ga0495609_0010718 3300046538 Bacteria 4385
715 Ga0495609_0073530 3300046538 Bacteria 1499
716 Ga0495609_0088916 3300046538 Bacteria 1344
717 Ga0495609_0098226 3300046538 Bacteria 1269
718 Ga0495609_0135374 3300046538 Bacteria 1053
719 Ga0495609_0138755 3300046538 Bacteria 1038
720 Ga0495609_0324097 3300046538 Bacteria 624
721 Ga0495621_0124882 3300046539 Bacteria 997
722 Ga0495621_0129299 3300046539 Bacteria 981
723 Ga0495621_0239139 3300046539 Bacteria 739
724 Ga0495597_0008648 3300046542 Bacteria 5090
725 Ga0495597_0039483 3300046542 Bacteria 2113
726 Ga0495597_0051584 3300046542 Bacteria 1813
727 Ga0495597_0071899 3300046542 Bacteria 1488
728 Ga0495597_0090026 3300046542 Bacteria 1303
729 Ga0495597_0098005 3300046542 Bacteria 1238
730 Ga0495597_0112166 3300046542 Bacteria 1142
731 Ga0495597_0123957 3300046542 Bacteria 1075
732 Ga0495597_0137308 3300046542 Bacteria 1010
733 Ga0495597_0173986 3300046542 Bacteria 872
734 Ga0495597_0184857 3300046542 Bacteria 840
735 Ga0495597_0196766 3300046542 Bacteria 808
736 Ga0495645_0099543 3300046543 Bacteria 2068
737 Ga0495645_0158047 3300046543 Bacteria 1569
738 Ga0495645_0380992 3300046543 Bacteria 902
739 Ga0495622_0010681 3300046557 Bacteria 4235
740 Ga0495622_0075497 3300046557 Bacteria 1553
741 Ga0495622_0087025 3300046557 Bacteria 1436
742 Ga0495622_0142933 3300046557 Bacteria 1086
743 Ga0495622_0143997 3300046557 Bacteria 1081
744 Ga0495622_0197854 3300046557 Bacteria 896
745 Ga0495622_0202751 3300046557 Bacteria 883
746 Ga0495622_0209861 3300046557 Bacteria 865
747 Ga0495622_0213533 3300046557 Bacteria 856
748 Ga0495633_0016754 3300046558 Bacteria 3768
749 Ga0495633_0040031 3300046558 Bacteria 2234
750 Ga0495633_0046083 3300046558 Bacteria 2063
751 Ga0495633_0047892 3300046558 Bacteria 2020
752 Ga0495633_0069829 3300046558 Bacteria 1639
753 Ga0495633_0113004 3300046558 Bacteria 1259
754 Ga0495633_0131615 3300046558 Bacteria 1157
755 Ga0495633_0171891 3300046558 Bacteria 998
756 Ga0495633_0254752 3300046558 Bacteria 800
757 Ga0495633_0276289 3300046558 Bacteria 764
758 Ga0495633_0282116 3300046558 Bacteria 755
759 Ga0495633_0300229 3300046558 Bacteria 729
760 Ga0495633_0345992 3300046558 Bacteria 674
761 Ga0495633_0359431 3300046558 Bacteria 659
762 Ga0495667_0076074 3300046559 Bacteria 2184
763 Ga0495656_0006272 3300046615 Bacteria 4164
764 Ga0495656_0070784 3300046615 Bacteria 1548
765 Ga0495656_0101671 3300046615 Bacteria 1330
766 Ga0495656_0150503 3300046615 Bacteria 1123
767 Ga0495656_0288364 3300046615 Bacteria 838
768 Ga0495656_0302232 3300046615 Bacteria 820
769 Ga0495656_0310447 3300046615 Bacteria 810
770 Ga0495668_0007707 3300046616 Bacteria 6842
771 Ga0495668_0020876 3300046616 Bacteria 3761
772 Ga0495668_0025580 3300046616 Bacteria 3353
773 Ga0495668_0054798 3300046616 Bacteria 2202
774 Ga0495668_0057793 3300046616 Bacteria 2140
775 Ga0495668_0067174 3300046616 Bacteria 1972
776 Ga0495668_0102990 3300046616 Bacteria 1561
777 Ga0495668_0157367 3300046616 Bacteria 1244
778 Ga0495668_0216198 3300046616 Bacteria 1049
779 Ga0495668_0216973 3300046616 Bacteria 1047
780 Ga0495668_0244514 3300046616 Bacteria 982
781 Ga0495668_0283014 3300046616 Bacteria 908
782 Ga0495668_0316831 3300046616 Bacteria 855
783 Ga0495668_0438164 3300046616 Bacteria 719
784 Ga0495668_0572655 3300046616 Bacteria 623
785 Ga0495668_0810551 3300046616 Bacteria 518
786 Ga0495634_0019079 3300046642 Bacteria 4874
787 Ga0495634_0192943 3300046642 Bacteria 1269
788 Ga0495611_0013452 3300046648 Bacteria 3484
789 Ga0495611_0051565 3300046648 Bacteria 1854
790 Ga0495611_0066175 3300046648 Bacteria 1647
791 Ga0495611_0077598 3300046648 Bacteria 1523
792 Ga0495611_0099340 3300046648 Bacteria 1350
793 Ga0495611_0167304 3300046648 Bacteria 1027
794 Ga0495611_0191501 3300046648 Bacteria 954
795 Ga0495611_0309654 3300046648 Bacteria 727
796 Ga0495625_0020104 3300046660 Bacteria 5160
797 Ga0495625_0021030 3300046660 Bacteria 5029
798 Ga0495625_0022675 3300046660 Bacteria 4809
799 Ga0495625_0053638 3300046660 Bacteria 2882
800 Ga0495625_0078068 3300046660 Bacteria 2311
801 Ga0495625_0134180 3300046660 Bacteria 1675
802 Ga0495625_0263877 3300046660 Bacteria 1114
803 Ga0495625_0322930 3300046660 Bacteria 982
804 Ga0495625_0347986 3300046660 Bacteria 937
805 Ga0495635_0014432 3300046663 Bacteria 5526
806 Ga0495635_0068579 3300046663 Bacteria 2432
807 Ga0495659_0012672 3300046664 Bacteria 2735
808 Ga0495659_0020773 3300046664 Bacteria 2208
809 Ga0495659_0047516 3300046664 Bacteria 1552
810 Ga0495659_0121116 3300046664 Bacteria 1030
811 Ga0495659_0309852 3300046664 Bacteria 668
812 Ga0495659_0447522 3300046664 Bacteria 562
813 Ga0495659_0470245 3300046664 Bacteria 549
814 Ga0495661_0010669 3300046665 Bacteria 6258
815 Ga0495661_0018478 3300046665 Bacteria 4584
816 Ga0495661_0058552 3300046665 Bacteria 2296
817 Ga0495661_0058855 3300046665 Bacteria 2288
818 Ga0495661_0077557 3300046665 Bacteria 1924
819 Ga0495661_0088865 3300046665 Bacteria 1762
820 Ga0495661_0115856 3300046665 Bacteria 1487
821 Ga0495661_0124105 3300046665 Bacteria 1422
822 Ga0495661_0149912 3300046665 Bacteria 1260
823 Ga0495661_0153590 3300046665 Bacteria 1241
824 Ga0495661_0156350 3300046665 Bacteria 1227
825 Ga0495661_0167032 3300046665 Bacteria 1176
826 Ga0495661_0199840 3300046665 Bacteria 1047
827 Ga0495661_0223551 3300046665 Bacteria 974
828 Ga0495661_0228249 3300046665 Bacteria 961
829 Ga0495661_0241389 3300046665 Bacteria 926
830 Ga0495661_0258570 3300046665 Bacteria 885
831 Ga0495661_0397778 3300046665 Bacteria 670
832 Ga0495661_0465733 3300046665 Bacteria 606
833 Ga0495661_0478009 3300046665 Bacteria 596
834 Ga0495661_0510115 3300046665 Bacteria 572
835 Ga0495588_0010876 3300046674 Bacteria 4252
836 Ga0495588_0014904 3300046674 Bacteria 3730
837 Ga0495588_0040459 3300046674 Bacteria 2377
838 Ga0495588_0062419 3300046674 Bacteria 1931
839 Ga0495588_0114119 3300046674 Bacteria 1423
840 Ga0495588_0120582 3300046674 Bacteria 1382
841 Ga0495588_0126731 3300046674 Bacteria 1346
842 Ga0495588_0169163 3300046674 Bacteria 1155
843 Ga0495588_0269792 3300046674 Bacteria 896
844 Ga0495588_0284320 3300046674 Bacteria 871
845 Ga0495588_0383066 3300046674 Bacteria 738
846 Ga0495588_0459929 3300046674 Bacteria 667
847 Ga0495657_0029648 3300046675 Bacteria 3836
848 Ga0495657_0353281 3300046675 Bacteria 870
849 Ga0495599_0007721 3300046678 Bacteria 6532
850 Ga0495599_0184025 3300046678 Bacteria 1287
851 Ga0495599_0416237 3300046678 Bacteria 799
852 Ga0495623_0068842 3300046679 Bacteria 2206
853 Ga0495623_0076509 3300046679 Bacteria 2076
854 Ga0495623_0205957 3300046679 Bacteria 1128
855 Ga0495623_0218757 3300046679 Bacteria 1086
856 Ga0495623_0283811 3300046679 Bacteria 920
857 Ga0495623_0312291 3300046679 Bacteria 865
858 Ga0495623_0380325 3300046679 Bacteria 763
859 Ga0495646_0112772 3300046680 Bacteria 1546
860 Ga0495646_0181463 3300046680 Bacteria 1155
861 Ga0495646_0253356 3300046680 Bacteria 942
862 Ga0495646_0333161 3300046680 Bacteria 797
863 Ga0495646_0637124 3300046680 Bacteria 539
864 Ga0495658_0224387 3300046683 Bacteria 1177
865 Ga0495669_0021103 3300046684 Bacteria 2824
866 Ga0495669_0056751 3300046684 Bacteria 1765
867 Ga0495669_0065000 3300046684 Bacteria 1655
868 Ga0495669_0067620 3300046684 Bacteria 1624
869 Ga0495669_0086910 3300046684 Bacteria 1440
870 Ga0495669_0112795 3300046684 Bacteria 1270
871 Ga0495669_0215544 3300046684 Bacteria 919
872 Ga0495669_0221649 3300046684 Bacteria 906
873 Ga0495613_0065356 3300046689 Bacteria 2658
874 Ga0495613_0253770 3300046689 Bacteria 1227
875 Ga0495613_0394069 3300046689 Bacteria 945
876 Ga0495624_0078632 3300046690 Bacteria 2045
877 Ga0495624_0121558 3300046690 Bacteria 1603
878 Ga0495624_0123298 3300046690 Bacteria 1591
879 Ga0495624_0777347 3300046690 Bacteria 566
880 Ga0495670_0042081 3300046691 Bacteria 2279
881 Ga0495670_0044966 3300046691 Bacteria 2204
882 Ga0495670_0046118 3300046691 Bacteria 2176
883 Ga0495670_0082751 3300046691 Bacteria 1636
884 Ga0495670_0152880 3300046691 Bacteria 1210
885 Ga0495670_0165436 3300046691 Bacteria 1163
886 Ga0495670_0172779 3300046691 Bacteria 1138
887 Ga0495670_0200169 3300046691 Bacteria 1057
888 Ga0495670_0298224 3300046691 Bacteria 863
889 Ga0495670_0329266 3300046691 Bacteria 820
890 Ga0495670_0337191 3300046691 Bacteria 810
891 Ga0495670_0638070 3300046691 Bacteria 580
892 Ga0495671_0016693 3300046692 Bacteria 3916
893 Ga0495671_0029072 3300046692 Bacteria 2841
894 Ga0495671_0049468 3300046692 Bacteria 2095
895 Ga0495671_0078583 3300046692 Bacteria 1617
896 Ga0495671_0116767 3300046692 Bacteria 1302
897 Ga0495671_0145008 3300046692 Bacteria 1156
898 Ga0495671_0182117 3300046692 Bacteria 1020
899 Ga0495671_0210520 3300046692 Bacteria 942
900 Ga0495671_0398155 3300046692 Bacteria 659
901 Ga0495649_0014801 3300046694 Bacteria 4457
902 Ga0495649_0024341 3300046694 Bacteria 3376
903 Ga0495649_0053355 3300046694 Bacteria 2188
904 Ga0495649_0060727 3300046694 Bacteria 2033
905 Ga0495649_0120385 3300046694 Bacteria 1388
906 Ga0495649_0184805 3300046694 Bacteria 1086
907 Ga0495649_0198523 3300046694 Bacteria 1042
908 Ga0495649_0482298 3300046694 Bacteria 617
909 Ga0495649_0588584 3300046694 Bacteria 549
910 Ga0495589_0014565 3300046794 Bacteria 4046
911 Ga0495589_0022141 3300046794 Bacteria 3245
912 Ga0495589_0043731 3300046794 Bacteria 2228
913 Ga0495589_0085487 3300046794 Bacteria 1532
914 Ga0495589_0085914 3300046794 Bacteria 1528
915 Ga0495589_0088958 3300046794 Bacteria 1499
916 Ga0495589_0106067 3300046794 Bacteria 1357
917 Ga0495589_0120451 3300046794 Bacteria 1263
918 Ga0495589_0137014 3300046794 Bacteria 1173
919 Ga0495589_0177569 3300046794 Bacteria 1011
920 Ga0495589_0228246 3300046794 Bacteria 873
921 Ga0495589_0306391 3300046794 Bacteria 735
922 Ga0495589_0328935 3300046794 Bacteria 705
923 Ga0495589_0411505 3300046794 Bacteria 620
924 Ga0495600_0011381 3300046809 Bacteria 5543
925 Ga0495600_0075615 3300046809 Bacteria 2199
926 Ga0495600_0169292 3300046809 Bacteria 1410
927 Ga0495600_0300712 3300046809 Bacteria 1012
928 Ga0495660_0003674 3300046810 Bacteria 9441
929 Ga0495660_0007171 3300046810 Bacteria 6566
930 Ga0495660_0030863 3300046810 Bacteria 3017
931 Ga0495660_0054740 3300046810 Bacteria 2161
932 Ga0495660_0091402 3300046810 Bacteria 1581
933 Ga0495660_0147915 3300046810 Bacteria 1162
934 Ga0495660_0154468 3300046810 Bacteria 1130
935 Ga0495660_0168230 3300046810 Bacteria 1069
936 Ga0495660_0219733 3300046810 Bacteria 896
937 Ga0495660_0232924 3300046810 Bacteria 862
938 Ga0495660_0308179 3300046810 Bacteria 715
939 Ga0495581_0011795 3300047315 Bacteria 5059
940 Ga0495581_0084029 3300047315 Bacteria 1844
941 Ga0495581_0360631 3300047315 Bacteria 848
942 Ga0495581_0381506 3300047315 Bacteria 822
943 Ga0495581_0723677 3300047315 Bacteria 573
944 Ga0495604_0098589 3300047317 Bacteria 2152
945 Ga0495604_0113202 3300047317 Bacteria 1975
946 Ga0495604_0145750 3300047317 Bacteria 1687
947 Ga0495604_0351376 3300047317 Bacteria 979
948 Ga0495604_0521019 3300047317 Bacteria 769
949 Ga0495636_0006088 3300047318 Bacteria 4736
950 Ga0495636_0006698 3300047318 Bacteria 4530
951 Ga0495636_0007040 3300047318 Bacteria 4424
952 Ga0495636_0022781 3300047318 Bacteria 2534
953 Ga0495636_0162291 3300047318 Bacteria 1007
954 Ga0495636_0287990 3300047318 Bacteria 766
955 Ga0495636_0535779 3300047318 Bacteria 568
956 Ga0495674_0035014 3300047319 Bacteria 4533
957 Ga0495672_0019097 3300047320 Bacteria 4531
958 Ga0495672_0020418 3300047320 Bacteria 4343
959 Ga0495672_0026706 3300047320 Bacteria 3679
960 Ga0495672_0059705 3300047320 Bacteria 2205
961 Ga0495672_0078821 3300047320 Bacteria 1841
962 Ga0495672_0083387 3300047320 Bacteria 1775
963 Ga0495672_0144473 3300047320 Bacteria 1239
964 Ga0495672_0205361 3300047320 Bacteria 982
965 Ga0495672_0350773 3300047320 Bacteria 685
966 Ga0495676_0059819 3300047321 Bacteria 2989
967 Ga0495676_0093491 3300047321 Bacteria 2242
968 Ga0495676_0173448 3300047321 Bacteria 1516
969 Ga0495676_0257446 3300047321 Bacteria 1188
970 Ga0495676_0304389 3300047321 Bacteria 1074
971 Ga0495676_0495608 3300047321 Bacteria 802
972 Ga0495680_0081403 3300047322 Bacteria 2444
973 Ga0495680_0082868 3300047322 Bacteria 2419
974 Ga0495680_0344851 3300047322 Bacteria 1038
975 Ga0495680_0537176 3300047322 Bacteria 789
976 Ga0495683_0025191 3300047323 Bacteria 3050
977 Ga0495683_0037514 3300047323 Bacteria 2456
978 Ga0495683_0070704 3300047323 Bacteria 1713
979 Ga0495683_0140598 3300047323 Bacteria 1131
980 Ga0495683_0142576 3300047323 Bacteria 1121
981 Ga0495683_0151837 3300047323 Bacteria 1077
982 Ga0495683_0186374 3300047323 Bacteria 944
983 Ga0495683_0233898 3300047323 Bacteria 813
984 Ga0495683_0234859 3300047323 Bacteria 811
985 Ga0495683_0322969 3300047323 Bacteria 657
986 Ga0495683_0326250 3300047323 Bacteria 653
987 Ga0495687_000370 3300047443 Bacteria 56035
988 Ga0495687_007822 3300047443 Bacteria 6222
989 Ga0495687_014326 3300047443 Bacteria 4086
990 Ga0495687_024856 3300047443 Bacteria 2840
991 Ga0495687_029913 3300047443 Bacteria 2513
992 Ga0495687_036882 3300047443 Bacteria 2182
993 Ga0495687_088588 3300047443 Bacteria 1191
994 Ga0495687_090810 3300047443 Bacteria 1169
995 Ga0495687_097393 3300047443 Bacteria 1111
996 Ga0495675_0151163 3300047444 Bacteria 1434
997 Ga0495675_0229325 3300047444 Bacteria 1121
998 Ga0495675_0243254 3300047444 Bacteria 1082
999 Ga0495675_0361090 3300047444 Bacteria 852
1000 Ga0495675_0526632 3300047444 Bacteria 676
1001 Ga0495677_0006314 3300047445 Bacteria 4477
1002 Ga0495677_0006510 3300047445 Bacteria 4412
1003 Ga0495677_0026532 3300047445 Bacteria 2101
1004 Ga0495677_0032012 3300047445 Bacteria 1914
1005 Ga0495677_0043835 3300047445 Bacteria 1640
1006 Ga0495677_0070385 3300047445 Bacteria 1303
1007 Ga0495677_0085894 3300047445 Bacteria 1182
1008 Ga0495677_0087226 3300047445 Bacteria 1173
1009 Ga0495677_0089584 3300047445 Bacteria 1158
1010 Ga0495677_0093603 3300047445 Bacteria 1133
1011 Ga0495677_0097213 3300047445 Bacteria 1112
1012 Ga0495677_0181154 3300047445 Bacteria 816
1013 Ga0495677_0215504 3300047445 Bacteria 747
1014 Ga0495677_0278112 3300047445 Bacteria 656
1015 Ga0495677_0280702 3300047445 Bacteria 653
1016 Ga0495679_008823 3300047446 Bacteria 4069
1017 Ga0495679_051789 3300047446 Bacteria 1229
1018 Ga0495679_052553 3300047446 Bacteria 1218
1019 Ga0495679_061198 3300047446 Bacteria 1103
1020 Ga0495679_065665 3300047446 Bacteria 1055
1021 Ga0495679_084892 3300047446 Bacteria 894
1022 Ga0495679_104770 3300047446 Bacteria 783
1023 Ga0495685_001797 3300047447 Bacteria 6613
1024 Ga0495685_049119 3300047447 Bacteria 1433
1025 Ga0495685_051223 3300047447 Bacteria 1400
1026 Ga0495685_059807 3300047447 Bacteria 1285
1027 Ga0495685_096110 3300047447 Bacteria 979
1028 Ga0495685_231982 3300047447 Bacteria 587
1029 Ga0495685_241979 3300047447 Bacteria 573
1030 Ga0495673_0000185 3300047469 Bacteria 100703
1031 Ga0495673_0000338 3300047469 Bacteria 59988
1032 Ga0495673_0002607 3300047469 Bacteria 12542
1033 Ga0495673_0100936 3300047469 Bacteria 1166
1034 Ga0495681_0018699 3300047470 Bacteria 3808
1035 Ga0495681_0030651 3300047470 Bacteria 2735
1036 Ga0495681_0061145 3300047470 Bacteria 1735
1037 Ga0495681_0078367 3300047470 Bacteria 1480
1038 Ga0495681_0106719 3300047470 Bacteria 1217
1039 Ga0495681_0139883 3300047470 Bacteria 1023
1040 Ga0495681_0152247 3300047470 Bacteria 969
1041 Ga0495681_0232725 3300047470 Bacteria 734
1042 Ga0495681_0271659 3300047470 Bacteria 663
1043 Ga0495686_0005000 3300047472 Bacteria 10648
1044 Ga0495686_0041880 3300047472 Bacteria 2914
1045 Ga0495686_0116547 3300047472 Bacteria 1596
1046 Ga0495686_0121709 3300047472 Bacteria 1554
1047 Ga0495686_0203037 3300047472 Bacteria 1136
1048 Ga0495686_0452869 3300047472 Bacteria 681
1049 Ga0495686_0727384 3300047472 Bacteria 504
1050 Ga0495593_0012462 3300047673 Bacteria 4859
1051 Ga0495593_0195327 3300047673 Bacteria 1017
1052 Ga0495593_0374729 3300047673 Bacteria 711
1053 Ga0495593_0682892 3300047673 Bacteria 515
1054 Ga0495602_0058801 3300048088 Bacteria 3362
1055 Ga0495602_0277034 3300048088 Bacteria 1237
1056 Ga0495602_0734444 3300048088 Bacteria 667
1057 Ga0495614_0029810 3300048089 Bacteria 2347
1058 Ga0495614_0060035 3300048089 Bacteria 1634
1059 Ga0495614_0107230 3300048089 Bacteria 1224
1060 Ga0495615_0020588 3300048090 Bacteria 1480
1061 Ga0495615_0042504 3300048090 Bacteria 1140
1062 Ga0495615_0078113 3300048090 Bacteria 903
1063 Ga0495626_0003909 3300048091 Bacteria 9334
1064 Ga0495626_0010744 3300048091 Bacteria 4868
1065 Ga0495626_0012906 3300048091 Bacteria 4359
1066 Ga0495626_0016437 3300048091 Bacteria 3756
1067 Ga0495626_0027831 3300048091 Bacteria 2745
1068 Ga0495626_0032859 3300048091 Bacteria 2489
1069 Ga0495626_0077411 3300048091 Bacteria 1482
1070 Ga0495626_0080378 3300048091 Bacteria 1449
1071 Ga0495626_0081637 3300048091 Bacteria 1435
1072 Ga0495626_0125936 3300048091 Bacteria 1097
1073 Ga0495626_0133404 3300048091 Bacteria 1058
1074 Ga0495626_0345249 3300048091 Bacteria 581
1075 Ga0496100_0018888 3300048903 Bacteria 4101
1076 Ga0496100_0632587 3300048903 Bacteria 832
1077 Ga0496100_0647665 3300048903 Bacteria 822
1078 Ga0496100_0972939 3300048903 Bacteria 667
1079 Ga0496101_0319243 3300048904 Bacteria 1218
1080 Ga0496102_0068828 3300048905 Bacteria 3248
1081 Ga0496102_0088863 3300048905 Bacteria 2857
1082 Ga0496102_0137406 3300048905 Bacteria 2290
1083 Ga0496102_0803991 3300048905 Bacteria 862
1084 Ga0496102_1070135 3300048905 Bacteria 726
1085 Ga0496102_1077448 3300048905 Bacteria 723
1086 Ga0496102_1348585 3300048905 Bacteria 632
1087 Ga0496103_0058673 3300048906 Bacteria 2391
1088 Ga0496103_0070829 3300048906 Bacteria 2181
1089 Ga0496103_0090188 3300048906 Bacteria 1934
1090 Ga0496103_0091802 3300048906 Bacteria 1916
1091 Ga0496103_0180310 3300048906 Bacteria 1357
1092 Ga0496103_0419965 3300048906 Bacteria 858
1093 Ga0496103_0612122 3300048906 Bacteria 693
1094 Ga0496104_0178000 3300048907 Bacteria 2037
1095 Ga0496104_0570097 3300048907 Bacteria 1042
1096 Ga0496104_1134155 3300048907 Bacteria 685
1097 Ga0496105_0442086 3300048908 Bacteria 1027
1098 Ga0496105_0534987 3300048908 Bacteria 916
1099 Ga0496105_0547476 3300048908 Bacteria 903
1100 Ga0496105_0952840 3300048908 Bacteria 644
1101 Ga0496106_0253104 3300048909 Bacteria 1408
1102 Ga0496106_0535103 3300048909 Bacteria 940
1103 Ga0496107_0248001 3300048910 Bacteria 1325
1104 Ga0496107_0398111 3300048910 Bacteria 1024
1105 Ga0496107_0479689 3300048910 Bacteria 923
1106 Ga0496107_0860266 3300048910 Bacteria 662
1107 Ga0496108_0191326 3300048911 Bacteria 1773
1108 Ga0496108_0599219 3300048911 Bacteria 960
1109 Ga0496108_0849703 3300048911 Bacteria 785
1110 Ga0496109_0072916 3300048912 Bacteria 3155
1111 Ga0496109_0186739 3300048912 Bacteria 1947
1112 Ga0496109_0783590 3300048912 Bacteria 891
1113 Ga0496109_1056140 3300048912 Bacteria 749
1114 Ga0496110_0080386 3300048913 Bacteria 2904
1115 Ga0496110_0491583 3300048913 Bacteria 1117
1116 Ga0496110_0690196 3300048913 Bacteria 922
1117 Ga0496110_0861253 3300048913 Bacteria 811
1118 Ga0496110_0936409 3300048913 Bacteria 773
1119 Ga0496110_1164934 3300048913 Bacteria 679
1120 Ga0496111_0091872 3300048914 Bacteria 2224
1121 Ga0496111_0146589 3300048914 Bacteria 1750
1122 Ga0496111_0521994 3300048914 Bacteria 873
1123 Ga0496112_0306153 3300048915 Bacteria 1534
1124 Ga0496113_0099847 3300048916 Bacteria 2248
1125 Ga0496113_0385700 3300048916 Bacteria 1124
1126 Ga0496114_0022403 3300048917 Bacteria 5149
1127 Ga0496114_0289742 3300048917 Bacteria 1444
1128 Ga0496114_0438915 3300048917 Bacteria 1156
1129 Ga0496114_0637577 3300048917 Bacteria 938
1130 Ga0496114_0641742 3300048917 Bacteria 934
1131 Ga0496115_0050867 3300048918 Bacteria 3321
1132 Ga0496115_0221193 3300048918 Bacteria 1562
1133 Ga0496115_0321110 3300048918 Bacteria 1266
1134 Ga0496115_0801713 3300048918 Bacteria 733
1135 Ga0496116_0091755 3300048919 Bacteria 1845
1136 Ga0496116_0253322 3300048919 Bacteria 874
1137 Ga0496118_0183090 3300048921 Bacteria 1263
1138 Ga0496120_0124356 3300048923 Bacteria 1329
1139 Ga0496121_0243249 3300048924 Bacteria 1252
1140 Ga0496121_0329613 3300048924 Bacteria 1024
1141 Ga0496121_0537195 3300048924 Bacteria 734
1142 Ga0496121_0676800 3300048924 Bacteria 624
1143 Ga0496122_0077023 3300048925 Bacteria 2344
1144 Ga0496122_0109128 3300048925 Bacteria 1822
1145 Ga0496122_0194708 3300048925 Bacteria 1192
1146 Ga0496122_0426972 3300048925 Bacteria 664
1147 Ga0496123_0013659 3300048926 Bacteria 6791
1148 Ga0496123_0031651 3300048926 Bacteria 3845
1149 Ga0496123_0069843 3300048926 Bacteria 2202
1150 Ga0496124_0106187 3300048927 Bacteria 2267
1151 Ga0496124_0129517 3300048927 Bacteria 2006
1152 Ga0496124_0132720 3300048927 Bacteria 1976
1153 Ga0496124_0150483 3300048927 Bacteria 1826
1154 Ga0496124_0323784 3300048927 Bacteria 1102
1155 Ga0496124_0348155 3300048927 Bacteria 1049
1156 Ga0496124_0355597 3300048927 Bacteria 1034
1157 Ga0496124_0745176 3300048927 Bacteria 614
1158 Ga0496124_0787945 3300048927 Bacteria 590
1159 Ga0496124_0801049 3300048927 Bacteria 583
1160 Ga0496125_0021606 3300048928 Bacteria 5998
1161 Ga0496125_0060592 3300048928 Bacteria 3040
1162 Ga0496125_0063503 3300048928 Bacteria 2944
1163 Ga0496125_0427486 3300048928 Bacteria 765
1164 Ga0496126_0031527 3300048929 Bacteria 5006
1165 Ga0496126_0345681 3300048929 Bacteria 1218
1166 Ga0496126_0708504 3300048929 Bacteria 781
1167 Ga0501306_000150 3300049127 Bacteria 4359
1168 Ga0501306_003340 3300049127 Bacteria 1723
1169 Ga0501306_009215 3300049127 Bacteria 1221
1170 Ga0501306_058971 3300049127 Bacteria 629
1171 Ga0501306_077581 3300049127 Bacteria 569
1172 Ga0501306_079075 3300049127 Bacteria 565
1173 Ga0501308_000398 3300049128 Bacteria 2773
1174 Ga0501308_002408 3300049128 Bacteria 1638
1175 Ga0501308_018121 3300049128 Bacteria 859
1176 Ga0501309_004241 3300049129 Bacteria 1663
1177 Ga0501309_011386 3300049129 Bacteria 1159
1178 Ga0501310_001072 3300049130 Bacteria 2465
1179 Ga0501310_006078 3300049130 Bacteria 1258
1180 Ga0501310_016049 3300049130 Bacteria 894
1181 Ga0501343_000533 3300049132 Bacteria 2250
1182 Ga0501343_007025 3300049132 Bacteria 885
1183 Ga0501343_010267 3300049132 Bacteria 763
1184 Ga0501304_001138 3300049160 Bacteria 1639
1185 Ga0501304_002860 3300049160 Bacteria 1229
1186 Ga0501304_005072 3300049160 Bacteria 1021
1187 Ga0501304_008888 3300049160 Bacteria 853
1188 Ga0501305_005503 3300049161 Bacteria 1538
1189 Ga0501305_006325 3300049161 Bacteria 1467
1190 Ga0501305_028998 3300049161 Bacteria 854
1191 Ga0501305_047139 3300049161 Bacteria 715
1192 Ga0501305_075734 3300049161 Bacteria 598
1193 Ga0501305_081335 3300049161 Bacteria 583
1194 Ga0501305_082426 3300049161 Bacteria 580
1195 Ga0501307_002498 3300049162 Bacteria 1720
1196 Ga0501307_002525 3300049162 Bacteria 1715
1197 Ga0501307_004154 3300049162 Bacteria 1463
1198 Ga0501307_004969 3300049162 Bacteria 1383
1199 Ga0501307_024948 3300049162 Bacteria 800
1200 Ga0501307_067261 3300049162 Bacteria 566
1201 Ga0495678_006998 3300049459 Bacteria 5916
1202 Ga0495678_025193 3300049459 Bacteria 2558
1203 Ga0495678_027928 3300049459 Bacteria 2387
1204 Ga0495678_059401 3300049459 Bacteria 1441
1205 Ga0495678_066094 3300049459 Bacteria 1340
1206 Ga0495678_069294 3300049459 Bacteria 1297
1207 Ga0495678_091123 3300049459 Bacteria 1073
1208 Ga0495678_092832 3300049459 Bacteria 1059
1209 Ga0495682_0063615 3300049460 Bacteria 1330
1210 Ga0495682_0080123 3300049460 Bacteria 1174
1211 Ga0495682_0124886 3300049460 Bacteria 921
1212 Ga0501297_011034 3300049520 Bacteria 1031
1213 Ga0501311_000165 3300049527 Bacteria 3696
1214 Ga0501311_020593 3300049527 Bacteria 893
1215 Ga0501311_023545 3300049527 Bacteria 853
1216 Ga0501311_089829 3300049527 Bacteria 532
1217 Ga0501312_004623 3300049528 Bacteria 1633
1218 Ga0501312_012905 3300049528 Bacteria 1155
1219 Ga0501312_025618 3300049528 Bacteria 900
1220 Ga0501312_032245 3300049528 Bacteria 826
1221 Ga0501312_053251 3300049528 Bacteria 687
1222 Ga0501312_090417 3300049528 Bacteria 564
1223 Ga0501313_000756 3300049529 Bacteria 2434
1224 Ga0501313_001122 3300049529 Bacteria 2196
1225 Ga0501314_005033 3300049530 Bacteria 1115
1226 Ga0501314_008905 3300049530 Bacteria 914
1227 Ga0501314_021302 3300049530 Bacteria 676
1228 Ga0501315_000556 3300049531 Bacteria 2665
1229 Ga0501315_002286 3300049531 Bacteria 1779
1230 Ga0501315_003217 3300049531 Bacteria 1616
1231 Ga0501315_003289 3300049531 Bacteria 1603
1232 Ga0501315_012963 3300049531 Bacteria 1038
1233 Ga0501315_013154 3300049531 Bacteria 1033
1234 Ga0501315_082020 3300049531 Bacteria 549
1235 Ga0501316_000848 3300049532 Bacteria 2366
1236 Ga0501316_006293 3300049532 Bacteria 1260
1237 Ga0501316_007300 3300049532 Bacteria 1197
1238 Ga0501316_043078 3300049532 Bacteria 634
1239 Ga0501317_016468 3300049533 Bacteria 959
1240 Ga0501317_016650 3300049533 Bacteria 956
1241 Ga0501317_022573 3300049533 Bacteria 863
1242 Ga0501319_026436 3300049535 Bacteria 543
1243 Ga0501320_003037 3300049536 Bacteria 1393
1244 Ga0501320_003150 3300049536 Bacteria 1378
1245 Ga0501320_003152 3300049536 Bacteria 1378
1246 Ga0501320_009090 3300049536 Bacteria 990
1247 Ga0501320_009230 3300049536 Bacteria 984
1248 Ga0501321_003885 3300049537 Bacteria 1399
1249 Ga0501321_021050 3300049537 Bacteria 811
1250 Ga0501321_025452 3300049537 Bacteria 763
1251 Ga0501321_026065 3300049537 Bacteria 757
1252 Ga0501321_039662 3300049537 Bacteria 658
1253 Ga0501322_003710 3300049538 Bacteria 1000
1254 Ga0501323_017947 3300049539 Bacteria 912
1255 Ga0501323_038409 3300049539 Bacteria 695
1256 Ga0501323_055330 3300049539 Bacteria 610
1257 Ga0501323_086114 3300049539 Bacteria 519
1258 Ga0501324_000146 3300049540 Bacteria 3029
1259 Ga0501324_032909 3300049540 Bacteria 572
1260 Ga0501324_039127 3300049540 Bacteria 538
1261 Ga0501325_002483 3300049541 Bacteria 1266
1262 Ga0501326_03837 3300049542 Bacteria 783
1263 Ga0501327_07824 3300049543 Bacteria 671
1264 Ga0501330_015869 3300049546 Bacteria 575
1265 Ga0501334_02030 3300049550 Bacteria 1172
1266 Ga0501334_11604 3300049550 Bacteria 647
1267 Ga0501335_016552 3300049551 Bacteria 760
1268 Ga0501335_030466 3300049551 Bacteria 608
1269 Ga0501336_001604 3300049552 Bacteria 1373
1270 Ga0501336_021445 3300049552 Bacteria 590
1271 Ga0501337_003695 3300049553 Bacteria 979
1272 Ga0501036_0168725 3300049572 Bacteria 1844
1273 Ga0501211_003467 3300049658 Bacteria 1625
1274 Ga0501222_052889 3300049662 Bacteria 599
1275 Ga0501227_001669 3300049665 Bacteria 4945
1276 Ga0501233_046721 3300049668 Bacteria 1036
1277 Ga0501238_028740 3300049671 Bacteria 800
1278 Ga0501249_011012 3300049679 Bacteria 1895
1279 Ga0501257_178657 3300049686 Bacteria 600
1280 Ga0501234_014155 3300049707 Bacteria 1252
1281 Ga0501232_048342 3300049757 Bacteria 648
1282 Ga0501263_009328 3300049760 Bacteria 1186
1283 Ga0501268_014162 3300049765 Bacteria 1297
1284 Ga0501268_048277 3300049765 Bacteria 818
1285 Ga0501279_003775 3300049775 Bacteria 1982
1286 Ga0501279_014665 3300049775 Bacteria 1080
1287 Ga0501035_0035964 3300049822 Bacteria 4492
1288 Ga0501044_1175829 3300049823 Bacteria 635
1289 nmdc:mga03683_124751_c1 3300050489 Bacteria 1148
1290 nmdc:mga03n38_79853_c1 3300050490 Bacteria 1535
1291 nmdc:mga0k408_362329_c1 3300050493 Bacteria 864
1292 nmdc:mga07m45_367000_c1 3300050496 Bacteria 836
1293 nmdc:mga07m45_95626_c1 3300050496 Bacteria 1704
1294 Ga0495601_0011363 3300053077 Bacteria 5322
1295 Ga0495655_0195039 3300053083 Bacteria 659
1296 Ga0500646_0325529 3300053090 Bacteria 556
1297 Ga0500594_0105109 3300053118 Bacteria 873
1298 Ga0500595_081341 3300053119 Bacteria 947
1299 Ga0500618_004294 3300053125 Bacteria 4610
1300 Ga0500621_188196 3300053126 Bacteria 742
1301 Ga0500559_0112531 3300053136 Bacteria 1262
1302 Ga0500573_0380923 3300053140 Bacteria 674
1303 Ga0500574_000852 3300053141 Bacteria 4160
1304 Ga0500586_092624 3300053145 Bacteria 1061
1305 Ga0500586_130803 3300053145 Bacteria 868
1306 Ga0500619_083039 3300053154 Bacteria 1077
1307 Ga0500624_071695 3300053157 Bacteria 678
1308 Ga0500636_0475721 3300053177 Bacteria 558
1309 Ga0587084_006452 3300059477 Bacteria 1425
1310 Ga0587084_017124 3300059477 Bacteria 1043
1311 Ga0587084_027909 3300059477 Bacteria 890
1312 Ga0587093_001802 3300059478 Bacteria 1885
1313 Ga0587093_003356 3300059478 Bacteria 1567
1314 Ga0587066_002048 3300059490 Bacteria 2157
1315 Ga0587066_025732 3300059490 Bacteria 1011
1316 Ga0587070_011858 3300059491 Bacteria 1313
1317 Ga0587070_012033 3300059491 Bacteria 1307
1318 Ga0587070_037857 3300059491 Bacteria 909
1319 Ga0587073_0000405 3300059492 Bacteria 3811
1320 Ga0587073_0152513 3300059492 Bacteria 655
1321 Ga0587077_008903 3300059493 Bacteria 1508
1322 Ga0587077_009273 3300059493 Bacteria 1489
1323 Ga0587080_003728 3300059503 Bacteria 1923
1324 Ga0587080_019330 3300059503 Bacteria 1103
1325 Ga0587080_053033 3300059503 Bacteria 771
1326 Ga0587082_000814 3300059504 Bacteria 2909
1327 Ga0587082_062171 3300059504 Bacteria 739
1328 Ga0587083_0032996 3300059505 Bacteria 1042
1329 Ga0587083_0039846 3300059505 Bacteria 978
1330 Ga0587085_006188 3300059506 Bacteria 1445
1331 Ga0587085_013499 3300059506 Bacteria 1138
1332 Ga0587086_000667 3300059507 Bacteria 2638
1333 Ga0587086_003732 3300059507 Bacteria 1551
1334 Ga0587086_012653 3300059507 Bacteria 1052
1335 Ga0587088_000683 3300059508 Bacteria 3024
1336 Ga0587088_006876 3300059508 Bacteria 1552
1337 Ga0587088_039639 3300059508 Bacteria 882
1338 Ga0587089_009849 3300059509 Bacteria 1181
1339 Ga0587089_018181 3300059509 Bacteria 951
1340 Ga0587089_031477 3300059509 Bacteria 784
1341 Ga0587090_003488 3300059510 Bacteria 1832
1342 Ga0587090_007045 3300059510 Bacteria 1464
1343 Ga0587091_002980 3300059511 Bacteria 2079
1344 Ga0587091_021583 3300059511 Bacteria 1129
1345 Ga0587092_005373 3300059512 Bacteria 1577
1346 Ga0587092_008921 3300059512 Bacteria 1336
1347 Ga0587094_002657 3300059513 Bacteria 1867
1348 Ga0587094_003403 3300059513 Bacteria 1731
1349 Ga0587094_003513 3300059513 Bacteria 1716
1350 Ga0587095_000862 3300059514 Bacteria 1720
1351 Ga0587095_001423 3300059514 Bacteria 1470
1352 Ga0587097_00287 3300059603 Bacteria 1337
1353 Ga0587097_01444 3300059603 Bacteria 857
1354 Ga0587098_001919 3300059604 Bacteria 1686
1355 Ga0587098_028142 3300059604 Bacteria 758
1356 Ga0587121_01643 3300059606 Bacteria 1126
1357 Ga0587125_000574 3300059607 Bacteria 2242
1358 Ga0587129_003518 3300059608 Bacteria 988
1359 Ga0587099_005269 3300059622 Bacteria 1156
1360 Ga0587101_000524 3300059623 Bacteria 2775
1361 Ga0587101_002989 3300059623 Bacteria 1678
1362 Ga0587101_008422 3300059623 Bacteria 1245
1363 Ga0587101_033901 3300059623 Bacteria 811
1364 Ga0587109_014290 3300059624 Bacteria 1330
1365 Ga0587109_031962 3300059624 Bacteria 1004
1366 Ga0587115_006225 3300059626 Bacteria 1369
1367 Ga0587117_015916 3300059627 Bacteria 994
1368 Ga0587128_005351 3300059630 Bacteria 1529
1369 Ga0587128_036484 3300059630 Bacteria 841
1370 Ga0587062_015555 3300059639 Bacteria 1018
1371 Ga0587062_016957 3300059639 Bacteria 991
1372 Ga0587062_064065 3300059639 Bacteria 651
1373 Ga0587068_006343 3300059641 Bacteria 1653
1374 Ga0587068_025778 3300059641 Bacteria 991
1375 Ga0587069_000151 3300059642 Bacteria 4141
1376 Ga0587069_008398 3300059642 Bacteria 1305
1377 Ga0587072_019128 3300059643 Bacteria 1196
1378 Ga0587072_039981 3300059643 Bacteria 908
1379 Ga0587075_002302 3300059644 Bacteria 2003
1380 Ga0587075_008575 3300059644 Bacteria 1312
1381 Ga0587076_000769 3300059645 Bacteria 2890
1382 Ga0587076_008880 3300059645 Bacteria 1415
1383 Ga0587078_021377 3300059646 Bacteria 820
1384 Ga0587079_000436 3300059647 Bacteria 3627
1385 Ga0587079_022980 3300059647 Bacteria 1137
1386 Ga0587079_034095 3300059647 Bacteria 994
1387 Ga0587079_037059 3300059647 Bacteria 967
1388 Ga0587079_048272 3300059647 Bacteria 885
1389 Ga0587100_005333 3300059648 Bacteria 954
1390 Ga0587102_000673 3300059649 Bacteria 2076
1391 Ga0587102_001335 3300059649 Bacteria 1704
1392 Ga0587102_011088 3300059649 Bacteria 901
1393 Ga0587104_000706 3300059650 Bacteria 1539
1394 Ga0587105_002305 3300059651 Bacteria 1080
1395 Ga0587107_008387 3300059652 Bacteria 1192
1396 Ga0587108_000215 3300059653 Bacteria 2673
1397 Ga0587110_001895 3300059654 Bacteria 1590
1398 Ga0587116_04152 3300059656 Bacteria 835
1399 Ga0587118_02411 3300059657 Bacteria 1210
1400 Ga0587119_001725 3300059658 Bacteria 1859
1401 Ga0587119_015430 3300059658 Bacteria 925
1402 Ga0587120_000930 3300059659 Bacteria 1689
1403 Ga0587065_06038 3300060245 Bacteria 714
1404 Ga0587081_13236 3300060246 Bacteria 610
1405 Ga0587096_00225 3300060247 Bacteria 1357
1406 Ga0587071_000779 3300060344 Bacteria 3530
1407 Ga0587071_015766 3300060344 Bacteria 1329
1408 Ga0587071_025527 3300060344 Bacteria 1109
1409 Ga0587071_048707 3300060344 Bacteria 870
1410 Ga0587111_0002093 3300060346 Bacteria 2589
1411 Ga0587111_0005555 3300060346 Bacteria 1953
1412 Ga0587111_0006057 3300060346 Bacteria 1899
1413 Ga0587111_0026675 3300060346 Bacteria 1153
1414 Ga0587111_0080351 3300060346 Bacteria 778
1415 Ga0466962_0268453 3300061719 Bacteria 840

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10006142 Ga0307414_100061427 85
2 3300014497 Ga0182008_10004539 Ga0182008_100045397 87
3 3300015261 Ga0182006_1000186 Ga0182006_10001863 87
4 3300015262 Ga0182007_10000202 Ga0182007_100002023 87
5 3300015265 Ga0182005_1001571 Ga0182005_10015713 87
6 3300017792 Ga0163161_10238636 Ga0163161_102386363 87
7 3300025728 Ga0207655_1027614 Ga0207655_10276146 87
8 3300003763 Ga0055529_1000375 Ga0055529_100037534 90
9 3300025233 Ga0209437_118485 Ga0209437_1184852 90
10 3300025272 Ga0209455_1000303 Ga0209455_100030335 90
11 3300049162 Ga0501307_002525 Ga0501307_002525_788_1201 90
12 3300049668 Ga0501233_046721 Ga0501233_046721_103_516 90
13 3300049679 Ga0501249_011012 Ga0501249_011012_1323_1736 90
14 3300030731 Ga0316177_1138179 Ga0316177_11381792 93
15 3300030732 Ga0316176_1045076 Ga0316176_10450762 93
16 3300030736 Ga0316180_1160791 Ga0316180_11607912 93
17 3300030745 Ga0316182_1052816 Ga0316182_10528162 93
18 3300032005 Ga0307411_10352971 Ga0307411_103529712 93
19 3300002737 JGI25162J39368_1013612 JGI25162J39368_10136123 96
20 3300002738 JGI25154J39366_1001113 JGI25154J39366_10011139 96
21 3300003771 Ga0055526_1021298 Ga0055526_10212983 96
22 3300009148 Ga0105243_11533616 Ga0105243_115336162 96
23 3300025233 Ga0209437_119366 Ga0209437_1193663 96
24 3300025246 Ga0209646_1000246 Ga0209646_100024638 96
25 3300025295 Ga0209564_1000230 Ga0209564_100023099 96
26 3300027111 Ga0209281_1008175 Ga0209281_10081754 96
27 3300046457 Ga0495590_0000020 Ga0495590_0000020_1028_1411 96
28 3300046460 Ga0495638_0010010 Ga0495638_0010010_463_846 96
29 3300046471 Ga0495650_0058728 Ga0495650_0058728_845_1228 96
30 3300046475 Ga0495639_0181988 Ga0495639_0181988_175_558 96
31 3300046506 Ga0495583_0013755 Ga0495583_0013755_331_714 96
32 3300046512 Ga0495610_0023962 Ga0495610_0023962_132_515 96
33 3300046522 Ga0495643_0032093 Ga0495643_0032093_342_725 96
34 3300046524 Ga0495648_0034037 Ga0495648_0034037_2608_2991 96
35 3300046524 Ga0495648_0042742 Ga0495648_0042742_331_714 96
36 3300046528 Ga0495642_0004349 Ga0495642_0004349_3834_4217 96
37 3300046538 Ga0495609_0010718 Ga0495609_0010718_1570_1953 96
38 3300046557 Ga0495622_0075497 Ga0495622_0075497_303_686 96
39 3300046616 Ga0495668_0007707 Ga0495668_0007707_558_941 96
40 3300046660 Ga0495625_0078068 Ga0495625_0078068_1797_2180 96
41 3300046691 Ga0495670_0638070 Ga0495670_0638070_131_514 96
42 3300046810 Ga0495660_0091402 Ga0495660_0091402_900_1283 96
43 3300047443 Ga0495687_024856 Ga0495687_024856_2010_2393 96
44 3300048090 Ga0495615_0020588 Ga0495615_0020588_860_1243 96
45 3300049459 Ga0495678_091123 Ga0495678_091123_132_515 96
46 3300053118 Ga0500594_0105109 Ga0500594_0105109_126_509 96
47 3300025910 Ga0207684_10913197 Ga0207684_109131972 97
48 3300046507 Ga0495606_0193919 Ga0495606_0193919_303_686 97
49 3300046520 Ga0495637_0044618 Ga0495637_0044618_1167_1550 97
50 3300047323 Ga0495683_0326250 Ga0495683_0326250_154_537 97
51 3300053125 Ga0500618_004294 Ga0500618_004294_3905_4288 97
52 3300005355 Ga0070671_101904447 Ga0070671_1019044472 98
53 3300003320 rootH2_10111913 rootH2_101119131 99
54 3300037471 Ga0395905_0150590 Ga0395905_0150590_618_1001 99
55 3300003300 Ga0006758J48902_1007376 Ga0006758J48902_10073763 100
56 3300003544 Ga0007417J51691_1002081 Ga0007417J51691_10020813 100
57 3300003613 Ga0007415J51800_107921 Ga0007415J51800_1079212 100
58 3300003693 Ga0032354_1055041 Ga0032354_10550413 100
59 3300005288 Ga0065714_10510726 Ga0065714_105107261 100
60 3300006048 Ga0075363_100016273 Ga0075363_1000162736 100
61 3300006051 Ga0075364_10849286 Ga0075364_108492862 100
62 3300009036 Ga0105244_10015476 Ga0105244_100154767 100
63 3300025728 Ga0207655_1003094 Ga0207655_100309410 100
64 3300025932 Ga0207690_11533167 Ga0207690_115331671 100
65 3300031730 Ga0307516_10309306 Ga0307516_103093062 100
66 3300032005 Ga0307411_11417131 Ga0307411_114171312 100
67 3300033180 Ga0307510_10280273 Ga0307510_102802733 100
68 3300039447 Ga0436361_0743577 Ga0436361_0743577_1715_2098 100
69 3300041512 Ga0451853_2414847 Ga0451853_2414847_409_792 100
70 3300046452 Ga0495617_004204 Ga0495617_004204_4533_4916 100
71 3300046453 Ga0495627_026656 Ga0495627_026656_253_636 100
72 3300046471 Ga0495650_0009500 Ga0495650_0009500_4791_5174 100
73 3300046492 Ga0495585_0047201 Ga0495585_0047201_891_1274 100
74 3300046512 Ga0495610_0027750 Ga0495610_0027750_2284_2667 100
75 3300046520 Ga0495637_0013614 Ga0495637_0013614_3058_3441 100
76 3300046524 Ga0495648_0107232 Ga0495648_0107232_349_732 100
77 3300046530 Ga0495654_0000115 Ga0495654_0000115_90641_91024 100
78 3300046530 Ga0495654_0082162 Ga0495654_0082162_299_682 100
79 3300046665 Ga0495661_0115856 Ga0495661_0115856_696_1079 100
80 3300046692 Ga0495671_0029072 Ga0495671_0029072_361_744 100
81 3300046694 Ga0495649_0060727 Ga0495649_0060727_1591_1974 100
82 3300046794 Ga0495589_0177569 Ga0495589_0177569_443_826 100
83 3300046810 Ga0495660_0054740 Ga0495660_0054740_864_1247 100
84 3300047323 Ga0495683_0140598 Ga0495683_0140598_483_866 100
85 3300047469 Ga0495673_0000338 Ga0495673_0000338_58412_58795 100
86 3300047470 Ga0495681_0271659 Ga0495681_0271659_181_564 100
87 3300048906 Ga0496103_0070829 Ga0496103_0070829_262_645 100
88 3300048914 Ga0496111_0521994 Ga0496111_0521994_23_406 100
89 3300048917 Ga0496114_0641742 Ga0496114_0641742_268_651 100
90 3300048925 Ga0496122_0194708 Ga0496122_0194708_771_1154 100
91 3300049531 Ga0501315_012963 Ga0501315_012963_195_578 100
92 3300049537 Ga0501321_021050 Ga0501321_021050_288_701 100
93 3300050489 nmdc:mga03683_124751_c1 nmdc:mga03683_124751_c1_322_705 100
94 3300050490 nmdc:mga03n38_79853_c1 nmdc:mga03n38_79853_c1_833_1216 100
95 3300050493 nmdc:mga0k408_362329_c1 nmdc:mga0k408_362329_c1_315_698 100
96 3300050496 nmdc:mga07m45_95626_c1 nmdc:mga07m45_95626_c1_515_898 100
97 3300053145 Ga0500586_092624 Ga0500586_092624_512_895 100
98 3300002771 JGI25163J39215_1004486 JGI25163J39215_10044861 102
99 3300003214 JGI25165J46597_1001017 JGI25165J46597_10010173 102
100 3300003751 Ga0055538_1000375 Ga0055538_10003753 102
101 3300003752 Ga0055539_1000377 Ga0055539_10003773 102
102 3300003756 Ga0055533_1000371 Ga0055533_10003713 102
103 3300003759 Ga0055525_1000523 Ga0055525_10005233 102
104 3300003841 Ga0055541_1000262 Ga0055541_100026212 102
105 3300014497 Ga0182008_10393084 Ga0182008_103930842 102
106 3300015262 Ga0182007_10018893 Ga0182007_100188932 102
107 3300015262 Ga0182007_10232394 Ga0182007_102323942 102
108 3300015265 Ga0182005_1002884 Ga0182005_10028847 102
109 3300025224 Ga0209784_100010 Ga0209784_100010284 102
110 3300025225 Ga0209566_100008 Ga0209566_100008284 102
111 3300025226 Ga0209674_100019 Ga0209674_100019284 102
112 3300025228 Ga0209672_104073 Ga0209672_1040732 102
113 3300025230 Ga0209563_100021 Ga0209563_100021284 102
114 3300025231 Ga0207427_100573 Ga0207427_10057313 102
115 3300025233 Ga0209437_100019 Ga0209437_100019284 102
116 3300025253 Ga0209677_100011 Ga0209677_100011284 102
117 3300025261 Ga0209233_1000025 Ga0209233_1000025284 102
118 3300031548 Ga0307408_102083828 Ga0307408_1020838282 102
119 3300031901 Ga0307406_10406741 Ga0307406_104067413 102
120 3300044735 Ga0466968_0207495 Ga0466968_0207495_507_890 102
121 3300046454 Ga0495592_0139781 Ga0495592_0139781_963_1346 102
122 3300046455 Ga0495603_0533480 Ga0495603_0533480_137_526 102
123 3300046457 Ga0495590_0037945 Ga0495590_0037945_184_567 102
124 3300046460 Ga0495638_0000408 Ga0495638_0000408_51051_51434 102
125 3300046462 Ga0495651_0061481 Ga0495651_0061481_1247_1630 102
126 3300046462 Ga0495651_0108148 Ga0495651_0108148_134_517 102
127 3300046463 Ga0495653_0504877 Ga0495653_0504877_157_540 102
128 3300046472 Ga0495580_0245555 Ga0495580_0245555_678_1067 102
129 3300046474 Ga0495605_0003232 Ga0495605_0003232_1565_1948 102
130 3300046491 Ga0495584_0060945 Ga0495584_0060945_300_683 102
131 3300046501 Ga0495607_0379756 Ga0495607_0379756_101_484 102
132 3300046506 Ga0495583_0000310 Ga0495583_0000310_76488_76871 102
133 3300046507 Ga0495606_0284940 Ga0495606_0284940_408_791 102
134 3300046511 Ga0495608_0027939 Ga0495608_0027939_688_1071 102
135 3300046511 Ga0495608_0087527 Ga0495608_0087527_996_1379 102
136 3300046513 Ga0495616_0209358 Ga0495616_0209358_387_770 102
137 3300046514 Ga0495618_0079070 Ga0495618_0079070_148_531 102
138 3300046516 Ga0495628_0051980 Ga0495628_0051980_2148_2531 102
139 3300046516 Ga0495628_0153435 Ga0495628_0153435_341_724 102
140 3300046524 Ga0495648_0167280 Ga0495648_0167280_462_845 102
141 3300046526 Ga0495666_0178036 Ga0495666_0178036_434_823 102
142 3300046528 Ga0495642_0096136 Ga0495642_0096136_514_897 102
143 3300046529 Ga0495652_0027829 Ga0495652_0027829_879_1262 102
144 3300046529 Ga0495652_0035148 Ga0495652_0035148_3614_3997 102
145 3300046529 Ga0495652_0503440 Ga0495652_0503440_400_783 102
146 3300046530 Ga0495654_0115950 Ga0495654_0115950_505_888 102
147 3300046531 Ga0495665_0482052 Ga0495665_0482052_97_486 102
148 3300046538 Ga0495609_0003741 Ga0495609_0003741_7786_8169 102
149 3300046542 Ga0495597_0196766 Ga0495597_0196766_322_705 102
150 3300046543 Ga0495645_0099543 Ga0495645_0099543_185_568 102
151 3300046543 Ga0495645_0158047 Ga0495645_0158047_347_730 102
152 3300046557 Ga0495622_0087025 Ga0495622_0087025_954_1343 102
153 3300046557 Ga0495622_0143997 Ga0495622_0143997_375_758 102
154 3300046558 Ga0495633_0345992 Ga0495633_0345992_273_656 102
155 3300046660 Ga0495625_0020104 Ga0495625_0020104_4448_4831 102
156 3300046660 Ga0495625_0134180 Ga0495625_0134180_1182_1571 102
157 3300046663 Ga0495635_0068579 Ga0495635_0068579_1739_2122 102
158 3300046664 Ga0495659_0020773 Ga0495659_0020773_462_845 102
159 3300046664 Ga0495659_0470245 Ga0495659_0470245_53_442 102
160 3300046665 Ga0495661_0258570 Ga0495661_0258570_340_723 102
161 3300046674 Ga0495588_0126731 Ga0495588_0126731_829_1218 102
162 3300046674 Ga0495588_0383066 Ga0495588_0383066_160_549 102
163 3300046675 Ga0495657_0029648 Ga0495657_0029648_762_1145 102
164 3300046678 Ga0495599_0007721 Ga0495599_0007721_5655_6038 102
165 3300046679 Ga0495623_0380325 Ga0495623_0380325_189_572 102
166 3300046680 Ga0495646_0112772 Ga0495646_0112772_179_562 102
167 3300046683 Ga0495658_0224387 Ga0495658_0224387_147_530 102
168 3300046689 Ga0495613_0253770 Ga0495613_0253770_474_863 102
169 3300046690 Ga0495624_0078632 Ga0495624_0078632_478_867 102
170 3300046690 Ga0495624_0121558 Ga0495624_0121558_1008_1391 102
171 3300046691 Ga0495670_0046118 Ga0495670_0046118_1374_1757 102
172 3300046691 Ga0495670_0082751 Ga0495670_0082751_597_986 102
173 3300046692 Ga0495671_0049468 Ga0495671_0049468_360_743 102
174 3300046692 Ga0495671_0145008 Ga0495671_0145008_302_685 102
175 3300046809 Ga0495600_0011381 Ga0495600_0011381_366_749 102
176 3300046810 Ga0495660_0007171 Ga0495660_0007171_1560_1943 102
177 3300046810 Ga0495660_0232924 Ga0495660_0232924_93_476 102
178 3300047317 Ga0495604_0113202 Ga0495604_0113202_566_949 102
179 3300047318 Ga0495636_0007040 Ga0495636_0007040_330_713 102
180 3300047320 Ga0495672_0026706 Ga0495672_0026706_386_769 102
181 3300047321 Ga0495676_0495608 Ga0495676_0495608_155_538 102
182 3300047443 Ga0495687_000370 Ga0495687_000370_330_713 102
183 3300047445 Ga0495677_0032012 Ga0495677_0032012_1202_1585 102
184 3300047469 Ga0495673_0100936 Ga0495673_0100936_265_648 102
185 3300047472 Ga0495686_0041880 Ga0495686_0041880_441_824 102
186 3300048088 Ga0495602_0277034 Ga0495602_0277034_764_1147 102
187 3300048088 Ga0495602_0734444 Ga0495602_0734444_161_544 102
188 3300048091 Ga0495626_0016437 Ga0495626_0016437_531_920 102
189 3300048910 Ga0496107_0860266 Ga0496107_0860266_200_589 102
190 3300048918 Ga0496115_0321110 Ga0496115_0321110_413_802 102
191 3300049128 Ga0501308_000398 Ga0501308_000398_2168_2551 102
192 3300049130 Ga0501310_016049 Ga0501310_016049_418_804 102
193 3300049459 Ga0495678_006998 Ga0495678_006998_4779_5162 102
194 3300049536 Ga0501320_009090 Ga0501320_009090_286_669 102
195 3300049765 Ga0501268_048277 Ga0501268_048277_303_686 102
196 3300053077 Ga0495601_0011363 Ga0495601_0011363_1180_1563 102
197 3300053119 Ga0500595_081341 Ga0500595_081341_352_735 102
198 3300053140 Ga0500573_0380923 Ga0500573_0380923_19_402 102
199 3300053141 Ga0500574_000852 Ga0500574_000852_2594_2977 102
200 3300053154 Ga0500619_083039 Ga0500619_083039_502_885 102
201 3300003773 Ga0055537_1007354 Ga0055537_10073542 103
202 3300003775 Ga0055524_1035570 Ga0055524_10355702 103
203 3300003775 Ga0055524_1039973 Ga0055524_10399732 103
204 3300003784 Ga0055534_1006810 Ga0055534_10068103 103
205 3300003790 Ga0055528_1012187 Ga0055528_10121875 103
206 3300009092 Ga0105250_10141157 Ga0105250_101411573 103
207 3300025263 Ga0209565_1006443 Ga0209565_10064433 103
208 3300025273 Ga0209673_1003465 Ga0209673_10034658 103
209 3300025291 Ga0209675_1009571 Ga0209675_10095713 103
210 3300025295 Ga0209564_1013777 Ga0209564_10137773 103
211 3300025299 Ga0209256_1012344 Ga0209256_10123443 103
212 3300025941 Ga0207711_10480757 Ga0207711_104807572 103
213 3300048903 Ga0496100_0632587 Ga0496100_0632587_133_516 103
214 3300049127 Ga0501306_000150 Ga0501306_000150_286_669 103
215 3300049161 Ga0501305_075734 Ga0501305_075734_27_410 103
216 3300049529 Ga0501313_001122 Ga0501313_001122_116_499 103
217 3300049531 Ga0501315_003289 Ga0501315_003289_1067_1450 103
218 3300049532 Ga0501316_043078 Ga0501316_043078_222_605 103
219 3300049662 Ga0501222_052889 Ga0501222_052889_157_540 103
220 3300049665 Ga0501227_001669 Ga0501227_001669_2383_2766 103
221 3300049775 Ga0501279_003775 Ga0501279_003775_1035_1418 103
222 3300005289 Ga0065704_10158451 Ga0065704_101584511 104
223 3300005336 Ga0070680_100331491 Ga0070680_1003314913 104
224 3300007265 Ga0099794_10479873 Ga0099794_104798732 104
225 3300009036 Ga0105244_10039890 Ga0105244_100398903 104
226 3300053083 Ga0495655_0195039 Ga0495655_0195039_179_562 104
227 3300053177 Ga0500636_0475721 Ga0500636_0475721_47_457 104
228 3300031731 Ga0307405_11287052 Ga0307405_112870521 105
229 3300046455 Ga0495603_0007446 Ga0495603_0007446_5969_6358 105
230 3300046455 Ga0495603_0164238 Ga0495603_0164238_809_1198 105
231 3300046459 Ga0495629_0415305 Ga0495629_0415305_299_688 105
232 3300046473 Ga0495582_0057380 Ga0495582_0057380_1506_1895 105
233 3300046474 Ga0495605_0071613 Ga0495605_0071613_828_1217 105
234 3300046491 Ga0495584_0051866 Ga0495584_0051866_1126_1515 105
235 3300046491 Ga0495584_0452034 Ga0495584_0452034_63_452 105
236 3300046492 Ga0495585_0331337 Ga0495585_0331337_128_517 105
237 3300046492 Ga0495585_0406997 Ga0495585_0406997_153_542 105
238 3300046499 Ga0495594_0186729 Ga0495594_0186729_74_463 105
239 3300046499 Ga0495594_0660763 Ga0495594_0660763_75_464 105
240 3300046500 Ga0495596_0059412 Ga0495596_0059412_885_1274 105
241 3300046506 Ga0495583_0041060 Ga0495583_0041060_338_727 105
242 3300046506 Ga0495583_0094961 Ga0495583_0094961_827_1216 105
243 3300046513 Ga0495616_0020539 Ga0495616_0020539_458_847 105
244 3300046513 Ga0495616_0103362 Ga0495616_0103362_471_860 105
245 3300046518 Ga0495631_0103090 Ga0495631_0103090_688_1077 105
246 3300046518 Ga0495631_0182275 Ga0495631_0182275_498_887 105
247 3300046519 Ga0495632_0166880 Ga0495632_0166880_553_942 105
248 3300046520 Ga0495637_0027010 Ga0495637_0027010_1620_2009 105
249 3300046522 Ga0495643_0065304 Ga0495643_0065304_1165_1554 105
250 3300046523 Ga0495644_0035051 Ga0495644_0035051_1180_1569 105
251 3300046523 Ga0495644_0088545 Ga0495644_0088545_340_729 105
252 3300046525 Ga0495663_0123673 Ga0495663_0123673_55_444 105
253 3300046526 Ga0495666_0244369 Ga0495666_0244369_349_738 105
254 3300046528 Ga0495642_0027378 Ga0495642_0027378_346_735 105
255 3300046530 Ga0495654_0065073 Ga0495654_0065073_164_553 105
256 3300046530 Ga0495654_0077712 Ga0495654_0077712_1022_1411 105
257 3300046531 Ga0495665_0192065 Ga0495665_0192065_151_540 105
258 3300046533 Ga0495640_0305576 Ga0495640_0305576_124_513 105
259 3300046542 Ga0495597_0112166 Ga0495597_0112166_259_648 105
260 3300046542 Ga0495597_0137308 Ga0495597_0137308_283_672 105
261 3300046557 Ga0495622_0142933 Ga0495622_0142933_494_883 105
262 3300046557 Ga0495622_0202751 Ga0495622_0202751_128_517 105
263 3300046557 Ga0495622_0209861 Ga0495622_0209861_436_825 105
264 3300046558 Ga0495633_0282116 Ga0495633_0282116_128_517 105
265 3300046558 Ga0495633_0300229 Ga0495633_0300229_295_684 105
266 3300046615 Ga0495656_0150503 Ga0495656_0150503_668_1057 105
267 3300046615 Ga0495656_0288364 Ga0495656_0288364_237_626 105
268 3300046648 Ga0495611_0167304 Ga0495611_0167304_359_748 105
269 3300046664 Ga0495659_0121116 Ga0495659_0121116_366_755 105
270 3300046665 Ga0495661_0124105 Ga0495661_0124105_346_735 105
271 3300046665 Ga0495661_0397778 Ga0495661_0397778_72_461 105
272 3300046665 Ga0495661_0465733 Ga0495661_0465733_128_517 105
273 3300046674 Ga0495588_0062419 Ga0495588_0062419_1468_1857 105
274 3300046674 Ga0495588_0114119 Ga0495588_0114119_960_1349 105
275 3300046674 Ga0495588_0284320 Ga0495588_0284320_155_544 105
276 3300046680 Ga0495646_0637124 Ga0495646_0637124_56_445 105
277 3300046684 Ga0495669_0056751 Ga0495669_0056751_90_479 105
278 3300046684 Ga0495669_0215544 Ga0495669_0215544_90_479 105
279 3300046692 Ga0495671_0078583 Ga0495671_0078583_688_1077 105
280 3300046694 Ga0495649_0198523 Ga0495649_0198523_44_433 105
281 3300046794 Ga0495589_0106067 Ga0495589_0106067_420_809 105
282 3300046794 Ga0495589_0228246 Ga0495589_0228246_75_464 105
283 3300046810 Ga0495660_0219733 Ga0495660_0219733_433_822 105
284 3300047315 Ga0495581_0084029 Ga0495581_0084029_510_899 105
285 3300047317 Ga0495604_0351376 Ga0495604_0351376_307_696 105
286 3300047321 Ga0495676_0093491 Ga0495676_0093491_335_724 105
287 3300047323 Ga0495683_0322969 Ga0495683_0322969_90_479 105
288 3300047445 Ga0495677_0089584 Ga0495677_0089584_420_809 105
289 3300047446 Ga0495679_084892 Ga0495679_084892_67_456 105
290 3300047447 Ga0495685_231982 Ga0495685_231982_188_577 105
291 3300047470 Ga0495681_0232725 Ga0495681_0232725_295_684 105
292 3300047673 Ga0495593_0682892 Ga0495593_0682892_47_436 105
293 3300048089 Ga0495614_0029810 Ga0495614_0029810_322_711 105
294 3300048091 Ga0495626_0010744 Ga0495626_0010744_1652_2041 105
295 3300048091 Ga0495626_0133404 Ga0495626_0133404_580_969 105
296 3300048905 Ga0496102_0803991 Ga0496102_0803991_90_479 105
297 3300048924 Ga0496121_0537195 Ga0496121_0537195_311_700 105
298 3300048929 Ga0496126_0708504 Ga0496126_0708504_336_725 105
299 3300053157 Ga0500624_071695 Ga0500624_071695_280_663 105
300 3300012485 Ga0157325_1004116 Ga0157325_10041161 106
301 3300046457 Ga0495590_0005309 Ga0495590_0005309_512_901 106
302 3300046460 Ga0495638_0463668 Ga0495638_0463668_90_479 106
303 3300046463 Ga0495653_0042103 Ga0495653_0042103_2849_3238 106
304 3300046474 Ga0495605_0013696 Ga0495605_0013696_3594_3983 106
305 3300046492 Ga0495585_0137334 Ga0495585_0137334_341_730 106
306 3300046499 Ga0495594_0338015 Ga0495594_0338015_324_713 106
307 3300046500 Ga0495596_0296545 Ga0495596_0296545_151_540 106
308 3300046501 Ga0495607_0123713 Ga0495607_0123713_714_1103 106
309 3300046506 Ga0495583_0197012 Ga0495583_0197012_121_510 106
310 3300046513 Ga0495616_0188240 Ga0495616_0188240_453_842 106
311 3300046518 Ga0495631_0091500 Ga0495631_0091500_574_963 106
312 3300046518 Ga0495631_0269289 Ga0495631_0269289_265_654 106
313 3300046520 Ga0495637_0107325 Ga0495637_0107325_339_728 106
314 3300046530 Ga0495654_0160159 Ga0495654_0160159_151_540 106
315 3300046535 Ga0495586_0052978 Ga0495586_0052978_1440_1829 106
316 3300046542 Ga0495597_0090026 Ga0495597_0090026_521_910 106
317 3300046558 Ga0495633_0359431 Ga0495633_0359431_256_645 106
318 3300046616 Ga0495668_0067174 Ga0495668_0067174_779_1168 106
319 3300046616 Ga0495668_0102990 Ga0495668_0102990_695_1084 106
320 3300046660 Ga0495625_0263877 Ga0495625_0263877_177_566 106
321 3300046663 Ga0495635_0014432 Ga0495635_0014432_4623_5012 106
322 3300046665 Ga0495661_0478009 Ga0495661_0478009_151_540 106
323 3300046680 Ga0495646_0253356 Ga0495646_0253356_243_632 106
324 3300046684 Ga0495669_0065000 Ga0495669_0065000_50_439 106
325 3300046689 Ga0495613_0065356 Ga0495613_0065356_1516_1905 106
326 3300046692 Ga0495671_0116767 Ga0495671_0116767_135_524 106
327 3300046794 Ga0495589_0043731 Ga0495589_0043731_1512_1901 106
328 3300046794 Ga0495589_0411505 Ga0495589_0411505_194_583 106
329 3300046809 Ga0495600_0300712 Ga0495600_0300712_44_433 106
330 3300047320 Ga0495672_0205361 Ga0495672_0205361_422_811 106
331 3300047322 Ga0495680_0082868 Ga0495680_0082868_1533_1922 106
332 3300047443 Ga0495687_007822 Ga0495687_007822_5482_5871 106
333 3300047444 Ga0495675_0243254 Ga0495675_0243254_320_709 106
334 3300047446 Ga0495679_052553 Ga0495679_052553_794_1183 106
335 3300047447 Ga0495685_049119 Ga0495685_049119_347_736 106
336 3300047673 Ga0495593_0195327 Ga0495593_0195327_126_515 106
337 3300048089 Ga0495614_0107230 Ga0495614_0107230_496_885 106
338 3300048091 Ga0495626_0125936 Ga0495626_0125936_153_542 106
339 3300048903 Ga0496100_0018888 Ga0496100_0018888_2728_3117 106
340 3300048904 Ga0496101_0319243 Ga0496101_0319243_369_758 106
341 3300048910 Ga0496107_0398111 Ga0496107_0398111_282_671 106
342 3300048912 Ga0496109_0186739 Ga0496109_0186739_744_1133 106
343 3300048912 Ga0496109_1056140 Ga0496109_1056140_142_531 106
344 3300048913 Ga0496110_0491583 Ga0496110_0491583_578_967 106
345 3300048913 Ga0496110_0861253 Ga0496110_0861253_151_540 106
346 3300048914 Ga0496111_0091872 Ga0496111_0091872_1152_1541 106
347 3300048916 Ga0496113_0099847 Ga0496113_0099847_1034_1423 106
348 3300048925 Ga0496122_0077023 Ga0496122_0077023_1575_1964 106
349 3300048926 Ga0496123_0031651 Ga0496123_0031651_2234_2623 106
350 3300048928 Ga0496125_0060592 Ga0496125_0060592_1107_1496 106
351 3300049459 Ga0495678_069294 Ga0495678_069294_758_1147 106
352 3300049520 Ga0501297_011034 Ga0501297_011034_222_605 106
353 3300004801 Ga0058860_12202994 Ga0058860_122029941 107
354 3300037471 Ga0395905_1906850 Ga0395905_1906850_12_386 108
355 3300045051 Ga0451576_1776876 Ga0451576_1776876_13_381 108
356 3300046507 Ga0495606_0435842 Ga0495606_0435842_10_384 108
357 3300046537 Ga0495598_0264374 Ga0495598_0264374_13_378 108
358 3300047320 Ga0495672_0350773 Ga0495672_0350773_15_389 108
359 iso_pu_bacteria 2511231003 2511247426 109
360 iso_pu_bacteria 2511231026 2511384278 109
361 iso_pu_bacteria 2521172590 2521560845 109
362 iso_pu_bacteria 2548876994 2550696713 109
363 iso_pu_bacteria 2551306416 2553008127 109
364 iso_pu_bacteria 2600255292 2601667097 109
365 iso_pu_bacteria 2643221554 2643789313 109
366 iso_pu_bacteria 2643221556 2643799317 109
367 iso_pu_bacteria 2643221603 2644030560 109
368 iso_pu_bacteria 2643221645 2644251646 109
369 iso_pu_bacteria 2643221664 2644356009 109
370 iso_pu_bacteria 2643221684 2644472513 109
371 iso_pu_bacteria 2738541280 2738738195 109
372 iso_pu_bacteria 2738541297 2738826685 109
373 iso_pu_bacteria 2738541300 2738842999 109
374 iso_pu_bacteria 2738541357 2739150482 109
375 iso_pu_bacteria 2738543003 2739192401 109
376 iso_pu_bacteria 2738543018 2739273747 109
377 iso_pu_bacteria 2738543026 2739318878 109
378 iso_pu_bacteria 2738543029 2739337119 109
379 iso_pu_bacteria 2738543030 2739342791 109
380 iso_pu_bacteria 2765235838 2765567279 109
381 iso_pu_bacteria 2808606386 2808984192 109
382 iso_pu_bacteria 2808606415 2809131996 109
383 iso_pu_bacteria 2808606418 2809145972 109
384 iso_pu_bacteria 2808606419 2809151619 109
385 iso_pu_bacteria 2818991445 2819594380 109
386 iso_pu_bacteria 2818991449 2819618852 109
387 iso_pu_bacteria 2821131069 2821136285 109
388 iso_pu_bacteria 2839094727 2839095493 109
389 iso_pu_bacteria 2842711865 2842717719 109
390 iso_pu_bacteria 2852618963 2852622921 109
391 iso_pu_bacteria 2857558681 2857563377 109
392 iso_pu_bacteria 2857564685 2857567908 109
393 iso_pu_bacteria 2884811622 2884814298 109
394 iso_pu_bacteria 2884836552 2884840777 109
395 iso_pu_bacteria 2884852848 2884857627 109
396 iso_pu_bacteria 2896154374 2896158567 109
397 iso_pu_bacteria 2904424332 2904427831 109
398 iso_pu_bacteria 2904439833 2904445257 109
399 iso_pu_bacteria 2904530477 2904533798 109
400 iso_pu_bacteria 2904584206 2904589365 109
401 iso_pu_bacteria 2904589729 2904595068 109
402 iso_pu_bacteria 2904601388 2904606734 109
403 iso_pu_bacteria 2919046199 2919050778 109
404 iso_pu_bacteria 2919079590 2919084998 109
405 iso_pu_bacteria 2919476304 2919476868 109
406 iso_pu_bacteria 2923510766 2923514686 109
407 iso_pu_bacteria 2928130867 2928135734 109
408 iso_pu_bacteria 8047673197 8047676180 109
409 3300005344 Ga0070661_100103030 Ga0070661_1001030303 110
410 3300005564 Ga0070664_100139315 Ga0070664_1001393153 110
411 3300005339 Ga0070660_100054384 Ga0070660_1000543843 112
412 3300005366 Ga0070659_100022490 Ga0070659_1000224903 112
413 3300025913 Ga0207695_10953808 Ga0207695_109538082 112
414 3300025919 Ga0207657_10006550 Ga0207657_100065502 112
415 3300025920 Ga0207649_10056050 Ga0207649_100560503 112
416 3300031903 Ga0307407_11519995 Ga0307407_115199951 112
417 3300039447 Ga0436361_0171206 Ga0436361_0171206_355_732 112
418 3300049162 Ga0501307_024948 Ga0501307_024948_174_575 112
419 3300049527 Ga0501311_023545 Ga0501311_023545_311_688 112
420 3300049551 Ga0501335_016552 Ga0501335_016552_338_739 112
421 3300002704 JGI25155J39150_1001422 JGI25155J39150_10014222 113
422 3300002737 JGI25162J39368_1003029 JGI25162J39368_10030298 113
423 3300002741 JGI25157J39369_1002793 JGI25157J39369_10027931 113
424 3300002865 Ga0006761J43178_107453 Ga0006761J43178_1074532 113
425 3300002870 Ga0006763J43179_103551 Ga0006763J43179_1035513 113
426 3300002872 Ga0006762J43184_104088 Ga0006762J43184_1040886 113
427 3300003161 Ga0006765J45826_105488 Ga0006765J45826_1054882 113
428 3300003161 Ga0006765J45826_112366 Ga0006765J45826_1123662 113
429 3300003162 Ga0006778J45830_1013353 Ga0006778J45830_10133532 113
430 3300003162 Ga0006778J45830_1040529 Ga0006778J45830_10405292 113
431 3300003163 Ga0006759J45824_1008312 Ga0006759J45824_10083123 113
432 3300003163 Ga0006759J45824_1017914 Ga0006759J45824_10179142 113
433 3300003163 Ga0006759J45824_1050895 Ga0006759J45824_10508952 113
434 3300003187 JGI25151J46595_10026667 JGI25151J46595_100266672 113
435 3300003215 JGI25153J46596_10069502 JGI25153J46596_100695021 113
436 3300003288 Ga0007428J48920_101816 Ga0007428J48920_1018162 113
437 3300003291 Ga0007421J48921_108960 Ga0007421J48921_1089602 113
438 3300003300 Ga0006758J48902_1003362 Ga0006758J48902_10033626 113
439 3300003300 Ga0006758J48902_1008629 Ga0006758J48902_10086292 113
440 3300003300 Ga0006758J48902_1013049 Ga0006758J48902_10130492 113
441 3300003305 Ga0006770J48903_1029811 Ga0006770J48903_10298112 113
442 3300003305 Ga0006770J48903_1044284 Ga0006770J48903_10442842 113
443 3300003308 Ga0006777J48905_1023760 Ga0006777J48905_10237602 113
444 3300003308 Ga0006777J48905_1039864 Ga0006777J48905_10398643 113
445 3300003354 JGI25160J50197_1016863 JGI25160J50197_10168633 113
446 3300003544 Ga0007417J51691_1010301 Ga0007417J51691_10103013 113
447 3300003544 Ga0007417J51691_1012480 Ga0007417J51691_10124802 113
448 3300003544 Ga0007417J51691_1047057 Ga0007417J51691_10470572 113
449 3300003559 Ga0007427J51700_104977 Ga0007427J51700_1049772 113
450 3300003568 Ga0006781J51513_1012464 Ga0006781J51513_10124643 113
451 3300003574 Ga0007410J51695_1007231 Ga0007410J51695_10072316 113
452 3300003574 Ga0007410J51695_1020989 Ga0007410J51695_10209893 113
453 3300003575 Ga0007409J51694_1001845 Ga0007409J51694_10018453 113
454 3300003575 Ga0007409J51694_1004205 Ga0007409J51694_10042053 113
455 3300003575 Ga0007409J51694_1052234 Ga0007409J51694_10522342 113
456 3300003577 Ga0007416J51690_1008732 Ga0007416J51690_10087323 113
457 3300003577 Ga0007416J51690_1012477 Ga0007416J51690_10124772 113
458 3300003577 Ga0007416J51690_1013143 Ga0007416J51690_10131432 113
459 3300003579 Ga0007429J51699_1009554 Ga0007429J51699_10095546 113
460 3300003579 Ga0007429J51699_1048446 Ga0007429J51699_10484462 113
461 3300003611 Ga0007411J51799_105052 Ga0007411J51799_1050523 113
462 3300003611 Ga0007411J51799_105765 Ga0007411J51799_1057652 113
463 3300003613 Ga0007415J51800_105799 Ga0007415J51800_1057992 113
464 3300003693 Ga0032354_1003507 Ga0032354_10035072 113
465 3300003693 Ga0032354_1011615 Ga0032354_10116153 113
466 3300003693 Ga0032354_1050188 Ga0032354_10501882 113
467 3300003735 Ga0006780_1004575 Ga0006780_10045756 113
468 3300003735 Ga0006780_1014123 Ga0006780_10141233 113
469 3300003751 Ga0055538_1002307 Ga0055538_10023073 113
470 3300003752 Ga0055539_1002407 Ga0055539_10024073 113
471 3300003756 Ga0055533_1003837 Ga0055533_10038373 113
472 3300003758 Ga0055532_1000420 Ga0055532_100042016 113
473 3300003759 Ga0055525_1000147 Ga0055525_100014772 113
474 3300003759 Ga0055525_1001833 Ga0055525_10018333 113
475 3300003761 Ga0055535_1005381 Ga0055535_10053813 113
476 3300003771 Ga0055526_1021258 Ga0055526_10212583 113
477 3300003773 Ga0055537_1012735 Ga0055537_10127353 113
478 3300003784 Ga0055534_1023815 Ga0055534_10238152 113
479 3300003790 Ga0055528_1007975 Ga0055528_10079758 113
480 3300003791 Ga0055530_10034470 Ga0055530_100344702 113
481 3300003792 Ga0055540_1071237 Ga0055540_10712372 113
482 3300003794 Ga0055531_10055730 Ga0055531_100557302 113
483 3300003841 Ga0055541_1003620 Ga0055541_10036203 113
484 3300004625 Ga0055543_1028398 Ga0055543_10283982 113
485 3300004625 Ga0055543_1061760 Ga0055543_10617601 113
486 3300004798 Ga0058859_11830236 Ga0058859_118302361 113
487 3300004799 Ga0058863_10053884 Ga0058863_100538843 113
488 3300004800 Ga0058861_10192042 Ga0058861_101920422 113
489 3300004803 Ga0058862_10285807 Ga0058862_102858072 113
490 3300005262 Ga0065165_1003318 Ga0065165_10033182 113
491 3300005262 Ga0065165_1131124 Ga0065165_11311242 113
492 3300005288 Ga0065714_10039928 Ga0065714_100399282 113
493 3300005288 Ga0065714_10228053 Ga0065714_102280532 113
494 3300005293 Ga0065715_10965565 Ga0065715_109655651 113
495 3300005328 Ga0070676_10119214 Ga0070676_101192143 113
496 3300005331 Ga0070670_100067314 Ga0070670_1000673143 113
497 3300005331 Ga0070670_100670173 Ga0070670_1006701732 113
498 3300005334 Ga0068869_100160311 Ga0068869_1001603113 113
499 3300005336 Ga0070680_100212917 Ga0070680_1002129172 113
500 3300005337 Ga0070682_100049501 Ga0070682_1000495013 113
501 3300005337 Ga0070682_100139754 Ga0070682_1001397542 113
502 3300005455 Ga0070663_100229308 Ga0070663_1002293082 113
503 3300005457 Ga0070662_100788233 Ga0070662_1007882332 113
504 3300005458 Ga0070681_10693651 Ga0070681_106936513 113
505 3300005459 Ga0068867_100247809 Ga0068867_1002478092 113
506 3300005535 Ga0070684_100335993 Ga0070684_1003359932 113
507 3300005539 Ga0068853_100254548 Ga0068853_1002545483 113
508 3300005543 Ga0070672_100523242 Ga0070672_1005232422 113
509 3300005563 Ga0068855_100434090 Ga0068855_1004340903 113
510 3300005563 Ga0068855_100593288 Ga0068855_1005932883 113
511 3300005563 Ga0068855_101125821 Ga0068855_1011258212 113
512 3300005564 Ga0070664_100796478 Ga0070664_1007964782 113
513 3300005577 Ga0068857_100025716 Ga0068857_1000257167 113
514 3300005578 Ga0068854_100377989 Ga0068854_1003779892 113
515 3300005578 Ga0068854_100576719 Ga0068854_1005767193 113
516 3300005614 Ga0068856_100085286 Ga0068856_1000852863 113
517 3300005614 Ga0068856_100087143 Ga0068856_1000871434 113
518 3300005616 Ga0068852_100062072 Ga0068852_1000620723 113
519 3300005834 Ga0068851_10071502 Ga0068851_100715022 113
520 3300005834 Ga0068851_10112534 Ga0068851_101125343 113
521 3300005834 Ga0068851_10405320 Ga0068851_104053202 113
522 3300005844 Ga0068862_101121132 Ga0068862_1011211321 113
523 3300006175 Ga0070712_100507328 Ga0070712_1005073283 113
524 3300006237 Ga0097621_100018618 Ga0097621_1000186185 113
525 3300006358 Ga0068871_100137146 Ga0068871_1001371463 113
526 3300006881 Ga0068865_100044877 Ga0068865_1000448773 113
527 3300006944 Ga0099823_1087981 Ga0099823_10879813 113
528 3300009011 Ga0105251_10078126 Ga0105251_100781262 113
529 3300009036 Ga0105244_10019926 Ga0105244_100199264 113
530 3300009092 Ga0105250_10339321 Ga0105250_103393212 113
531 3300009093 Ga0105240_10021815 Ga0105240_100218153 113
532 3300009093 Ga0105240_10209527 Ga0105240_102095273 113
533 3300009093 Ga0105240_10307686 Ga0105240_103076863 113
534 3300009098 Ga0105245_10043502 Ga0105245_100435026 113
535 3300009148 Ga0105243_10016441 Ga0105243_100164417 113
536 3300009148 Ga0105243_11118759 Ga0105243_111187592 113
537 3300009148 Ga0105243_13037755 Ga0105243_130377552 113
538 3300009174 Ga0105241_10173179 Ga0105241_101731793 113
539 3300009176 Ga0105242_10156388 Ga0105242_101563883 113
540 3300009177 Ga0105248_10786239 Ga0105248_107862392 113
541 3300009177 Ga0105248_10951637 Ga0105248_109516372 113
542 3300009545 Ga0105237_10140721 Ga0105237_101407213 113
543 3300009545 Ga0105237_10176405 Ga0105237_101764052 113
544 3300009551 Ga0105238_10002020 Ga0105238_100020203 113
545 3300009551 Ga0105238_10313151 Ga0105238_103131513 113
546 3300009551 Ga0105238_10953002 Ga0105238_109530023 113
547 3300009553 Ga0105249_11042875 Ga0105249_110428752 113
548 3300009829 Ga0130086_1005042 Ga0130086_10050424 113
549 3300009829 Ga0130086_1075241 Ga0130086_10752414 113
550 3300009829 Ga0130086_1091490 Ga0130086_10914903 113
551 3300009850 Ga0130085_1017480 Ga0130085_10174804 113
552 3300009850 Ga0130085_1078041 Ga0130085_10780414 113
553 3300009850 Ga0130085_1107450 Ga0130085_11074503 113
554 3300010375 Ga0105239_10030541 Ga0105239_100305417 113
555 3300010375 Ga0105239_10138610 Ga0105239_101386104 113
556 3300010375 Ga0105239_10177507 Ga0105239_101775073 113
557 3300010375 Ga0105239_11227710 Ga0105239_112277103 113
558 3300011119 Ga0105246_10340845 Ga0105246_103408452 113
559 3300011119 Ga0105246_10866596 Ga0105246_108665962 113
560 3300013100 Ga0157373_10261474 Ga0157373_102614742 113
561 3300013100 Ga0157373_10718048 Ga0157373_107180482 113
562 3300013102 Ga0157371_10000710 Ga0157371_100007103 113
563 3300013104 Ga0157370_10290342 Ga0157370_102903422 113
564 3300013104 Ga0157370_10955217 Ga0157370_109552172 113
565 3300013105 Ga0157369_10404300 Ga0157369_104043003 113
566 3300013297 Ga0157378_12462498 Ga0157378_124624981 113
567 3300013306 Ga0163162_10719007 Ga0163162_107190072 113
568 3300013307 Ga0157372_11159304 Ga0157372_111593042 113
569 3300013307 Ga0157372_12979912 Ga0157372_129799122 113
570 3300013308 Ga0157375_11086602 Ga0157375_110866022 113
571 3300014497 Ga0182008_10005790 Ga0182008_100057903 113
572 3300014497 Ga0182008_10171183 Ga0182008_101711832 113
573 3300014745 Ga0157377_10226863 Ga0157377_102268632 113
574 3300014969 Ga0157376_10163721 Ga0157376_101637214 113
575 3300014969 Ga0157376_11695674 Ga0157376_116956742 113
576 3300015261 Ga0182006_1010089 Ga0182006_10100891 113
577 3300015261 Ga0182006_1013810 Ga0182006_10138105 113
578 3300015262 Ga0182007_10031144 Ga0182007_100311442 113
579 3300015262 Ga0182007_10032705 Ga0182007_100327053 113
580 3300017792 Ga0163161_10231881 Ga0163161_102318813 113
581 3300017792 Ga0163161_10236417 Ga0163161_102364173 113
582 3300020076 Ga0206355_1609219 Ga0206355_16092192 113
583 3300020077 Ga0206351_10512755 Ga0206351_105127553 113
584 3300020080 Ga0206350_10480254 Ga0206350_104802543 113
585 3300020081 Ga0206354_10352477 Ga0206354_103524773 113
586 3300021361 Ga0213872_10052983 Ga0213872_100529833 113
587 3300021361 Ga0213872_10067471 Ga0213872_100674712 113
588 3300025206 Ga0209435_100186 Ga0209435_10018615 113
589 3300025206 Ga0209435_100191 Ga0209435_1001912 113
590 3300025208 Ga0209436_101414 Ga0209436_1014148 113
591 3300025208 Ga0209436_101521 Ga0209436_1015218 113
592 3300025224 Ga0209784_100035 Ga0209784_100035119 113
593 3300025225 Ga0209566_100040 Ga0209566_100040119 113
594 3300025226 Ga0209674_100057 Ga0209674_100057119 113
595 3300025229 Ga0209147_100060 Ga0209147_100060166 113
596 3300025230 Ga0209563_100011 Ga0209563_100011648 113
597 3300025230 Ga0209563_100059 Ga0209563_100059119 113
598 3300025233 Ga0209437_100639 Ga0209437_1006393 113
599 3300025242 Ga0209258_100141 Ga0209258_10014170 113
600 3300025245 Ga0207425_1001042 Ga0207425_10010426 113
601 3300025245 Ga0207425_1022002 Ga0207425_10220023 113
602 3300025246 Ga0209646_1001041 Ga0209646_10010418 113
603 3300025250 Ga0209026_1004204 Ga0209026_10042043 113
604 3300025250 Ga0209026_1007856 Ga0209026_10078564 113
605 3300025253 Ga0209677_100036 Ga0209677_100036119 113
606 3300025253 Ga0209677_111325 Ga0209677_1113252 113
607 3300025254 Ga0209148_1000323 Ga0209148_100032350 113
608 3300025254 Ga0209148_1011865 Ga0209148_10118653 113
609 3300025256 Ga0209759_1015039 Ga0209759_10150393 113
610 3300025263 Ga0209565_1010529 Ga0209565_10105292 113
611 3300025263 Ga0209565_1026547 Ga0209565_10265471 113
612 3300025263 Ga0209565_1048209 Ga0209565_10482092 113
613 3300025263 Ga0209565_1067964 Ga0209565_10679642 113
614 3300025272 Ga0209455_1005403 Ga0209455_10054034 113
615 3300025273 Ga0209673_1004929 Ga0209673_10049293 113
616 3300025284 Ga0209130_1002838 Ga0209130_10028388 113
617 3300025291 Ga0209675_1002952 Ga0209675_10029523 113
618 3300025294 Ga0209025_1001281 Ga0209025_100128116 113
619 3300025295 Ga0209564_1000027 Ga0209564_1000027440 113
620 3300025295 Ga0209564_1019927 Ga0209564_10199274 113
621 3300025297 Ga0209758_1011259 Ga0209758_10112597 113
622 3300025298 Ga0209050_1000292 Ga0209050_100029280 113
623 3300025299 Ga0209256_1004685 Ga0209256_10046858 113
624 3300025302 Ga0207426_1002480 Ga0207426_10024809 113
625 3300025303 Ga0209051_1055224 Ga0209051_10552243 113
626 3300025304 Ga0209257_1000295 Ga0209257_100029583 113
627 3300025321 Ga0207656_10251696 Ga0207656_102516962 113
628 3300025321 Ga0207656_10287302 Ga0207656_102873022 113
629 3300025728 Ga0207655_1142968 Ga0207655_11429681 113
630 3300025735 Ga0207713_1130135 Ga0207713_11301353 113
631 3300025904 Ga0207647_10261112 Ga0207647_102611123 113
632 3300025907 Ga0207645_10214311 Ga0207645_102143113 113
633 3300025909 Ga0207705_11005312 Ga0207705_110053122 113
634 3300025911 Ga0207654_10002179 Ga0207654_100021799 113
635 3300025912 Ga0207707_10487097 Ga0207707_104870972 113
636 3300025913 Ga0207695_10003953 Ga0207695_100039533 113
637 3300025913 Ga0207695_10072393 Ga0207695_100723933 113
638 3300025913 Ga0207695_10401694 Ga0207695_104016942 113
639 3300025914 Ga0207671_10139299 Ga0207671_101392992 113
640 3300025914 Ga0207671_10178519 Ga0207671_101785193 113
641 3300025914 Ga0207671_10579222 Ga0207671_105792222 113
642 3300025915 Ga0207693_10010110 Ga0207693_100101102 113
643 3300025920 Ga0207649_10350719 Ga0207649_103507193 113
644 3300025924 Ga0207694_10001435 Ga0207694_100014353 113
645 3300025924 Ga0207694_10281831 Ga0207694_102818313 113
646 3300025924 Ga0207694_10295775 Ga0207694_102957752 113
647 3300025925 Ga0207650_10088896 Ga0207650_100888964 113
648 3300025926 Ga0207659_11475330 Ga0207659_114753302 113
649 3300025927 Ga0207687_10591242 Ga0207687_105912422 113
650 3300025933 Ga0207706_10313632 Ga0207706_103136323 113
651 3300025934 Ga0207686_10112187 Ga0207686_101121873 113
652 3300025935 Ga0207709_10055004 Ga0207709_100550043 113
653 3300025937 Ga0207669_10511819 Ga0207669_105118193 113
654 3300025938 Ga0207704_10095815 Ga0207704_100958153 113
655 3300025940 Ga0207691_10316183 Ga0207691_103161832 113
656 3300025941 Ga0207711_10734557 Ga0207711_107345572 113
657 3300025942 Ga0207689_10123864 Ga0207689_101238642 113
658 3300025949 Ga0207667_10023256 Ga0207667_100232568 113
659 3300025949 Ga0207667_10042185 Ga0207667_100421853 113
660 3300025949 Ga0207667_10143578 Ga0207667_101435784 113
661 3300025981 Ga0207640_10169293 Ga0207640_101692933 113
662 3300026041 Ga0207639_10312484 Ga0207639_103124842 113
663 3300026067 Ga0207678_10543520 Ga0207678_105435203 113
664 3300026089 Ga0207648_10531514 Ga0207648_105315143 113
665 3300026116 Ga0207674_10021420 Ga0207674_100214207 113
666 3300026116 Ga0207674_10637617 Ga0207674_106376172 113
667 3300026121 Ga0207683_10480854 Ga0207683_104808542 113
668 3300026142 Ga0207698_10012103 Ga0207698_100121033 113
669 3300028380 Ga0268265_10147695 Ga0268265_101476951 113
670 3300030735 Ga0316178_1018733 Ga0316178_10187333 113
671 3300030742 Ga0316183_1020377 Ga0316183_10203772 113
672 3300030745 Ga0316182_1275498 Ga0316182_12754982 113
673 3300031548 Ga0307408_100144522 Ga0307408_1001445222 113
674 3300031548 Ga0307408_102093717 Ga0307408_1020937172 113
675 3300031711 Ga0265314_10275927 Ga0265314_102759272 113
676 3300031911 Ga0307412_10649115 Ga0307412_106491152 113
677 3300032002 Ga0307416_100004760 Ga0307416_1000047609 113
678 3300032005 Ga0307411_10495387 Ga0307411_104953873 113
679 3300032005 Ga0307411_10595392 Ga0307411_105953922 113
680 3300035090 Ga0373949_0294284 Ga0373949_0294284_83_466 113
681 3300035114 Ga0373939_0053081 Ga0373939_0053081_518_901 113
682 3300035692 Ga0373935_0201381 Ga0373935_0201381_958_1338 113
683 3300037312 Ga0395899_0000078 Ga0395899_0000078_140186_140575 113
684 3300037312 Ga0395899_0005833 Ga0395899_0005833_8886_9269 113
685 3300037312 Ga0395899_0668497 Ga0395899_0668497_27_416 113
686 3300037312 Ga0395899_0683208 Ga0395899_0683208_227_610 113
687 3300037312 Ga0395899_1008921 Ga0395899_1008921_27_416 113
688 3300037418 Ga0395900_0082284 Ga0395900_0082284_71_454 113
689 3300037418 Ga0395900_0195712 Ga0395900_0195712_693_1076 113
690 3300037418 Ga0395900_0249092 Ga0395900_0249092_523_906 113
691 3300037418 Ga0395900_0560241 Ga0395900_0560241_135_524 113
692 3300037418 Ga0395900_1850502 Ga0395900_1850502_73_456 113
693 3300037466 Ga0395898_0695698 Ga0395898_0695698_87_476 113
694 3300037466 Ga0395898_1601238 Ga0395898_1601238_39_428 113
695 3300037471 Ga0395905_0000549 Ga0395905_0000549_50903_51286 113
696 3300037471 Ga0395905_0007900 Ga0395905_0007900_1290_1673 113
697 3300037471 Ga0395905_0011730 Ga0395905_0011730_6519_6902 113
698 3300037471 Ga0395905_0092664 Ga0395905_0092664_297_680 113
699 3300037471 Ga0395905_0537645 Ga0395905_0537645_580_969 113
700 3300038443 Ga0395901_0004460 Ga0395901_0004460_293_676 113
701 3300038443 Ga0395901_0094399 Ga0395901_0094399_2249_2638 113
702 3300038443 Ga0395901_0164294 Ga0395901_0164294_1570_1953 113
703 3300038443 Ga0395901_0464144 Ga0395901_0464144_514_897 113
704 3300038443 Ga0395901_0548664 Ga0395901_0548664_668_1057 113
705 3300038443 Ga0395901_1464874 Ga0395901_1464874_227_610 113
706 3300039447 Ga0436361_0004974 Ga0436361_0004974_79_462 113
707 3300039447 Ga0436361_0578689 Ga0436361_0578689_1067_1450 113
708 3300039447 Ga0436361_0767937 Ga0436361_0767937_79_462 113
709 3300039447 Ga0436361_1038070 Ga0436361_1038070_328_708 113
710 3300041413 Ga0439465_0049368 Ga0439465_0049368_350_736 113
711 3300041491 Ga0451833_0022593 Ga0451833_0022593_107_490 113
712 3300042002 Ga0439442_092526 Ga0439442_092526_95_481 113
713 3300042005 Ga0439448_0261686 Ga0439448_0261686_29_418 113
714 3300042006 Ga0439432_126317 Ga0439432_126317_217_603 113
715 3300042007 Ga0439449_0244662 Ga0439449_0244662_256_642 113
716 3300042008 Ga0439450_013480 Ga0439450_013480_551_940 113
717 3300042008 Ga0439450_048323 Ga0439450_048323_311_700 113
718 3300042012 Ga0439455_0027559 Ga0439455_0027559_441_824 113
719 3300042012 Ga0439455_0069102 Ga0439455_0069102_494_883 113
720 3300042012 Ga0439455_0166579 Ga0439455_0166579_226_615 113
721 3300042123 Ga0450921_020664 Ga0450921_020664_59_445 113
722 3300042127 Ga0450890_033574 Ga0450890_033574_133_516 113
723 3300042132 Ga0450895_019290 Ga0450895_019290_70_459 113
724 3300042134 Ga0450898_013755 Ga0450898_013755_621_1007 113
725 3300042139 Ga0450904_004772 Ga0450904_004772_968_1357 113
726 3300042156 Ga0439446_0168394 Ga0439446_0168394_202_588 113
727 3300042157 Ga0439458_0076007 Ga0439458_0076007_27_416 113
728 3300042435 Ga0439434_0057775 Ga0439434_0057775_278_661 113
729 3300042439 Ga0439464_0028984 Ga0439464_0028984_418_807 113
730 3300044658 Ga0466972_0005095 Ga0466972_0005095_369_752 113
731 3300044658 Ga0466972_0052412 Ga0466972_0052412_966_1349 113
732 3300044683 Ga0466965_0043592 Ga0466965_0043592_324_707 113
733 3300044683 Ga0466965_0231235 Ga0466965_0231235_296_685 113
734 3300044683 Ga0466965_0247551 Ga0466965_0247551_276_659 113
735 3300044683 Ga0466965_0373023 Ga0466965_0373023_14_403 113
736 3300044683 Ga0466965_0595604 Ga0466965_0595604_226_609 113
737 3300044684 Ga0466966_0038419 Ga0466966_0038419_705_1088 113
738 3300044684 Ga0466966_0978184 Ga0466966_0978184_24_413 113
739 3300044706 Ga0466964_0024210 Ga0466964_0024210_979_1368 113
740 3300044706 Ga0466964_0087285 Ga0466964_0087285_121_504 113
741 3300044706 Ga0466964_0152185 Ga0466964_0152185_421_804 113
742 3300044706 Ga0466964_0242638 Ga0466964_0242638_390_773 113
743 3300044719 Ga0466971_0221878 Ga0466971_0221878_124_507 113
744 3300044719 Ga0466971_0240173 Ga0466971_0240173_428_817 113
745 3300044735 Ga0466968_0012025 Ga0466968_0012025_1577_1966 113
746 3300044735 Ga0466968_0284188 Ga0466968_0284188_47_430 113
747 3300044735 Ga0466968_0327837 Ga0466968_0327837_50_433 113
748 3300044765 Ga0466970_0057746 Ga0466970_0057746_1183_1566 113
749 3300044765 Ga0466970_0232590 Ga0466970_0232590_257_640 113
750 3300044842 Ga0466957_0167221 Ga0466957_0167221_10_393 113
751 3300044842 Ga0466957_0233015 Ga0466957_0233015_373_762 113
752 3300044842 Ga0466957_0286206 Ga0466957_0286206_359_748 113
753 3300044842 Ga0466957_0983406 Ga0466957_0983406_91_474 113
754 3300044901 Ga0466960_0943304 Ga0466960_0943304_51_434 113
755 3300045049 Ga0466959_0204553 Ga0466959_0204553_313_702 113
756 3300045836 Ga0466958_0896361 Ga0466958_0896361_163_552 113
757 3300045976 Ga0466967_0948199 Ga0466967_0948199_182_565 113
758 3300045976 Ga0466967_1169271 Ga0466967_1169271_45_434 113
759 3300045976 Ga0466967_1605038 Ga0466967_1605038_82_465 113
760 3300045976 Ga0466967_1689390 Ga0466967_1689390_27_416 113
761 3300046452 Ga0495617_001026 Ga0495617_001026_8110_8499 113
762 3300046452 Ga0495617_197794 Ga0495617_197794_49_438 113
763 3300046453 Ga0495627_045406 Ga0495627_045406_576_965 113
764 3300046455 Ga0495603_0066125 Ga0495603_0066125_949_1338 113
765 3300046457 Ga0495590_0018848 Ga0495590_0018848_1570_1959 113
766 3300046457 Ga0495590_0029266 Ga0495590_0029266_1438_1827 113
767 3300046457 Ga0495590_0124562 Ga0495590_0124562_412_795 113
768 3300046457 Ga0495590_0233781 Ga0495590_0233781_130_519 113
769 3300046457 Ga0495590_0249208 Ga0495590_0249208_167_556 113
770 3300046458 Ga0495591_008200 Ga0495591_008200_461_850 113
771 3300046458 Ga0495591_061027 Ga0495591_061027_152_541 113
772 3300046460 Ga0495638_0010721 Ga0495638_0010721_5527_5916 113
773 3300046460 Ga0495638_0069655 Ga0495638_0069655_1534_1917 113
774 3300046463 Ga0495653_0003544 Ga0495653_0003544_338_721 113
775 3300046463 Ga0495653_0025764 Ga0495653_0025764_3788_4177 113
776 3300046471 Ga0495650_0008022 Ga0495650_0008022_420_809 113
777 3300046471 Ga0495650_0017326 Ga0495650_0017326_365_748 113
778 3300046471 Ga0495650_0032252 Ga0495650_0032252_467_856 113
779 3300046472 Ga0495580_0008648 Ga0495580_0008648_6266_6655 113
780 3300046472 Ga0495580_0370728 Ga0495580_0370728_416_805 113
781 3300046472 Ga0495580_0743097 Ga0495580_0743097_91_480 113
782 3300046473 Ga0495582_0013331 Ga0495582_0013331_345_734 113
783 3300046473 Ga0495582_0049936 Ga0495582_0049936_381_770 113
784 3300046474 Ga0495605_0013410 Ga0495605_0013410_368_757 113
785 3300046474 Ga0495605_0082794 Ga0495605_0082794_960_1349 113
786 3300046474 Ga0495605_0103420 Ga0495605_0103420_90_479 113
787 3300046474 Ga0495605_0105953 Ga0495605_0105953_610_999 113
788 3300046474 Ga0495605_0190560 Ga0495605_0190560_357_746 113
789 3300046474 Ga0495605_0195503 Ga0495605_0195503_106_495 113
790 3300046474 Ga0495605_0224230 Ga0495605_0224230_105_494 113
791 3300046475 Ga0495639_0570768 Ga0495639_0570768_33_422 113
792 3300046491 Ga0495584_0002812 Ga0495584_0002812_1310_1699 113
793 3300046491 Ga0495584_0020283 Ga0495584_0020283_54_443 113
794 3300046491 Ga0495584_0075775 Ga0495584_0075775_348_737 113
795 3300046491 Ga0495584_0081139 Ga0495584_0081139_859_1248 113
796 3300046491 Ga0495584_0103631 Ga0495584_0103631_257_640 113
797 3300046491 Ga0495584_0113268 Ga0495584_0113268_363_752 113
798 3300046491 Ga0495584_0120831 Ga0495584_0120831_350_739 113
799 3300046491 Ga0495584_0125919 Ga0495584_0125919_588_977 113
800 3300046491 Ga0495584_0167318 Ga0495584_0167318_357_746 113
801 3300046491 Ga0495584_0287350 Ga0495584_0287350_83_472 113
802 3300046491 Ga0495584_0355186 Ga0495584_0355186_78_467 113
803 3300046491 Ga0495584_0502519 Ga0495584_0502519_80_469 113
804 3300046492 Ga0495585_0012012 Ga0495585_0012012_4340_4729 113
805 3300046492 Ga0495585_0015837 Ga0495585_0015837_3032_3421 113
806 3300046492 Ga0495585_0047852 Ga0495585_0047852_399_788 113
807 3300046492 Ga0495585_0063130 Ga0495585_0063130_1528_1917 113
808 3300046492 Ga0495585_0137156 Ga0495585_0137156_454_843 113
809 3300046492 Ga0495585_0143002 Ga0495585_0143002_580_969 113
810 3300046492 Ga0495585_0149517 Ga0495585_0149517_59_448 113
811 3300046492 Ga0495585_0159448 Ga0495585_0159448_439_828 113
812 3300046492 Ga0495585_0174673 Ga0495585_0174673_398_787 113
813 3300046492 Ga0495585_0270942 Ga0495585_0270942_83_472 113
814 3300046492 Ga0495585_0290070 Ga0495585_0290070_335_724 113
815 3300046492 Ga0495585_0357830 Ga0495585_0357830_264_653 113
816 3300046492 Ga0495585_0436392 Ga0495585_0436392_129_518 113
817 3300046492 Ga0495585_0523948 Ga0495585_0523948_73_462 113
818 3300046499 Ga0495594_0020007 Ga0495594_0020007_1784_2173 113
819 3300046499 Ga0495594_0302827 Ga0495594_0302827_421_810 113
820 3300046499 Ga0495594_0330178 Ga0495594_0330178_321_710 113
821 3300046500 Ga0495596_0005175 Ga0495596_0005175_5471_5860 113
822 3300046500 Ga0495596_0021654 Ga0495596_0021654_2034_2423 113
823 3300046500 Ga0495596_0040721 Ga0495596_0040721_1095_1484 113
824 3300046500 Ga0495596_0044056 Ga0495596_0044056_440_829 113
825 3300046500 Ga0495596_0277946 Ga0495596_0277946_179_568 113
826 3300046500 Ga0495596_0295666 Ga0495596_0295666_152_541 113
827 3300046501 Ga0495607_0090940 Ga0495607_0090940_813_1202 113
828 3300046501 Ga0495607_0099837 Ga0495607_0099837_645_1034 113
829 3300046501 Ga0495607_0141517 Ga0495607_0141517_807_1196 113
830 3300046501 Ga0495607_0162714 Ga0495607_0162714_350_733 113
831 3300046501 Ga0495607_0196673 Ga0495607_0196673_399_788 113
832 3300046501 Ga0495607_0283948 Ga0495607_0283948_365_754 113
833 3300046506 Ga0495583_0006309 Ga0495583_0006309_6849_7238 113
834 3300046506 Ga0495583_0008959 Ga0495583_0008959_5204_5590 113
835 3300046506 Ga0495583_0039755 Ga0495583_0039755_1542_1925 113
836 3300046506 Ga0495583_0047710 Ga0495583_0047710_75_464 113
837 3300046506 Ga0495583_0096954 Ga0495583_0096954_293_682 113
838 3300046506 Ga0495583_0122294 Ga0495583_0122294_589_978 113
839 3300046506 Ga0495583_0131777 Ga0495583_0131777_505_894 113
840 3300046506 Ga0495583_0251356 Ga0495583_0251356_279_668 113
841 3300046507 Ga0495606_0007181 Ga0495606_0007181_7718_8101 113
842 3300046507 Ga0495606_0013036 Ga0495606_0013036_5885_6268 113
843 3300046507 Ga0495606_0019502 Ga0495606_0019502_3987_4370 113
844 3300046507 Ga0495606_0039988 Ga0495606_0039988_492_875 113
845 3300046507 Ga0495606_0108118 Ga0495606_0108118_891_1280 113
846 3300046507 Ga0495606_0109444 Ga0495606_0109444_421_804 113
847 3300046507 Ga0495606_0148706 Ga0495606_0148706_447_836 113
848 3300046507 Ga0495606_0149612 Ga0495606_0149612_320_709 113
849 3300046507 Ga0495606_0217296 Ga0495606_0217296_82_471 113
850 3300046507 Ga0495606_0293819 Ga0495606_0293819_171_560 113
851 3300046507 Ga0495606_0313019 Ga0495606_0313019_101_490 113
852 3300046507 Ga0495606_0325847 Ga0495606_0325847_369_752 113
853 3300046507 Ga0495606_0379068 Ga0495606_0379068_51_440 113
854 3300046507 Ga0495606_0526404 Ga0495606_0526404_20_409 113
855 3300046512 Ga0495610_0003877 Ga0495610_0003877_3268_3651 113
856 3300046512 Ga0495610_0018155 Ga0495610_0018155_350_739 113
857 3300046512 Ga0495610_0198124 Ga0495610_0198124_26_415 113
858 3300046512 Ga0495610_0203181 Ga0495610_0203181_129_518 113
859 3300046513 Ga0495616_0002539 Ga0495616_0002539_4583_4972 113
860 3300046513 Ga0495616_0022828 Ga0495616_0022828_2448_2837 113
861 3300046513 Ga0495616_0160497 Ga0495616_0160497_306_689 113
862 3300046513 Ga0495616_0322294 Ga0495616_0322294_110_499 113
863 3300046514 Ga0495618_0606092 Ga0495618_0606092_25_414 113
864 3300046515 Ga0495620_0011229 Ga0495620_0011229_371_760 113
865 3300046517 Ga0495630_0473133 Ga0495630_0473133_264_653 113
866 3300046517 Ga0495630_0528698 Ga0495630_0528698_337_726 113
867 3300046518 Ga0495631_0026738 Ga0495631_0026738_396_785 113
868 3300046518 Ga0495631_0037499 Ga0495631_0037499_862_1251 113
869 3300046518 Ga0495631_0037577 Ga0495631_0037577_1555_1944 113
870 3300046518 Ga0495631_0073566 Ga0495631_0073566_308_697 113
871 3300046518 Ga0495631_0093621 Ga0495631_0093621_527_916 113
872 3300046518 Ga0495631_0106058 Ga0495631_0106058_350_739 113
873 3300046518 Ga0495631_0174114 Ga0495631_0174114_382_771 113
874 3300046518 Ga0495631_0211047 Ga0495631_0211047_72_461 113
875 3300046519 Ga0495632_0041954 Ga0495632_0041954_352_741 113
876 3300046519 Ga0495632_0052841 Ga0495632_0052841_643_1032 113
877 3300046519 Ga0495632_0112463 Ga0495632_0112463_568_957 113
878 3300046519 Ga0495632_0154007 Ga0495632_0154007_116_505 113
879 3300046519 Ga0495632_0195587 Ga0495632_0195587_40_429 113
880 3300046520 Ga0495637_0001714 Ga0495637_0001714_489_878 113
881 3300046520 Ga0495637_0074308 Ga0495637_0074308_879_1268 113
882 3300046520 Ga0495637_0294839 Ga0495637_0294839_100_489 113
883 3300046522 Ga0495643_0010644 Ga0495643_0010644_3101_3484 113
884 3300046522 Ga0495643_0066699 Ga0495643_0066699_859_1248 113
885 3300046522 Ga0495643_0078750 Ga0495643_0078750_1269_1658 113
886 3300046522 Ga0495643_0081093 Ga0495643_0081093_357_746 113
887 3300046522 Ga0495643_0085218 Ga0495643_0085218_1188_1577 113
888 3300046522 Ga0495643_0091504 Ga0495643_0091504_876_1265 113
889 3300046522 Ga0495643_0118867 Ga0495643_0118867_391_780 113
890 3300046522 Ga0495643_0139286 Ga0495643_0139286_625_1014 113
891 3300046522 Ga0495643_0192027 Ga0495643_0192027_277_666 113
892 3300046522 Ga0495643_0221022 Ga0495643_0221022_226_609 113
893 3300046522 Ga0495643_0226757 Ga0495643_0226757_233_616 113
894 3300046523 Ga0495644_0027051 Ga0495644_0027051_593_982 113
895 3300046523 Ga0495644_0083860 Ga0495644_0083860_359_748 113
896 3300046523 Ga0495644_0084397 Ga0495644_0084397_310_699 113
897 3300046523 Ga0495644_0098570 Ga0495644_0098570_374_763 113
898 3300046523 Ga0495644_0112630 Ga0495644_0112630_503_892 113
899 3300046523 Ga0495644_0113788 Ga0495644_0113788_429_818 113
900 3300046523 Ga0495644_0120039 Ga0495644_0120039_567_956 113
901 3300046524 Ga0495648_0013276 Ga0495648_0013276_5202_5591 113
902 3300046524 Ga0495648_0069259 Ga0495648_0069259_504_893 113
903 3300046524 Ga0495648_0175469 Ga0495648_0175469_366_755 113
904 3300046524 Ga0495648_0179256 Ga0495648_0179256_455_844 113
905 3300046525 Ga0495663_0010607 Ga0495663_0010607_733_1122 113
906 3300046525 Ga0495663_0031792 Ga0495663_0031792_785_1174 113
907 3300046525 Ga0495663_0093960 Ga0495663_0093960_266_655 113
908 3300046525 Ga0495663_0150239 Ga0495663_0150239_231_620 113
909 3300046525 Ga0495663_0181453 Ga0495663_0181453_320_703 113
910 3300046526 Ga0495666_0087815 Ga0495666_0087815_613_1002 113
911 3300046526 Ga0495666_0268240 Ga0495666_0268240_167_556 113
912 3300046526 Ga0495666_0293812 Ga0495666_0293812_147_536 113
913 3300046528 Ga0495642_0021122 Ga0495642_0021122_2012_2395 113
914 3300046528 Ga0495642_0048979 Ga0495642_0048979_820_1209 113
915 3300046528 Ga0495642_0052249 Ga0495642_0052249_398_787 113
916 3300046528 Ga0495642_0061666 Ga0495642_0061666_266_649 113
917 3300046528 Ga0495642_0066277 Ga0495642_0066277_12_401 113
918 3300046528 Ga0495642_0067965 Ga0495642_0067965_603_992 113
919 3300046528 Ga0495642_0115352 Ga0495642_0115352_69_458 113
920 3300046528 Ga0495642_0124442 Ga0495642_0124442_240_629 113
921 3300046528 Ga0495642_0127967 Ga0495642_0127967_368_757 113
922 3300046528 Ga0495642_0178962 Ga0495642_0178962_514_903 113
923 3300046528 Ga0495642_0182863 Ga0495642_0182863_65_454 113
924 3300046528 Ga0495642_0213288 Ga0495642_0213288_147_530 113
925 3300046528 Ga0495642_0324610 Ga0495642_0324610_240_629 113
926 3300046529 Ga0495652_0271463 Ga0495652_0271463_545_934 113
927 3300046529 Ga0495652_0314968 Ga0495652_0314968_355_744 113
928 3300046530 Ga0495654_0091742 Ga0495654_0091742_201_590 113
929 3300046530 Ga0495654_0168280 Ga0495654_0168280_109_498 113
930 3300046531 Ga0495665_0046360 Ga0495665_0046360_1559_1948 113
931 3300046531 Ga0495665_0055908 Ga0495665_0055908_586_975 113
932 3300046531 Ga0495665_0081402 Ga0495665_0081402_547_936 113
933 3300046533 Ga0495640_0307279 Ga0495640_0307279_349_738 113
934 3300046535 Ga0495586_0034290 Ga0495586_0034290_1228_1617 113
935 3300046535 Ga0495586_0121477 Ga0495586_0121477_229_618 113
936 3300046536 Ga0495587_0015602 Ga0495587_0015602_465_854 113
937 3300046536 Ga0495587_0118398 Ga0495587_0118398_1087_1476 113
938 3300046536 Ga0495587_0246276 Ga0495587_0246276_390_779 113
939 3300046536 Ga0495587_0334153 Ga0495587_0334153_101_490 113
940 3300046537 Ga0495598_0217997 Ga0495598_0217997_241_624 113
941 3300046538 Ga0495609_0002112 Ga0495609_0002112_11457_11846 113
942 3300046538 Ga0495609_0005231 Ga0495609_0005231_352_735 113
943 3300046538 Ga0495609_0073530 Ga0495609_0073530_224_613 113
944 3300046538 Ga0495609_0088916 Ga0495609_0088916_746_1135 113
945 3300046538 Ga0495609_0098226 Ga0495609_0098226_565_954 113
946 3300046538 Ga0495609_0135374 Ga0495609_0135374_608_997 113
947 3300046538 Ga0495609_0138755 Ga0495609_0138755_277_666 113
948 3300046538 Ga0495609_0324097 Ga0495609_0324097_224_613 113
949 3300046539 Ga0495621_0124882 Ga0495621_0124882_57_446 113
950 3300046539 Ga0495621_0129299 Ga0495621_0129299_144_527 113
951 3300046539 Ga0495621_0239139 Ga0495621_0239139_334_717 113
952 3300046542 Ga0495597_0008648 Ga0495597_0008648_4303_4692 113
953 3300046542 Ga0495597_0039483 Ga0495597_0039483_1303_1692 113
954 3300046542 Ga0495597_0051584 Ga0495597_0051584_533_916 113
955 3300046542 Ga0495597_0071899 Ga0495597_0071899_822_1211 113
956 3300046542 Ga0495597_0098005 Ga0495597_0098005_414_803 113
957 3300046542 Ga0495597_0123957 Ga0495597_0123957_616_1005 113
958 3300046542 Ga0495597_0173986 Ga0495597_0173986_394_783 113
959 3300046542 Ga0495597_0184857 Ga0495597_0184857_272_661 113
960 3300046543 Ga0495645_0380992 Ga0495645_0380992_43_432 113
961 3300046557 Ga0495622_0010681 Ga0495622_0010681_366_749 113
962 3300046557 Ga0495622_0197854 Ga0495622_0197854_189_578 113
963 3300046557 Ga0495622_0213533 Ga0495622_0213533_305_694 113
964 3300046558 Ga0495633_0016754 Ga0495633_0016754_427_810 113
965 3300046558 Ga0495633_0040031 Ga0495633_0040031_1616_2005 113
966 3300046558 Ga0495633_0046083 Ga0495633_0046083_865_1254 113
967 3300046558 Ga0495633_0047892 Ga0495633_0047892_1515_1904 113
968 3300046558 Ga0495633_0069829 Ga0495633_0069829_441_830 113
969 3300046558 Ga0495633_0113004 Ga0495633_0113004_203_586 113
970 3300046558 Ga0495633_0131615 Ga0495633_0131615_687_1076 113
971 3300046558 Ga0495633_0171891 Ga0495633_0171891_370_759 113
972 3300046558 Ga0495633_0254752 Ga0495633_0254752_56_445 113
973 3300046558 Ga0495633_0276289 Ga0495633_0276289_355_744 113
974 3300046559 Ga0495667_0076074 Ga0495667_0076074_347_736 113
975 3300046615 Ga0495656_0006272 Ga0495656_0006272_840_1229 113
976 3300046615 Ga0495656_0070784 Ga0495656_0070784_571_960 113
977 3300046615 Ga0495656_0101671 Ga0495656_0101671_463_852 113
978 3300046615 Ga0495656_0302232 Ga0495656_0302232_229_612 113
979 3300046615 Ga0495656_0310447 Ga0495656_0310447_346_735 113
980 3300046616 Ga0495668_0020876 Ga0495668_0020876_2573_2956 113
981 3300046616 Ga0495668_0025580 Ga0495668_0025580_397_780 113
982 3300046616 Ga0495668_0054798 Ga0495668_0054798_200_589 113
983 3300046616 Ga0495668_0057793 Ga0495668_0057793_1334_1723 113
984 3300046616 Ga0495668_0157367 Ga0495668_0157367_324_713 113
985 3300046616 Ga0495668_0216198 Ga0495668_0216198_343_732 113
986 3300046616 Ga0495668_0216973 Ga0495668_0216973_363_752 113
987 3300046616 Ga0495668_0244514 Ga0495668_0244514_519_908 113
988 3300046616 Ga0495668_0283014 Ga0495668_0283014_102_485 113
989 3300046616 Ga0495668_0316831 Ga0495668_0316831_448_837 113
990 3300046616 Ga0495668_0438164 Ga0495668_0438164_292_675 113
991 3300046616 Ga0495668_0572655 Ga0495668_0572655_201_590 113
992 3300046616 Ga0495668_0810551 Ga0495668_0810551_53_442 113
993 3300046642 Ga0495634_0019079 Ga0495634_0019079_3978_4367 113
994 3300046642 Ga0495634_0192943 Ga0495634_0192943_504_893 113
995 3300046648 Ga0495611_0013452 Ga0495611_0013452_2721_3110 113
996 3300046648 Ga0495611_0051565 Ga0495611_0051565_641_1030 113
997 3300046648 Ga0495611_0066175 Ga0495611_0066175_322_711 113
998 3300046648 Ga0495611_0077598 Ga0495611_0077598_670_1059 113
999 3300046648 Ga0495611_0099340 Ga0495611_0099340_551_940 113
1000 3300046648 Ga0495611_0191501 Ga0495611_0191501_416_805 113
1001 3300046648 Ga0495611_0309654 Ga0495611_0309654_280_669 113
1002 3300046660 Ga0495625_0021030 Ga0495625_0021030_1484_1867 113
1003 3300046660 Ga0495625_0022675 Ga0495625_0022675_3830_4219 113
1004 3300046660 Ga0495625_0053638 Ga0495625_0053638_1071_1451 113
1005 3300046660 Ga0495625_0322930 Ga0495625_0322930_251_640 113
1006 3300046660 Ga0495625_0347986 Ga0495625_0347986_83_472 113
1007 3300046664 Ga0495659_0012672 Ga0495659_0012672_819_1208 113
1008 3300046664 Ga0495659_0047516 Ga0495659_0047516_330_713 113
1009 3300046664 Ga0495659_0309852 Ga0495659_0309852_195_584 113
1010 3300046664 Ga0495659_0447522 Ga0495659_0447522_159_548 113
1011 3300046665 Ga0495661_0010669 Ga0495661_0010669_1932_2315 113
1012 3300046665 Ga0495661_0018478 Ga0495661_0018478_3572_3955 113
1013 3300046665 Ga0495661_0058552 Ga0495661_0058552_1486_1875 113
1014 3300046665 Ga0495661_0058855 Ga0495661_0058855_73_462 113
1015 3300046665 Ga0495661_0077557 Ga0495661_0077557_27_416 113
1016 3300046665 Ga0495661_0088865 Ga0495661_0088865_960_1349 113
1017 3300046665 Ga0495661_0149912 Ga0495661_0149912_490_879 113
1018 3300046665 Ga0495661_0153590 Ga0495661_0153590_417_806 113
1019 3300046665 Ga0495661_0156350 Ga0495661_0156350_514_903 113
1020 3300046665 Ga0495661_0167032 Ga0495661_0167032_341_730 113
1021 3300046665 Ga0495661_0199840 Ga0495661_0199840_315_704 113
1022 3300046665 Ga0495661_0223551 Ga0495661_0223551_268_657 113
1023 3300046665 Ga0495661_0228249 Ga0495661_0228249_456_845 113
1024 3300046665 Ga0495661_0241389 Ga0495661_0241389_264_653 113
1025 3300046665 Ga0495661_0510115 Ga0495661_0510115_62_451 113
1026 3300046674 Ga0495588_0010876 Ga0495588_0010876_450_839 113
1027 3300046674 Ga0495588_0014904 Ga0495588_0014904_2436_2825 113
1028 3300046674 Ga0495588_0040459 Ga0495588_0040459_347_736 113
1029 3300046674 Ga0495588_0120582 Ga0495588_0120582_393_782 113
1030 3300046674 Ga0495588_0169163 Ga0495588_0169163_413_802 113
1031 3300046674 Ga0495588_0269792 Ga0495588_0269792_472_861 113
1032 3300046674 Ga0495588_0459929 Ga0495588_0459929_28_417 113
1033 3300046675 Ga0495657_0353281 Ga0495657_0353281_300_689 113
1034 3300046678 Ga0495599_0184025 Ga0495599_0184025_93_482 113
1035 3300046678 Ga0495599_0416237 Ga0495599_0416237_12_401 113
1036 3300046679 Ga0495623_0068842 Ga0495623_0068842_1275_1664 113
1037 3300046679 Ga0495623_0076509 Ga0495623_0076509_1109_1498 113
1038 3300046679 Ga0495623_0205957 Ga0495623_0205957_390_779 113
1039 3300046679 Ga0495623_0218757 Ga0495623_0218757_453_842 113
1040 3300046679 Ga0495623_0283811 Ga0495623_0283811_159_548 113
1041 3300046679 Ga0495623_0312291 Ga0495623_0312291_305_694 113
1042 3300046680 Ga0495646_0181463 Ga0495646_0181463_450_839 113
1043 3300046680 Ga0495646_0333161 Ga0495646_0333161_391_780 113
1044 3300046684 Ga0495669_0021103 Ga0495669_0021103_407_790 113
1045 3300046684 Ga0495669_0067620 Ga0495669_0067620_784_1173 113
1046 3300046684 Ga0495669_0086910 Ga0495669_0086910_563_952 113
1047 3300046684 Ga0495669_0112795 Ga0495669_0112795_347_736 113
1048 3300046684 Ga0495669_0221649 Ga0495669_0221649_394_783 113
1049 3300046689 Ga0495613_0394069 Ga0495613_0394069_493_882 113
1050 3300046690 Ga0495624_0123298 Ga0495624_0123298_331_720 113
1051 3300046690 Ga0495624_0777347 Ga0495624_0777347_159_548 113
1052 3300046691 Ga0495670_0042081 Ga0495670_0042081_1469_1858 113
1053 3300046691 Ga0495670_0044966 Ga0495670_0044966_1369_1758 113
1054 3300046691 Ga0495670_0152880 Ga0495670_0152880_810_1199 113
1055 3300046691 Ga0495670_0165436 Ga0495670_0165436_483_872 113
1056 3300046691 Ga0495670_0172779 Ga0495670_0172779_432_821 113
1057 3300046691 Ga0495670_0200169 Ga0495670_0200169_460_849 113
1058 3300046691 Ga0495670_0298224 Ga0495670_0298224_152_541 113
1059 3300046691 Ga0495670_0329266 Ga0495670_0329266_75_464 113
1060 3300046691 Ga0495670_0337191 Ga0495670_0337191_347_736 113
1061 3300046692 Ga0495671_0016693 Ga0495671_0016693_359_748 113
1062 3300046692 Ga0495671_0182117 Ga0495671_0182117_180_569 113
1063 3300046692 Ga0495671_0210520 Ga0495671_0210520_453_836 113
1064 3300046692 Ga0495671_0398155 Ga0495671_0398155_67_456 113
1065 3300046694 Ga0495649_0014801 Ga0495649_0014801_341_730 113
1066 3300046694 Ga0495649_0024341 Ga0495649_0024341_795_1184 113
1067 3300046694 Ga0495649_0053355 Ga0495649_0053355_1491_1874 113
1068 3300046694 Ga0495649_0120385 Ga0495649_0120385_325_714 113
1069 3300046694 Ga0495649_0184805 Ga0495649_0184805_279_662 113
1070 3300046694 Ga0495649_0482298 Ga0495649_0482298_29_418 113
1071 3300046694 Ga0495649_0588584 Ga0495649_0588584_89_472 113
1072 3300046794 Ga0495589_0014565 Ga0495589_0014565_3044_3433 113
1073 3300046794 Ga0495589_0022141 Ga0495589_0022141_2506_2895 113
1074 3300046794 Ga0495589_0085487 Ga0495589_0085487_322_711 113
1075 3300046794 Ga0495589_0085914 Ga0495589_0085914_807_1196 113
1076 3300046794 Ga0495589_0088958 Ga0495589_0088958_274_663 113
1077 3300046794 Ga0495589_0120451 Ga0495589_0120451_162_551 113
1078 3300046794 Ga0495589_0137014 Ga0495589_0137014_339_728 113
1079 3300046794 Ga0495589_0306391 Ga0495589_0306391_272_661 113
1080 3300046794 Ga0495589_0328935 Ga0495589_0328935_134_523 113
1081 3300046809 Ga0495600_0075615 Ga0495600_0075615_227_616 113
1082 3300046809 Ga0495600_0169292 Ga0495600_0169292_685_1074 113
1083 3300046810 Ga0495660_0003674 Ga0495660_0003674_396_785 113
1084 3300046810 Ga0495660_0030863 Ga0495660_0030863_2222_2605 113
1085 3300046810 Ga0495660_0147915 Ga0495660_0147915_56_445 113
1086 3300046810 Ga0495660_0154468 Ga0495660_0154468_532_921 113
1087 3300046810 Ga0495660_0168230 Ga0495660_0168230_340_729 113
1088 3300046810 Ga0495660_0308179 Ga0495660_0308179_257_646 113
1089 3300047315 Ga0495581_0011795 Ga0495581_0011795_664_1053 113
1090 3300047315 Ga0495581_0360631 Ga0495581_0360631_255_644 113
1091 3300047315 Ga0495581_0381506 Ga0495581_0381506_48_437 113
1092 3300047315 Ga0495581_0723677 Ga0495581_0723677_121_510 113
1093 3300047317 Ga0495604_0098589 Ga0495604_0098589_338_727 113
1094 3300047317 Ga0495604_0145750 Ga0495604_0145750_190_579 113
1095 3300047317 Ga0495604_0521019 Ga0495604_0521019_268_657 113
1096 3300047318 Ga0495636_0006088 Ga0495636_0006088_3979_4368 113
1097 3300047318 Ga0495636_0006698 Ga0495636_0006698_347_736 113
1098 3300047318 Ga0495636_0022781 Ga0495636_0022781_321_704 113
1099 3300047318 Ga0495636_0162291 Ga0495636_0162291_374_763 113
1100 3300047318 Ga0495636_0287990 Ga0495636_0287990_288_677 113
1101 3300047318 Ga0495636_0535779 Ga0495636_0535779_99_488 113
1102 3300047319 Ga0495674_0035014 Ga0495674_0035014_333_722 113
1103 3300047320 Ga0495672_0019097 Ga0495672_0019097_3786_4169 113
1104 3300047320 Ga0495672_0020418 Ga0495672_0020418_3821_4210 113
1105 3300047320 Ga0495672_0059705 Ga0495672_0059705_1415_1804 113
1106 3300047320 Ga0495672_0078821 Ga0495672_0078821_471_860 113
1107 3300047320 Ga0495672_0083387 Ga0495672_0083387_785_1174 113
1108 3300047320 Ga0495672_0144473 Ga0495672_0144473_336_725 113
1109 3300047321 Ga0495676_0059819 Ga0495676_0059819_1799_2188 113
1110 3300047321 Ga0495676_0173448 Ga0495676_0173448_438_827 113
1111 3300047321 Ga0495676_0257446 Ga0495676_0257446_515_904 113
1112 3300047321 Ga0495676_0304389 Ga0495676_0304389_267_656 113
1113 3300047322 Ga0495680_0081403 Ga0495680_0081403_1549_1938 113
1114 3300047322 Ga0495680_0344851 Ga0495680_0344851_529_918 113
1115 3300047322 Ga0495680_0537176 Ga0495680_0537176_157_546 113
1116 3300047323 Ga0495683_0025191 Ga0495683_0025191_489_878 113
1117 3300047323 Ga0495683_0037514 Ga0495683_0037514_1582_1971 113
1118 3300047323 Ga0495683_0070704 Ga0495683_0070704_134_523 113
1119 3300047323 Ga0495683_0142576 Ga0495683_0142576_153_542 113
1120 3300047323 Ga0495683_0151837 Ga0495683_0151837_543_932 113
1121 3300047323 Ga0495683_0186374 Ga0495683_0186374_146_562 113
1122 3300047323 Ga0495683_0233898 Ga0495683_0233898_291_680 113
1123 3300047323 Ga0495683_0234859 Ga0495683_0234859_351_740 113
1124 3300047443 Ga0495687_014326 Ga0495687_014326_351_740 113
1125 3300047443 Ga0495687_029913 Ga0495687_029913_318_701 113
1126 3300047443 Ga0495687_036882 Ga0495687_036882_1447_1836 113
1127 3300047443 Ga0495687_088588 Ga0495687_088588_255_638 113
1128 3300047443 Ga0495687_090810 Ga0495687_090810_563_946 113
1129 3300047443 Ga0495687_097393 Ga0495687_097393_324_713 113
1130 3300047444 Ga0495675_0151163 Ga0495675_0151163_464_853 113
1131 3300047444 Ga0495675_0229325 Ga0495675_0229325_505_894 113
1132 3300047444 Ga0495675_0361090 Ga0495675_0361090_108_497 113
1133 3300047444 Ga0495675_0526632 Ga0495675_0526632_141_530 113
1134 3300047445 Ga0495677_0006314 Ga0495677_0006314_73_462 113
1135 3300047445 Ga0495677_0006510 Ga0495677_0006510_3733_4116 113
1136 3300047445 Ga0495677_0026532 Ga0495677_0026532_902_1291 113
1137 3300047445 Ga0495677_0043835 Ga0495677_0043835_54_443 113
1138 3300047445 Ga0495677_0070385 Ga0495677_0070385_21_410 113
1139 3300047445 Ga0495677_0085894 Ga0495677_0085894_682_1071 113
1140 3300047445 Ga0495677_0087226 Ga0495677_0087226_155_544 113
1141 3300047445 Ga0495677_0093603 Ga0495677_0093603_701_1090 113
1142 3300047445 Ga0495677_0097213 Ga0495677_0097213_61_450 113
1143 3300047445 Ga0495677_0181154 Ga0495677_0181154_73_462 113
1144 3300047445 Ga0495677_0215504 Ga0495677_0215504_291_680 113
1145 3300047445 Ga0495677_0278112 Ga0495677_0278112_241_630 113
1146 3300047445 Ga0495677_0280702 Ga0495677_0280702_120_503 113
1147 3300047446 Ga0495679_008823 Ga0495679_008823_2265_2654 113
1148 3300047446 Ga0495679_051789 Ga0495679_051789_446_835 113
1149 3300047446 Ga0495679_061198 Ga0495679_061198_432_821 113
1150 3300047446 Ga0495679_065665 Ga0495679_065665_302_685 113
1151 3300047446 Ga0495679_104770 Ga0495679_104770_147_536 113
1152 3300047447 Ga0495685_001797 Ga0495685_001797_855_1238 113
1153 3300047447 Ga0495685_051223 Ga0495685_051223_322_711 113
1154 3300047447 Ga0495685_059807 Ga0495685_059807_477_866 113
1155 3300047447 Ga0495685_096110 Ga0495685_096110_336_725 113
1156 3300047447 Ga0495685_241979 Ga0495685_241979_37_420 113
1157 3300047469 Ga0495673_0000185 Ga0495673_0000185_8120_8503 113
1158 3300047469 Ga0495673_0002607 Ga0495673_0002607_800_1189 113
1159 3300047470 Ga0495681_0018699 Ga0495681_0018699_1692_2075 113
1160 3300047470 Ga0495681_0030651 Ga0495681_0030651_2272_2661 113
1161 3300047470 Ga0495681_0061145 Ga0495681_0061145_385_774 113
1162 3300047470 Ga0495681_0078367 Ga0495681_0078367_454_843 113
1163 3300047470 Ga0495681_0106719 Ga0495681_0106719_413_802 113
1164 3300047470 Ga0495681_0139883 Ga0495681_0139883_446_835 113
1165 3300047470 Ga0495681_0152247 Ga0495681_0152247_430_819 113
1166 3300047472 Ga0495686_0005000 Ga0495686_0005000_9833_10216 113
1167 3300047472 Ga0495686_0116547 Ga0495686_0116547_289_672 113
1168 3300047472 Ga0495686_0121709 Ga0495686_0121709_1105_1488 113
1169 3300047472 Ga0495686_0203037 Ga0495686_0203037_314_697 113
1170 3300047472 Ga0495686_0452869 Ga0495686_0452869_67_456 113
1171 3300047472 Ga0495686_0727384 Ga0495686_0727384_60_449 113
1172 3300047673 Ga0495593_0012462 Ga0495593_0012462_678_1067 113
1173 3300047673 Ga0495593_0374729 Ga0495593_0374729_204_593 113
1174 3300048088 Ga0495602_0058801 Ga0495602_0058801_753_1142 113
1175 3300048089 Ga0495614_0060035 Ga0495614_0060035_890_1279 113
1176 3300048090 Ga0495615_0042504 Ga0495615_0042504_488_877 113
1177 3300048090 Ga0495615_0078113 Ga0495615_0078113_275_664 113
1178 3300048091 Ga0495626_0003909 Ga0495626_0003909_357_746 113
1179 3300048091 Ga0495626_0012906 Ga0495626_0012906_3888_4277 113
1180 3300048091 Ga0495626_0027831 Ga0495626_0027831_668_1057 113
1181 3300048091 Ga0495626_0032859 Ga0495626_0032859_1624_2013 113
1182 3300048091 Ga0495626_0077411 Ga0495626_0077411_574_963 113
1183 3300048091 Ga0495626_0080378 Ga0495626_0080378_583_972 113
1184 3300048091 Ga0495626_0081637 Ga0495626_0081637_372_761 113
1185 3300048091 Ga0495626_0345249 Ga0495626_0345249_23_412 113
1186 3300048903 Ga0496100_0647665 Ga0496100_0647665_391_780 113
1187 3300048903 Ga0496100_0972939 Ga0496100_0972939_132_515 113
1188 3300048905 Ga0496102_0068828 Ga0496102_0068828_2458_2847 113
1189 3300048905 Ga0496102_0088863 Ga0496102_0088863_1497_1880 113
1190 3300048905 Ga0496102_0137406 Ga0496102_0137406_416_805 113
1191 3300048905 Ga0496102_1070135 Ga0496102_1070135_14_403 113
1192 3300048905 Ga0496102_1077448 Ga0496102_1077448_90_479 113
1193 3300048905 Ga0496102_1348585 Ga0496102_1348585_72_455 113
1194 3300048906 Ga0496103_0058673 Ga0496103_0058673_1463_1846 113
1195 3300048906 Ga0496103_0090188 Ga0496103_0090188_387_776 113
1196 3300048906 Ga0496103_0091802 Ga0496103_0091802_662_1051 113
1197 3300048906 Ga0496103_0180310 Ga0496103_0180310_516_905 113
1198 3300048906 Ga0496103_0419965 Ga0496103_0419965_370_759 113
1199 3300048906 Ga0496103_0612122 Ga0496103_0612122_246_635 113
1200 3300048907 Ga0496104_0178000 Ga0496104_0178000_126_509 113
1201 3300048907 Ga0496104_0570097 Ga0496104_0570097_503_892 113
1202 3300048907 Ga0496104_1134155 Ga0496104_1134155_265_648 113
1203 3300048908 Ga0496105_0442086 Ga0496105_0442086_567_950 113
1204 3300048908 Ga0496105_0534987 Ga0496105_0534987_225_608 113
1205 3300048908 Ga0496105_0547476 Ga0496105_0547476_209_598 113
1206 3300048908 Ga0496105_0952840 Ga0496105_0952840_68_457 113
1207 3300048909 Ga0496106_0253104 Ga0496106_0253104_694_1083 113
1208 3300048909 Ga0496106_0535103 Ga0496106_0535103_405_788 113
1209 3300048910 Ga0496107_0248001 Ga0496107_0248001_286_669 113
1210 3300048910 Ga0496107_0479689 Ga0496107_0479689_265_648 113
1211 3300048911 Ga0496108_0191326 Ga0496108_0191326_832_1215 113
1212 3300048911 Ga0496108_0599219 Ga0496108_0599219_272_661 113
1213 3300048911 Ga0496108_0849703 Ga0496108_0849703_150_539 113
1214 3300048912 Ga0496109_0072916 Ga0496109_0072916_889_1272 113
1215 3300048912 Ga0496109_0783590 Ga0496109_0783590_371_760 113
1216 3300048913 Ga0496110_0080386 Ga0496110_0080386_795_1178 113
1217 3300048913 Ga0496110_0690196 Ga0496110_0690196_139_519 113
1218 3300048913 Ga0496110_0936409 Ga0496110_0936409_80_463 113
1219 3300048913 Ga0496110_1164934 Ga0496110_1164934_27_416 113
1220 3300048914 Ga0496111_0146589 Ga0496111_0146589_1060_1443 113
1221 3300048915 Ga0496112_0306153 Ga0496112_0306153_44_433 113
1222 3300048916 Ga0496113_0385700 Ga0496113_0385700_459_848 113
1223 3300048917 Ga0496114_0022403 Ga0496114_0022403_1495_1878 113
1224 3300048917 Ga0496114_0289742 Ga0496114_0289742_35_424 113
1225 3300048917 Ga0496114_0438915 Ga0496114_0438915_422_805 113
1226 3300048917 Ga0496114_0637577 Ga0496114_0637577_111_494 113
1227 3300048918 Ga0496115_0050867 Ga0496115_0050867_2433_2822 113
1228 3300048918 Ga0496115_0221193 Ga0496115_0221193_856_1245 113
1229 3300048918 Ga0496115_0801713 Ga0496115_0801713_293_682 113
1230 3300048919 Ga0496116_0091755 Ga0496116_0091755_256_636 113
1231 3300048919 Ga0496116_0253322 Ga0496116_0253322_443_826 113
1232 3300048921 Ga0496118_0183090 Ga0496118_0183090_596_976 113
1233 3300048923 Ga0496120_0124356 Ga0496120_0124356_146_529 113
1234 3300048924 Ga0496121_0243249 Ga0496121_0243249_247_633 113
1235 3300048924 Ga0496121_0329613 Ga0496121_0329613_351_761 113
1236 3300048924 Ga0496121_0676800 Ga0496121_0676800_47_430 113
1237 3300048925 Ga0496122_0109128 Ga0496122_0109128_484_864 113
1238 3300048925 Ga0496122_0426972 Ga0496122_0426972_177_560 113
1239 3300048926 Ga0496123_0013659 Ga0496123_0013659_5929_6309 113
1240 3300048926 Ga0496123_0069843 Ga0496123_0069843_1510_1893 113
1241 3300048927 Ga0496124_0106187 Ga0496124_0106187_363_749 113
1242 3300048927 Ga0496124_0129517 Ga0496124_0129517_1490_1879 113
1243 3300048927 Ga0496124_0132720 Ga0496124_0132720_1547_1930 113
1244 3300048927 Ga0496124_0150483 Ga0496124_0150483_340_729 113
1245 3300048927 Ga0496124_0323784 Ga0496124_0323784_298_687 113
1246 3300048927 Ga0496124_0348155 Ga0496124_0348155_357_746 113
1247 3300048927 Ga0496124_0355597 Ga0496124_0355597_601_990 113
1248 3300048927 Ga0496124_0745176 Ga0496124_0745176_184_573 113
1249 3300048927 Ga0496124_0787945 Ga0496124_0787945_128_517 113
1250 3300048927 Ga0496124_0801049 Ga0496124_0801049_150_539 113
1251 3300048928 Ga0496125_0021606 Ga0496125_0021606_5337_5720 113
1252 3300048928 Ga0496125_0063503 Ga0496125_0063503_2207_2596 113
1253 3300048928 Ga0496125_0427486 Ga0496125_0427486_348_728 113
1254 3300048929 Ga0496126_0031527 Ga0496126_0031527_4481_4864 113
1255 3300048929 Ga0496126_0345681 Ga0496126_0345681_656_1042 113
1256 3300049127 Ga0501306_003340 Ga0501306_003340_1056_1439 113
1257 3300049127 Ga0501306_009215 Ga0501306_009215_343_732 113
1258 3300049127 Ga0501306_058971 Ga0501306_058971_17_403 113
1259 3300049127 Ga0501306_077581 Ga0501306_077581_35_424 113
1260 3300049127 Ga0501306_079075 Ga0501306_079075_156_539 113
1261 3300049128 Ga0501308_002408 Ga0501308_002408_306_689 113
1262 3300049128 Ga0501308_018121 Ga0501308_018121_31_411 113
1263 3300049129 Ga0501309_004241 Ga0501309_004241_1240_1623 113
1264 3300049129 Ga0501309_011386 Ga0501309_011386_346_735 113
1265 3300049130 Ga0501310_001072 Ga0501310_001072_1603_1989 113
1266 3300049130 Ga0501310_006078 Ga0501310_006078_491_874 113
1267 3300049132 Ga0501343_000533 Ga0501343_000533_1342_1731 113
1268 3300049132 Ga0501343_007025 Ga0501343_007025_289_669 113
1269 3300049132 Ga0501343_010267 Ga0501343_010267_303_686 113
1270 3300049160 Ga0501304_001138 Ga0501304_001138_68_451 113
1271 3300049160 Ga0501304_002860 Ga0501304_002860_346_735 113
1272 3300049160 Ga0501304_005072 Ga0501304_005072_271_654 113
1273 3300049160 Ga0501304_008888 Ga0501304_008888_263_643 113
1274 3300049161 Ga0501305_005503 Ga0501305_005503_292_678 113
1275 3300049161 Ga0501305_006325 Ga0501305_006325_1053_1436 113
1276 3300049161 Ga0501305_028998 Ga0501305_028998_142_531 113
1277 3300049161 Ga0501305_047139 Ga0501305_047139_292_681 113
1278 3300049161 Ga0501305_081335 Ga0501305_081335_85_468 113
1279 3300049161 Ga0501305_082426 Ga0501305_082426_36_416 113
1280 3300049162 Ga0501307_002498 Ga0501307_002498_1212_1595 113
1281 3300049162 Ga0501307_004154 Ga0501307_004154_667_1050 113
1282 3300049162 Ga0501307_004969 Ga0501307_004969_428_817 113
1283 3300049162 Ga0501307_067261 Ga0501307_067261_152_538 113
1284 3300049459 Ga0495678_025193 Ga0495678_025193_1692_2081 113
1285 3300049459 Ga0495678_027928 Ga0495678_027928_1597_1986 113
1286 3300049459 Ga0495678_059401 Ga0495678_059401_928_1311 113
1287 3300049459 Ga0495678_066094 Ga0495678_066094_458_844 113
1288 3300049459 Ga0495678_092832 Ga0495678_092832_596_985 113
1289 3300049460 Ga0495682_0063615 Ga0495682_0063615_405_794 113
1290 3300049460 Ga0495682_0080123 Ga0495682_0080123_634_1023 113
1291 3300049460 Ga0495682_0124886 Ga0495682_0124886_119_502 113
1292 3300049527 Ga0501311_000165 Ga0501311_000165_3258_3641 113
1293 3300049527 Ga0501311_020593 Ga0501311_020593_129_512 113
1294 3300049527 Ga0501311_089829 Ga0501311_089829_128_511 113
1295 3300049528 Ga0501312_004623 Ga0501312_004623_27_416 113
1296 3300049528 Ga0501312_012905 Ga0501312_012905_52_435 113
1297 3300049528 Ga0501312_025618 Ga0501312_025618_285_668 113
1298 3300049528 Ga0501312_032245 Ga0501312_032245_264_650 113
1299 3300049528 Ga0501312_053251 Ga0501312_053251_97_486 113
1300 3300049528 Ga0501312_090417 Ga0501312_090417_97_486 113
1301 3300049529 Ga0501313_000756 Ga0501313_000756_349_732 113
1302 3300049530 Ga0501314_005033 Ga0501314_005033_340_729 113
1303 3300049530 Ga0501314_008905 Ga0501314_008905_247_630 113
1304 3300049530 Ga0501314_021302 Ga0501314_021302_267_653 113
1305 3300049531 Ga0501315_000556 Ga0501315_000556_2130_2513 113
1306 3300049531 Ga0501315_002286 Ga0501315_002286_962_1345 113
1307 3300049531 Ga0501315_003217 Ga0501315_003217_153_539 113
1308 3300049531 Ga0501315_013154 Ga0501315_013154_157_546 113
1309 3300049531 Ga0501315_082020 Ga0501315_082020_89_475 113
1310 3300049532 Ga0501316_000848 Ga0501316_000848_349_732 113
1311 3300049532 Ga0501316_006293 Ga0501316_006293_43_429 113
1312 3300049532 Ga0501316_007300 Ga0501316_007300_616_1002 113
1313 3300049533 Ga0501317_016468 Ga0501317_016468_221_604 113
1314 3300049533 Ga0501317_016650 Ga0501317_016650_234_623 113
1315 3300049533 Ga0501317_022573 Ga0501317_022573_464_844 113
1316 3300049535 Ga0501319_026436 Ga0501319_026436_131_517 113
1317 3300049536 Ga0501320_003037 Ga0501320_003037_95_478 113
1318 3300049536 Ga0501320_003150 Ga0501320_003150_132_521 113
1319 3300049536 Ga0501320_003152 Ga0501320_003152_214_597 113
1320 3300049536 Ga0501320_009230 Ga0501320_009230_170_556 113
1321 3300049537 Ga0501321_003885 Ga0501321_003885_506_892 113
1322 3300049537 Ga0501321_025452 Ga0501321_025452_97_486 113
1323 3300049537 Ga0501321_026065 Ga0501321_026065_97_486 113
1324 3300049537 Ga0501321_039662 Ga0501321_039662_29_412 113
1325 3300049538 Ga0501322_003710 Ga0501322_003710_340_729 113
1326 3300049539 Ga0501323_017947 Ga0501323_017947_245_628 113
1327 3300049539 Ga0501323_038409 Ga0501323_038409_296_679 113
1328 3300049539 Ga0501323_055330 Ga0501323_055330_105_491 113
1329 3300049539 Ga0501323_086114 Ga0501323_086114_67_456 113
1330 3300049540 Ga0501324_000146 Ga0501324_000146_143_532 113
1331 3300049540 Ga0501324_032909 Ga0501324_032909_143_532 113
1332 3300049540 Ga0501324_039127 Ga0501324_039127_103_489 113
1333 3300049541 Ga0501325_002483 Ga0501325_002483_658_1041 113
1334 3300049542 Ga0501326_03837 Ga0501326_03837_58_447 113
1335 3300049543 Ga0501327_07824 Ga0501327_07824_271_660 113
1336 3300049546 Ga0501330_015869 Ga0501330_015869_149_556 113
1337 3300049550 Ga0501334_02030 Ga0501334_02030_452_841 113
1338 3300049550 Ga0501334_11604 Ga0501334_11604_221_604 113
1339 3300049551 Ga0501335_030466 Ga0501335_030466_40_426 113
1340 3300049552 Ga0501336_001604 Ga0501336_001604_288_668 113
1341 3300049552 Ga0501336_021445 Ga0501336_021445_140_523 113
1342 3300049553 Ga0501337_003695 Ga0501337_003695_367_750 113
1343 3300049572 Ga0501036_0168725 Ga0501036_0168725_1257_1646 113
1344 3300049658 Ga0501211_003467 Ga0501211_003467_823_1206 113
1345 3300049671 Ga0501238_028740 Ga0501238_028740_320_703 113
1346 3300049686 Ga0501257_178657 Ga0501257_178657_86_472 113
1347 3300049707 Ga0501234_014155 Ga0501234_014155_193_576 113
1348 3300049757 Ga0501232_048342 Ga0501232_048342_119_502 113
1349 3300049760 Ga0501263_009328 Ga0501263_009328_504_887 113
1350 3300049765 Ga0501268_014162 Ga0501268_014162_707_1090 113
1351 3300049775 Ga0501279_014665 Ga0501279_014665_312_695 113
1352 3300049822 Ga0501035_0035964 Ga0501035_0035964_2020_2409 113
1353 3300049823 Ga0501044_1175829 Ga0501044_1175829_137_520 113
1354 3300050496 nmdc:mga07m45_367000_c1 nmdc:mga07m45_367000_c1_246_629 113
1355 3300053090 Ga0500646_0325529 Ga0500646_0325529_68_448 113
1356 3300053126 Ga0500621_188196 Ga0500621_188196_208_597 113
1357 3300053136 Ga0500559_0112531 Ga0500559_0112531_175_558 113
1358 3300053145 Ga0500586_130803 Ga0500586_130803_301_684 113
1359 3300059477 Ga0587084_006452 Ga0587084_006452_309_692 113
1360 3300059477 Ga0587084_017124 Ga0587084_017124_131_544 113
1361 3300059477 Ga0587084_027909 Ga0587084_027909_354_743 113
1362 3300059478 Ga0587093_001802 Ga0587093_001802_1190_1573 113
1363 3300059478 Ga0587093_003356 Ga0587093_003356_515_904 113
1364 3300059490 Ga0587066_002048 Ga0587066_002048_241_624 113
1365 3300059490 Ga0587066_025732 Ga0587066_025732_346_759 113
1366 3300059491 Ga0587070_011858 Ga0587070_011858_538_927 113
1367 3300059491 Ga0587070_012033 Ga0587070_012033_483_896 113
1368 3300059491 Ga0587070_037857 Ga0587070_037857_399_788 113
1369 3300059492 Ga0587073_0000405 Ga0587073_0000405_2575_2964 113
1370 3300059492 Ga0587073_0152513 Ga0587073_0152513_100_483 113
1371 3300059493 Ga0587077_008903 Ga0587077_008903_861_1274 113
1372 3300059493 Ga0587077_009273 Ga0587077_009273_249_632 113
1373 3300059503 Ga0587080_003728 Ga0587080_003728_343_726 113
1374 3300059503 Ga0587080_019330 Ga0587080_019330_404_817 113
1375 3300059503 Ga0587080_053033 Ga0587080_053033_169_552 113
1376 3300059504 Ga0587082_000814 Ga0587082_000814_2093_2506 113
1377 3300059504 Ga0587082_062171 Ga0587082_062171_138_521 113
1378 3300059505 Ga0587083_0032996 Ga0587083_0032996_404_817 113
1379 3300059505 Ga0587083_0039846 Ga0587083_0039846_245_634 113
1380 3300059506 Ga0587085_006188 Ga0587085_006188_565_954 113
1381 3300059506 Ga0587085_013499 Ga0587085_013499_363_776 113
1382 3300059507 Ga0587086_000667 Ga0587086_000667_1796_2185 113
1383 3300059507 Ga0587086_003732 Ga0587086_003732_209_592 113
1384 3300059507 Ga0587086_012653 Ga0587086_012653_307_690 113
1385 3300059508 Ga0587088_000683 Ga0587088_000683_254_643 113
1386 3300059508 Ga0587088_006876 Ga0587088_006876_947_1330 113
1387 3300059508 Ga0587088_039639 Ga0587088_039639_284_667 113
1388 3300059509 Ga0587089_009849 Ga0587089_009849_188_577 113
1389 3300059509 Ga0587089_018181 Ga0587089_018181_322_735 113
1390 3300059509 Ga0587089_031477 Ga0587089_031477_279_662 113
1391 3300059510 Ga0587090_003488 Ga0587090_003488_384_797 113
1392 3300059510 Ga0587090_007045 Ga0587090_007045_894_1277 113
1393 3300059511 Ga0587091_002980 Ga0587091_002980_1543_1932 113
1394 3300059511 Ga0587091_021583 Ga0587091_021583_307_720 113
1395 3300059512 Ga0587092_005373 Ga0587092_005373_338_727 113
1396 3300059512 Ga0587092_008921 Ga0587092_008921_647_1060 113
1397 3300059513 Ga0587094_002657 Ga0587094_002657_507_890 113
1398 3300059513 Ga0587094_003403 Ga0587094_003403_978_1367 113
1399 3300059513 Ga0587094_003513 Ga0587094_003513_1175_1588 113
1400 3300059514 Ga0587095_000862 Ga0587095_000862_915_1298 113
1401 3300059514 Ga0587095_001423 Ga0587095_001423_814_1203 113
1402 3300059603 Ga0587097_00287 Ga0587097_00287_447_836 113
1403 3300059603 Ga0587097_01444 Ga0587097_01444_263_646 113
1404 3300059604 Ga0587098_001919 Ga0587098_001919_911_1300 113
1405 3300059604 Ga0587098_028142 Ga0587098_028142_231_614 113
1406 3300059606 Ga0587121_01643 Ga0587121_01643_364_753 113
1407 3300059607 Ga0587125_000574 Ga0587125_000574_1041_1430 113
1408 3300059608 Ga0587129_003518 Ga0587129_003518_231_620 113
1409 3300059622 Ga0587099_005269 Ga0587099_005269_390_779 113
1410 3300059623 Ga0587101_000524 Ga0587101_000524_2049_2432 113
1411 3300059623 Ga0587101_002989 Ga0587101_002989_969_1382 113
1412 3300059623 Ga0587101_008422 Ga0587101_008422_319_708 113
1413 3300059623 Ga0587101_033901 Ga0587101_033901_195_584 113
1414 3300059624 Ga0587109_014290 Ga0587109_014290_783_1172 113
1415 3300059624 Ga0587109_031962 Ga0587109_031962_368_781 113
1416 3300059626 Ga0587115_006225 Ga0587115_006225_433_822 113
1417 3300059627 Ga0587117_015916 Ga0587117_015916_349_762 113
1418 3300059630 Ga0587128_005351 Ga0587128_005351_770_1159 113
1419 3300059630 Ga0587128_036484 Ga0587128_036484_212_625 113
1420 3300059639 Ga0587062_015555 Ga0587062_015555_282_695 113
1421 3300059639 Ga0587062_016957 Ga0587062_016957_270_653 113
1422 3300059639 Ga0587062_064065 Ga0587062_064065_101_484 113
1423 3300059641 Ga0587068_006343 Ga0587068_006343_873_1262 113
1424 3300059641 Ga0587068_025778 Ga0587068_025778_307_720 113
1425 3300059642 Ga0587069_000151 Ga0587069_000151_2813_3196 113
1426 3300059642 Ga0587069_008398 Ga0587069_008398_706_1089 113
1427 3300059643 Ga0587072_019128 Ga0587072_019128_308_721 113
1428 3300059643 Ga0587072_039981 Ga0587072_039981_372_761 113
1429 3300059644 Ga0587075_002302 Ga0587075_002302_1236_1619 113
1430 3300059644 Ga0587075_008575 Ga0587075_008575_330_743 113
1431 3300059645 Ga0587076_000769 Ga0587076_000769_254_637 113
1432 3300059645 Ga0587076_008880 Ga0587076_008880_307_720 113
1433 3300059646 Ga0587078_021377 Ga0587078_021377_302_715 113
1434 3300059647 Ga0587079_000436 Ga0587079_000436_227_610 113
1435 3300059647 Ga0587079_022980 Ga0587079_022980_363_752 113
1436 3300059647 Ga0587079_034095 Ga0587079_034095_338_721 113
1437 3300059647 Ga0587079_037059 Ga0587079_037059_276_689 113
1438 3300059647 Ga0587079_048272 Ga0587079_048272_294_677 113
1439 3300059648 Ga0587100_005333 Ga0587100_005333_288_701 113
1440 3300059649 Ga0587102_000673 Ga0587102_000673_823_1212 113
1441 3300059649 Ga0587102_001335 Ga0587102_001335_1027_1410 113
1442 3300059649 Ga0587102_011088 Ga0587102_011088_258_671 113
1443 3300059650 Ga0587104_000706 Ga0587104_000706_172_561 113
1444 3300059651 Ga0587105_002305 Ga0587105_002305_338_727 113
1445 3300059652 Ga0587107_008387 Ga0587107_008387_346_735 113
1446 3300059653 Ga0587108_000215 Ga0587108_000215_123_512 113
1447 3300059654 Ga0587110_001895 Ga0587110_001895_338_727 113
1448 3300059656 Ga0587116_04152 Ga0587116_04152_206_619 113
1449 3300059657 Ga0587118_02411 Ga0587118_02411_332_721 113
1450 3300059658 Ga0587119_001725 Ga0587119_001725_463_852 113
1451 3300059658 Ga0587119_015430 Ga0587119_015430_257_670 113
1452 3300059659 Ga0587120_000930 Ga0587120_000930_342_731 113
1453 3300060245 Ga0587065_06038 Ga0587065_06038_250_639 113
1454 3300060246 Ga0587081_13236 Ga0587081_13236_34_447 113
1455 3300060247 Ga0587096_00225 Ga0587096_00225_489_878 113
1456 3300060344 Ga0587071_000779 Ga0587071_000779_326_709 113
1457 3300060344 Ga0587071_015766 Ga0587071_015766_540_923 113
1458 3300060344 Ga0587071_025527 Ga0587071_025527_396_809 113
1459 3300060344 Ga0587071_048707 Ga0587071_048707_300_689 113
1460 3300060346 Ga0587111_0002093 Ga0587111_0002093_415_798 113
1461 3300060346 Ga0587111_0005555 Ga0587111_0005555_703_1092 113
1462 3300060346 Ga0587111_0006057 Ga0587111_0006057_1161_1544 113
1463 3300060346 Ga0587111_0026675 Ga0587111_0026675_307_720 113
1464 3300060346 Ga0587111_0080351 Ga0587111_0080351_327_707 113
1465 3300061719 Ga0466962_0268453 Ga0466962_0268453_389_778 113
1466 iso_pu_bacteria 2885080285 2885080589 113
1467 iso_pu_bacteria 2932416698 2932422363 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00584

SecE

SecE/Sec61-gamma subunits of protein translocation complex

81

136

0.96

Feature Viewer

pLDDT pTM Quality
73.96 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map