F494183
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1468 | 653 | 2936 | 59 |
Family's Representative Sequence
| Representative Sequence | 3300005617|Ga0068859_100874285|Ga0068859_1008742852 |
| Length | 68 |
| Sequence | MAVQKSRVTRSRRGMRRSHDALSGPALSVEKTTGATHRRHHVSPDGYYRGRQVLDLSPVTEDDSDNEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 28 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 29 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 46 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 47 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 50 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 92 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 108 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 129 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 135 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300023552 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300023562 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 138 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 204 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 213 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 215 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 216 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 217 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 218 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 219 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 220 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 221 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300030942 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 230 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 231 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 232 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 237 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 238 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 239 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 241 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 242 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 244 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 250 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 251 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 252 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 253 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 254 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 261 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 265 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 274 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 275 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 276 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 277 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 278 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041454 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaT | Metatranscriptome | Rhizoplane |
| 282 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 283 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 284 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 285 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 286 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 287 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 288 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 289 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 290 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 291 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 292 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 293 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 294 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 295 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 296 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 297 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 298 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 299 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 300 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 301 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 302 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 303 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 304 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 305 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 306 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 307 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 308 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 309 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 310 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 311 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 312 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 313 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 314 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 315 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 316 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 412 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 413 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 414 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 415 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 416 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 417 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 418 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 419 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 420 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 421 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 422 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 423 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 424 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 425 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 426 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 427 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 428 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 429 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 430 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 431 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 432 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 433 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 434 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 435 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 436 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 437 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 459 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 460 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 461 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 462 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 463 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 464 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 465 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 466 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 467 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 489 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 491 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 492 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 493 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 494 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 495 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 498 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 499 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 500 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 502 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 503 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 504 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 505 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 506 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 507 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 509 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 513 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 514 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 515 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 516 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 517 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 518 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 520 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 523 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 547 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 548 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 549 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 550 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 551 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 574 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 575 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 576 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 577 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 578 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 579 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 580 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 581 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 582 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 583 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 584 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 585 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 586 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 587 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 588 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 589 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 590 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 591 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 592 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 593 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 594 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 595 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 596 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 597 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 598 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 599 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 600 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 601 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 602 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 603 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 604 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 605 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 606 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 607 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 608 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 609 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 610 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 611 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 612 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 613 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 614 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 615 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 616 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 617 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 618 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 619 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 620 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 621 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 622 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 623 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 624 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 625 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 626 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 627 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 628 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 629 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 630 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 631 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 632 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 633 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 634 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 635 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 636 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 637 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 638 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 639 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 640 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 641 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 642 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 643 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 644 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 645 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 646 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 647 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 648 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 649 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 650 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 651 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 652 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 653 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.28 |
| Metatranscriptomes | 22.41 |
| Isolates | 5.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.13 |
| Nodule | 0.54 |
| Rhizoplane | 2.72 |
| Rhizosphere | 76.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068859_100874285 | 3300005617 | Bacteria | 984 |
| 2 | JGI24740J21852_10000462 | 3300001979 | Bacteria | 17404 |
| 3 | JGI24740J21852_10000722 | 3300001979 | Bacteria | 14380 |
| 4 | JGI24740J21852_10001385 | 3300001979 | Bacteria | 11061 |
| 5 | JGI24740J21852_10020567 | 3300001979 | Bacteria | 2300 |
| 6 | JGI24740J21852_10124610 | 3300001979 | Bacteria | 644 |
| 7 | JGI24739J22299_10017122 | 3300001989 | Bacteria | 2618 |
| 8 | JGI24739J22299_10055368 | 3300001989 | Bacteria | 1268 |
| 9 | JGI24739J22299_10151185 | 3300001989 | Bacteria | 686 |
| 10 | JGI24737J22298_10028137 | 3300001990 | Bacteria | 1768 |
| 11 | JGI24737J22298_10032661 | 3300001990 | Bacteria | 1620 |
| 12 | JGI24737J22298_10044667 | 3300001990 | Bacteria | 1354 |
| 13 | JGI24735J21928_10000381 | 3300002067 | Bacteria | 15526 |
| 14 | JGI24735J21928_10002924 | 3300002067 | Bacteria | 5878 |
| 15 | JGI24735J21928_10012808 | 3300002067 | Bacteria | 2648 |
| 16 | JGI24738J21930_10002568 | 3300002075 | Bacteria | 4705 |
| 17 | JGI24738J21930_10060147 | 3300002075 | Bacteria | 780 |
| 18 | JGI25156J39149_1007106 | 3300002705 | Bacteria | 2977 |
| 19 | JGI25156J39149_1011215 | 3300002705 | Bacteria | 2041 |
| 20 | JGI25156J39149_1014217 | 3300002705 | Bacteria | 1652 |
| 21 | JGI25156J39149_1019256 | 3300002705 | Bacteria | 1234 |
| 22 | JGI25154J39366_1000446 | 3300002738 | Bacteria | 21840 |
| 23 | JGI25157J39369_1017322 | 3300002741 | Bacteria | 875 |
| 24 | JGI25157J39369_1024694 | 3300002741 | Bacteria | 703 |
| 25 | JGI25164J39214_1010585 | 3300002772 | Bacteria | 892 |
| 26 | Ga0006765J45826_106676 | 3300003161 | Bacteria | 831 |
| 27 | Ga0006778J45830_1030621 | 3300003162 | Bacteria | 1423 |
| 28 | Ga0006759J45824_1026941 | 3300003163 | Bacteria | 621 |
| 29 | Ga0006759J45824_1033546 | 3300003163 | Bacteria | 828 |
| 30 | Ga0006759J45824_1058067 | 3300003163 | Bacteria | 671 |
| 31 | Ga0006759J45824_1063513 | 3300003163 | Bacteria | 639 |
| 32 | Ga0006759J45824_1065469 | 3300003163 | Bacteria | 535 |
| 33 | JGI25165J46597_1002385 | 3300003214 | Bacteria | 6223 |
| 34 | Ga0006758J48902_1015910 | 3300003300 | Bacteria | 821 |
| 35 | Ga0006758J48902_1018924 | 3300003300 | Bacteria | 526 |
| 36 | Ga0006770J48903_1010498 | 3300003305 | Bacteria | 525 |
| 37 | Ga0006770J48903_1025987 | 3300003305 | Bacteria | 821 |
| 38 | Ga0006777J48905_1019728 | 3300003308 | Bacteria | 1100 |
| 39 | rootH2_10009142 | 3300003320 | Bacteria | 4952 |
| 40 | rootH2_10030882 | 3300003320 | Bacteria | 2464 |
| 41 | rootL2_10004981 | 3300003322 | Bacteria | 32520 |
| 42 | rootL2_10014064 | 3300003322 | Bacteria | 12412 |
| 43 | JGI25160J50197_1067253 | 3300003354 | Bacteria | 694 |
| 44 | Ga0006556J51387_1019267 | 3300003479 | Bacteria | 2214 |
| 45 | Ga0006556J51387_1025420 | 3300003479 | Bacteria | 2088 |
| 46 | Ga0007417J51691_1002769 | 3300003544 | Bacteria | 2716 |
| 47 | Ga0007417J51691_1029679 | 3300003544 | Bacteria | 804 |
| 48 | Ga0006560J51390_1014813 | 3300003565 | Bacteria | 1917 |
| 49 | Ga0006560J51390_1028592 | 3300003565 | Bacteria | 805 |
| 50 | Ga0006554J51385_1021491 | 3300003567 | Bacteria | 1642 |
| 51 | Ga0006554J51385_1029024 | 3300003567 | Bacteria | 582 |
| 52 | Ga0007410J51695_1002724 | 3300003574 | Bacteria | 1998 |
| 53 | Ga0007409J51694_1016976 | 3300003575 | Bacteria | 853 |
| 54 | Ga0007416J51690_1016876 | 3300003577 | Bacteria | 805 |
| 55 | Ga0007416J51690_1030315 | 3300003577 | Bacteria | 832 |
| 56 | Ga0006562J51391_1028115 | 3300003578 | Bacteria | 1183 |
| 57 | Ga0007429J51699_1022603 | 3300003579 | Bacteria | 1847 |
| 58 | Ga0007415J51800_106685 | 3300003613 | Bacteria | 625 |
| 59 | Ga0006780_1025422 | 3300003735 | Bacteria | 622 |
| 60 | Ga0055539_1000034 | 3300003752 | Bacteria | 223400 |
| 61 | Ga0055533_1006004 | 3300003756 | Bacteria | 1858 |
| 62 | Ga0055533_1007436 | 3300003756 | Bacteria | 1491 |
| 63 | Ga0055533_1008546 | 3300003756 | Bacteria | 1285 |
| 64 | Ga0055533_1015348 | 3300003756 | Bacteria | 755 |
| 65 | Ga0055532_1000002 | 3300003758 | Bacteria | 576000 |
| 66 | Ga0055532_1000039 | 3300003758 | Bacteria | 198049 |
| 67 | Ga0055532_1011346 | 3300003758 | Bacteria | 1050 |
| 68 | Ga0055525_1000538 | 3300003759 | Bacteria | 18074 |
| 69 | Ga0055527_1000024 | 3300003760 | Bacteria | 198049 |
| 70 | Ga0055527_1001254 | 3300003760 | Bacteria | 5582 |
| 71 | Ga0055535_1000028 | 3300003761 | Bacteria | 198049 |
| 72 | Ga0055535_1031885 | 3300003761 | Bacteria | 538 |
| 73 | Ga0055542_1000047 | 3300003762 | Bacteria | 198049 |
| 74 | Ga0055542_1003250 | 3300003762 | Bacteria | 4535 |
| 75 | Ga0055529_1000028 | 3300003763 | Bacteria | 287650 |
| 76 | Ga0055529_1000054 | 3300003763 | Bacteria | 198049 |
| 77 | Ga0055529_1000146 | 3300003763 | Bacteria | 100947 |
| 78 | Ga0055524_1001224 | 3300003775 | Bacteria | 15168 |
| 79 | Ga0055524_1002725 | 3300003775 | Bacteria | 8921 |
| 80 | Ga0055528_1002393 | 3300003790 | Bacteria | 10095 |
| 81 | Ga0055530_10050039 | 3300003791 | Bacteria | 975 |
| 82 | Ga0055540_1020093 | 3300003792 | Bacteria | 1778 |
| 83 | Ga0055531_10001660 | 3300003794 | Bacteria | 16067 |
| 84 | Ga0055531_10001947 | 3300003794 | Bacteria | 14432 |
| 85 | Ga0055531_10005441 | 3300003794 | Bacteria | 7454 |
| 86 | Ga0055541_1000217 | 3300003841 | Bacteria | 23975 |
| 87 | Ga0055541_1000861 | 3300003841 | Bacteria | 7401 |
| 88 | Ga0055541_1018901 | 3300003841 | Bacteria | 842 |
| 89 | Ga0058692_1006669 | 3300003856 | Bacteria | 3142 |
| 90 | Ga0058692_1049135 | 3300003856 | Bacteria | 705 |
| 91 | Ga0058692_1068129 | 3300003856 | Bacteria | 545 |
| 92 | Ga0065714_10046912 | 3300005288 | Bacteria | 821 |
| 93 | Ga0065714_10084786 | 3300005288 | Bacteria | 2180 |
| 94 | Ga0065714_10224958 | 3300005288 | Bacteria | 831 |
| 95 | Ga0065714_10261913 | 3300005288 | Bacteria | 729 |
| 96 | Ga0065704_10348879 | 3300005289 | Bacteria | 813 |
| 97 | Ga0065704_10520996 | 3300005289 | Bacteria | 653 |
| 98 | Ga0065715_10040010 | 3300005293 | Bacteria | 1236 |
| 99 | Ga0065715_10110556 | 3300005293 | Bacteria | 2615 |
| 100 | Ga0070658_10177134 | 3300005327 | Bacteria | 1793 |
| 101 | Ga0070658_10389801 | 3300005327 | Bacteria | 1196 |
| 102 | Ga0070658_10753222 | 3300005327 | Bacteria | 846 |
| 103 | Ga0070683_101927808 | 3300005329 | Bacteria | 568 |
| 104 | Ga0070666_11279761 | 3300005335 | Bacteria | 547 |
| 105 | Ga0070680_100791418 | 3300005336 | Bacteria | 817 |
| 106 | Ga0070682_100987440 | 3300005337 | Bacteria | 698 |
| 107 | Ga0070660_100000010 | 3300005339 | Bacteria | 136324 |
| 108 | Ga0070660_100277925 | 3300005339 | Bacteria | 1370 |
| 109 | Ga0070661_100000013 | 3300005344 | Bacteria | 163010 |
| 110 | Ga0070661_100093227 | 3300005344 | Bacteria | 2232 |
| 111 | Ga0070692_10499228 | 3300005345 | Bacteria | 788 |
| 112 | Ga0070671_101298003 | 3300005355 | Bacteria | 642 |
| 113 | Ga0070673_100951645 | 3300005364 | Bacteria | 798 |
| 114 | Ga0070659_100000167 | 3300005366 | Bacteria | 50757 |
| 115 | Ga0070659_100004951 | 3300005366 | Bacteria | 9532 |
| 116 | Ga0070667_102343612 | 3300005367 | Bacteria | 503 |
| 117 | Ga0070709_11745908 | 3300005434 | Bacteria | 509 |
| 118 | Ga0070714_101981311 | 3300005435 | Bacteria | 568 |
| 119 | Ga0070700_100022541 | 3300005441 | Bacteria | 3674 |
| 120 | Ga0070694_100115522 | 3300005444 | Bacteria | 1918 |
| 121 | Ga0070663_100000006 | 3300005455 | Bacteria | 208068 |
| 122 | Ga0070663_100000789 | 3300005455 | Bacteria | 17198 |
| 123 | Ga0070663_100209120 | 3300005455 | Bacteria | 1527 |
| 124 | Ga0070663_100220504 | 3300005455 | Bacteria | 1489 |
| 125 | Ga0070678_100250848 | 3300005456 | Bacteria | 1484 |
| 126 | Ga0068867_100011280 | 3300005459 | Bacteria | 6303 |
| 127 | Ga0070698_100022508 | 3300005471 | Bacteria | 6593 |
| 128 | Ga0070684_100112388 | 3300005535 | Bacteria | 2444 |
| 129 | Ga0070665_100152074 | 3300005548 | Bacteria | 2317 |
| 130 | Ga0068855_100200821 | 3300005563 | Bacteria | 2244 |
| 131 | Ga0068855_100647388 | 3300005563 | Bacteria | 1135 |
| 132 | Ga0070664_100000002 | 3300005564 | Bacteria | 458815 |
| 133 | Ga0070664_100289682 | 3300005564 | Bacteria | 1478 |
| 134 | Ga0070664_100694083 | 3300005564 | Bacteria | 948 |
| 135 | Ga0068857_100091892 | 3300005577 | Bacteria | 2717 |
| 136 | Ga0068854_100000004 | 3300005578 | Bacteria | 216381 |
| 137 | Ga0068856_100000294 | 3300005614 | Bacteria | 54780 |
| 138 | Ga0068856_100347853 | 3300005614 | Bacteria | 1501 |
| 139 | Ga0068856_101857231 | 3300005614 | Bacteria | 614 |
| 140 | Ga0068852_100017069 | 3300005616 | Bacteria | 5685 |
| 141 | Ga0068852_100450436 | 3300005616 | Bacteria | 1274 |
| 142 | Ga0068852_101568641 | 3300005616 | Bacteria | 681 |
| 143 | Ga0068852_102763728 | 3300005616 | Bacteria | 509 |
| 144 | Ga0068859_101526719 | 3300005617 | Bacteria | 737 |
| 145 | Ga0068859_101745050 | 3300005617 | Bacteria | 687 |
| 146 | Ga0068851_10139601 | 3300005834 | Bacteria | 1317 |
| 147 | Ga0068863_101657777 | 3300005841 | Bacteria | 649 |
| 148 | Ga0068858_100069756 | 3300005842 | Bacteria | 3258 |
| 149 | Ga0070717_10256184 | 3300006028 | Bacteria | 1547 |
| 150 | Ga0075365_10253105 | 3300006038 | Bacteria | 1238 |
| 151 | Ga0075362_10061866 | 3300006177 | Bacteria | 1695 |
| 152 | Ga0075362_10092280 | 3300006177 | Bacteria | 1407 |
| 153 | Ga0075367_10596582 | 3300006178 | Bacteria | 702 |
| 154 | Ga0075366_10000297 | 3300006195 | Bacteria | 22376 |
| 155 | Ga0075366_10004967 | 3300006195 | Bacteria | 7174 |
| 156 | Ga0075366_10153481 | 3300006195 | Bacteria | 1395 |
| 157 | Ga0075366_10353437 | 3300006195 | Bacteria | 902 |
| 158 | Ga0075370_10004264 | 3300006353 | Bacteria | 6922 |
| 159 | Ga0075370_10061586 | 3300006353 | Bacteria | 2138 |
| 160 | Ga0075370_10073600 | 3300006353 | Bacteria | 1957 |
| 161 | Ga0075370_10509261 | 3300006353 | Bacteria | 727 |
| 162 | Ga0075428_100001491 | 3300006844 | Bacteria | 25032 |
| 163 | Ga0075430_100351694 | 3300006846 | Bacteria | 1217 |
| 164 | Ga0075429_100019402 | 3300006880 | Bacteria | 5891 |
| 165 | Ga0097620_100874141 | 3300006931 | Bacteria | 984 |
| 166 | Ga0097620_101526693 | 3300006931 | Bacteria | 737 |
| 167 | Ga0097620_101745101 | 3300006931 | Bacteria | 687 |
| 168 | Ga0099823_1000021 | 3300006944 | Bacteria | 76133 |
| 169 | Ga0079104_1004712 | 3300006946 | Bacteria | 5713 |
| 170 | Ga0105251_10000285 | 3300009011 | Bacteria | 50961 |
| 171 | Ga0105251_10011588 | 3300009011 | Bacteria | 5031 |
| 172 | Ga0105244_10002843 | 3300009036 | Bacteria | 12850 |
| 173 | Ga0105244_10077568 | 3300009036 | Bacteria | 1648 |
| 174 | Ga0105250_10023278 | 3300009092 | Bacteria | 2496 |
| 175 | Ga0105240_10039709 | 3300009093 | Bacteria | 6025 |
| 176 | Ga0105240_10044017 | 3300009093 | Bacteria | 5676 |
| 177 | Ga0105240_10196897 | 3300009093 | Bacteria | 2365 |
| 178 | Ga0105240_10285562 | 3300009093 | Bacteria | 1894 |
| 179 | Ga0105240_10659582 | 3300009093 | Bacteria | 1146 |
| 180 | Ga0105240_12582466 | 3300009093 | Bacteria | 525 |
| 181 | Ga0105245_12487278 | 3300009098 | Bacteria | 571 |
| 182 | Ga0105247_11032429 | 3300009101 | Bacteria | 644 |
| 183 | Ga0105247_11474049 | 3300009101 | Bacteria | 554 |
| 184 | Ga0114129_10469325 | 3300009147 | Bacteria | 1648 |
| 185 | Ga0105243_10394151 | 3300009148 | Bacteria | 1284 |
| 186 | Ga0105241_10242416 | 3300009174 | Bacteria | 1525 |
| 187 | Ga0105241_10587920 | 3300009174 | Bacteria | 1004 |
| 188 | Ga0105241_12254420 | 3300009174 | Bacteria | 541 |
| 189 | Ga0105242_11453379 | 3300009176 | Bacteria | 715 |
| 190 | Ga0105237_10076033 | 3300009545 | Bacteria | 3348 |
| 191 | Ga0105237_10578021 | 3300009545 | Bacteria | 1130 |
| 192 | Ga0105238_10003306 | 3300009551 | Bacteria | 16104 |
| 193 | Ga0105238_10141523 | 3300009551 | Bacteria | 2382 |
| 194 | Ga0105238_11015730 | 3300009551 | Bacteria | 850 |
| 195 | Ga0105238_11444304 | 3300009551 | Bacteria | 716 |
| 196 | Ga0105239_10005044 | 3300010375 | Bacteria | 15592 |
| 197 | Ga0105239_10450556 | 3300010375 | Bacteria | 1460 |
| 198 | Ga0105239_11392114 | 3300010375 | Bacteria | 810 |
| 199 | Ga0105246_10058772 | 3300011119 | Bacteria | 2665 |
| 200 | Ga0105246_10721267 | 3300011119 | Bacteria | 876 |
| 201 | Ga0157317_1006171 | 3300012475 | Bacteria | 830 |
| 202 | Ga0157319_1000027 | 3300012497 | Bacteria | 62955 |
| 203 | Ga0157373_10020184 | 3300013100 | Bacteria | 4847 |
| 204 | Ga0157371_10000123 | 3300013102 | Bacteria | 118119 |
| 205 | Ga0157371_10076165 | 3300013102 | Bacteria | 2376 |
| 206 | Ga0157371_10096288 | 3300013102 | Bacteria | 2097 |
| 207 | Ga0157371_11136901 | 3300013102 | Bacteria | 600 |
| 208 | Ga0157370_10428933 | 3300013104 | Bacteria | 1216 |
| 209 | Ga0157370_10792782 | 3300013104 | Bacteria | 862 |
| 210 | Ga0157370_10798975 | 3300013104 | Bacteria | 859 |
| 211 | Ga0157369_10000799 | 3300013105 | Bacteria | 40249 |
| 212 | Ga0157369_10013524 | 3300013105 | Bacteria | 9224 |
| 213 | Ga0157369_10375809 | 3300013105 | Bacteria | 1475 |
| 214 | Ga0157374_10047490 | 3300013296 | Bacteria | 3981 |
| 215 | Ga0157372_10001159 | 3300013307 | Bacteria | 28511 |
| 216 | Ga0157375_11410527 | 3300013308 | Bacteria | 821 |
| 217 | Ga0157380_11716885 | 3300014326 | Bacteria | 686 |
| 218 | Ga0182008_10077541 | 3300014497 | Bacteria | 1635 |
| 219 | Ga0182008_10135930 | 3300014497 | Bacteria | 1228 |
| 220 | Ga0182008_10549202 | 3300014497 | Bacteria | 642 |
| 221 | Ga0157379_11363739 | 3300014968 | Bacteria | 686 |
| 222 | Ga0157379_12428713 | 3300014968 | Bacteria | 523 |
| 223 | Ga0157376_10222879 | 3300014969 | Bacteria | 1747 |
| 224 | Ga0182006_1000017 | 3300015261 | Bacteria | 299454 |
| 225 | Ga0182006_1015580 | 3300015261 | Bacteria | 3257 |
| 226 | Ga0182007_10002423 | 3300015262 | Bacteria | 9311 |
| 227 | Ga0182007_10009675 | 3300015262 | Bacteria | 3867 |
| 228 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 229 | Ga0182005_1044771 | 3300015265 | Bacteria | 1202 |
| 230 | Ga0163161_10021537 | 3300017792 | Bacteria | 4529 |
| 231 | Ga0163161_11574876 | 3300017792 | Bacteria | 579 |
| 232 | Ga0184593_104580 | 3300019179 | Bacteria | 724 |
| 233 | Ga0197907_11246003 | 3300020069 | Bacteria | 3458 |
| 234 | Ga0206356_10127094 | 3300020070 | Bacteria | 2619 |
| 235 | Ga0206356_11033933 | 3300020070 | Bacteria | 591 |
| 236 | Ga0206356_11308868 | 3300020070 | Bacteria | 1251 |
| 237 | Ga0206349_1150076 | 3300020075 | Bacteria | 3313 |
| 238 | Ga0206355_1206374 | 3300020076 | Bacteria | 546 |
| 239 | Ga0206355_1326248 | 3300020076 | Bacteria | 4647 |
| 240 | Ga0206351_10084287 | 3300020077 | Bacteria | 517 |
| 241 | Ga0206351_10167421 | 3300020077 | Bacteria | 22180 |
| 242 | Ga0206351_10400801 | 3300020077 | Bacteria | 576 |
| 243 | Ga0206352_10143491 | 3300020078 | Bacteria | 1846 |
| 244 | Ga0206352_11149020 | 3300020078 | Bacteria | 724 |
| 245 | Ga0206350_10476662 | 3300020080 | Bacteria | 1234 |
| 246 | Ga0206350_10897671 | 3300020080 | Bacteria | 613 |
| 247 | Ga0206350_11588402 | 3300020080 | Bacteria | 1829 |
| 248 | Ga0206354_10009750 | 3300020081 | Bacteria | 1842 |
| 249 | Ga0206354_11478331 | 3300020081 | Bacteria | 1013 |
| 250 | Ga0154015_1099906 | 3300020610 | Bacteria | 39484 |
| 251 | Ga0213872_10001047 | 3300021361 | Bacteria | 19247 |
| 252 | Ga0213872_10002408 | 3300021361 | Bacteria | 11037 |
| 253 | Ga0213872_10005517 | 3300021361 | Bacteria | 6485 |
| 254 | Ga0213872_10128455 | 3300021361 | Bacteria | 1117 |
| 255 | Ga0213872_10454875 | 3300021361 | Bacteria | 514 |
| 256 | Ga0224712_10046990 | 3300022467 | Bacteria | 1659 |
| 257 | Ga0247551_104997 | 3300023552 | Bacteria | 543 |
| 258 | Ga0247516_119814 | 3300023562 | Bacteria | 563 |
| 259 | Ga0209435_103104 | 3300025206 | Bacteria | 1908 |
| 260 | Ga0209435_104748 | 3300025206 | Bacteria | 1529 |
| 261 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 262 | Ga0209784_100293 | 3300025224 | Bacteria | 27186 |
| 263 | Ga0209784_100803 | 3300025224 | Bacteria | 7383 |
| 264 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 265 | Ga0209566_100370 | 3300025225 | Bacteria | 37519 |
| 266 | Ga0209566_100896 | 3300025225 | Bacteria | 14309 |
| 267 | Ga0209566_101272 | 3300025225 | Bacteria | 8471 |
| 268 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 269 | Ga0209674_100013 | 3300025226 | Bacteria | 813140 |
| 270 | Ga0209674_100122 | 3300025226 | Bacteria | 131720 |
| 271 | Ga0209674_100424 | 3300025226 | Bacteria | 20459 |
| 272 | Ga0209674_101948 | 3300025226 | Bacteria | 4832 |
| 273 | Ga0209672_100010 | 3300025228 | Bacteria | 873151 |
| 274 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 275 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 276 | Ga0209672_100213 | 3300025228 | Bacteria | 45410 |
| 277 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 278 | Ga0209147_100006 | 3300025229 | Bacteria | 873276 |
| 279 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 280 | Ga0209147_101660 | 3300025229 | Bacteria | 7325 |
| 281 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 282 | Ga0209563_100857 | 3300025230 | Bacteria | 9043 |
| 283 | Ga0209563_104817 | 3300025230 | Bacteria | 2527 |
| 284 | Ga0207427_103586 | 3300025231 | Bacteria | 3156 |
| 285 | Ga0209437_109386 | 3300025233 | Bacteria | 1527 |
| 286 | Ga0209437_113794 | 3300025233 | Bacteria | 1145 |
| 287 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 288 | Ga0209258_100010 | 3300025242 | Bacteria | 873276 |
| 289 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 290 | Ga0209258_100253 | 3300025242 | Bacteria | 96309 |
| 291 | Ga0209258_103902 | 3300025242 | Bacteria | 3020 |
| 292 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 293 | Ga0209646_1000174 | 3300025246 | Bacteria | 84479 |
| 294 | Ga0209646_1020439 | 3300025246 | Bacteria | 956 |
| 295 | Ga0209646_1025196 | 3300025246 | Bacteria | 833 |
| 296 | Ga0209026_1002115 | 3300025250 | Bacteria | 7781 |
| 297 | Ga0209026_1045405 | 3300025250 | Bacteria | 632 |
| 298 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 299 | Ga0209677_111617 | 3300025253 | Bacteria | 1361 |
| 300 | Ga0209148_1000018 | 3300025254 | Bacteria | 756247 |
| 301 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 302 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 303 | Ga0209759_1000327 | 3300025256 | Bacteria | 62700 |
| 304 | Ga0209759_1000804 | 3300025256 | Bacteria | 25401 |
| 305 | Ga0209759_1001294 | 3300025256 | Bacteria | 14869 |
| 306 | Ga0209759_1001771 | 3300025256 | Bacteria | 11009 |
| 307 | Ga0209759_1002181 | 3300025256 | Bacteria | 8969 |
| 308 | Ga0209759_1007195 | 3300025256 | Bacteria | 3618 |
| 309 | Ga0209759_1026741 | 3300025256 | Bacteria | 1204 |
| 310 | Ga0209233_1000135 | 3300025261 | Bacteria | 201057 |
| 311 | Ga0209565_1023806 | 3300025263 | Bacteria | 1256 |
| 312 | Ga0209565_1058772 | 3300025263 | Bacteria | 671 |
| 313 | Ga0209455_1000015 | 3300025272 | Bacteria | 756128 |
| 314 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 315 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 316 | Ga0209455_1000213 | 3300025272 | Bacteria | 82040 |
| 317 | Ga0209673_1000201 | 3300025273 | Bacteria | 120059 |
| 318 | Ga0209673_1006977 | 3300025273 | Bacteria | 5326 |
| 319 | Ga0209673_1007222 | 3300025273 | Bacteria | 5173 |
| 320 | Ga0209673_1033078 | 3300025273 | Bacteria | 1582 |
| 321 | Ga0209130_1066354 | 3300025284 | Bacteria | 612 |
| 322 | Ga0209675_1037692 | 3300025291 | Bacteria | 1084 |
| 323 | Ga0209676_1004133 | 3300025292 | Bacteria | 8268 |
| 324 | Ga0209676_1093711 | 3300025292 | Bacteria | 654 |
| 325 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 326 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 327 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 328 | Ga0209564_1002800 | 3300025295 | Bacteria | 12995 |
| 329 | Ga0209050_1003281 | 3300025298 | Bacteria | 12153 |
| 330 | Ga0209050_1003824 | 3300025298 | Bacteria | 10743 |
| 331 | Ga0209256_1000424 | 3300025299 | Bacteria | 66333 |
| 332 | Ga0209256_1002394 | 3300025299 | Bacteria | 15451 |
| 333 | Ga0207426_1003279 | 3300025302 | Bacteria | 9024 |
| 334 | Ga0209051_1000244 | 3300025303 | Bacteria | 91505 |
| 335 | Ga0209051_1000469 | 3300025303 | Bacteria | 52936 |
| 336 | Ga0209051_1139745 | 3300025303 | Bacteria | 584 |
| 337 | Ga0209257_1000144 | 3300025304 | Bacteria | 197078 |
| 338 | Ga0209257_1000946 | 3300025304 | Bacteria | 40063 |
| 339 | Ga0209257_1002583 | 3300025304 | Bacteria | 17605 |
| 340 | Ga0207656_10508006 | 3300025321 | Bacteria | 612 |
| 341 | Ga0207696_1029949 | 3300025711 | Bacteria | 1658 |
| 342 | Ga0207655_1008662 | 3300025728 | Bacteria | 6421 |
| 343 | Ga0207655_1076323 | 3300025728 | Bacteria | 1226 |
| 344 | Ga0207655_1078846 | 3300025728 | Bacteria | 1195 |
| 345 | Ga0207713_1001188 | 3300025735 | Bacteria | 21909 |
| 346 | Ga0207713_1003181 | 3300025735 | Bacteria | 11351 |
| 347 | Ga0207642_10392418 | 3300025899 | Bacteria | 829 |
| 348 | Ga0207710_10547682 | 3300025900 | Bacteria | 603 |
| 349 | Ga0207647_10000835 | 3300025904 | Bacteria | 23959 |
| 350 | Ga0207647_10018639 | 3300025904 | Bacteria | 4688 |
| 351 | Ga0207647_10072504 | 3300025904 | Bacteria | 2076 |
| 352 | Ga0207699_11371450 | 3300025906 | Bacteria | 523 |
| 353 | Ga0207645_11127937 | 3300025907 | Bacteria | 528 |
| 354 | Ga0207705_10114607 | 3300025909 | Bacteria | 1994 |
| 355 | Ga0207705_10189679 | 3300025909 | Bacteria | 1554 |
| 356 | Ga0207654_10363279 | 3300025911 | Bacteria | 999 |
| 357 | Ga0207695_10006070 | 3300025913 | Bacteria | 15766 |
| 358 | Ga0207695_10029964 | 3300025913 | Bacteria | 6001 |
| 359 | Ga0207695_10079796 | 3300025913 | Bacteria | 3315 |
| 360 | Ga0207695_10199467 | 3300025913 | Bacteria | 1916 |
| 361 | Ga0207671_10020134 | 3300025914 | Bacteria | 5086 |
| 362 | Ga0207671_10063258 | 3300025914 | Bacteria | 2749 |
| 363 | Ga0207660_11098842 | 3300025917 | Bacteria | 648 |
| 364 | Ga0207657_10000001 | 3300025919 | Bacteria | 458536 |
| 365 | Ga0207657_10077952 | 3300025919 | Bacteria | 2792 |
| 366 | Ga0207657_11400713 | 3300025919 | Bacteria | 525 |
| 367 | Ga0207649_10000019 | 3300025920 | Bacteria | 212682 |
| 368 | Ga0207649_10241282 | 3300025920 | Bacteria | 1297 |
| 369 | Ga0207681_10018919 | 3300025923 | Bacteria | 4344 |
| 370 | Ga0207694_10010183 | 3300025924 | Bacteria | 7086 |
| 371 | Ga0207694_10066616 | 3300025924 | Bacteria | 2810 |
| 372 | Ga0207694_10598207 | 3300025924 | Bacteria | 927 |
| 373 | Ga0207694_10615137 | 3300025924 | Bacteria | 914 |
| 374 | Ga0207694_11605520 | 3300025924 | Bacteria | 548 |
| 375 | Ga0207650_10917360 | 3300025925 | Bacteria | 744 |
| 376 | Ga0207644_11039168 | 3300025931 | Bacteria | 688 |
| 377 | Ga0207690_10000006 | 3300025932 | Bacteria | 433880 |
| 378 | Ga0207690_10004157 | 3300025932 | Bacteria | 8555 |
| 379 | Ga0207686_11762972 | 3300025934 | Bacteria | 512 |
| 380 | Ga0207709_10326946 | 3300025935 | Bacteria | 1150 |
| 381 | Ga0207709_11064110 | 3300025935 | Bacteria | 663 |
| 382 | Ga0207669_11756621 | 3300025937 | Bacteria | 530 |
| 383 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 384 | Ga0207679_10881743 | 3300025945 | Bacteria | 818 |
| 385 | Ga0207679_11188239 | 3300025945 | Bacteria | 700 |
| 386 | Ga0207667_10023086 | 3300025949 | Bacteria | 6854 |
| 387 | Ga0207667_10520474 | 3300025949 | Bacteria | 1205 |
| 388 | Ga0207640_10000240 | 3300025981 | Bacteria | 37127 |
| 389 | Ga0207640_11151542 | 3300025981 | Bacteria | 688 |
| 390 | Ga0207703_10044817 | 3300026035 | Bacteria | 3556 |
| 391 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 392 | Ga0207678_10000167 | 3300026067 | Bacteria | 55724 |
| 393 | Ga0207678_10138210 | 3300026067 | Bacteria | 2079 |
| 394 | Ga0207708_10226667 | 3300026075 | Bacteria | 1499 |
| 395 | Ga0207702_10000009 | 3300026078 | Bacteria | 305906 |
| 396 | Ga0207702_10401565 | 3300026078 | Bacteria | 1322 |
| 397 | Ga0207641_11619979 | 3300026088 | Bacteria | 649 |
| 398 | Ga0207648_10145745 | 3300026089 | Bacteria | 2088 |
| 399 | Ga0207648_10356667 | 3300026089 | Bacteria | 1319 |
| 400 | Ga0207674_10017905 | 3300026116 | Bacteria | 7722 |
| 401 | Ga0207674_10163724 | 3300026116 | Bacteria | 2178 |
| 402 | Ga0207683_10204392 | 3300026121 | Bacteria | 1796 |
| 403 | Ga0207698_10020074 | 3300026142 | Bacteria | 4591 |
| 404 | Ga0207698_10261005 | 3300026142 | Bacteria | 1591 |
| 405 | Ga0207698_11228918 | 3300026142 | Bacteria | 763 |
| 406 | Ga0209281_1005251 | 3300027111 | Bacteria | 3639 |
| 407 | Ga0209973_1003908 | 3300027252 | Bacteria | 1499 |
| 408 | Ga0209389_1000341 | 3300027296 | Bacteria | 28381 |
| 409 | Ga0209371_1000297 | 3300027312 | Bacteria | 55845 |
| 410 | Ga0209371_1009283 | 3300027312 | Bacteria | 3140 |
| 411 | Ga0209998_10123810 | 3300027717 | Bacteria | 653 |
| 412 | Ga0209974_10000696 | 3300027876 | Bacteria | 11455 |
| 413 | Ga0209974_10001341 | 3300027876 | Bacteria | 8852 |
| 414 | Ga0209974_10464471 | 3300027876 | Bacteria | 504 |
| 415 | Ga0207428_10001343 | 3300027907 | Bacteria | 26179 |
| 416 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 417 | Ga0307515_10094677 | 3300028794 | Bacteria | 3686 |
| 418 | Ga0307515_10235483 | 3300028794 | Bacteria | 1613 |
| 419 | Ga0265338_10856238 | 3300028800 | Bacteria | 621 |
| 420 | Ga0311001_1028972 | 3300029277 | Bacteria | 503 |
| 421 | Ga0268256_1000261 | 3300030500 | Bacteria | 55844 |
| 422 | Ga0268256_1009819 | 3300030500 | Bacteria | 3140 |
| 423 | Ga0268256_1038334 | 3300030500 | Bacteria | 1090 |
| 424 | Ga0307512_10064260 | 3300030522 | Bacteria | 2797 |
| 425 | Ga0316177_1201187 | 3300030731 | Bacteria | 620 |
| 426 | Ga0314311_1115675 | 3300030733 | Bacteria | 1364 |
| 427 | Ga0314311_1176908 | 3300030733 | Bacteria | 541 |
| 428 | Ga0316179_1009805 | 3300030734 | Bacteria | 1005 |
| 429 | Ga0316179_1031030 | 3300030734 | Bacteria | 611 |
| 430 | Ga0316183_1114423 | 3300030742 | Bacteria | 1531 |
| 431 | Ga0316181_1150926 | 3300030744 | Bacteria | 769 |
| 432 | Ga0316181_1220920 | 3300030744 | Bacteria | 2819 |
| 433 | Ga0316182_1362949 | 3300030745 | Bacteria | 684 |
| 434 | Ga0265767_101143 | 3300030836 | Bacteria | 1256 |
| 435 | Ga0265766_1002226 | 3300030863 | Bacteria | 1056 |
| 436 | Ga0265766_1016835 | 3300030863 | Bacteria | 576 |
| 437 | Ga0265766_1021884 | 3300030863 | Bacteria | 531 |
| 438 | Ga0265764_114734 | 3300030882 | Bacteria | 531 |
| 439 | Ga0265769_101647 | 3300030888 | Bacteria | 1095 |
| 440 | Ga0265761_106943 | 3300030889 | Bacteria | 612 |
| 441 | Ga0247549_103512 | 3300030942 | Bacteria | 585 |
| 442 | Ga0265773_1027860 | 3300031018 | Bacteria | 592 |
| 443 | Ga0265332_10009574 | 3300031238 | Bacteria | 4322 |
| 444 | Ga0265328_10185176 | 3300031239 | Bacteria | 788 |
| 445 | Ga0265329_10203737 | 3300031242 | Bacteria | 652 |
| 446 | Ga0265327_10001175 | 3300031251 | Bacteria | 35521 |
| 447 | Ga0265316_10001277 | 3300031344 | Bacteria | 27035 |
| 448 | Ga0307513_10011348 | 3300031456 | Bacteria | 11079 |
| 449 | Ga0307408_100000663 | 3300031548 | Bacteria | 28685 |
| 450 | Ga0307408_100002158 | 3300031548 | Bacteria | 14074 |
| 451 | Ga0307408_100134587 | 3300031548 | Bacteria | 1932 |
| 452 | Ga0307408_101055504 | 3300031548 | Bacteria | 751 |
| 453 | Ga0307514_10000319 | 3300031649 | Bacteria | 115327 |
| 454 | Ga0316575_10002655 | 3300031665 | Bacteria | 6026 |
| 455 | Ga0316575_10119739 | 3300031665 | Bacteria | 1076 |
| 456 | Ga0316575_10138864 | 3300031665 | Bacteria | 999 |
| 457 | Ga0316575_10232613 | 3300031665 | Unclassified | 771 |
| 458 | Ga0310111_120975 | 3300031667 | Bacteria | 795 |
| 459 | Ga0316579_10000223 | 3300031691 | Bacteria | 17183 |
| 460 | Ga0316579_10003497 | 3300031691 | Bacteria | 6137 |
| 461 | Ga0316579_10014597 | 3300031691 | Bacteria | 3401 |
| 462 | Ga0316579_10241042 | 3300031691 | Bacteria | 875 |
| 463 | Ga0316579_10297992 | 3300031691 | Unclassified | 779 |
| 464 | Ga0265314_10467514 | 3300031711 | Bacteria | 669 |
| 465 | Ga0316576_10013047 | 3300031727 | Bacteria | 5508 |
| 466 | Ga0316576_10023215 | 3300031727 | Bacteria | 4317 |
| 467 | Ga0316576_10216585 | 3300031727 | Bacteria | 1441 |
| 468 | Ga0316576_10293236 | 3300031727 | Unclassified | 1216 |
| 469 | Ga0316576_11014721 | 3300031727 | Bacteria | 591 |
| 470 | Ga0316578_10008120 | 3300031728 | Bacteria | 5316 |
| 471 | Ga0316578_10020537 | 3300031728 | Bacteria | 3652 |
| 472 | Ga0316578_10074386 | 3300031728 | Bacteria | 2014 |
| 473 | Ga0316578_10190161 | 3300031728 | Bacteria | 1237 |
| 474 | Ga0316578_10311552 | 3300031728 | Bacteria | 940 |
| 475 | Ga0316578_10430988 | 3300031728 | Bacteria | 780 |
| 476 | Ga0316578_10437514 | 3300031728 | Bacteria | 773 |
| 477 | Ga0316578_10929235 | 3300031728 | Unclassified | 502 |
| 478 | Ga0307405_10113333 | 3300031731 | Bacteria | 1841 |
| 479 | Ga0307405_11251356 | 3300031731 | Bacteria | 644 |
| 480 | Ga0316577_10038905 | 3300031733 | Bacteria | 2661 |
| 481 | Ga0316577_10080598 | 3300031733 | Bacteria | 1820 |
| 482 | Ga0316577_10094394 | 3300031733 | Bacteria | 1675 |
| 483 | Ga0316577_10195069 | 3300031733 | Bacteria | 1144 |
| 484 | Ga0316577_10198272 | 3300031733 | Bacteria | 1134 |
| 485 | Ga0316577_10267531 | 3300031733 | Bacteria | 967 |
| 486 | Ga0247548_105409 | 3300031814 | Bacteria | 604 |
| 487 | Ga0307406_10001789 | 3300031901 | Bacteria | 11747 |
| 488 | Ga0307406_10391076 | 3300031901 | Bacteria | 1099 |
| 489 | Ga0307412_10000008 | 3300031911 | Bacteria | 461034 |
| 490 | Ga0307412_10000845 | 3300031911 | Bacteria | 17634 |
| 491 | Ga0307412_10324403 | 3300031911 | Bacteria | 1226 |
| 492 | Ga0307412_10583511 | 3300031911 | Bacteria | 944 |
| 493 | Ga0307412_12026738 | 3300031911 | Bacteria | 533 |
| 494 | Ga0307409_100059348 | 3300031995 | Bacteria | 2977 |
| 495 | Ga0307416_100381760 | 3300032002 | Bacteria | 1439 |
| 496 | Ga0307414_11636843 | 3300032004 | Bacteria | 600 |
| 497 | Ga0307411_10103964 | 3300032005 | Bacteria | 2016 |
| 498 | Ga0316583_10007592 | 3300032133 | Bacteria | 3905 |
| 499 | Ga0316583_10015794 | 3300032133 | Bacteria | 2719 |
| 500 | Ga0316583_10062211 | 3300032133 | Bacteria | 1307 |
| 501 | Ga0316583_10141379 | 3300032133 | Bacteria | 839 |
| 502 | Ga0316583_10359814 | 3300032133 | Bacteria | 503 |
| 503 | Ga0316585_10001492 | 3300032137 | Bacteria | 6198 |
| 504 | Ga0316585_10002042 | 3300032137 | Bacteria | 5413 |
| 505 | Ga0316580_10002575 | 3300032139 | Bacteria | 5019 |
| 506 | Ga0316580_10010682 | 3300032139 | Bacteria | 2780 |
| 507 | Ga0316580_10115613 | 3300032139 | Unclassified | 821 |
| 508 | Ga0316593_10000184 | 3300032168 | Bacteria | 9441 |
| 509 | Ga0316593_10000461 | 3300032168 | Bacteria | 7469 |
| 510 | Ga0316593_10000850 | 3300032168 | Bacteria | 6172 |
| 511 | Ga0316593_10000905 | 3300032168 | Bacteria | 6063 |
| 512 | Ga0316593_10005627 | 3300032168 | Bacteria | 3322 |
| 513 | Ga0316593_10011079 | 3300032168 | Bacteria | 2610 |
| 514 | Ga0316593_10015927 | 3300032168 | Bacteria | 2271 |
| 515 | Ga0316593_10016257 | 3300032168 | Bacteria | 2253 |
| 516 | Ga0316593_10018048 | 3300032168 | Bacteria | 2162 |
| 517 | Ga0316593_10023063 | 3300032168 | Bacteria | 1962 |
| 518 | Ga0316593_10040179 | 3300032168 | Bacteria | 1554 |
| 519 | Ga0316593_10074069 | 3300032168 | Bacteria | 1181 |
| 520 | Ga0316593_10074693 | 3300032168 | Bacteria | 1176 |
| 521 | Ga0316593_10085717 | 3300032168 | Bacteria | 1104 |
| 522 | Ga0316593_10124271 | 3300032168 | Bacteria | 928 |
| 523 | Ga0316593_10124809 | 3300032168 | Bacteria | 926 |
| 524 | Ga0316593_10161438 | 3300032168 | Unclassified | 819 |
| 525 | Ga0316593_10182502 | 3300032168 | Bacteria | 772 |
| 526 | Ga0316593_10242096 | 3300032168 | Bacteria | 673 |
| 527 | Ga0316593_10246253 | 3300032168 | Bacteria | 668 |
| 528 | Ga0316593_10281050 | 3300032168 | Bacteria | 627 |
| 529 | Ga0316593_10337121 | 3300032168 | Unclassified | 575 |
| 530 | Ga0316592_1000418 | 3300033524 | Bacteria | 5762 |
| 531 | Ga0316592_1000834 | 3300033524 | Bacteria | 4628 |
| 532 | Ga0316592_1001455 | 3300033524 | Bacteria | 3816 |
| 533 | Ga0316592_1002172 | 3300033524 | Bacteria | 3344 |
| 534 | Ga0316592_1005091 | 3300033524 | Bacteria | 2479 |
| 535 | Ga0316592_1007741 | 3300033524 | Bacteria | 2103 |
| 536 | Ga0316592_1008452 | 3300033524 | Bacteria | 2036 |
| 537 | Ga0316592_1015251 | 3300033524 | Bacteria | 1598 |
| 538 | Ga0316592_1027020 | 3300033524 | Bacteria | 1240 |
| 539 | Ga0316592_1056001 | 3300033524 | Bacteria | 883 |
| 540 | Ga0316592_1057814 | 3300033524 | Bacteria | 869 |
| 541 | Ga0316592_1075825 | 3300033524 | Bacteria | 763 |
| 542 | Ga0316586_1002586 | 3300033527 | Bacteria | 2276 |
| 543 | Ga0316586_1004157 | 3300033527 | Bacteria | 1956 |
| 544 | Ga0316586_1048671 | 3300033527 | Bacteria | 756 |
| 545 | Ga0316586_1103135 | 3300033527 | Bacteria | 546 |
| 546 | Ga0316588_1000358 | 3300033528 | Bacteria | 5911 |
| 547 | Ga0316588_1000978 | 3300033528 | Bacteria | 4444 |
| 548 | Ga0316588_1003991 | 3300033528 | Bacteria | 2749 |
| 549 | Ga0316588_1021263 | 3300033528 | Bacteria | 1475 |
| 550 | Ga0316588_1042135 | 3300033528 | Unclassified | 1093 |
| 551 | Ga0316588_1052481 | 3300033528 | Bacteria | 990 |
| 552 | Ga0316588_1059017 | 3300033528 | Unclassified | 935 |
| 553 | Ga0316588_1077066 | 3300033528 | Bacteria | 823 |
| 554 | Ga0316588_1090112 | 3300033528 | Bacteria | 763 |
| 555 | Ga0316587_1000327 | 3300033529 | Bacteria | 4482 |
| 556 | Ga0316587_1001516 | 3300033529 | Bacteria | 2886 |
| 557 | Ga0316587_1002276 | 3300033529 | Bacteria | 2543 |
| 558 | Ga0316587_1009238 | 3300033529 | Bacteria | 1561 |
| 559 | Ga0316587_1010565 | 3300033529 | Bacteria | 1478 |
| 560 | Ga0316587_1029286 | 3300033529 | Unclassified | 968 |
| 561 | Ga0316587_1036032 | 3300033529 | Unclassified | 885 |
| 562 | Ga0316587_1036410 | 3300033529 | Bacteria | 881 |
| 563 | Ga0316587_1097520 | 3300033529 | Bacteria | 564 |
| 564 | Ga0316596_1000420 | 3300033541 | Bacteria | 7070 |
| 565 | Ga0316596_1001044 | 3300033541 | Bacteria | 5365 |
| 566 | Ga0316596_1004668 | 3300033541 | Bacteria | 3091 |
| 567 | Ga0316596_1009739 | 3300033541 | Bacteria | 2310 |
| 568 | Ga0316596_1019773 | 3300033541 | Bacteria | 1710 |
| 569 | Ga0316596_1027444 | 3300033541 | Bacteria | 1469 |
| 570 | Ga0316596_1036210 | 3300033541 | Bacteria | 1290 |
| 571 | Ga0316596_1047590 | 3300033541 | Bacteria | 1133 |
| 572 | Ga0316596_1072695 | 3300033541 | Bacteria | 921 |
| 573 | Ga0316596_1089874 | 3300033541 | Unclassified | 827 |
| 574 | Ga0316596_1098142 | 3300033541 | Unclassified | 791 |
| 575 | Ga0316596_1113804 | 3300033541 | Unclassified | 735 |
| 576 | Ga0316596_1176816 | 3300033541 | Unclassified | 590 |
| 577 | Ga0316596_1231771 | 3300033541 | Unclassified | 518 |
| 578 | Ga0373928_0104388 | 3300035084 | Bacteria | 743 |
| 579 | Ga0316574_0000770 | 3300035398 | Bacteria | 13806 |
| 580 | Ga0316574_0305564 | 3300035398 | Bacteria | 1011 |
| 581 | Ga0316574_0361910 | 3300035398 | Bacteria | 917 |
| 582 | Ga0316574_0497394 | 3300035398 | Bacteria | 760 |
| 583 | Ga0316574_0569701 | 3300035398 | Unclassified | 701 |
| 584 | Ga0316574_0704972 | 3300035398 | Unclassified | 619 |
| 585 | Ga0373924_0015722 | 3300035410 | Bacteria | 2880 |
| 586 | Ga0373931_0010733 | 3300035691 | Bacteria | 4410 |
| 587 | Ga0373931_0617817 | 3300035691 | Bacteria | 710 |
| 588 | Ga0310109_014588 | 3300036534 | Bacteria | 1066 |
| 589 | Ga0316582_0001537 | 3300036647 | Bacteria | 10216 |
| 590 | Ga0316582_0032685 | 3300036647 | Bacteria | 3190 |
| 591 | Ga0316582_0047897 | 3300036647 | Bacteria | 2700 |
| 592 | Ga0316582_0105863 | 3300036647 | Bacteria | 1867 |
| 593 | Ga0316582_0225009 | 3300036647 | Bacteria | 1283 |
| 594 | Ga0316582_0325154 | 3300036647 | Bacteria | 1057 |
| 595 | Ga0316582_0554367 | 3300036647 | Bacteria | 792 |
| 596 | Ga0316582_0901898 | 3300036647 | Unclassified | 605 |
| 597 | Ga0316584_0014853 | 3300036712 | Bacteria | 5562 |
| 598 | Ga0316584_0151535 | 3300036712 | Bacteria | 1726 |
| 599 | Ga0316584_0198220 | 3300036712 | Bacteria | 1482 |
| 600 | Ga0316584_0210336 | 3300036712 | Bacteria | 1432 |
| 601 | Ga0316584_0314431 | 3300036712 | Bacteria | 1131 |
| 602 | Ga0316584_0381218 | 3300036712 | Unclassified | 1007 |
| 603 | Ga0395899_0000041 | 3300037312 | Bacteria | 255615 |
| 604 | Ga0395899_0031186 | 3300037312 | Bacteria | 4007 |
| 605 | Ga0395899_0086705 | 3300037312 | Bacteria | 2273 |
| 606 | Ga0395900_0000797 | 3300037418 | Bacteria | 41664 |
| 607 | Ga0395900_0001690 | 3300037418 | Bacteria | 25639 |
| 608 | Ga0395900_0009723 | 3300037418 | Bacteria | 9850 |
| 609 | Ga0395900_0198721 | 3300037418 | Bacteria | 2030 |
| 610 | Ga0395900_0346672 | 3300037418 | Bacteria | 1459 |
| 611 | Ga0395898_0000220 | 3300037466 | Bacteria | 146473 |
| 612 | Ga0395898_0040162 | 3300037466 | Bacteria | 4628 |
| 613 | Ga0395898_0367817 | 3300037466 | Bacteria | 1371 |
| 614 | Ga0395898_0623605 | 3300037466 | Bacteria | 1021 |
| 615 | Ga0395905_0021181 | 3300037471 | Bacteria | 6153 |
| 616 | Ga0395905_0088384 | 3300037471 | Bacteria | 2905 |
| 617 | Ga0395905_0563467 | 3300037471 | Bacteria | 1040 |
| 618 | Ga0316581_0001281 | 3300037588 | Bacteria | 5582 |
| 619 | Ga0316581_0184420 | 3300037588 | Unclassified | 643 |
| 620 | Ga0395901_0000011 | 3300038443 | Bacteria | 400724 |
| 621 | Ga0395901_0000106 | 3300038443 | Bacteria | 114313 |
| 622 | Ga0395901_0044283 | 3300038443 | Bacteria | 4615 |
| 623 | Ga0395901_0200791 | 3300038443 | Bacteria | 2090 |
| 624 | Ga0400490_46138 | 3300038726 | Bacteria | 13561 |
| 625 | Ga0400490_48203 | 3300038726 | Bacteria | 18626 |
| 626 | Ga0400490_60606 | 3300038726 | Bacteria | 8679 |
| 627 | Ga0400488_57509 | 3300038741 | Bacteria | 4330 |
| 628 | Ga0400483_047628 | 3300039062 | Bacteria | 4192 |
| 629 | Ga0400483_179240 | 3300039062 | Bacteria | 6112 |
| 630 | Ga0400487_50157 | 3300039110 | Bacteria | 4858 |
| 631 | Ga0436365_0005079 | 3300039437 | Bacteria | 1836 |
| 632 | Ga0436360_0518562 | 3300039438 | Bacteria | 524 |
| 633 | Ga0436361_0085296 | 3300039447 | Bacteria | 2388 |
| 634 | Ga0436361_0119299 | 3300039447 | Bacteria | 18398 |
| 635 | Ga0436361_0209693 | 3300039447 | Bacteria | 3817 |
| 636 | Ga0436361_0260589 | 3300039447 | Bacteria | 1706 |
| 637 | Ga0436361_0360842 | 3300039447 | Bacteria | 25330 |
| 638 | Ga0436361_0399282 | 3300039447 | Bacteria | 657 |
| 639 | Ga0436361_0416774 | 3300039447 | Bacteria | 925 |
| 640 | Ga0436361_0508128 | 3300039447 | Bacteria | 12467 |
| 641 | Ga0451793_1402114 | 3300041452 | Bacteria | 929 |
| 642 | Ga0451799_22873 | 3300041454 | Bacteria | 512 |
| 643 | Ga0451805_049160 | 3300041461 | Bacteria | 592 |
| 644 | Ga0451839_0220486 | 3300041496 | Bacteria | 516 |
| 645 | Ga0451853_3370414 | 3300041512 | Bacteria | 1147 |
| 646 | Ga0439445_0047401 | 3300042004 | Bacteria | 1154 |
| 647 | Ga0439445_0207706 | 3300042004 | Bacteria | 579 |
| 648 | Ga0439432_224662 | 3300042006 | Bacteria | 541 |
| 649 | Ga0439454_005931 | 3300042011 | Bacteria | 1481 |
| 650 | Ga0450911_000530 | 3300042115 | Bacteria | 12036 |
| 651 | Ga0450911_024880 | 3300042115 | Bacteria | 777 |
| 652 | Ga0450923_059872 | 3300042125 | Bacteria | 829 |
| 653 | Ga0450890_004781 | 3300042127 | Bacteria | 1759 |
| 654 | Ga0439446_0072906 | 3300042156 | Bacteria | 1053 |
| 655 | Ga0439446_0280482 | 3300042156 | Bacteria | 581 |
| 656 | Ga0439458_0240244 | 3300042157 | Bacteria | 502 |
| 657 | Ga0439459_0000026 | 3300042438 | Bacteria | 12841 |
| 658 | Ga0450901_044632 | 3300042533 | Bacteria | 503 |
| 659 | Ga0466986_0208548 | 3300044650 | Bacteria | 1278 |
| 660 | Ga0466969_0000212 | 3300044656 | Bacteria | 31753 |
| 661 | Ga0466969_0003756 | 3300044656 | Bacteria | 8068 |
| 662 | Ga0466969_0009461 | 3300044656 | Bacteria | 5167 |
| 663 | Ga0466969_0126684 | 3300044656 | Bacteria | 1186 |
| 664 | Ga0466972_0004661 | 3300044658 | Bacteria | 6865 |
| 665 | Ga0466972_0012555 | 3300044658 | Bacteria | 4256 |
| 666 | Ga0466972_0041828 | 3300044658 | Bacteria | 2229 |
| 667 | Ga0466972_0055688 | 3300044658 | Bacteria | 1902 |
| 668 | Ga0466972_0147739 | 3300044658 | Bacteria | 1105 |
| 669 | Ga0466972_0441782 | 3300044658 | Bacteria | 611 |
| 670 | Ga0466973_0008590 | 3300044659 | Bacteria | 9269 |
| 671 | Ga0466980_0148245 | 3300044668 | Bacteria | 1563 |
| 672 | Ga0466978_0027607 | 3300044671 | Bacteria | 3428 |
| 673 | Ga0466982_0250390 | 3300044672 | Bacteria | 1036 |
| 674 | Ga0466982_0265117 | 3300044672 | Bacteria | 997 |
| 675 | Ga0453683_0099868 | 3300044673 | Bacteria | 1822 |
| 676 | Ga0466965_0003246 | 3300044683 | Bacteria | 7109 |
| 677 | Ga0466965_0005740 | 3300044683 | Bacteria | 5601 |
| 678 | Ga0466965_0035070 | 3300044683 | Bacteria | 2456 |
| 679 | Ga0466965_0050704 | 3300044683 | Bacteria | 2058 |
| 680 | Ga0466965_0090269 | 3300044683 | Bacteria | 1558 |
| 681 | Ga0466965_0130703 | 3300044683 | Bacteria | 1302 |
| 682 | Ga0466965_0159994 | 3300044683 | Bacteria | 1180 |
| 683 | Ga0466965_0418414 | 3300044683 | Bacteria | 742 |
| 684 | Ga0466966_0003888 | 3300044684 | Bacteria | 9867 |
| 685 | Ga0466966_0009685 | 3300044684 | Bacteria | 6382 |
| 686 | Ga0466966_0013697 | 3300044684 | Bacteria | 5365 |
| 687 | Ga0466966_0113920 | 3300044684 | Bacteria | 1665 |
| 688 | Ga0466966_0190799 | 3300044684 | Bacteria | 1241 |
| 689 | Ga0466966_0288251 | 3300044684 | Bacteria | 987 |
| 690 | Ga0466966_0412471 | 3300044684 | Bacteria | 812 |
| 691 | Ga0466966_0494582 | 3300044684 | Bacteria | 735 |
| 692 | Ga0466961_0000415 | 3300044693 | Bacteria | 27177 |
| 693 | Ga0466961_0001007 | 3300044693 | Bacteria | 17404 |
| 694 | Ga0466961_0007203 | 3300044693 | Bacteria | 7074 |
| 695 | Ga0466961_0014813 | 3300044693 | Bacteria | 5009 |
| 696 | Ga0466961_0121839 | 3300044693 | Bacteria | 1637 |
| 697 | Ga0466961_0268484 | 3300044693 | Bacteria | 1045 |
| 698 | Ga0466961_0340099 | 3300044693 | Bacteria | 914 |
| 699 | Ga0466961_0532423 | 3300044693 | Bacteria | 708 |
| 700 | Ga0466963_0001278 | 3300044694 | Bacteria | 13354 |
| 701 | Ga0466963_0090391 | 3300044694 | Bacteria | 2085 |
| 702 | Ga0466963_0092180 | 3300044694 | Bacteria | 2064 |
| 703 | Ga0466963_0106552 | 3300044694 | Bacteria | 1922 |
| 704 | Ga0466963_0173523 | 3300044694 | Bacteria | 1503 |
| 705 | Ga0466963_0288155 | 3300044694 | Bacteria | 1154 |
| 706 | Ga0466964_0001878 | 3300044706 | Bacteria | 7333 |
| 707 | Ga0466964_0007716 | 3300044706 | Bacteria | 4027 |
| 708 | Ga0466964_0076040 | 3300044706 | Bacteria | 1431 |
| 709 | Ga0466964_0222730 | 3300044706 | Bacteria | 917 |
| 710 | Ga0466964_0419693 | 3300044706 | Bacteria | 703 |
| 711 | Ga0466971_0001557 | 3300044719 | Bacteria | 9682 |
| 712 | Ga0466971_0024782 | 3300044719 | Bacteria | 2677 |
| 713 | Ga0466971_0071483 | 3300044719 | Bacteria | 1576 |
| 714 | Ga0466971_0423259 | 3300044719 | Bacteria | 651 |
| 715 | Ga0466971_0441195 | 3300044719 | Bacteria | 638 |
| 716 | Ga0466968_0003428 | 3300044735 | Bacteria | 5865 |
| 717 | Ga0466968_0016798 | 3300044735 | Bacteria | 2917 |
| 718 | Ga0466970_0006924 | 3300044765 | Bacteria | 5676 |
| 719 | Ga0466970_0022440 | 3300044765 | Bacteria | 3294 |
| 720 | Ga0466970_0037074 | 3300044765 | Bacteria | 2583 |
| 721 | Ga0466970_0075084 | 3300044765 | Bacteria | 1820 |
| 722 | Ga0466970_0168989 | 3300044765 | Bacteria | 1211 |
| 723 | Ga0466970_0173992 | 3300044765 | Bacteria | 1193 |
| 724 | Ga0466957_0003890 | 3300044842 | Bacteria | 8250 |
| 725 | Ga0466957_0022595 | 3300044842 | Bacteria | 3713 |
| 726 | Ga0466957_0030419 | 3300044842 | Bacteria | 3223 |
| 727 | Ga0466957_0044973 | 3300044842 | Bacteria | 2676 |
| 728 | Ga0466957_0167885 | 3300044842 | Bacteria | 1428 |
| 729 | Ga0466957_0623878 | 3300044842 | Bacteria | 756 |
| 730 | Ga0466960_0040069 | 3300044901 | Bacteria | 2213 |
| 731 | Ga0466960_0260758 | 3300044901 | Bacteria | 965 |
| 732 | Ga0466959_0002179 | 3300045049 | Bacteria | 12452 |
| 733 | Ga0466959_0002658 | 3300045049 | Bacteria | 11471 |
| 734 | Ga0466959_0006378 | 3300045049 | Bacteria | 8167 |
| 735 | Ga0466959_0007553 | 3300045049 | Bacteria | 7640 |
| 736 | Ga0466959_0023160 | 3300045049 | Bacteria | 4595 |
| 737 | Ga0466958_0006562 | 3300045836 | Bacteria | 6342 |
| 738 | Ga0466958_0035137 | 3300045836 | Bacteria | 2993 |
| 739 | Ga0466958_0048644 | 3300045836 | Bacteria | 2563 |
| 740 | Ga0466958_0195199 | 3300045836 | Bacteria | 1287 |
| 741 | Ga0466967_0010385 | 3300045976 | Bacteria | 6982 |
| 742 | Ga0466967_0557058 | 3300045976 | Bacteria | 1129 |
| 743 | Ga0466967_1257985 | 3300045976 | Bacteria | 737 |
| 744 | Ga0495617_000843 | 3300046452 | Bacteria | 14581 |
| 745 | Ga0495617_005276 | 3300046452 | Bacteria | 4600 |
| 746 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 747 | Ga0495592_0106127 | 3300046454 | Bacteria | 1994 |
| 748 | Ga0495592_0388974 | 3300046454 | Bacteria | 886 |
| 749 | Ga0495603_0027448 | 3300046455 | Bacteria | 3436 |
| 750 | Ga0495590_0002241 | 3300046457 | Bacteria | 8071 |
| 751 | Ga0495590_0010204 | 3300046457 | Bacteria | 3537 |
| 752 | Ga0495590_0044896 | 3300046457 | Bacteria | 1541 |
| 753 | Ga0495591_004107 | 3300046458 | Bacteria | 7244 |
| 754 | Ga0495629_0000060 | 3300046459 | Bacteria | 100921 |
| 755 | Ga0495629_0018287 | 3300046459 | Bacteria | 5018 |
| 756 | Ga0495629_0127038 | 3300046459 | Bacteria | 1776 |
| 757 | Ga0495629_0689902 | 3300046459 | Bacteria | 678 |
| 758 | Ga0495638_0009335 | 3300046460 | Bacteria | 6896 |
| 759 | Ga0495641_0005783 | 3300046461 | Bacteria | 8212 |
| 760 | Ga0495641_0219475 | 3300046461 | Bacteria | 853 |
| 761 | Ga0495651_0022338 | 3300046462 | Bacteria | 4917 |
| 762 | Ga0495651_0334936 | 3300046462 | Bacteria | 1004 |
| 763 | Ga0495653_0026964 | 3300046463 | Bacteria | 4601 |
| 764 | Ga0495653_0146152 | 3300046463 | Bacteria | 1656 |
| 765 | Ga0495653_0148465 | 3300046463 | Bacteria | 1640 |
| 766 | Ga0495653_0519160 | 3300046463 | Bacteria | 740 |
| 767 | Ga0495653_0849521 | 3300046463 | Bacteria | 546 |
| 768 | Ga0495650_0000837 | 3300046471 | Bacteria | 37114 |
| 769 | Ga0495650_0007308 | 3300046471 | Bacteria | 6667 |
| 770 | Ga0495650_0008995 | 3300046471 | Bacteria | 5741 |
| 771 | Ga0495650_0137162 | 3300046471 | Bacteria | 888 |
| 772 | Ga0495580_0000975 | 3300046472 | Bacteria | 25069 |
| 773 | Ga0495580_0009352 | 3300046472 | Bacteria | 7709 |
| 774 | Ga0495580_0048496 | 3300046472 | Bacteria | 3006 |
| 775 | Ga0495580_0052848 | 3300046472 | Bacteria | 2868 |
| 776 | Ga0495580_0109638 | 3300046472 | Bacteria | 1917 |
| 777 | Ga0495582_0002748 | 3300046473 | Bacteria | 9822 |
| 778 | Ga0495582_0037546 | 3300046473 | Bacteria | 2664 |
| 779 | Ga0495605_0019964 | 3300046474 | Bacteria | 3567 |
| 780 | Ga0495605_0046155 | 3300046474 | Bacteria | 2143 |
| 781 | Ga0495605_0064560 | 3300046474 | Bacteria | 1743 |
| 782 | Ga0495605_0168173 | 3300046474 | Bacteria | 970 |
| 783 | Ga0495662_0120824 | 3300046476 | Bacteria | 1286 |
| 784 | Ga0495662_0132942 | 3300046476 | Bacteria | 1223 |
| 785 | Ga0495662_0261704 | 3300046476 | Bacteria | 851 |
| 786 | Ga0495664_0000037 | 3300046477 | Bacteria | 70108 |
| 787 | Ga0495664_0010939 | 3300046477 | Bacteria | 5104 |
| 788 | Ga0495664_0016639 | 3300046477 | Bacteria | 4192 |
| 789 | Ga0495664_0357168 | 3300046477 | Bacteria | 879 |
| 790 | Ga0495584_0002307 | 3300046491 | Bacteria | 10888 |
| 791 | Ga0495584_0413837 | 3300046491 | Bacteria | 685 |
| 792 | Ga0495585_0398843 | 3300046492 | Bacteria | 662 |
| 793 | Ga0495594_0042385 | 3300046499 | Bacteria | 2493 |
| 794 | Ga0495596_0018802 | 3300046500 | Bacteria | 2845 |
| 795 | Ga0495596_0076148 | 3300046500 | Bacteria | 1303 |
| 796 | Ga0495607_0090253 | 3300046501 | Bacteria | 1662 |
| 797 | Ga0495583_0000177 | 3300046506 | Bacteria | 108704 |
| 798 | Ga0495583_0000221 | 3300046506 | Bacteria | 96143 |
| 799 | Ga0495583_0001627 | 3300046506 | Bacteria | 21932 |
| 800 | Ga0495583_0027095 | 3300046506 | Bacteria | 2831 |
| 801 | Ga0495583_0078735 | 3300046506 | Bacteria | 1435 |
| 802 | Ga0495606_0040529 | 3300046507 | Bacteria | 3130 |
| 803 | Ga0495606_0046538 | 3300046507 | Bacteria | 2866 |
| 804 | Ga0495606_0060057 | 3300046507 | Bacteria | 2436 |
| 805 | Ga0495606_0064965 | 3300046507 | Bacteria | 2320 |
| 806 | Ga0495606_0219356 | 3300046507 | Bacteria | 1072 |
| 807 | Ga0495608_0002733 | 3300046511 | Bacteria | 12673 |
| 808 | Ga0495608_0939969 | 3300046511 | Bacteria | 504 |
| 809 | Ga0495610_0003920 | 3300046512 | Bacteria | 11276 |
| 810 | Ga0495610_0045830 | 3300046512 | Bacteria | 2161 |
| 811 | Ga0495616_0026387 | 3300046513 | Bacteria | 3093 |
| 812 | Ga0495616_0431709 | 3300046513 | Bacteria | 536 |
| 813 | Ga0495618_0005010 | 3300046514 | Bacteria | 8093 |
| 814 | Ga0495618_0005105 | 3300046514 | Bacteria | 8015 |
| 815 | Ga0495620_0010464 | 3300046515 | Bacteria | 4895 |
| 816 | Ga0495620_0044545 | 3300046515 | Bacteria | 1927 |
| 817 | Ga0495628_0011261 | 3300046516 | Bacteria | 7567 |
| 818 | Ga0495628_0019283 | 3300046516 | Bacteria | 5641 |
| 819 | Ga0495628_0081905 | 3300046516 | Bacteria | 2506 |
| 820 | Ga0495628_0089721 | 3300046516 | Bacteria | 2380 |
| 821 | Ga0495630_0018087 | 3300046517 | Bacteria | 5172 |
| 822 | Ga0495630_0060980 | 3300046517 | Bacteria | 2832 |
| 823 | Ga0495630_0200148 | 3300046517 | Bacteria | 1524 |
| 824 | Ga0495630_0250715 | 3300046517 | Bacteria | 1352 |
| 825 | Ga0495630_1176338 | 3300046517 | Bacteria | 580 |
| 826 | Ga0495632_0203715 | 3300046519 | Bacteria | 900 |
| 827 | Ga0495632_0259407 | 3300046519 | Bacteria | 778 |
| 828 | Ga0495637_0014142 | 3300046520 | Bacteria | 3771 |
| 829 | Ga0495643_0000123 | 3300046522 | Bacteria | 124936 |
| 830 | Ga0495643_0036541 | 3300046522 | Bacteria | 2698 |
| 831 | Ga0495643_0154126 | 3300046522 | Bacteria | 1135 |
| 832 | Ga0495644_0006676 | 3300046523 | Bacteria | 4470 |
| 833 | Ga0495648_0002540 | 3300046524 | Bacteria | 16736 |
| 834 | Ga0495648_0018998 | 3300046524 | Bacteria | 4847 |
| 835 | Ga0495648_0028053 | 3300046524 | Bacteria | 3755 |
| 836 | Ga0495648_0043051 | 3300046524 | Bacteria | 2834 |
| 837 | Ga0495666_0001885 | 3300046526 | Bacteria | 10351 |
| 838 | Ga0495666_0142952 | 3300046526 | Bacteria | 1114 |
| 839 | Ga0495642_0025247 | 3300046528 | Bacteria | 2355 |
| 840 | Ga0495642_0036504 | 3300046528 | Bacteria | 1986 |
| 841 | Ga0495652_0031410 | 3300046529 | Bacteria | 4651 |
| 842 | Ga0495652_0115948 | 3300046529 | Bacteria | 2145 |
| 843 | Ga0495652_0131756 | 3300046529 | Bacteria | 1978 |
| 844 | Ga0495652_0182733 | 3300046529 | Bacteria | 1607 |
| 845 | Ga0495654_0007194 | 3300046530 | Bacteria | 6243 |
| 846 | Ga0495654_0016009 | 3300046530 | Bacteria | 3973 |
| 847 | Ga0495654_0047831 | 3300046530 | Bacteria | 2101 |
| 848 | Ga0495654_0216948 | 3300046530 | Bacteria | 811 |
| 849 | Ga0495654_0243293 | 3300046530 | Bacteria | 752 |
| 850 | Ga0495665_0027180 | 3300046531 | Bacteria | 3072 |
| 851 | Ga0495665_0088982 | 3300046531 | Bacteria | 1622 |
| 852 | Ga0495665_0233349 | 3300046531 | Bacteria | 949 |
| 853 | Ga0495665_0332830 | 3300046531 | Bacteria | 774 |
| 854 | Ga0495640_0012106 | 3300046533 | Bacteria | 6607 |
| 855 | Ga0495640_0017853 | 3300046533 | Bacteria | 5276 |
| 856 | Ga0495640_0576921 | 3300046533 | Bacteria | 680 |
| 857 | Ga0495586_0004650 | 3300046535 | Bacteria | 7337 |
| 858 | Ga0495586_0133203 | 3300046535 | Bacteria | 1392 |
| 859 | Ga0495587_0003135 | 3300046536 | Bacteria | 11060 |
| 860 | Ga0495587_0083669 | 3300046536 | Bacteria | 1848 |
| 861 | Ga0495609_0000479 | 3300046538 | Bacteria | 32080 |
| 862 | Ga0495609_0207150 | 3300046538 | Bacteria | 818 |
| 863 | Ga0495597_0010421 | 3300046542 | Bacteria | 4546 |
| 864 | Ga0495597_0017578 | 3300046542 | Bacteria | 3363 |
| 865 | Ga0495597_0095922 | 3300046542 | Bacteria | 1254 |
| 866 | Ga0495597_0126266 | 3300046542 | Bacteria | 1063 |
| 867 | Ga0495597_0132415 | 3300046542 | Bacteria | 1033 |
| 868 | Ga0495597_0144854 | 3300046542 | Bacteria | 978 |
| 869 | Ga0495645_0028172 | 3300046543 | Bacteria | 4081 |
| 870 | Ga0495645_0049735 | 3300046543 | Bacteria | 3052 |
| 871 | Ga0495622_0000028 | 3300046557 | Bacteria | 133197 |
| 872 | Ga0495622_0064758 | 3300046557 | Bacteria | 1690 |
| 873 | Ga0495633_0001452 | 3300046558 | Bacteria | 18400 |
| 874 | Ga0495633_0003780 | 3300046558 | Bacteria | 9929 |
| 875 | Ga0495633_0045139 | 3300046558 | Bacteria | 2087 |
| 876 | Ga0495633_0133096 | 3300046558 | Bacteria | 1151 |
| 877 | Ga0495633_0185045 | 3300046558 | Bacteria | 958 |
| 878 | Ga0495633_0319569 | 3300046558 | Bacteria | 704 |
| 879 | Ga0495667_0426429 | 3300046559 | Bacteria | 834 |
| 880 | Ga0495656_0003881 | 3300046615 | Bacteria | 5084 |
| 881 | Ga0495656_0109049 | 3300046615 | Bacteria | 1292 |
| 882 | Ga0495656_0144429 | 3300046615 | Bacteria | 1144 |
| 883 | Ga0495668_0464305 | 3300046616 | Bacteria | 697 |
| 884 | Ga0495634_0070463 | 3300046642 | Bacteria | 2304 |
| 885 | Ga0495634_0100657 | 3300046642 | Bacteria | 1867 |
| 886 | Ga0495634_0307495 | 3300046642 | Bacteria | 957 |
| 887 | Ga0495634_0315326 | 3300046642 | Bacteria | 942 |
| 888 | Ga0495611_0017514 | 3300046648 | Bacteria | 3065 |
| 889 | Ga0495611_0085027 | 3300046648 | Bacteria | 1458 |
| 890 | Ga0495625_0010387 | 3300046660 | Bacteria | 7709 |
| 891 | Ga0495625_0098533 | 3300046660 | Bacteria | 2011 |
| 892 | Ga0495635_0001911 | 3300046663 | Bacteria | 14154 |
| 893 | Ga0495635_0582656 | 3300046663 | Bacteria | 731 |
| 894 | Ga0495659_0000284 | 3300046664 | Bacteria | 20570 |
| 895 | Ga0495659_0001733 | 3300046664 | Bacteria | 7257 |
| 896 | Ga0495659_0032379 | 3300046664 | Bacteria | 1829 |
| 897 | Ga0495659_0258790 | 3300046664 | Bacteria | 727 |
| 898 | Ga0495661_0015384 | 3300046665 | Bacteria | 5107 |
| 899 | Ga0495661_0032098 | 3300046665 | Bacteria | 3323 |
| 900 | Ga0495661_0068043 | 3300046665 | Bacteria | 2090 |
| 901 | Ga0495661_0187824 | 3300046665 | Bacteria | 1090 |
| 902 | Ga0495588_0016869 | 3300046674 | Bacteria | 3536 |
| 903 | Ga0495588_0266466 | 3300046674 | Bacteria | 902 |
| 904 | Ga0495657_0012465 | 3300046675 | Bacteria | 6317 |
| 905 | Ga0495599_0015303 | 3300046678 | Bacteria | 4759 |
| 906 | Ga0495599_0158502 | 3300046678 | Bacteria | 1399 |
| 907 | Ga0495623_0007364 | 3300046679 | Bacteria | 7144 |
| 908 | Ga0495623_0021394 | 3300046679 | Bacteria | 4176 |
| 909 | Ga0495646_0004251 | 3300046680 | Bacteria | 9011 |
| 910 | Ga0495646_0064817 | 3300046680 | Bacteria | 2164 |
| 911 | Ga0495669_0110981 | 3300046684 | Bacteria | 1280 |
| 912 | Ga0495613_0022883 | 3300046689 | Bacteria | 4656 |
| 913 | Ga0495613_0907691 | 3300046689 | Bacteria | 570 |
| 914 | Ga0495624_0006795 | 3300046690 | Bacteria | 8082 |
| 915 | Ga0495624_0015717 | 3300046690 | Bacteria | 5103 |
| 916 | Ga0495624_0017723 | 3300046690 | Bacteria | 4775 |
| 917 | Ga0495624_0020284 | 3300046690 | Bacteria | 4427 |
| 918 | Ga0495624_0027317 | 3300046690 | Bacteria | 3736 |
| 919 | Ga0495670_0054856 | 3300046691 | Bacteria | 1998 |
| 920 | Ga0495670_0070743 | 3300046691 | Bacteria | 1765 |
| 921 | Ga0495671_0000108 | 3300046692 | Bacteria | 74169 |
| 922 | Ga0495671_0137186 | 3300046692 | Bacteria | 1192 |
| 923 | Ga0495671_0221131 | 3300046692 | Bacteria | 916 |
| 924 | Ga0495671_0397240 | 3300046692 | Bacteria | 660 |
| 925 | Ga0495649_0042023 | 3300046694 | Bacteria | 2498 |
| 926 | Ga0495649_0047936 | 3300046694 | Bacteria | 2322 |
| 927 | Ga0495649_0113338 | 3300046694 | Bacteria | 1437 |
| 928 | Ga0495589_0002451 | 3300046794 | Bacteria | 10415 |
| 929 | Ga0495589_0042042 | 3300046794 | Bacteria | 2278 |
| 930 | Ga0495600_0002084 | 3300046809 | Bacteria | 11290 |
| 931 | Ga0495600_0060784 | 3300046809 | Bacteria | 2467 |
| 932 | Ga0495600_0769114 | 3300046809 | Bacteria | 575 |
| 933 | Ga0495660_0000705 | 3300046810 | Bacteria | 25643 |
| 934 | Ga0495660_0067675 | 3300046810 | Bacteria | 1902 |
| 935 | Ga0495660_0160847 | 3300046810 | Bacteria | 1101 |
| 936 | Ga0495660_0190688 | 3300046810 | Bacteria | 985 |
| 937 | Ga0495660_0278812 | 3300046810 | Bacteria | 765 |
| 938 | Ga0495581_0004052 | 3300047315 | Bacteria | 8436 |
| 939 | Ga0495581_0102795 | 3300047315 | Bacteria | 1660 |
| 940 | Ga0495581_0149957 | 3300047315 | Bacteria | 1361 |
| 941 | Ga0495604_0011916 | 3300047317 | Bacteria | 6914 |
| 942 | Ga0495604_0065108 | 3300047317 | Bacteria | 2775 |
| 943 | Ga0495604_0095261 | 3300047317 | Bacteria | 2199 |
| 944 | Ga0495636_0012717 | 3300047318 | Bacteria | 3333 |
| 945 | Ga0495636_0016093 | 3300047318 | Bacteria | 2984 |
| 946 | Ga0495674_0006962 | 3300047319 | Bacteria | 10818 |
| 947 | Ga0495674_0007875 | 3300047319 | Bacteria | 10175 |
| 948 | Ga0495674_0030492 | 3300047319 | Bacteria | 4903 |
| 949 | Ga0495674_0064038 | 3300047319 | Bacteria | 3197 |
| 950 | Ga0495674_0302711 | 3300047319 | Bacteria | 1305 |
| 951 | Ga0495674_0951762 | 3300047319 | Bacteria | 660 |
| 952 | Ga0495672_0000181 | 3300047320 | Bacteria | 91278 |
| 953 | Ga0495672_0000366 | 3300047320 | Bacteria | 57469 |
| 954 | Ga0495672_0004977 | 3300047320 | Bacteria | 10663 |
| 955 | Ga0495672_0032552 | 3300047320 | Bacteria | 3241 |
| 956 | Ga0495672_0047636 | 3300047320 | Bacteria | 2547 |
| 957 | Ga0495676_0065694 | 3300047321 | Bacteria | 2814 |
| 958 | Ga0495676_0321395 | 3300047321 | Bacteria | 1039 |
| 959 | Ga0495680_0013833 | 3300047322 | Bacteria | 7020 |
| 960 | Ga0495680_0191214 | 3300047322 | Bacteria | 1472 |
| 961 | Ga0495683_0012933 | 3300047323 | Bacteria | 4375 |
| 962 | Ga0495683_0021720 | 3300047323 | Bacteria | 3305 |
| 963 | Ga0495683_0030717 | 3300047323 | Bacteria | 2739 |
| 964 | Ga0495683_0299903 | 3300047323 | Bacteria | 690 |
| 965 | Ga0495687_005585 | 3300047443 | Bacteria | 7962 |
| 966 | Ga0495687_006712 | 3300047443 | Bacteria | 6978 |
| 967 | Ga0495687_026489 | 3300047443 | Bacteria | 2728 |
| 968 | Ga0495687_040102 | 3300047443 | Bacteria | 2066 |
| 969 | Ga0495675_0002828 | 3300047444 | Bacteria | 10396 |
| 970 | Ga0495675_0010388 | 3300047444 | Bacteria | 5818 |
| 971 | Ga0495675_0343950 | 3300047444 | Bacteria | 878 |
| 972 | Ga0495677_0002355 | 3300047445 | Bacteria | 7419 |
| 973 | Ga0495677_0053591 | 3300047445 | Bacteria | 1487 |
| 974 | Ga0495679_000038 | 3300047446 | Bacteria | 157311 |
| 975 | Ga0495679_001758 | 3300047446 | Bacteria | 11895 |
| 976 | Ga0495679_004370 | 3300047446 | Bacteria | 6548 |
| 977 | Ga0495685_000012 | 3300047447 | Bacteria | 80496 |
| 978 | Ga0495673_0000188 | 3300047469 | Bacteria | 99425 |
| 979 | Ga0495673_0030133 | 3300047469 | Bacteria | 2552 |
| 980 | Ga0495673_0035867 | 3300047469 | Bacteria | 2280 |
| 981 | Ga0495681_0004664 | 3300047470 | Bacteria | 9291 |
| 982 | Ga0495681_0023688 | 3300047470 | Bacteria | 3255 |
| 983 | Ga0495681_0266656 | 3300047470 | Bacteria | 671 |
| 984 | Ga0495684_0099372 | 3300047471 | Bacteria | 2200 |
| 985 | Ga0495684_0981306 | 3300047471 | Bacteria | 538 |
| 986 | Ga0495686_0000380 | 3300047472 | Bacteria | 71038 |
| 987 | Ga0495686_0003712 | 3300047472 | Bacteria | 13033 |
| 988 | Ga0495686_0093464 | 3300047472 | Bacteria | 1823 |
| 989 | Ga0495686_0264767 | 3300047472 | Bacteria | 961 |
| 990 | Ga0495593_0067595 | 3300047673 | Bacteria | 1860 |
| 991 | Ga0495593_0175509 | 3300047673 | Bacteria | 1079 |
| 992 | Ga0495593_0253204 | 3300047673 | Bacteria | 881 |
| 993 | Ga0495602_0075108 | 3300048088 | Bacteria | 2869 |
| 994 | Ga0495602_0108305 | 3300048088 | Bacteria | 2262 |
| 995 | Ga0495602_0139136 | 3300048088 | Bacteria | 1924 |
| 996 | Ga0495602_0369908 | 3300048088 | Bacteria | 1029 |
| 997 | Ga0495614_0003506 | 3300048089 | Bacteria | 7027 |
| 998 | Ga0495614_0009064 | 3300048089 | Bacteria | 4410 |
| 999 | Ga0495614_0023359 | 3300048089 | Bacteria | 2667 |
| 1000 | Ga0495614_0465011 | 3300048089 | Bacteria | 599 |
| 1001 | Ga0495626_0001169 | 3300048091 | Bacteria | 21818 |
| 1002 | Ga0495626_0015633 | 3300048091 | Bacteria | 3879 |
| 1003 | Ga0495626_0020668 | 3300048091 | Bacteria | 3277 |
| 1004 | Ga0495626_0320457 | 3300048091 | Bacteria | 609 |
| 1005 | Ga0496100_0001564 | 3300048903 | Bacteria | 11251 |
| 1006 | Ga0496100_1348507 | 3300048903 | Bacteria | 563 |
| 1007 | Ga0496101_0004610 | 3300048904 | Bacteria | 8706 |
| 1008 | Ga0496101_0328315 | 3300048904 | Bacteria | 1201 |
| 1009 | Ga0496101_0424436 | 3300048904 | Bacteria | 1048 |
| 1010 | Ga0496102_0008702 | 3300048905 | Bacteria | 8712 |
| 1011 | Ga0496102_0014532 | 3300048905 | Bacteria | 6841 |
| 1012 | Ga0496102_0184660 | 3300048905 | Bacteria | 1965 |
| 1013 | Ga0496102_1531281 | 3300048905 | Bacteria | 585 |
| 1014 | Ga0496103_0003074 | 3300048906 | Bacteria | 10259 |
| 1015 | Ga0496103_0009410 | 3300048906 | Bacteria | 5789 |
| 1016 | Ga0496103_0110398 | 3300048906 | Bacteria | 1747 |
| 1017 | Ga0496103_0437231 | 3300048906 | Bacteria | 839 |
| 1018 | Ga0496104_1668037 | 3300048907 | Bacteria | 540 |
| 1019 | Ga0496105_0055064 | 3300048908 | Bacteria | 3284 |
| 1020 | Ga0496105_0212234 | 3300048908 | Bacteria | 1578 |
| 1021 | Ga0496106_0138726 | 3300048909 | Bacteria | 1911 |
| 1022 | Ga0496107_0109583 | 3300048910 | Bacteria | 2028 |
| 1023 | Ga0496108_0900138 | 3300048911 | Bacteria | 759 |
| 1024 | Ga0496109_0195160 | 3300048912 | Bacteria | 1903 |
| 1025 | Ga0496110_0099317 | 3300048913 | Bacteria | 2609 |
| 1026 | Ga0496110_1007485 | 3300048913 | Bacteria | 740 |
| 1027 | Ga0496110_1177451 | 3300048913 | Bacteria | 675 |
| 1028 | Ga0496110_1586065 | 3300048913 | Bacteria | 564 |
| 1029 | Ga0496111_0177460 | 3300048914 | Bacteria | 1583 |
| 1030 | Ga0496111_0238931 | 3300048914 | Bacteria | 1349 |
| 1031 | Ga0496112_0165240 | 3300048915 | Bacteria | 2179 |
| 1032 | Ga0496112_1396035 | 3300048915 | Bacteria | 615 |
| 1033 | Ga0496113_0026351 | 3300048916 | Bacteria | 4155 |
| 1034 | Ga0496113_0912600 | 3300048916 | Bacteria | 694 |
| 1035 | Ga0496113_1482673 | 3300048916 | Unclassified | 524 |
| 1036 | Ga0496113_1514884 | 3300048916 | Bacteria | 517 |
| 1037 | Ga0496114_0168757 | 3300048917 | Bacteria | 1906 |
| 1038 | Ga0496114_0171177 | 3300048917 | Bacteria | 1893 |
| 1039 | Ga0496114_0269836 | 3300048917 | Bacteria | 1499 |
| 1040 | Ga0496115_0217914 | 3300048918 | Bacteria | 1575 |
| 1041 | Ga0496116_0007137 | 3300048919 | Bacteria | 9993 |
| 1042 | Ga0496116_0024774 | 3300048919 | Bacteria | 4427 |
| 1043 | Ga0496116_0040168 | 3300048919 | Bacteria | 3224 |
| 1044 | Ga0496116_0173243 | 3300048919 | Bacteria | 1166 |
| 1045 | Ga0496116_0404592 | 3300048919 | Bacteria | 602 |
| 1046 | Ga0496117_0009193 | 3300048920 | Bacteria | 9253 |
| 1047 | Ga0496117_0012754 | 3300048920 | Bacteria | 7375 |
| 1048 | Ga0496117_0023308 | 3300048920 | Bacteria | 4938 |
| 1049 | Ga0496117_0024619 | 3300048920 | Bacteria | 4754 |
| 1050 | Ga0496117_0041125 | 3300048920 | Bacteria | 3391 |
| 1051 | Ga0496118_0002548 | 3300048921 | Bacteria | 24410 |
| 1052 | Ga0496118_0008041 | 3300048921 | Bacteria | 11014 |
| 1053 | Ga0496118_0017381 | 3300048921 | Bacteria | 6548 |
| 1054 | Ga0496118_0019819 | 3300048921 | Bacteria | 5997 |
| 1055 | Ga0496118_0039449 | 3300048921 | Bacteria | 3767 |
| 1056 | Ga0496118_0063758 | 3300048921 | Bacteria | 2709 |
| 1057 | Ga0496119_0008234 | 3300048922 | Bacteria | 9214 |
| 1058 | Ga0496119_0203713 | 3300048922 | Bacteria | 1022 |
| 1059 | Ga0496120_0006959 | 3300048923 | Bacteria | 8524 |
| 1060 | Ga0496120_0292255 | 3300048923 | Bacteria | 749 |
| 1061 | Ga0496121_0000306 | 3300048924 | Bacteria | 102245 |
| 1062 | Ga0496121_0004537 | 3300048924 | Bacteria | 18576 |
| 1063 | Ga0496121_0007042 | 3300048924 | Bacteria | 13657 |
| 1064 | Ga0496121_0065853 | 3300048924 | Bacteria | 2945 |
| 1065 | Ga0496121_0260830 | 3300048924 | Bacteria | 1196 |
| 1066 | Ga0496121_0296634 | 3300048924 | Bacteria | 1099 |
| 1067 | Ga0496122_0000644 | 3300048925 | Bacteria | 70937 |
| 1068 | Ga0496122_0004387 | 3300048925 | Bacteria | 17565 |
| 1069 | Ga0496122_0034717 | 3300048925 | Bacteria | 4120 |
| 1070 | Ga0496122_0280000 | 3300048925 | Bacteria | 912 |
| 1071 | Ga0496122_0548951 | 3300048925 | Bacteria | 551 |
| 1072 | Ga0496123_0000203 | 3300048926 | Bacteria | 121361 |
| 1073 | Ga0496123_0013893 | 3300048926 | Bacteria | 6710 |
| 1074 | Ga0496123_0124169 | 3300048926 | Bacteria | 1444 |
| 1075 | Ga0496123_0149579 | 3300048926 | Bacteria | 1262 |
| 1076 | Ga0496124_0008511 | 3300048927 | Bacteria | 10717 |
| 1077 | Ga0496124_0009308 | 3300048927 | Bacteria | 10124 |
| 1078 | Ga0496124_0038717 | 3300048927 | Bacteria | 4138 |
| 1079 | Ga0496124_0051693 | 3300048927 | Bacteria | 3494 |
| 1080 | Ga0496124_0055125 | 3300048927 | Bacteria | 3361 |
| 1081 | Ga0496124_0063559 | 3300048927 | Bacteria | 3083 |
| 1082 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 1083 | Ga0496125_0003109 | 3300048928 | Bacteria | 20660 |
| 1084 | Ga0496125_0007345 | 3300048928 | Bacteria | 11735 |
| 1085 | Ga0496125_0020259 | 3300048928 | Bacteria | 6245 |
| 1086 | Ga0496125_0035345 | 3300048928 | Bacteria | 4385 |
| 1087 | Ga0496125_0095438 | 3300048928 | Bacteria | 2212 |
| 1088 | Ga0496125_0204583 | 3300048928 | Bacteria | 1288 |
| 1089 | Ga0496125_0278086 | 3300048928 | Bacteria | 1039 |
| 1090 | Ga0496126_0002232 | 3300048929 | Bacteria | 26785 |
| 1091 | Ga0496126_0003420 | 3300048929 | Bacteria | 20038 |
| 1092 | Ga0496126_0038550 | 3300048929 | Bacteria | 4445 |
| 1093 | Ga0496126_0056077 | 3300048929 | Bacteria | 3563 |
| 1094 | Ga0496126_0062435 | 3300048929 | Bacteria | 3343 |
| 1095 | Ga0496126_0552921 | 3300048929 | Bacteria | 913 |
| 1096 | Ga0466983_0920657 | 3300048986 | Bacteria | 507 |
| 1097 | Ga0501306_018797 | 3300049127 | Bacteria | 948 |
| 1098 | Ga0501306_091083 | 3300049127 | Bacteria | 536 |
| 1099 | Ga0501306_093629 | 3300049127 | Bacteria | 531 |
| 1100 | Ga0501308_000315 | 3300049128 | Bacteria | 2988 |
| 1101 | Ga0501308_037032 | 3300049128 | Bacteria | 675 |
| 1102 | Ga0501309_017424 | 3300049129 | Bacteria | 986 |
| 1103 | Ga0501310_017772 | 3300049130 | Bacteria | 863 |
| 1104 | Ga0501341_02833 | 3300049131 | Bacteria | 957 |
| 1105 | Ga0501341_05638 | 3300049131 | Bacteria | 753 |
| 1106 | Ga0501343_006326 | 3300049132 | Bacteria | 922 |
| 1107 | Ga0501304_002330 | 3300049160 | Bacteria | 1310 |
| 1108 | Ga0501304_024903 | 3300049160 | Bacteria | 611 |
| 1109 | Ga0501305_003896 | 3300049161 | Bacteria | 1722 |
| 1110 | Ga0501305_021623 | 3300049161 | Bacteria | 952 |
| 1111 | Ga0501305_095814 | 3300049161 | Bacteria | 548 |
| 1112 | Ga0501307_026574 | 3300049162 | Bacteria | 783 |
| 1113 | Ga0501307_085034 | 3300049162 | Bacteria | 521 |
| 1114 | Ga0495678_000004 | 3300049459 | Bacteria | 532920 |
| 1115 | Ga0495678_043783 | 3300049459 | Bacteria | 1775 |
| 1116 | Ga0495682_0019450 | 3300049460 | Bacteria | 2553 |
| 1117 | Ga0495682_0086305 | 3300049460 | Bacteria | 1127 |
| 1118 | Ga0501311_007961 | 3300049527 | Bacteria | 1231 |
| 1119 | Ga0501312_028442 | 3300049528 | Bacteria | 867 |
| 1120 | Ga0501312_033713 | 3300049528 | Bacteria | 813 |
| 1121 | Ga0501312_087788 | 3300049528 | Bacteria | 570 |
| 1122 | Ga0501313_009046 | 3300049529 | Bacteria | 1117 |
| 1123 | Ga0501313_046959 | 3300049529 | Bacteria | 590 |
| 1124 | Ga0501314_005186 | 3300049530 | Bacteria | 1103 |
| 1125 | Ga0501314_030317 | 3300049530 | Bacteria | 599 |
| 1126 | Ga0501315_002372 | 3300049531 | Bacteria | 1761 |
| 1127 | Ga0501315_009861 | 3300049531 | Bacteria | 1137 |
| 1128 | Ga0501315_037184 | 3300049531 | Bacteria | 724 |
| 1129 | Ga0501315_052119 | 3300049531 | Bacteria | 645 |
| 1130 | Ga0501315_088192 | 3300049531 | Bacteria | 535 |
| 1131 | Ga0501316_038549 | 3300049532 | Bacteria | 660 |
| 1132 | Ga0501316_076814 | 3300049532 | Bacteria | 512 |
| 1133 | Ga0501317_056037 | 3300049533 | Bacteria | 637 |
| 1134 | Ga0501317_101203 | 3300049533 | Bacteria | 520 |
| 1135 | Ga0501318_043630 | 3300049534 | Bacteria | 649 |
| 1136 | Ga0501319_000620 | 3300049535 | Bacteria | 1776 |
| 1137 | Ga0501319_003465 | 3300049535 | Bacteria | 1056 |
| 1138 | Ga0501319_017426 | 3300049535 | Bacteria | 623 |
| 1139 | Ga0501320_001140 | 3300049536 | Bacteria | 1850 |
| 1140 | Ga0501320_007226 | 3300049536 | Bacteria | 1063 |
| 1141 | Ga0501320_020731 | 3300049536 | Bacteria | 759 |
| 1142 | Ga0501321_025190 | 3300049537 | Bacteria | 766 |
| 1143 | Ga0501323_000562 | 3300049539 | Bacteria | 2815 |
| 1144 | Ga0501323_017412 | 3300049539 | Bacteria | 923 |
| 1145 | Ga0501323_025630 | 3300049539 | Bacteria | 803 |
| 1146 | Ga0501324_012443 | 3300049540 | Bacteria | 796 |
| 1147 | Ga0501324_021515 | 3300049540 | Bacteria | 662 |
| 1148 | Ga0501324_044802 | 3300049540 | Bacteria | 513 |
| 1149 | Ga0501325_006584 | 3300049541 | Bacteria | 959 |
| 1150 | Ga0501326_09348 | 3300049542 | Bacteria | 578 |
| 1151 | Ga0501329_10738 | 3300049545 | Bacteria | 577 |
| 1152 | Ga0501329_12003 | 3300049545 | Bacteria | 557 |
| 1153 | Ga0501335_008825 | 3300049551 | Bacteria | 953 |
| 1154 | Ga0501337_011731 | 3300049553 | Bacteria | 650 |
| 1155 | Ga0501337_015195 | 3300049553 | Bacteria | 593 |
| 1156 | Ga0501337_021820 | 3300049553 | Bacteria | 524 |
| 1157 | Ga0501337_025092 | 3300049553 | Bacteria | 500 |
| 1158 | Ga0501338_05164 | 3300049554 | Bacteria | 805 |
| 1159 | Ga0501031_0322400 | 3300049568 | Bacteria | 1001 |
| 1160 | Ga0501032_0166201 | 3300049569 | Bacteria | 1448 |
| 1161 | Ga0501033_0000642 | 3300049570 | Bacteria | 32324 |
| 1162 | Ga0501033_0087505 | 3300049570 | Bacteria | 2280 |
| 1163 | Ga0501033_0638143 | 3300049570 | Bacteria | 728 |
| 1164 | Ga0501034_0004519 | 3300049571 | Bacteria | 15470 |
| 1165 | Ga0501034_0018858 | 3300049571 | Bacteria | 7070 |
| 1166 | Ga0501034_0135557 | 3300049571 | Bacteria | 2443 |
| 1167 | Ga0501034_0503757 | 3300049571 | Bacteria | 1124 |
| 1168 | Ga0501034_0897898 | 3300049571 | Bacteria | 774 |
| 1169 | Ga0501036_0002870 | 3300049572 | Bacteria | 13658 |
| 1170 | Ga0501036_0529773 | 3300049572 | Bacteria | 979 |
| 1171 | Ga0501037_0095024 | 3300049573 | Bacteria | 2155 |
| 1172 | Ga0501037_0145797 | 3300049573 | Bacteria | 1693 |
| 1173 | Ga0501037_0396915 | 3300049573 | Bacteria | 946 |
| 1174 | Ga0501038_0019977 | 3300049574 | Bacteria | 6030 |
| 1175 | Ga0501038_0099781 | 3300049574 | Bacteria | 2420 |
| 1176 | Ga0501038_0614513 | 3300049574 | Bacteria | 821 |
| 1177 | Ga0501038_0854985 | 3300049574 | Bacteria | 673 |
| 1178 | Ga0501038_1316813 | 3300049574 | Bacteria | 521 |
| 1179 | Ga0501039_0066082 | 3300049575 | Bacteria | 2807 |
| 1180 | Ga0501041_0117973 | 3300049577 | Bacteria | 1648 |
| 1181 | Ga0501042_0376229 | 3300049578 | Bacteria | 1028 |
| 1182 | Ga0501043_0029837 | 3300049579 | Bacteria | 4284 |
| 1183 | Ga0501043_0275446 | 3300049579 | Bacteria | 1291 |
| 1184 | Ga0501043_0637405 | 3300049579 | Bacteria | 784 |
| 1185 | Ga0501043_0651096 | 3300049579 | Bacteria | 774 |
| 1186 | Ga0501046_0345873 | 3300049580 | Bacteria | 1080 |
| 1187 | Ga0501047_0251848 | 3300049581 | Bacteria | 1614 |
| 1188 | Ga0501048_0932869 | 3300049582 | Bacteria | 624 |
| 1189 | Ga0501068_0001118 | 3300049584 | Bacteria | 14194 |
| 1190 | Ga0501069_0786040 | 3300049585 | Bacteria | 576 |
| 1191 | Ga0501070_0031743 | 3300049586 | Bacteria | 4426 |
| 1192 | Ga0501071_0955919 | 3300049587 | Bacteria | 661 |
| 1193 | Ga0501071_1339514 | 3300049587 | Bacteria | 553 |
| 1194 | Ga0501072_0001234 | 3300049588 | Bacteria | 19087 |
| 1195 | Ga0501073_0000651 | 3300049589 | Bacteria | 24370 |
| 1196 | Ga0501074_0231440 | 3300049590 | Bacteria | 1315 |
| 1197 | Ga0501076_0374926 | 3300049592 | Bacteria | 1169 |
| 1198 | Ga0501077_0320333 | 3300049593 | Bacteria | 988 |
| 1199 | Ga0501209_000078 | 3300049656 | Bacteria | 9704 |
| 1200 | Ga0501233_198393 | 3300049668 | Bacteria | 583 |
| 1201 | Ga0501235_034034 | 3300049669 | Bacteria | 1155 |
| 1202 | Ga0501249_027340 | 3300049679 | Bacteria | 1262 |
| 1203 | Ga0501080_0000604 | 3300049742 | Bacteria | 28440 |
| 1204 | Ga0501080_0320684 | 3300049742 | Bacteria | 1403 |
| 1205 | Ga0501081_0148790 | 3300049743 | Bacteria | 1681 |
| 1206 | Ga0501081_0887637 | 3300049743 | Bacteria | 672 |
| 1207 | Ga0501083_0259184 | 3300049744 | Bacteria | 1131 |
| 1208 | Ga0501266_000163 | 3300049763 | Bacteria | 8551 |
| 1209 | Ga0501268_075156 | 3300049765 | Bacteria | 689 |
| 1210 | Ga0501035_0099514 | 3300049822 | Bacteria | 2552 |
| 1211 | Ga0501044_0003646 | 3300049823 | Bacteria | 17332 |
| 1212 | Ga0501044_0036229 | 3300049823 | Bacteria | 5162 |
| 1213 | Ga0501044_0245047 | 3300049823 | Bacteria | 1735 |
| 1214 | Ga0501044_0812045 | 3300049823 | Bacteria | 814 |
| 1215 | Ga0501044_1223762 | 3300049823 | Bacteria | 618 |
| 1216 | Ga0501045_0561509 | 3300049824 | Bacteria | 846 |
| 1217 | nmdc:mga03683_220198_c1 | 3300050489 | Bacteria | 875 |
| 1218 | nmdc:mga03683_31242_c1 | 3300050489 | Bacteria | 2135 |
| 1219 | nmdc:mga03n38_530914_c1 | 3300050490 | Bacteria | 663 |
| 1220 | nmdc:mga0yw44_598823_c1 | 3300050492 | Bacteria | 749 |
| 1221 | nmdc:mga0k408_308126_c1 | 3300050493 | Bacteria | 945 |
| 1222 | nmdc:mga0k408_607118_c1 | 3300050493 | Bacteria | 645 |
| 1223 | nmdc:mga0k408_746819_c1 | 3300050493 | Bacteria | 572 |
| 1224 | nmdc:mga0k408_86809_c1 | 3300050493 | Bacteria | 1837 |
| 1225 | nmdc:mga0k408_940_c1 | 3300050493 | Bacteria | 15979 |
| 1226 | nmdc:mga07m45_15021_c1 | 3300050496 | Bacteria | 4135 |
| 1227 | nmdc:mga07m45_212810_c2 | 3300050496 | Bacteria | 776 |
| 1228 | nmdc:mga07m45_729995_c1 | 3300050496 | Bacteria | 569 |
| 1229 | nmdc:mga07m45_786307_c1 | 3300050496 | Bacteria | 546 |
| 1230 | nmdc:mga05p37_1322380_c1 | 3300050507 | Bacteria | 733 |
| 1231 | nmdc:mga09592_9523_c1 | 3300050508 | Bacteria | 7896 |
| 1232 | nmdc:mga0qj67_286042_c1 | 3300050509 | Bacteria | 1336 |
| 1233 | nmdc:mga08y16_1000_c1 | 3300050511 | Bacteria | 27606 |
| 1234 | Ga0495655_0170877 | 3300053083 | Bacteria | 696 |
| 1235 | Ga0500643_035180 | 3300053087 | Bacteria | 1504 |
| 1236 | Ga0500644_0016047 | 3300053088 | Bacteria | 2150 |
| 1237 | Ga0500646_0038494 | 3300053090 | Bacteria | 1339 |
| 1238 | Ga0500562_001613 | 3300053108 | Bacteria | 5607 |
| 1239 | Ga0500569_080694 | 3300053109 | Bacteria | 1040 |
| 1240 | Ga0500594_0005237 | 3300053118 | Bacteria | 2873 |
| 1241 | Ga0500618_000089 | 3300053125 | Bacteria | 74800 |
| 1242 | Ga0500559_0046340 | 3300053136 | Bacteria | 1906 |
| 1243 | Ga0500568_0338118 | 3300053139 | Bacteria | 546 |
| 1244 | Ga0500616_0027216 | 3300053153 | Bacteria | 3158 |
| 1245 | Ga0500622_0033857 | 3300053156 | Bacteria | 2679 |
| 1246 | Ga0501084_0064611 | 3300054114 | Bacteria | 3062 |
| 1247 | Ga0587084_006518 | 3300059477 | Bacteria | 1420 |
| 1248 | Ga0587084_027678 | 3300059477 | Bacteria | 893 |
| 1249 | Ga0587084_030888 | 3300059477 | Bacteria | 862 |
| 1250 | Ga0587084_097968 | 3300059477 | Bacteria | 591 |
| 1251 | Ga0587093_017438 | 3300059478 | Bacteria | 926 |
| 1252 | Ga0587093_026237 | 3300059478 | Bacteria | 812 |
| 1253 | Ga0587093_050875 | 3300059478 | Bacteria | 654 |
| 1254 | Ga0587093_070061 | 3300059478 | Bacteria | 588 |
| 1255 | Ga0587093_076702 | 3300059478 | Bacteria | 570 |
| 1256 | Ga0587066_073682 | 3300059490 | Bacteria | 724 |
| 1257 | Ga0587066_081599 | 3300059490 | Bacteria | 702 |
| 1258 | Ga0587070_001925 | 3300059491 | Bacteria | 2258 |
| 1259 | Ga0587070_003193 | 3300059491 | Bacteria | 1945 |
| 1260 | Ga0587070_045376 | 3300059491 | Bacteria | 857 |
| 1261 | Ga0587070_141909 | 3300059491 | Bacteria | 594 |
| 1262 | Ga0587073_0014350 | 3300059492 | Bacteria | 1408 |
| 1263 | Ga0587077_012119 | 3300059493 | Bacteria | 1371 |
| 1264 | Ga0587077_122502 | 3300059493 | Bacteria | 650 |
| 1265 | Ga0587077_144587 | 3300059493 | Bacteria | 616 |
| 1266 | Ga0587080_024381 | 3300059503 | Bacteria | 1015 |
| 1267 | Ga0587080_046836 | 3300059503 | Bacteria | 805 |
| 1268 | Ga0587080_085853 | 3300059503 | Bacteria | 653 |
| 1269 | Ga0587082_008841 | 3300059504 | Bacteria | 1416 |
| 1270 | Ga0587083_0013579 | 3300059505 | Bacteria | 1389 |
| 1271 | Ga0587083_0019354 | 3300059505 | Bacteria | 1242 |
| 1272 | Ga0587083_0028806 | 3300059505 | Bacteria | 1090 |
| 1273 | Ga0587083_0034614 | 3300059505 | Bacteria | 1026 |
| 1274 | Ga0587083_0194068 | 3300059505 | Bacteria | 576 |
| 1275 | Ga0587083_0269335 | 3300059505 | Bacteria | 514 |
| 1276 | Ga0587085_009816 | 3300059506 | Bacteria | 1256 |
| 1277 | Ga0587085_032916 | 3300059506 | Bacteria | 863 |
| 1278 | Ga0587085_060002 | 3300059506 | Bacteria | 717 |
| 1279 | Ga0587085_108120 | 3300059506 | Bacteria | 596 |
| 1280 | Ga0587085_149440 | 3300059506 | Bacteria | 537 |
| 1281 | Ga0587086_008158 | 3300059507 | Bacteria | 1218 |
| 1282 | Ga0587086_021317 | 3300059507 | Bacteria | 887 |
| 1283 | Ga0587086_033214 | 3300059507 | Bacteria | 769 |
| 1284 | Ga0587086_048555 | 3300059507 | Bacteria | 678 |
| 1285 | Ga0587088_000882 | 3300059508 | Bacteria | 2840 |
| 1286 | Ga0587088_006968 | 3300059508 | Bacteria | 1545 |
| 1287 | Ga0587088_030437 | 3300059508 | Bacteria | 961 |
| 1288 | Ga0587088_045517 | 3300059508 | Bacteria | 842 |
| 1289 | Ga0587088_167628 | 3300059508 | Bacteria | 542 |
| 1290 | Ga0587089_007933 | 3300059509 | Bacteria | 1271 |
| 1291 | Ga0587090_003231 | 3300059510 | Bacteria | 1876 |
| 1292 | Ga0587090_009257 | 3300059510 | Bacteria | 1340 |
| 1293 | Ga0587090_012737 | 3300059510 | Bacteria | 1204 |
| 1294 | Ga0587090_065885 | 3300059510 | Bacteria | 697 |
| 1295 | Ga0587090_164428 | 3300059510 | Bacteria | 511 |
| 1296 | Ga0587091_010895 | 3300059511 | Bacteria | 1404 |
| 1297 | Ga0587091_070940 | 3300059511 | Bacteria | 762 |
| 1298 | Ga0587091_219763 | 3300059511 | Bacteria | 519 |
| 1299 | Ga0587092_088939 | 3300059512 | Bacteria | 621 |
| 1300 | Ga0587094_000788 | 3300059513 | Bacteria | 2716 |
| 1301 | Ga0587094_066580 | 3300059513 | Bacteria | 641 |
| 1302 | Ga0587094_085313 | 3300059513 | Bacteria | 590 |
| 1303 | Ga0587095_014951 | 3300059514 | Bacteria | 699 |
| 1304 | Ga0587097_04718 | 3300059603 | Bacteria | 622 |
| 1305 | Ga0587098_003422 | 3300059604 | Bacteria | 1426 |
| 1306 | Ga0587098_027475 | 3300059604 | Bacteria | 764 |
| 1307 | Ga0587098_064646 | 3300059604 | Bacteria | 581 |
| 1308 | Ga0587106_004918 | 3300059605 | Bacteria | 1499 |
| 1309 | Ga0587106_022386 | 3300059605 | Bacteria | 949 |
| 1310 | Ga0587106_109047 | 3300059605 | Bacteria | 574 |
| 1311 | Ga0587099_009695 | 3300059622 | Bacteria | 950 |
| 1312 | Ga0587101_005345 | 3300059623 | Bacteria | 1421 |
| 1313 | Ga0587101_010389 | 3300059623 | Bacteria | 1168 |
| 1314 | Ga0587101_064865 | 3300059623 | Bacteria | 660 |
| 1315 | Ga0587101_092923 | 3300059623 | Bacteria | 589 |
| 1316 | Ga0587109_013974 | 3300059624 | Bacteria | 1340 |
| 1317 | Ga0587109_037677 | 3300059624 | Bacteria | 946 |
| 1318 | Ga0587109_090453 | 3300059624 | Bacteria | 690 |
| 1319 | Ga0587113_040128 | 3300059625 | Bacteria | 558 |
| 1320 | Ga0587117_012462 | 3300059627 | Bacteria | 1073 |
| 1321 | Ga0587117_068196 | 3300059627 | Bacteria | 625 |
| 1322 | Ga0587117_106426 | 3300059627 | Bacteria | 541 |
| 1323 | Ga0587122_039863 | 3300059628 | Bacteria | 581 |
| 1324 | Ga0587128_006927 | 3300059630 | Bacteria | 1414 |
| 1325 | Ga0587128_047518 | 3300059630 | Bacteria | 773 |
| 1326 | Ga0587128_068546 | 3300059630 | Bacteria | 686 |
| 1327 | Ga0587062_029227 | 3300059639 | Bacteria | 834 |
| 1328 | Ga0587062_090492 | 3300059639 | Bacteria | 582 |
| 1329 | Ga0587067_001455 | 3300059640 | Bacteria | 2566 |
| 1330 | Ga0587067_091754 | 3300059640 | Bacteria | 689 |
| 1331 | Ga0587068_009221 | 3300059641 | Bacteria | 1447 |
| 1332 | Ga0587068_019527 | 3300059641 | Bacteria | 1100 |
| 1333 | Ga0587068_025175 | 3300059641 | Bacteria | 1000 |
| 1334 | Ga0587068_080168 | 3300059641 | Bacteria | 658 |
| 1335 | Ga0587068_160640 | 3300059641 | Bacteria | 514 |
| 1336 | Ga0587069_007418 | 3300059642 | Bacteria | 1354 |
| 1337 | Ga0587069_012315 | 3300059642 | Bacteria | 1158 |
| 1338 | Ga0587069_115643 | 3300059642 | Bacteria | 563 |
| 1339 | Ga0587072_000318 | 3300059643 | Bacteria | 4543 |
| 1340 | Ga0587072_015319 | 3300059643 | Bacteria | 1301 |
| 1341 | Ga0587075_006769 | 3300059644 | Bacteria | 1418 |
| 1342 | Ga0587075_007812 | 3300059644 | Bacteria | 1352 |
| 1343 | Ga0587075_120187 | 3300059644 | Bacteria | 543 |
| 1344 | Ga0587075_129184 | 3300059644 | Bacteria | 530 |
| 1345 | Ga0587076_001018 | 3300059645 | Bacteria | 2692 |
| 1346 | Ga0587076_053980 | 3300059645 | Bacteria | 792 |
| 1347 | Ga0587076_096236 | 3300059645 | Bacteria | 655 |
| 1348 | Ga0587076_154540 | 3300059645 | Bacteria | 559 |
| 1349 | Ga0587078_004582 | 3300059646 | Bacteria | 1447 |
| 1350 | Ga0587078_005901 | 3300059646 | Bacteria | 1318 |
| 1351 | Ga0587078_025270 | 3300059646 | Bacteria | 774 |
| 1352 | Ga0587078_038185 | 3300059646 | Bacteria | 671 |
| 1353 | Ga0587079_005815 | 3300059647 | Bacteria | 1764 |
| 1354 | Ga0587079_008433 | 3300059647 | Bacteria | 1576 |
| 1355 | Ga0587079_040050 | 3300059647 | Bacteria | 942 |
| 1356 | Ga0587079_250102 | 3300059647 | Bacteria | 504 |
| 1357 | Ga0587100_015477 | 3300059648 | Bacteria | 699 |
| 1358 | Ga0587102_002623 | 3300059649 | Bacteria | 1407 |
| 1359 | Ga0587102_003037 | 3300059649 | Bacteria | 1341 |
| 1360 | Ga0587104_000990 | 3300059650 | Bacteria | 1402 |
| 1361 | Ga0587105_008812 | 3300059651 | Bacteria | 739 |
| 1362 | Ga0587105_014206 | 3300059651 | Bacteria | 642 |
| 1363 | Ga0587107_050553 | 3300059652 | Bacteria | 703 |
| 1364 | Ga0587108_004500 | 3300059653 | Bacteria | 1023 |
| 1365 | Ga0587108_007881 | 3300059653 | Bacteria | 853 |
| 1366 | Ga0587110_017285 | 3300059654 | Bacteria | 788 |
| 1367 | Ga0587118_25462 | 3300059657 | Bacteria | 505 |
| 1368 | Ga0587120_011487 | 3300059659 | Bacteria | 762 |
| 1369 | Ga0587124_001169 | 3300059660 | Bacteria | 1654 |
| 1370 | Ga0587124_024105 | 3300059660 | Bacteria | 639 |
| 1371 | Ga0587071_013457 | 3300060344 | Bacteria | 1410 |
| 1372 | Ga0587071_069557 | 3300060344 | Bacteria | 764 |
| 1373 | Ga0587071_086867 | 3300060344 | Bacteria | 705 |
| 1374 | Ga0587071_161341 | 3300060344 | Bacteria | 564 |
| 1375 | Ga0587071_222899 | 3300060344 | Bacteria | 502 |
| 1376 | Ga0587111_0005708 | 3300060346 | Bacteria | 1936 |
| 1377 | Ga0587111_0015287 | 3300060346 | Bacteria | 1401 |
| 1378 | Ga0587111_0023929 | 3300060346 | Bacteria | 1198 |
| 1379 | Ga0587111_0035749 | 3300060346 | Bacteria | 1037 |
| 1380 | Ga0587111_0108202 | 3300060346 | Bacteria | 701 |
| 1381 | Ga0587111_0129360 | 3300060346 | Bacteria | 658 |
| 1382 | Ga0587111_0222049 | 3300060346 | Bacteria | 546 |
| 1383 | Ga0501082_0403934 | 3300060353 | Bacteria | 1192 |
| 1384 | Ga0501082_0726448 | 3300060353 | Bacteria | 869 |
| 1385 | Ga0466962_0018616 | 3300061719 | Bacteria | 3340 |
| 1386 | Ga0466962_0019466 | 3300061719 | Bacteria | 3262 |
| 1387 | Ga0466962_0133377 | 3300061719 | Bacteria | 1201 |
| 1388 | Ga0466962_0174343 | 3300061719 | Bacteria | 1048 |
| 1389 | Ga0466962_0342271 | 3300061719 | Bacteria | 744 |
| 1390 | Ga0530510_0782690 | 3300061734 | Bacteria | 728 |
| 1391 | 2511250639 | 2511231003 | Bacteria | 5606035 |
| 1392 | 2511384947 | 2511231026 | Bacteria | 5225445 |
| 1393 | 2521557885 | 2521172590 | Bacteria | 5047645 |
| 1394 | 2548499938 | 2547132374 | Bacteria | 5530232 |
| 1395 | 2550693924 | 2548876994 | Bacteria | 4904866 |
| 1396 | 2553003008 | 2551306416 | Bacteria | 6152985 |
| 1397 | 2601667669 | 2600255292 | Bacteria | 6300551 |
| 1398 | 2643786927 | 2643221554 | Bacteria | 6603920 |
| 1399 | 2643802363 | 2643221556 | Bacteria | 7251154 |
| 1400 | 2643868168 | 2643221570 | Bacteria | 5103772 |
| 1401 | 2643993837 | 2643221596 | Bacteria | 5006805 |
| 1402 | 2644059731 | 2643221609 | Bacteria | 6756331 |
| 1403 | 2644074874 | 2643221611 | Bacteria | 6820941 |
| 1404 | 2644215984 | 2643221638 | Bacteria | 6579467 |
| 1405 | 2644254474 | 2643221645 | Bacteria | 7207331 |
| 1406 | 2644293775 | 2643221652 | Bacteria | 5140275 |
| 1407 | 2644357861 | 2643221664 | Bacteria | 7272945 |
| 1408 | 2644475876 | 2643221684 | Bacteria | 7145183 |
| 1409 | 2644644744 | 2643221717 | Bacteria | 5676132 |
| 1410 | 2738741281 | 2738541280 | Bacteria | 6630198 |
| 1411 | 2738829178 | 2738541297 | Bacteria | 6549566 |
| 1412 | 2738845750 | 2738541300 | Bacteria | 6675882 |
| 1413 | 2739152974 | 2738541357 | Bacteria | 6549408 |
| 1414 | 2739194894 | 2738543003 | Bacteria | 6549560 |
| 1415 | 2739241259 | 2738543012 | Bacteria | 7115078 |
| 1416 | 2739248155 | 2738543013 | Bacteria | 5618633 |
| 1417 | 2739277558 | 2738543018 | Bacteria | 6718814 |
| 1418 | 2739321370 | 2738543026 | Bacteria | 6549408 |
| 1419 | 2739340074 | 2738543029 | Bacteria | 6549249 |
| 1420 | 2739346519 | 2738543030 | Bacteria | 6719714 |
| 1421 | 2765569006 | 2765235838 | Bacteria | 5445269 |
| 1422 | 2808984486 | 2808606386 | Bacteria | 4471946 |
| 1423 | 2809131213 | 2808606415 | Bacteria | 4576710 |
| 1424 | 2809145415 | 2808606418 | Bacteria | 6724496 |
| 1425 | 2809150452 | 2808606419 | Bacteria | 4576925 |
| 1426 | 2816473425 | 2816332133 | Bacteria | 7249298 |
| 1427 | 2819542546 | 2818991436 | Bacteria | 5376622 |
| 1428 | 2819591174 | 2818991445 | Bacteria | 4955017 |
| 1429 | 2819614974 | 2818991449 | Bacteria | 5518009 |
| 1430 | 2839096109 | 2839094727 | Bacteria | 5534556 |
| 1431 | 2842717744 | 2842711865 | Bacteria | 7155354 |
| 1432 | 2842721370 | 2842718218 | Bacteria | 4560148 |
| 1433 | 2842734294 | 2842733646 | Bacteria | 5716726 |
| 1434 | 2842749455 | 2842747753 | Bacteria | 5578255 |
| 1435 | 2852621968 | 2852618963 | Bacteria | 4577824 |
| 1436 | 2857550304 | 2857547612 | Bacteria | 6179999 |
| 1437 | 2857554476 | 2857553236 | Bacteria | 6166726 |
| 1438 | 2857559445 | 2857558681 | Bacteria | 6617694 |
| 1439 | 2857564717 | 2857564685 | Bacteria | 6290584 |
| 1440 | 2881105478 | 2881101125 | Bacteria | 4590519 |
| 1441 | 2884812292 | 2884811622 | Bacteria | 5552861 |
| 1442 | 2884836899 | 2884836552 | Bacteria | 5219991 |
| 1443 | 2884853190 | 2884852848 | Bacteria | 5221161 |
| 1444 | 2885085396 | 2885080285 | Bacteria | 6355622 |
| 1445 | 2885197881 | 2885192300 | Bacteria | 5882526 |
| 1446 | 2894026947 | 2894023352 | Bacteria | 5167372 |
| 1447 | 2896155692 | 2896154374 | Bacteria | 5221518 |
| 1448 | 2904425976 | 2904424332 | Bacteria | 7633521 |
| 1449 | 2904441349 | 2904439833 | Bacteria | 5931679 |
| 1450 | 2904531711 | 2904530477 | Bacteria | 5876334 |
| 1451 | 2904544513 | 2904541872 | Bacteria | 8915136 |
| 1452 | 2904588064 | 2904584206 | Bacteria | 6028872 |
| 1453 | 2904589776 | 2904589729 | Bacteria | 6113573 |
| 1454 | 2904602838 | 2904601388 | Bacteria | 5884906 |
| 1455 | 2919046347 | 2919046199 | Bacteria | 5567169 |
| 1456 | 2919079658 | 2919079590 | Bacteria | 5946433 |
| 1457 | 2919478420 | 2919476304 | Bacteria | 5888696 |
| 1458 | 2919707237 | 2919704043 | Bacteria | 5560311 |
| 1459 | 2923511117 | 2923510766 | Bacteria | 5926163 |
| 1460 | 2928115670 | 2928115317 | Bacteria | 6477646 |
| 1461 | 2928131053 | 2928130867 | Bacteria | 5467269 |
| 1462 | 2929161917 | 2929160207 | Bacteria | 9075316 |
| 1463 | 2932411274 | 2932410948 | Bacteria | 6312192 |
| 1464 | 2932419159 | 2932416698 | Bacteria | 6315112 |
| 1465 | 2932423744 | 2932422444 | Bacteria | 4678430 |
| 1466 | 2939632643 | 2939631187 | Bacteria | 6118131 |
| 1467 | 2990713472 | 2990710928 | Bacteria | 5002431 |
| 1468 | 8047673774 | 8047673197 | Bacteria | 7395230 |
| 1469 | Ga0068859_100874285 | |||
| 1470 | JGI24740J21852_10000462 | |||
| 1471 | JGI24740J21852_10000722 | |||
| 1472 | JGI24740J21852_10001385 | |||
| 1473 | JGI24740J21852_10020567 | |||
| 1474 | JGI24740J21852_10124610 | |||
| 1475 | JGI24739J22299_10017122 | |||
| 1476 | JGI24739J22299_10055368 | |||
| 1477 | JGI24739J22299_10151185 | |||
| 1478 | JGI24737J22298_10028137 | |||
| 1479 | JGI24737J22298_10032661 | |||
| 1480 | JGI24737J22298_10044667 | |||
| 1481 | JGI24735J21928_10000381 | |||
| 1482 | JGI24735J21928_10002924 | |||
| 1483 | JGI24735J21928_10012808 | |||
| 1484 | JGI24738J21930_10002568 | |||
| 1485 | JGI24738J21930_10060147 | |||
| 1486 | JGI25156J39149_1007106 | |||
| 1487 | JGI25156J39149_1011215 | |||
| 1488 | JGI25156J39149_1014217 | |||
| 1489 | JGI25156J39149_1019256 | |||
| 1490 | JGI25154J39366_1000446 | |||
| 1491 | JGI25157J39369_1017322 | |||
| 1492 | JGI25157J39369_1024694 | |||
| 1493 | JGI25164J39214_1010585 | |||
| 1494 | Ga0006765J45826_106676 | |||
| 1495 | Ga0006778J45830_1030621 | |||
| 1496 | Ga0006759J45824_1026941 | |||
| 1497 | Ga0006759J45824_1033546 | |||
| 1498 | Ga0006759J45824_1058067 | |||
| 1499 | Ga0006759J45824_1063513 | |||
| 1500 | Ga0006759J45824_1065469 | |||
| 1501 | JGI25165J46597_1002385 | |||
| 1502 | Ga0006758J48902_1015910 | |||
| 1503 | Ga0006758J48902_1018924 | |||
| 1504 | Ga0006770J48903_1010498 | |||
| 1505 | Ga0006770J48903_1025987 | |||
| 1506 | Ga0006777J48905_1019728 | |||
| 1507 | rootH2_10009142 | |||
| 1508 | rootH2_10030882 | |||
| 1509 | rootL2_10004981 | |||
| 1510 | rootL2_10014064 | |||
| 1511 | JGI25160J50197_1067253 | |||
| 1512 | Ga0006556J51387_1019267 | |||
| 1513 | Ga0006556J51387_1025420 | |||
| 1514 | Ga0007417J51691_1002769 | |||
| 1515 | Ga0007417J51691_1029679 | |||
| 1516 | Ga0006560J51390_1014813 | |||
| 1517 | Ga0006560J51390_1028592 | |||
| 1518 | Ga0006554J51385_1021491 | |||
| 1519 | Ga0006554J51385_1029024 | |||
| 1520 | Ga0007410J51695_1002724 | |||
| 1521 | Ga0007409J51694_1016976 | |||
| 1522 | Ga0007416J51690_1016876 | |||
| 1523 | Ga0007416J51690_1030315 | |||
| 1524 | Ga0006562J51391_1028115 | |||
| 1525 | Ga0007429J51699_1022603 | |||
| 1526 | Ga0007415J51800_106685 | |||
| 1527 | Ga0006780_1025422 | |||
| 1528 | Ga0055539_1000034 | |||
| 1529 | Ga0055533_1006004 | |||
| 1530 | Ga0055533_1007436 | |||
| 1531 | Ga0055533_1008546 | |||
| 1532 | Ga0055533_1015348 | |||
| 1533 | Ga0055532_1000002 | |||
| 1534 | Ga0055532_1000039 | |||
| 1535 | Ga0055532_1011346 | |||
| 1536 | Ga0055525_1000538 | |||
| 1537 | Ga0055527_1000024 | |||
| 1538 | Ga0055527_1001254 | |||
| 1539 | Ga0055535_1000028 | |||
| 1540 | Ga0055535_1031885 | |||
| 1541 | Ga0055542_1000047 | |||
| 1542 | Ga0055542_1003250 | |||
| 1543 | Ga0055529_1000028 | |||
| 1544 | Ga0055529_1000054 | |||
| 1545 | Ga0055529_1000146 | |||
| 1546 | Ga0055524_1001224 | |||
| 1547 | Ga0055524_1002725 | |||
| 1548 | Ga0055528_1002393 | |||
| 1549 | Ga0055530_10050039 | |||
| 1550 | Ga0055540_1020093 | |||
| 1551 | Ga0055531_10001660 | |||
| 1552 | Ga0055531_10001947 | |||
| 1553 | Ga0055531_10005441 | |||
| 1554 | Ga0055541_1000217 | |||
| 1555 | Ga0055541_1000861 | |||
| 1556 | Ga0055541_1018901 | |||
| 1557 | Ga0058692_1006669 | |||
| 1558 | Ga0058692_1049135 | |||
| 1559 | Ga0058692_1068129 | |||
| 1560 | Ga0065714_10046912 | |||
| 1561 | Ga0065714_10084786 | |||
| 1562 | Ga0065714_10224958 | |||
| 1563 | Ga0065714_10261913 | |||
| 1564 | Ga0065704_10348879 | |||
| 1565 | Ga0065704_10520996 | |||
| 1566 | Ga0065715_10040010 | |||
| 1567 | Ga0065715_10110556 | |||
| 1568 | Ga0070658_10177134 | |||
| 1569 | Ga0070658_10389801 | |||
| 1570 | Ga0070658_10753222 | |||
| 1571 | Ga0070683_101927808 | |||
| 1572 | Ga0070666_11279761 | |||
| 1573 | Ga0070680_100791418 | |||
| 1574 | Ga0070682_100987440 | |||
| 1575 | Ga0070660_100000010 | |||
| 1576 | Ga0070660_100277925 | |||
| 1577 | Ga0070661_100000013 | |||
| 1578 | Ga0070661_100093227 | |||
| 1579 | Ga0070692_10499228 | |||
| 1580 | Ga0070671_101298003 | |||
| 1581 | Ga0070673_100951645 | |||
| 1582 | Ga0070659_100000167 | |||
| 1583 | Ga0070659_100004951 | |||
| 1584 | Ga0070667_102343612 | |||
| 1585 | Ga0070709_11745908 | |||
| 1586 | Ga0070714_101981311 | |||
| 1587 | Ga0070700_100022541 | |||
| 1588 | Ga0070694_100115522 | |||
| 1589 | Ga0070663_100000006 | |||
| 1590 | Ga0070663_100000789 | |||
| 1591 | Ga0070663_100209120 | |||
| 1592 | Ga0070663_100220504 | |||
| 1593 | Ga0070678_100250848 | |||
| 1594 | Ga0068867_100011280 | |||
| 1595 | Ga0070698_100022508 | |||
| 1596 | Ga0070684_100112388 | |||
| 1597 | Ga0070665_100152074 | |||
| 1598 | Ga0068855_100200821 | |||
| 1599 | Ga0068855_100647388 | |||
| 1600 | Ga0070664_100000002 | |||
| 1601 | Ga0070664_100289682 | |||
| 1602 | Ga0070664_100694083 | |||
| 1603 | Ga0068857_100091892 | |||
| 1604 | Ga0068854_100000004 | |||
| 1605 | Ga0068856_100000294 | |||
| 1606 | Ga0068856_100347853 | |||
| 1607 | Ga0068856_101857231 | |||
| 1608 | Ga0068852_100017069 | |||
| 1609 | Ga0068852_100450436 | |||
| 1610 | Ga0068852_101568641 | |||
| 1611 | Ga0068852_102763728 | |||
| 1612 | Ga0068859_101526719 | |||
| 1613 | Ga0068859_101745050 | |||
| 1614 | Ga0068851_10139601 | |||
| 1615 | Ga0068863_101657777 | |||
| 1616 | Ga0068858_100069756 | |||
| 1617 | Ga0070717_10256184 | |||
| 1618 | Ga0075365_10253105 | |||
| 1619 | Ga0075362_10061866 | |||
| 1620 | Ga0075362_10092280 | |||
| 1621 | Ga0075367_10596582 | |||
| 1622 | Ga0075366_10000297 | |||
| 1623 | Ga0075366_10004967 | |||
| 1624 | Ga0075366_10153481 | |||
| 1625 | Ga0075366_10353437 | |||
| 1626 | Ga0075370_10004264 | |||
| 1627 | Ga0075370_10061586 | |||
| 1628 | Ga0075370_10073600 | |||
| 1629 | Ga0075370_10509261 | |||
| 1630 | Ga0075428_100001491 | |||
| 1631 | Ga0075430_100351694 | |||
| 1632 | Ga0075429_100019402 | |||
| 1633 | Ga0097620_100874141 | |||
| 1634 | Ga0097620_101526693 | |||
| 1635 | Ga0097620_101745101 | |||
| 1636 | Ga0099823_1000021 | |||
| 1637 | Ga0079104_1004712 | |||
| 1638 | Ga0105251_10000285 | |||
| 1639 | Ga0105251_10011588 | |||
| 1640 | Ga0105244_10002843 | |||
| 1641 | Ga0105244_10077568 | |||
| 1642 | Ga0105250_10023278 | |||
| 1643 | Ga0105240_10039709 | |||
| 1644 | Ga0105240_10044017 | |||
| 1645 | Ga0105240_10196897 | |||
| 1646 | Ga0105240_10285562 | |||
| 1647 | Ga0105240_10659582 | |||
| 1648 | Ga0105240_12582466 | |||
| 1649 | Ga0105245_12487278 | |||
| 1650 | Ga0105247_11032429 | |||
| 1651 | Ga0105247_11474049 | |||
| 1652 | Ga0114129_10469325 | |||
| 1653 | Ga0105243_10394151 | |||
| 1654 | Ga0105241_10242416 | |||
| 1655 | Ga0105241_10587920 | |||
| 1656 | Ga0105241_12254420 | |||
| 1657 | Ga0105242_11453379 | |||
| 1658 | Ga0105237_10076033 | |||
| 1659 | Ga0105237_10578021 | |||
| 1660 | Ga0105238_10003306 | |||
| 1661 | Ga0105238_10141523 | |||
| 1662 | Ga0105238_11015730 | |||
| 1663 | Ga0105238_11444304 | |||
| 1664 | Ga0105239_10005044 | |||
| 1665 | Ga0105239_10450556 | |||
| 1666 | Ga0105239_11392114 | |||
| 1667 | Ga0105246_10058772 | |||
| 1668 | Ga0105246_10721267 | |||
| 1669 | Ga0157317_1006171 | |||
| 1670 | Ga0157319_1000027 | |||
| 1671 | Ga0157373_10020184 | |||
| 1672 | Ga0157371_10000123 | |||
| 1673 | Ga0157371_10076165 | |||
| 1674 | Ga0157371_10096288 | |||
| 1675 | Ga0157371_11136901 | |||
| 1676 | Ga0157370_10428933 | |||
| 1677 | Ga0157370_10792782 | |||
| 1678 | Ga0157370_10798975 | |||
| 1679 | Ga0157369_10000799 | |||
| 1680 | Ga0157369_10013524 | |||
| 1681 | Ga0157369_10375809 | |||
| 1682 | Ga0157374_10047490 | |||
| 1683 | Ga0157372_10001159 | |||
| 1684 | Ga0157375_11410527 | |||
| 1685 | Ga0157380_11716885 | |||
| 1686 | Ga0182008_10077541 | |||
| 1687 | Ga0182008_10135930 | |||
| 1688 | Ga0182008_10549202 | |||
| 1689 | Ga0157379_11363739 | |||
| 1690 | Ga0157379_12428713 | |||
| 1691 | Ga0157376_10222879 | |||
| 1692 | Ga0182006_1000017 | |||
| 1693 | Ga0182006_1015580 | |||
| 1694 | Ga0182007_10002423 | |||
| 1695 | Ga0182007_10009675 | |||
| 1696 | Ga0182005_1000007 | |||
| 1697 | Ga0182005_1044771 | |||
| 1698 | Ga0163161_10021537 | |||
| 1699 | Ga0163161_11574876 | |||
| 1700 | Ga0184593_104580 | |||
| 1701 | Ga0197907_11246003 | |||
| 1702 | Ga0206356_10127094 | |||
| 1703 | Ga0206356_11033933 | |||
| 1704 | Ga0206356_11308868 | |||
| 1705 | Ga0206349_1150076 | |||
| 1706 | Ga0206355_1206374 | |||
| 1707 | Ga0206355_1326248 | |||
| 1708 | Ga0206351_10084287 | |||
| 1709 | Ga0206351_10167421 | |||
| 1710 | Ga0206351_10400801 | |||
| 1711 | Ga0206352_10143491 | |||
| 1712 | Ga0206352_11149020 | |||
| 1713 | Ga0206350_10476662 | |||
| 1714 | Ga0206350_10897671 | |||
| 1715 | Ga0206350_11588402 | |||
| 1716 | Ga0206354_10009750 | |||
| 1717 | Ga0206354_11478331 | |||
| 1718 | Ga0154015_1099906 | |||
| 1719 | Ga0213872_10001047 | |||
| 1720 | Ga0213872_10002408 | |||
| 1721 | Ga0213872_10005517 | |||
| 1722 | Ga0213872_10128455 | |||
| 1723 | Ga0213872_10454875 | |||
| 1724 | Ga0224712_10046990 | |||
| 1725 | Ga0247551_104997 | |||
| 1726 | Ga0247516_119814 | |||
| 1727 | Ga0209435_103104 | |||
| 1728 | Ga0209435_104748 | |||
| 1729 | Ga0209784_100003 | |||
| 1730 | Ga0209784_100293 | |||
| 1731 | Ga0209784_100803 | |||
| 1732 | Ga0209566_100002 | |||
| 1733 | Ga0209566_100370 | |||
| 1734 | Ga0209566_100896 | |||
| 1735 | Ga0209566_101272 | |||
| 1736 | Ga0209674_100008 | |||
| 1737 | Ga0209674_100013 | |||
| 1738 | Ga0209674_100122 | |||
| 1739 | Ga0209674_100424 | |||
| 1740 | Ga0209674_101948 | |||
| 1741 | Ga0209672_100010 | |||
| 1742 | Ga0209672_100019 | |||
| 1743 | Ga0209672_100051 | |||
| 1744 | Ga0209672_100213 | |||
| 1745 | Ga0209147_100002 | |||
| 1746 | Ga0209147_100006 | |||
| 1747 | Ga0209147_100026 | |||
| 1748 | Ga0209147_101660 | |||
| 1749 | Ga0209563_100004 | |||
| 1750 | Ga0209563_100857 | |||
| 1751 | Ga0209563_104817 | |||
| 1752 | Ga0207427_103586 | |||
| 1753 | Ga0209437_109386 | |||
| 1754 | Ga0209437_113794 | |||
| 1755 | Ga0209258_100002 | |||
| 1756 | Ga0209258_100010 | |||
| 1757 | Ga0209258_100031 | |||
| 1758 | Ga0209258_100253 | |||
| 1759 | Ga0209258_103902 | |||
| 1760 | Ga0209646_1000022 | |||
| 1761 | Ga0209646_1000174 | |||
| 1762 | Ga0209646_1020439 | |||
| 1763 | Ga0209646_1025196 | |||
| 1764 | Ga0209026_1002115 | |||
| 1765 | Ga0209026_1045405 | |||
| 1766 | Ga0209677_100009 | |||
| 1767 | Ga0209677_111617 | |||
| 1768 | Ga0209148_1000018 | |||
| 1769 | Ga0209148_1000021 | |||
| 1770 | Ga0209148_1000027 | |||
| 1771 | Ga0209759_1000327 | |||
| 1772 | Ga0209759_1000804 | |||
| 1773 | Ga0209759_1001294 | |||
| 1774 | Ga0209759_1001771 | |||
| 1775 | Ga0209759_1002181 | |||
| 1776 | Ga0209759_1007195 | |||
| 1777 | Ga0209759_1026741 | |||
| 1778 | Ga0209233_1000135 | |||
| 1779 | Ga0209565_1023806 | |||
| 1780 | Ga0209565_1058772 | |||
| 1781 | Ga0209455_1000015 | |||
| 1782 | Ga0209455_1000021 | |||
| 1783 | Ga0209455_1000037 | |||
| 1784 | Ga0209455_1000213 | |||
| 1785 | Ga0209673_1000201 | |||
| 1786 | Ga0209673_1006977 | |||
| 1787 | Ga0209673_1007222 | |||
| 1788 | Ga0209673_1033078 | |||
| 1789 | Ga0209130_1066354 | |||
| 1790 | Ga0209675_1037692 | |||
| 1791 | Ga0209676_1004133 | |||
| 1792 | Ga0209676_1093711 | |||
| 1793 | Ga0209025_1000003 | |||
| 1794 | Ga0209564_1000009 | |||
| 1795 | Ga0209564_1000068 | |||
| 1796 | Ga0209564_1002800 | |||
| 1797 | Ga0209050_1003281 | |||
| 1798 | Ga0209050_1003824 | |||
| 1799 | Ga0209256_1000424 | |||
| 1800 | Ga0209256_1002394 | |||
| 1801 | Ga0207426_1003279 | |||
| 1802 | Ga0209051_1000244 | |||
| 1803 | Ga0209051_1000469 | |||
| 1804 | Ga0209051_1139745 | |||
| 1805 | Ga0209257_1000144 | |||
| 1806 | Ga0209257_1000946 | |||
| 1807 | Ga0209257_1002583 | |||
| 1808 | Ga0207656_10508006 | |||
| 1809 | Ga0207696_1029949 | |||
| 1810 | Ga0207655_1008662 | |||
| 1811 | Ga0207655_1076323 | |||
| 1812 | Ga0207655_1078846 | |||
| 1813 | Ga0207713_1001188 | |||
| 1814 | Ga0207713_1003181 | |||
| 1815 | Ga0207642_10392418 | |||
| 1816 | Ga0207710_10547682 | |||
| 1817 | Ga0207647_10000835 | |||
| 1818 | Ga0207647_10018639 | |||
| 1819 | Ga0207647_10072504 | |||
| 1820 | Ga0207699_11371450 | |||
| 1821 | Ga0207645_11127937 | |||
| 1822 | Ga0207705_10114607 | |||
| 1823 | Ga0207705_10189679 | |||
| 1824 | Ga0207654_10363279 | |||
| 1825 | Ga0207695_10006070 | |||
| 1826 | Ga0207695_10029964 | |||
| 1827 | Ga0207695_10079796 | |||
| 1828 | Ga0207695_10199467 | |||
| 1829 | Ga0207671_10020134 | |||
| 1830 | Ga0207671_10063258 | |||
| 1831 | Ga0207660_11098842 | |||
| 1832 | Ga0207657_10000001 | |||
| 1833 | Ga0207657_10077952 | |||
| 1834 | Ga0207657_11400713 | |||
| 1835 | Ga0207649_10000019 | |||
| 1836 | Ga0207649_10241282 | |||
| 1837 | Ga0207681_10018919 | |||
| 1838 | Ga0207694_10010183 | |||
| 1839 | Ga0207694_10066616 | |||
| 1840 | Ga0207694_10598207 | |||
| 1841 | Ga0207694_10615137 | |||
| 1842 | Ga0207694_11605520 | |||
| 1843 | Ga0207650_10917360 | |||
| 1844 | Ga0207644_11039168 | |||
| 1845 | Ga0207690_10000006 | |||
| 1846 | Ga0207690_10004157 | |||
| 1847 | Ga0207686_11762972 | |||
| 1848 | Ga0207709_10326946 | |||
| 1849 | Ga0207709_11064110 | |||
| 1850 | Ga0207669_11756621 | |||
| 1851 | Ga0207679_10000001 | |||
| 1852 | Ga0207679_10881743 | |||
| 1853 | Ga0207679_11188239 | |||
| 1854 | Ga0207667_10023086 | |||
| 1855 | Ga0207667_10520474 | |||
| 1856 | Ga0207640_10000240 | |||
| 1857 | Ga0207640_11151542 | |||
| 1858 | Ga0207703_10044817 | |||
| 1859 | Ga0207678_10000001 | |||
| 1860 | Ga0207678_10000167 | |||
| 1861 | Ga0207678_10138210 | |||
| 1862 | Ga0207708_10226667 | |||
| 1863 | Ga0207702_10000009 | |||
| 1864 | Ga0207702_10401565 | |||
| 1865 | Ga0207641_11619979 | |||
| 1866 | Ga0207648_10145745 | |||
| 1867 | Ga0207648_10356667 | |||
| 1868 | Ga0207674_10017905 | |||
| 1869 | Ga0207674_10163724 | |||
| 1870 | Ga0207683_10204392 | |||
| 1871 | Ga0207698_10020074 | |||
| 1872 | Ga0207698_10261005 | |||
| 1873 | Ga0207698_11228918 | |||
| 1874 | Ga0209281_1005251 | |||
| 1875 | Ga0209973_1003908 | |||
| 1876 | Ga0209389_1000341 | |||
| 1877 | Ga0209371_1000297 | |||
| 1878 | Ga0209371_1009283 | |||
| 1879 | Ga0209998_10123810 | |||
| 1880 | Ga0209974_10000696 | |||
| 1881 | Ga0209974_10001341 | |||
| 1882 | Ga0209974_10464471 | |||
| 1883 | Ga0207428_10001343 | |||
| 1884 | Ga0307515_10000084 | |||
| 1885 | Ga0307515_10094677 | |||
| 1886 | Ga0307515_10235483 | |||
| 1887 | Ga0265338_10856238 | |||
| 1888 | Ga0311001_1028972 | |||
| 1889 | Ga0268256_1000261 | |||
| 1890 | Ga0268256_1009819 | |||
| 1891 | Ga0268256_1038334 | |||
| 1892 | Ga0307512_10064260 | |||
| 1893 | Ga0316177_1201187 | |||
| 1894 | Ga0314311_1115675 | |||
| 1895 | Ga0314311_1176908 | |||
| 1896 | Ga0316179_1009805 | |||
| 1897 | Ga0316179_1031030 | |||
| 1898 | Ga0316183_1114423 | |||
| 1899 | Ga0316181_1150926 | |||
| 1900 | Ga0316181_1220920 | |||
| 1901 | Ga0316182_1362949 | |||
| 1902 | Ga0265767_101143 | |||
| 1903 | Ga0265766_1002226 | |||
| 1904 | Ga0265766_1016835 | |||
| 1905 | Ga0265766_1021884 | |||
| 1906 | Ga0265764_114734 | |||
| 1907 | Ga0265769_101647 | |||
| 1908 | Ga0265761_106943 | |||
| 1909 | Ga0247549_103512 | |||
| 1910 | Ga0265773_1027860 | |||
| 1911 | Ga0265332_10009574 | |||
| 1912 | Ga0265328_10185176 | |||
| 1913 | Ga0265329_10203737 | |||
| 1914 | Ga0265327_10001175 | |||
| 1915 | Ga0265316_10001277 | |||
| 1916 | Ga0307513_10011348 | |||
| 1917 | Ga0307408_100000663 | |||
| 1918 | Ga0307408_100002158 | |||
| 1919 | Ga0307408_100134587 | |||
| 1920 | Ga0307408_101055504 | |||
| 1921 | Ga0307514_10000319 | |||
| 1922 | Ga0316575_10002655 | |||
| 1923 | Ga0316575_10119739 | |||
| 1924 | Ga0316575_10138864 | |||
| 1925 | Ga0316575_10232613 | |||
| 1926 | Ga0310111_120975 | |||
| 1927 | Ga0316579_10000223 | |||
| 1928 | Ga0316579_10003497 | |||
| 1929 | Ga0316579_10014597 | |||
| 1930 | Ga0316579_10241042 | |||
| 1931 | Ga0316579_10297992 | |||
| 1932 | Ga0265314_10467514 | |||
| 1933 | Ga0316576_10013047 | |||
| 1934 | Ga0316576_10023215 | |||
| 1935 | Ga0316576_10216585 | |||
| 1936 | Ga0316576_10293236 | |||
| 1937 | Ga0316576_11014721 | |||
| 1938 | Ga0316578_10008120 | |||
| 1939 | Ga0316578_10020537 | |||
| 1940 | Ga0316578_10074386 | |||
| 1941 | Ga0316578_10190161 | |||
| 1942 | Ga0316578_10311552 | |||
| 1943 | Ga0316578_10430988 | |||
| 1944 | Ga0316578_10437514 | |||
| 1945 | Ga0316578_10929235 | |||
| 1946 | Ga0307405_10113333 | |||
| 1947 | Ga0307405_11251356 | |||
| 1948 | Ga0316577_10038905 | |||
| 1949 | Ga0316577_10080598 | |||
| 1950 | Ga0316577_10094394 | |||
| 1951 | Ga0316577_10195069 | |||
| 1952 | Ga0316577_10198272 | |||
| 1953 | Ga0316577_10267531 | |||
| 1954 | Ga0247548_105409 | |||
| 1955 | Ga0307406_10001789 | |||
| 1956 | Ga0307406_10391076 | |||
| 1957 | Ga0307412_10000008 | |||
| 1958 | Ga0307412_10000845 | |||
| 1959 | Ga0307412_10324403 | |||
| 1960 | Ga0307412_10583511 | |||
| 1961 | Ga0307412_12026738 | |||
| 1962 | Ga0307409_100059348 | |||
| 1963 | Ga0307416_100381760 | |||
| 1964 | Ga0307414_11636843 | |||
| 1965 | Ga0307411_10103964 | |||
| 1966 | Ga0316583_10007592 | |||
| 1967 | Ga0316583_10015794 | |||
| 1968 | Ga0316583_10062211 | |||
| 1969 | Ga0316583_10141379 | |||
| 1970 | Ga0316583_10359814 | |||
| 1971 | Ga0316585_10001492 | |||
| 1972 | Ga0316585_10002042 | |||
| 1973 | Ga0316580_10002575 | |||
| 1974 | Ga0316580_10010682 | |||
| 1975 | Ga0316580_10115613 | |||
| 1976 | Ga0316593_10000184 | |||
| 1977 | Ga0316593_10000461 | |||
| 1978 | Ga0316593_10000850 | |||
| 1979 | Ga0316593_10000905 | |||
| 1980 | Ga0316593_10005627 | |||
| 1981 | Ga0316593_10011079 | |||
| 1982 | Ga0316593_10015927 | |||
| 1983 | Ga0316593_10016257 | |||
| 1984 | Ga0316593_10018048 | |||
| 1985 | Ga0316593_10023063 | |||
| 1986 | Ga0316593_10040179 | |||
| 1987 | Ga0316593_10074069 | |||
| 1988 | Ga0316593_10074693 | |||
| 1989 | Ga0316593_10085717 | |||
| 1990 | Ga0316593_10124271 | |||
| 1991 | Ga0316593_10124809 | |||
| 1992 | Ga0316593_10161438 | |||
| 1993 | Ga0316593_10182502 | |||
| 1994 | Ga0316593_10242096 | |||
| 1995 | Ga0316593_10246253 | |||
| 1996 | Ga0316593_10281050 | |||
| 1997 | Ga0316593_10337121 | |||
| 1998 | Ga0316592_1000418 | |||
| 1999 | Ga0316592_1000834 | |||
| 2000 | Ga0316592_1001455 | |||
| 2001 | Ga0316592_1002172 | |||
| 2002 | Ga0316592_1005091 | |||
| 2003 | Ga0316592_1007741 | |||
| 2004 | Ga0316592_1008452 | |||
| 2005 | Ga0316592_1015251 | |||
| 2006 | Ga0316592_1027020 | |||
| 2007 | Ga0316592_1056001 | |||
| 2008 | Ga0316592_1057814 | |||
| 2009 | Ga0316592_1075825 | |||
| 2010 | Ga0316586_1002586 | |||
| 2011 | Ga0316586_1004157 | |||
| 2012 | Ga0316586_1048671 | |||
| 2013 | Ga0316586_1103135 | |||
| 2014 | Ga0316588_1000358 | |||
| 2015 | Ga0316588_1000978 | |||
| 2016 | Ga0316588_1003991 | |||
| 2017 | Ga0316588_1021263 | |||
| 2018 | Ga0316588_1042135 | |||
| 2019 | Ga0316588_1052481 | |||
| 2020 | Ga0316588_1059017 | |||
| 2021 | Ga0316588_1077066 | |||
| 2022 | Ga0316588_1090112 | |||
| 2023 | Ga0316587_1000327 | |||
| 2024 | Ga0316587_1001516 | |||
| 2025 | Ga0316587_1002276 | |||
| 2026 | Ga0316587_1009238 | |||
| 2027 | Ga0316587_1010565 | |||
| 2028 | Ga0316587_1029286 | |||
| 2029 | Ga0316587_1036032 | |||
| 2030 | Ga0316587_1036410 | |||
| 2031 | Ga0316587_1097520 | |||
| 2032 | Ga0316596_1000420 | |||
| 2033 | Ga0316596_1001044 | |||
| 2034 | Ga0316596_1004668 | |||
| 2035 | Ga0316596_1009739 | |||
| 2036 | Ga0316596_1019773 | |||
| 2037 | Ga0316596_1027444 | |||
| 2038 | Ga0316596_1036210 | |||
| 2039 | Ga0316596_1047590 | |||
| 2040 | Ga0316596_1072695 | |||
| 2041 | Ga0316596_1089874 | |||
| 2042 | Ga0316596_1098142 | |||
| 2043 | Ga0316596_1113804 | |||
| 2044 | Ga0316596_1176816 | |||
| 2045 | Ga0316596_1231771 | |||
| 2046 | Ga0373928_0104388 | |||
| 2047 | Ga0316574_0000770 | |||
| 2048 | Ga0316574_0305564 | |||
| 2049 | Ga0316574_0361910 | |||
| 2050 | Ga0316574_0497394 | |||
| 2051 | Ga0316574_0569701 | |||
| 2052 | Ga0316574_0704972 | |||
| 2053 | Ga0373924_0015722 | |||
| 2054 | Ga0373931_0010733 | |||
| 2055 | Ga0373931_0617817 | |||
| 2056 | Ga0310109_014588 | |||
| 2057 | Ga0316582_0001537 | |||
| 2058 | Ga0316582_0032685 | |||
| 2059 | Ga0316582_0047897 | |||
| 2060 | Ga0316582_0105863 | |||
| 2061 | Ga0316582_0225009 | |||
| 2062 | Ga0316582_0325154 | |||
| 2063 | Ga0316582_0554367 | |||
| 2064 | Ga0316582_0901898 | |||
| 2065 | Ga0316584_0014853 | |||
| 2066 | Ga0316584_0151535 | |||
| 2067 | Ga0316584_0198220 | |||
| 2068 | Ga0316584_0210336 | |||
| 2069 | Ga0316584_0314431 | |||
| 2070 | Ga0316584_0381218 | |||
| 2071 | Ga0395899_0000041 | |||
| 2072 | Ga0395899_0031186 | |||
| 2073 | Ga0395899_0086705 | |||
| 2074 | Ga0395900_0000797 | |||
| 2075 | Ga0395900_0001690 | |||
| 2076 | Ga0395900_0009723 | |||
| 2077 | Ga0395900_0198721 | |||
| 2078 | Ga0395900_0346672 | |||
| 2079 | Ga0395898_0000220 | |||
| 2080 | Ga0395898_0040162 | |||
| 2081 | Ga0395898_0367817 | |||
| 2082 | Ga0395898_0623605 | |||
| 2083 | Ga0395905_0021181 | |||
| 2084 | Ga0395905_0088384 | |||
| 2085 | Ga0395905_0563467 | |||
| 2086 | Ga0316581_0001281 | |||
| 2087 | Ga0316581_0184420 | |||
| 2088 | Ga0395901_0000011 | |||
| 2089 | Ga0395901_0000106 | |||
| 2090 | Ga0395901_0044283 | |||
| 2091 | Ga0395901_0200791 | |||
| 2092 | Ga0400490_46138 | |||
| 2093 | Ga0400490_48203 | |||
| 2094 | Ga0400490_60606 | |||
| 2095 | Ga0400488_57509 | |||
| 2096 | Ga0400483_047628 | |||
| 2097 | Ga0400483_179240 | |||
| 2098 | Ga0400487_50157 | |||
| 2099 | Ga0436365_0005079 | |||
| 2100 | Ga0436360_0518562 | |||
| 2101 | Ga0436361_0085296 | |||
| 2102 | Ga0436361_0119299 | |||
| 2103 | Ga0436361_0209693 | |||
| 2104 | Ga0436361_0260589 | |||
| 2105 | Ga0436361_0360842 | |||
| 2106 | Ga0436361_0399282 | |||
| 2107 | Ga0436361_0416774 | |||
| 2108 | Ga0436361_0508128 | |||
| 2109 | Ga0451793_1402114 | |||
| 2110 | Ga0451799_22873 | |||
| 2111 | Ga0451805_049160 | |||
| 2112 | Ga0451839_0220486 | |||
| 2113 | Ga0451853_3370414 | |||
| 2114 | Ga0439445_0047401 | |||
| 2115 | Ga0439445_0207706 | |||
| 2116 | Ga0439432_224662 | |||
| 2117 | Ga0439454_005931 | |||
| 2118 | Ga0450911_000530 | |||
| 2119 | Ga0450911_024880 | |||
| 2120 | Ga0450923_059872 | |||
| 2121 | Ga0450890_004781 | |||
| 2122 | Ga0439446_0072906 | |||
| 2123 | Ga0439446_0280482 | |||
| 2124 | Ga0439458_0240244 | |||
| 2125 | Ga0439459_0000026 | |||
| 2126 | Ga0450901_044632 | |||
| 2127 | Ga0466986_0208548 | |||
| 2128 | Ga0466969_0000212 | |||
| 2129 | Ga0466969_0003756 | |||
| 2130 | Ga0466969_0009461 | |||
| 2131 | Ga0466969_0126684 | |||
| 2132 | Ga0466972_0004661 | |||
| 2133 | Ga0466972_0012555 | |||
| 2134 | Ga0466972_0041828 | |||
| 2135 | Ga0466972_0055688 | |||
| 2136 | Ga0466972_0147739 | |||
| 2137 | Ga0466972_0441782 | |||
| 2138 | Ga0466973_0008590 | |||
| 2139 | Ga0466980_0148245 | |||
| 2140 | Ga0466978_0027607 | |||
| 2141 | Ga0466982_0250390 | |||
| 2142 | Ga0466982_0265117 | |||
| 2143 | Ga0453683_0099868 | |||
| 2144 | Ga0466965_0003246 | |||
| 2145 | Ga0466965_0005740 | |||
| 2146 | Ga0466965_0035070 | |||
| 2147 | Ga0466965_0050704 | |||
| 2148 | Ga0466965_0090269 | |||
| 2149 | Ga0466965_0130703 | |||
| 2150 | Ga0466965_0159994 | |||
| 2151 | Ga0466965_0418414 | |||
| 2152 | Ga0466966_0003888 | |||
| 2153 | Ga0466966_0009685 | |||
| 2154 | Ga0466966_0013697 | |||
| 2155 | Ga0466966_0113920 | |||
| 2156 | Ga0466966_0190799 | |||
| 2157 | Ga0466966_0288251 | |||
| 2158 | Ga0466966_0412471 | |||
| 2159 | Ga0466966_0494582 | |||
| 2160 | Ga0466961_0000415 | |||
| 2161 | Ga0466961_0001007 | |||
| 2162 | Ga0466961_0007203 | |||
| 2163 | Ga0466961_0014813 | |||
| 2164 | Ga0466961_0121839 | |||
| 2165 | Ga0466961_0268484 | |||
| 2166 | Ga0466961_0340099 | |||
| 2167 | Ga0466961_0532423 | |||
| 2168 | Ga0466963_0001278 | |||
| 2169 | Ga0466963_0090391 | |||
| 2170 | Ga0466963_0092180 | |||
| 2171 | Ga0466963_0106552 | |||
| 2172 | Ga0466963_0173523 | |||
| 2173 | Ga0466963_0288155 | |||
| 2174 | Ga0466964_0001878 | |||
| 2175 | Ga0466964_0007716 | |||
| 2176 | Ga0466964_0076040 | |||
| 2177 | Ga0466964_0222730 | |||
| 2178 | Ga0466964_0419693 | |||
| 2179 | Ga0466971_0001557 | |||
| 2180 | Ga0466971_0024782 | |||
| 2181 | Ga0466971_0071483 | |||
| 2182 | Ga0466971_0423259 | |||
| 2183 | Ga0466971_0441195 | |||
| 2184 | Ga0466968_0003428 | |||
| 2185 | Ga0466968_0016798 | |||
| 2186 | Ga0466970_0006924 | |||
| 2187 | Ga0466970_0022440 | |||
| 2188 | Ga0466970_0037074 | |||
| 2189 | Ga0466970_0075084 | |||
| 2190 | Ga0466970_0168989 | |||
| 2191 | Ga0466970_0173992 | |||
| 2192 | Ga0466957_0003890 | |||
| 2193 | Ga0466957_0022595 | |||
| 2194 | Ga0466957_0030419 | |||
| 2195 | Ga0466957_0044973 | |||
| 2196 | Ga0466957_0167885 | |||
| 2197 | Ga0466957_0623878 | |||
| 2198 | Ga0466960_0040069 | |||
| 2199 | Ga0466960_0260758 | |||
| 2200 | Ga0466959_0002179 | |||
| 2201 | Ga0466959_0002658 | |||
| 2202 | Ga0466959_0006378 | |||
| 2203 | Ga0466959_0007553 | |||
| 2204 | Ga0466959_0023160 | |||
| 2205 | Ga0466958_0006562 | |||
| 2206 | Ga0466958_0035137 | |||
| 2207 | Ga0466958_0048644 | |||
| 2208 | Ga0466958_0195199 | |||
| 2209 | Ga0466967_0010385 | |||
| 2210 | Ga0466967_0557058 | |||
| 2211 | Ga0466967_1257985 | |||
| 2212 | Ga0495617_000843 | |||
| 2213 | Ga0495617_005276 | |||
| 2214 | Ga0495627_000007 | |||
| 2215 | Ga0495592_0106127 | |||
| 2216 | Ga0495592_0388974 | |||
| 2217 | Ga0495603_0027448 | |||
| 2218 | Ga0495590_0002241 | |||
| 2219 | Ga0495590_0010204 | |||
| 2220 | Ga0495590_0044896 | |||
| 2221 | Ga0495591_004107 | |||
| 2222 | Ga0495629_0000060 | |||
| 2223 | Ga0495629_0018287 | |||
| 2224 | Ga0495629_0127038 | |||
| 2225 | Ga0495629_0689902 | |||
| 2226 | Ga0495638_0009335 | |||
| 2227 | Ga0495641_0005783 | |||
| 2228 | Ga0495641_0219475 | |||
| 2229 | Ga0495651_0022338 | |||
| 2230 | Ga0495651_0334936 | |||
| 2231 | Ga0495653_0026964 | |||
| 2232 | Ga0495653_0146152 | |||
| 2233 | Ga0495653_0148465 | |||
| 2234 | Ga0495653_0519160 | |||
| 2235 | Ga0495653_0849521 | |||
| 2236 | Ga0495650_0000837 | |||
| 2237 | Ga0495650_0007308 | |||
| 2238 | Ga0495650_0008995 | |||
| 2239 | Ga0495650_0137162 | |||
| 2240 | Ga0495580_0000975 | |||
| 2241 | Ga0495580_0009352 | |||
| 2242 | Ga0495580_0048496 | |||
| 2243 | Ga0495580_0052848 | |||
| 2244 | Ga0495580_0109638 | |||
| 2245 | Ga0495582_0002748 | |||
| 2246 | Ga0495582_0037546 | |||
| 2247 | Ga0495605_0019964 | |||
| 2248 | Ga0495605_0046155 | |||
| 2249 | Ga0495605_0064560 | |||
| 2250 | Ga0495605_0168173 | |||
| 2251 | Ga0495662_0120824 | |||
| 2252 | Ga0495662_0132942 | |||
| 2253 | Ga0495662_0261704 | |||
| 2254 | Ga0495664_0000037 | |||
| 2255 | Ga0495664_0010939 | |||
| 2256 | Ga0495664_0016639 | |||
| 2257 | Ga0495664_0357168 | |||
| 2258 | Ga0495584_0002307 | |||
| 2259 | Ga0495584_0413837 | |||
| 2260 | Ga0495585_0398843 | |||
| 2261 | Ga0495594_0042385 | |||
| 2262 | Ga0495596_0018802 | |||
| 2263 | Ga0495596_0076148 | |||
| 2264 | Ga0495607_0090253 | |||
| 2265 | Ga0495583_0000177 | |||
| 2266 | Ga0495583_0000221 | |||
| 2267 | Ga0495583_0001627 | |||
| 2268 | Ga0495583_0027095 | |||
| 2269 | Ga0495583_0078735 | |||
| 2270 | Ga0495606_0040529 | |||
| 2271 | Ga0495606_0046538 | |||
| 2272 | Ga0495606_0060057 | |||
| 2273 | Ga0495606_0064965 | |||
| 2274 | Ga0495606_0219356 | |||
| 2275 | Ga0495608_0002733 | |||
| 2276 | Ga0495608_0939969 | |||
| 2277 | Ga0495610_0003920 | |||
| 2278 | Ga0495610_0045830 | |||
| 2279 | Ga0495616_0026387 | |||
| 2280 | Ga0495616_0431709 | |||
| 2281 | Ga0495618_0005010 | |||
| 2282 | Ga0495618_0005105 | |||
| 2283 | Ga0495620_0010464 | |||
| 2284 | Ga0495620_0044545 | |||
| 2285 | Ga0495628_0011261 | |||
| 2286 | Ga0495628_0019283 | |||
| 2287 | Ga0495628_0081905 | |||
| 2288 | Ga0495628_0089721 | |||
| 2289 | Ga0495630_0018087 | |||
| 2290 | Ga0495630_0060980 | |||
| 2291 | Ga0495630_0200148 | |||
| 2292 | Ga0495630_0250715 | |||
| 2293 | Ga0495630_1176338 | |||
| 2294 | Ga0495632_0203715 | |||
| 2295 | Ga0495632_0259407 | |||
| 2296 | Ga0495637_0014142 | |||
| 2297 | Ga0495643_0000123 | |||
| 2298 | Ga0495643_0036541 | |||
| 2299 | Ga0495643_0154126 | |||
| 2300 | Ga0495644_0006676 | |||
| 2301 | Ga0495648_0002540 | |||
| 2302 | Ga0495648_0018998 | |||
| 2303 | Ga0495648_0028053 | |||
| 2304 | Ga0495648_0043051 | |||
| 2305 | Ga0495666_0001885 | |||
| 2306 | Ga0495666_0142952 | |||
| 2307 | Ga0495642_0025247 | |||
| 2308 | Ga0495642_0036504 | |||
| 2309 | Ga0495652_0031410 | |||
| 2310 | Ga0495652_0115948 | |||
| 2311 | Ga0495652_0131756 | |||
| 2312 | Ga0495652_0182733 | |||
| 2313 | Ga0495654_0007194 | |||
| 2314 | Ga0495654_0016009 | |||
| 2315 | Ga0495654_0047831 | |||
| 2316 | Ga0495654_0216948 | |||
| 2317 | Ga0495654_0243293 | |||
| 2318 | Ga0495665_0027180 | |||
| 2319 | Ga0495665_0088982 | |||
| 2320 | Ga0495665_0233349 | |||
| 2321 | Ga0495665_0332830 | |||
| 2322 | Ga0495640_0012106 | |||
| 2323 | Ga0495640_0017853 | |||
| 2324 | Ga0495640_0576921 | |||
| 2325 | Ga0495586_0004650 | |||
| 2326 | Ga0495586_0133203 | |||
| 2327 | Ga0495587_0003135 | |||
| 2328 | Ga0495587_0083669 | |||
| 2329 | Ga0495609_0000479 | |||
| 2330 | Ga0495609_0207150 | |||
| 2331 | Ga0495597_0010421 | |||
| 2332 | Ga0495597_0017578 | |||
| 2333 | Ga0495597_0095922 | |||
| 2334 | Ga0495597_0126266 | |||
| 2335 | Ga0495597_0132415 | |||
| 2336 | Ga0495597_0144854 | |||
| 2337 | Ga0495645_0028172 | |||
| 2338 | Ga0495645_0049735 | |||
| 2339 | Ga0495622_0000028 | |||
| 2340 | Ga0495622_0064758 | |||
| 2341 | Ga0495633_0001452 | |||
| 2342 | Ga0495633_0003780 | |||
| 2343 | Ga0495633_0045139 | |||
| 2344 | Ga0495633_0133096 | |||
| 2345 | Ga0495633_0185045 | |||
| 2346 | Ga0495633_0319569 | |||
| 2347 | Ga0495667_0426429 | |||
| 2348 | Ga0495656_0003881 | |||
| 2349 | Ga0495656_0109049 | |||
| 2350 | Ga0495656_0144429 | |||
| 2351 | Ga0495668_0464305 | |||
| 2352 | Ga0495634_0070463 | |||
| 2353 | Ga0495634_0100657 | |||
| 2354 | Ga0495634_0307495 | |||
| 2355 | Ga0495634_0315326 | |||
| 2356 | Ga0495611_0017514 | |||
| 2357 | Ga0495611_0085027 | |||
| 2358 | Ga0495625_0010387 | |||
| 2359 | Ga0495625_0098533 | |||
| 2360 | Ga0495635_0001911 | |||
| 2361 | Ga0495635_0582656 | |||
| 2362 | Ga0495659_0000284 | |||
| 2363 | Ga0495659_0001733 | |||
| 2364 | Ga0495659_0032379 | |||
| 2365 | Ga0495659_0258790 | |||
| 2366 | Ga0495661_0015384 | |||
| 2367 | Ga0495661_0032098 | |||
| 2368 | Ga0495661_0068043 | |||
| 2369 | Ga0495661_0187824 | |||
| 2370 | Ga0495588_0016869 | |||
| 2371 | Ga0495588_0266466 | |||
| 2372 | Ga0495657_0012465 | |||
| 2373 | Ga0495599_0015303 | |||
| 2374 | Ga0495599_0158502 | |||
| 2375 | Ga0495623_0007364 | |||
| 2376 | Ga0495623_0021394 | |||
| 2377 | Ga0495646_0004251 | |||
| 2378 | Ga0495646_0064817 | |||
| 2379 | Ga0495669_0110981 | |||
| 2380 | Ga0495613_0022883 | |||
| 2381 | Ga0495613_0907691 | |||
| 2382 | Ga0495624_0006795 | |||
| 2383 | Ga0495624_0015717 | |||
| 2384 | Ga0495624_0017723 | |||
| 2385 | Ga0495624_0020284 | |||
| 2386 | Ga0495624_0027317 | |||
| 2387 | Ga0495670_0054856 | |||
| 2388 | Ga0495670_0070743 | |||
| 2389 | Ga0495671_0000108 | |||
| 2390 | Ga0495671_0137186 | |||
| 2391 | Ga0495671_0221131 | |||
| 2392 | Ga0495671_0397240 | |||
| 2393 | Ga0495649_0042023 | |||
| 2394 | Ga0495649_0047936 | |||
| 2395 | Ga0495649_0113338 | |||
| 2396 | Ga0495589_0002451 | |||
| 2397 | Ga0495589_0042042 | |||
| 2398 | Ga0495600_0002084 | |||
| 2399 | Ga0495600_0060784 | |||
| 2400 | Ga0495600_0769114 | |||
| 2401 | Ga0495660_0000705 | |||
| 2402 | Ga0495660_0067675 | |||
| 2403 | Ga0495660_0160847 | |||
| 2404 | Ga0495660_0190688 | |||
| 2405 | Ga0495660_0278812 | |||
| 2406 | Ga0495581_0004052 | |||
| 2407 | Ga0495581_0102795 | |||
| 2408 | Ga0495581_0149957 | |||
| 2409 | Ga0495604_0011916 | |||
| 2410 | Ga0495604_0065108 | |||
| 2411 | Ga0495604_0095261 | |||
| 2412 | Ga0495636_0012717 | |||
| 2413 | Ga0495636_0016093 | |||
| 2414 | Ga0495674_0006962 | |||
| 2415 | Ga0495674_0007875 | |||
| 2416 | Ga0495674_0030492 | |||
| 2417 | Ga0495674_0064038 | |||
| 2418 | Ga0495674_0302711 | |||
| 2419 | Ga0495674_0951762 | |||
| 2420 | Ga0495672_0000181 | |||
| 2421 | Ga0495672_0000366 | |||
| 2422 | Ga0495672_0004977 | |||
| 2423 | Ga0495672_0032552 | |||
| 2424 | Ga0495672_0047636 | |||
| 2425 | Ga0495676_0065694 | |||
| 2426 | Ga0495676_0321395 | |||
| 2427 | Ga0495680_0013833 | |||
| 2428 | Ga0495680_0191214 | |||
| 2429 | Ga0495683_0012933 | |||
| 2430 | Ga0495683_0021720 | |||
| 2431 | Ga0495683_0030717 | |||
| 2432 | Ga0495683_0299903 | |||
| 2433 | Ga0495687_005585 | |||
| 2434 | Ga0495687_006712 | |||
| 2435 | Ga0495687_026489 | |||
| 2436 | Ga0495687_040102 | |||
| 2437 | Ga0495675_0002828 | |||
| 2438 | Ga0495675_0010388 | |||
| 2439 | Ga0495675_0343950 | |||
| 2440 | Ga0495677_0002355 | |||
| 2441 | Ga0495677_0053591 | |||
| 2442 | Ga0495679_000038 | |||
| 2443 | Ga0495679_001758 | |||
| 2444 | Ga0495679_004370 | |||
| 2445 | Ga0495685_000012 | |||
| 2446 | Ga0495673_0000188 | |||
| 2447 | Ga0495673_0030133 | |||
| 2448 | Ga0495673_0035867 | |||
| 2449 | Ga0495681_0004664 | |||
| 2450 | Ga0495681_0023688 | |||
| 2451 | Ga0495681_0266656 | |||
| 2452 | Ga0495684_0099372 | |||
| 2453 | Ga0495684_0981306 | |||
| 2454 | Ga0495686_0000380 | |||
| 2455 | Ga0495686_0003712 | |||
| 2456 | Ga0495686_0093464 | |||
| 2457 | Ga0495686_0264767 | |||
| 2458 | Ga0495593_0067595 | |||
| 2459 | Ga0495593_0175509 | |||
| 2460 | Ga0495593_0253204 | |||
| 2461 | Ga0495602_0075108 | |||
| 2462 | Ga0495602_0108305 | |||
| 2463 | Ga0495602_0139136 | |||
| 2464 | Ga0495602_0369908 | |||
| 2465 | Ga0495614_0003506 | |||
| 2466 | Ga0495614_0009064 | |||
| 2467 | Ga0495614_0023359 | |||
| 2468 | Ga0495614_0465011 | |||
| 2469 | Ga0495626_0001169 | |||
| 2470 | Ga0495626_0015633 | |||
| 2471 | Ga0495626_0020668 | |||
| 2472 | Ga0495626_0320457 | |||
| 2473 | Ga0496100_0001564 | |||
| 2474 | Ga0496100_1348507 | |||
| 2475 | Ga0496101_0004610 | |||
| 2476 | Ga0496101_0328315 | |||
| 2477 | Ga0496101_0424436 | |||
| 2478 | Ga0496102_0008702 | |||
| 2479 | Ga0496102_0014532 | |||
| 2480 | Ga0496102_0184660 | |||
| 2481 | Ga0496102_1531281 | |||
| 2482 | Ga0496103_0003074 | |||
| 2483 | Ga0496103_0009410 | |||
| 2484 | Ga0496103_0110398 | |||
| 2485 | Ga0496103_0437231 | |||
| 2486 | Ga0496104_1668037 | |||
| 2487 | Ga0496105_0055064 | |||
| 2488 | Ga0496105_0212234 | |||
| 2489 | Ga0496106_0138726 | |||
| 2490 | Ga0496107_0109583 | |||
| 2491 | Ga0496108_0900138 | |||
| 2492 | Ga0496109_0195160 | |||
| 2493 | Ga0496110_0099317 | |||
| 2494 | Ga0496110_1007485 | |||
| 2495 | Ga0496110_1177451 | |||
| 2496 | Ga0496110_1586065 | |||
| 2497 | Ga0496111_0177460 | |||
| 2498 | Ga0496111_0238931 | |||
| 2499 | Ga0496112_0165240 | |||
| 2500 | Ga0496112_1396035 | |||
| 2501 | Ga0496113_0026351 | |||
| 2502 | Ga0496113_0912600 | |||
| 2503 | Ga0496113_1482673 | |||
| 2504 | Ga0496113_1514884 | |||
| 2505 | Ga0496114_0168757 | |||
| 2506 | Ga0496114_0171177 | |||
| 2507 | Ga0496114_0269836 | |||
| 2508 | Ga0496115_0217914 | |||
| 2509 | Ga0496116_0007137 | |||
| 2510 | Ga0496116_0024774 | |||
| 2511 | Ga0496116_0040168 | |||
| 2512 | Ga0496116_0173243 | |||
| 2513 | Ga0496116_0404592 | |||
| 2514 | Ga0496117_0009193 | |||
| 2515 | Ga0496117_0012754 | |||
| 2516 | Ga0496117_0023308 | |||
| 2517 | Ga0496117_0024619 | |||
| 2518 | Ga0496117_0041125 | |||
| 2519 | Ga0496118_0002548 | |||
| 2520 | Ga0496118_0008041 | |||
| 2521 | Ga0496118_0017381 | |||
| 2522 | Ga0496118_0019819 | |||
| 2523 | Ga0496118_0039449 | |||
| 2524 | Ga0496118_0063758 | |||
| 2525 | Ga0496119_0008234 | |||
| 2526 | Ga0496119_0203713 | |||
| 2527 | Ga0496120_0006959 | |||
| 2528 | Ga0496120_0292255 | |||
| 2529 | Ga0496121_0000306 | |||
| 2530 | Ga0496121_0004537 | |||
| 2531 | Ga0496121_0007042 | |||
| 2532 | Ga0496121_0065853 | |||
| 2533 | Ga0496121_0260830 | |||
| 2534 | Ga0496121_0296634 | |||
| 2535 | Ga0496122_0000644 | |||
| 2536 | Ga0496122_0004387 | |||
| 2537 | Ga0496122_0034717 | |||
| 2538 | Ga0496122_0280000 | |||
| 2539 | Ga0496122_0548951 | |||
| 2540 | Ga0496123_0000203 | |||
| 2541 | Ga0496123_0013893 | |||
| 2542 | Ga0496123_0124169 | |||
| 2543 | Ga0496123_0149579 | |||
| 2544 | Ga0496124_0008511 | |||
| 2545 | Ga0496124_0009308 | |||
| 2546 | Ga0496124_0038717 | |||
| 2547 | Ga0496124_0051693 | |||
| 2548 | Ga0496124_0055125 | |||
| 2549 | Ga0496124_0063559 | |||
| 2550 | Ga0496125_0000011 | |||
| 2551 | Ga0496125_0003109 | |||
| 2552 | Ga0496125_0007345 | |||
| 2553 | Ga0496125_0020259 | |||
| 2554 | Ga0496125_0035345 | |||
| 2555 | Ga0496125_0095438 | |||
| 2556 | Ga0496125_0204583 | |||
| 2557 | Ga0496125_0278086 | |||
| 2558 | Ga0496126_0002232 | |||
| 2559 | Ga0496126_0003420 | |||
| 2560 | Ga0496126_0038550 | |||
| 2561 | Ga0496126_0056077 | |||
| 2562 | Ga0496126_0062435 | |||
| 2563 | Ga0496126_0552921 | |||
| 2564 | Ga0466983_0920657 | |||
| 2565 | Ga0501306_018797 | |||
| 2566 | Ga0501306_091083 | |||
| 2567 | Ga0501306_093629 | |||
| 2568 | Ga0501308_000315 | |||
| 2569 | Ga0501308_037032 | |||
| 2570 | Ga0501309_017424 | |||
| 2571 | Ga0501310_017772 | |||
| 2572 | Ga0501341_02833 | |||
| 2573 | Ga0501341_05638 | |||
| 2574 | Ga0501343_006326 | |||
| 2575 | Ga0501304_002330 | |||
| 2576 | Ga0501304_024903 | |||
| 2577 | Ga0501305_003896 | |||
| 2578 | Ga0501305_021623 | |||
| 2579 | Ga0501305_095814 | |||
| 2580 | Ga0501307_026574 | |||
| 2581 | Ga0501307_085034 | |||
| 2582 | Ga0495678_000004 | |||
| 2583 | Ga0495678_043783 | |||
| 2584 | Ga0495682_0019450 | |||
| 2585 | Ga0495682_0086305 | |||
| 2586 | Ga0501311_007961 | |||
| 2587 | Ga0501312_028442 | |||
| 2588 | Ga0501312_033713 | |||
| 2589 | Ga0501312_087788 | |||
| 2590 | Ga0501313_009046 | |||
| 2591 | Ga0501313_046959 | |||
| 2592 | Ga0501314_005186 | |||
| 2593 | Ga0501314_030317 | |||
| 2594 | Ga0501315_002372 | |||
| 2595 | Ga0501315_009861 | |||
| 2596 | Ga0501315_037184 | |||
| 2597 | Ga0501315_052119 | |||
| 2598 | Ga0501315_088192 | |||
| 2599 | Ga0501316_038549 | |||
| 2600 | Ga0501316_076814 | |||
| 2601 | Ga0501317_056037 | |||
| 2602 | Ga0501317_101203 | |||
| 2603 | Ga0501318_043630 | |||
| 2604 | Ga0501319_000620 | |||
| 2605 | Ga0501319_003465 | |||
| 2606 | Ga0501319_017426 | |||
| 2607 | Ga0501320_001140 | |||
| 2608 | Ga0501320_007226 | |||
| 2609 | Ga0501320_020731 | |||
| 2610 | Ga0501321_025190 | |||
| 2611 | Ga0501323_000562 | |||
| 2612 | Ga0501323_017412 | |||
| 2613 | Ga0501323_025630 | |||
| 2614 | Ga0501324_012443 | |||
| 2615 | Ga0501324_021515 | |||
| 2616 | Ga0501324_044802 | |||
| 2617 | Ga0501325_006584 | |||
| 2618 | Ga0501326_09348 | |||
| 2619 | Ga0501329_10738 | |||
| 2620 | Ga0501329_12003 | |||
| 2621 | Ga0501335_008825 | |||
| 2622 | Ga0501337_011731 | |||
| 2623 | Ga0501337_015195 | |||
| 2624 | Ga0501337_021820 | |||
| 2625 | Ga0501337_025092 | |||
| 2626 | Ga0501338_05164 | |||
| 2627 | Ga0501031_0322400 | |||
| 2628 | Ga0501032_0166201 | |||
| 2629 | Ga0501033_0000642 | |||
| 2630 | Ga0501033_0087505 | |||
| 2631 | Ga0501033_0638143 | |||
| 2632 | Ga0501034_0004519 | |||
| 2633 | Ga0501034_0018858 | |||
| 2634 | Ga0501034_0135557 | |||
| 2635 | Ga0501034_0503757 | |||
| 2636 | Ga0501034_0897898 | |||
| 2637 | Ga0501036_0002870 | |||
| 2638 | Ga0501036_0529773 | |||
| 2639 | Ga0501037_0095024 | |||
| 2640 | Ga0501037_0145797 | |||
| 2641 | Ga0501037_0396915 | |||
| 2642 | Ga0501038_0019977 | |||
| 2643 | Ga0501038_0099781 | |||
| 2644 | Ga0501038_0614513 | |||
| 2645 | Ga0501038_0854985 | |||
| 2646 | Ga0501038_1316813 | |||
| 2647 | Ga0501039_0066082 | |||
| 2648 | Ga0501041_0117973 | |||
| 2649 | Ga0501042_0376229 | |||
| 2650 | Ga0501043_0029837 | |||
| 2651 | Ga0501043_0275446 | |||
| 2652 | Ga0501043_0637405 | |||
| 2653 | Ga0501043_0651096 | |||
| 2654 | Ga0501046_0345873 | |||
| 2655 | Ga0501047_0251848 | |||
| 2656 | Ga0501048_0932869 | |||
| 2657 | Ga0501068_0001118 | |||
| 2658 | Ga0501069_0786040 | |||
| 2659 | Ga0501070_0031743 | |||
| 2660 | Ga0501071_0955919 | |||
| 2661 | Ga0501071_1339514 | |||
| 2662 | Ga0501072_0001234 | |||
| 2663 | Ga0501073_0000651 | |||
| 2664 | Ga0501074_0231440 | |||
| 2665 | Ga0501076_0374926 | |||
| 2666 | Ga0501077_0320333 | |||
| 2667 | Ga0501209_000078 | |||
| 2668 | Ga0501233_198393 | |||
| 2669 | Ga0501235_034034 | |||
| 2670 | Ga0501249_027340 | |||
| 2671 | Ga0501080_0000604 | |||
| 2672 | Ga0501080_0320684 | |||
| 2673 | Ga0501081_0148790 | |||
| 2674 | Ga0501081_0887637 | |||
| 2675 | Ga0501083_0259184 | |||
| 2676 | Ga0501266_000163 | |||
| 2677 | Ga0501268_075156 | |||
| 2678 | Ga0501035_0099514 | |||
| 2679 | Ga0501044_0003646 | |||
| 2680 | Ga0501044_0036229 | |||
| 2681 | Ga0501044_0245047 | |||
| 2682 | Ga0501044_0812045 | |||
| 2683 | Ga0501044_1223762 | |||
| 2684 | Ga0501045_0561509 | |||
| 2685 | nmdc:mga03683_220198_c1 | |||
| 2686 | nmdc:mga03683_31242_c1 | |||
| 2687 | nmdc:mga03n38_530914_c1 | |||
| 2688 | nmdc:mga0yw44_598823_c1 | |||
| 2689 | nmdc:mga0k408_308126_c1 | |||
| 2690 | nmdc:mga0k408_607118_c1 | |||
| 2691 | nmdc:mga0k408_746819_c1 | |||
| 2692 | nmdc:mga0k408_86809_c1 | |||
| 2693 | nmdc:mga0k408_940_c1 | |||
| 2694 | nmdc:mga07m45_15021_c1 | |||
| 2695 | nmdc:mga07m45_212810_c2 | |||
| 2696 | nmdc:mga07m45_729995_c1 | |||
| 2697 | nmdc:mga07m45_786307_c1 | |||
| 2698 | nmdc:mga05p37_1322380_c1 | |||
| 2699 | nmdc:mga09592_9523_c1 | |||
| 2700 | nmdc:mga0qj67_286042_c1 | |||
| 2701 | nmdc:mga08y16_1000_c1 | |||
| 2702 | Ga0495655_0170877 | |||
| 2703 | Ga0500643_035180 | |||
| 2704 | Ga0500644_0016047 | |||
| 2705 | Ga0500646_0038494 | |||
| 2706 | Ga0500562_001613 | |||
| 2707 | Ga0500569_080694 | |||
| 2708 | Ga0500594_0005237 | |||
| 2709 | Ga0500618_000089 | |||
| 2710 | Ga0500559_0046340 | |||
| 2711 | Ga0500568_0338118 | |||
| 2712 | Ga0500616_0027216 | |||
| 2713 | Ga0500622_0033857 | |||
| 2714 | Ga0501084_0064611 | |||
| 2715 | Ga0587084_006518 | |||
| 2716 | Ga0587084_027678 | |||
| 2717 | Ga0587084_030888 | |||
| 2718 | Ga0587084_097968 | |||
| 2719 | Ga0587093_017438 | |||
| 2720 | Ga0587093_026237 | |||
| 2721 | Ga0587093_050875 | |||
| 2722 | Ga0587093_070061 | |||
| 2723 | Ga0587093_076702 | |||
| 2724 | Ga0587066_073682 | |||
| 2725 | Ga0587066_081599 | |||
| 2726 | Ga0587070_001925 | |||
| 2727 | Ga0587070_003193 | |||
| 2728 | Ga0587070_045376 | |||
| 2729 | Ga0587070_141909 | |||
| 2730 | Ga0587073_0014350 | |||
| 2731 | Ga0587077_012119 | |||
| 2732 | Ga0587077_122502 | |||
| 2733 | Ga0587077_144587 | |||
| 2734 | Ga0587080_024381 | |||
| 2735 | Ga0587080_046836 | |||
| 2736 | Ga0587080_085853 | |||
| 2737 | Ga0587082_008841 | |||
| 2738 | Ga0587083_0013579 | |||
| 2739 | Ga0587083_0019354 | |||
| 2740 | Ga0587083_0028806 | |||
| 2741 | Ga0587083_0034614 | |||
| 2742 | Ga0587083_0194068 | |||
| 2743 | Ga0587083_0269335 | |||
| 2744 | Ga0587085_009816 | |||
| 2745 | Ga0587085_032916 | |||
| 2746 | Ga0587085_060002 | |||
| 2747 | Ga0587085_108120 | |||
| 2748 | Ga0587085_149440 | |||
| 2749 | Ga0587086_008158 | |||
| 2750 | Ga0587086_021317 | |||
| 2751 | Ga0587086_033214 | |||
| 2752 | Ga0587086_048555 | |||
| 2753 | Ga0587088_000882 | |||
| 2754 | Ga0587088_006968 | |||
| 2755 | Ga0587088_030437 | |||
| 2756 | Ga0587088_045517 | |||
| 2757 | Ga0587088_167628 | |||
| 2758 | Ga0587089_007933 | |||
| 2759 | Ga0587090_003231 | |||
| 2760 | Ga0587090_009257 | |||
| 2761 | Ga0587090_012737 | |||
| 2762 | Ga0587090_065885 | |||
| 2763 | Ga0587090_164428 | |||
| 2764 | Ga0587091_010895 | |||
| 2765 | Ga0587091_070940 | |||
| 2766 | Ga0587091_219763 | |||
| 2767 | Ga0587092_088939 | |||
| 2768 | Ga0587094_000788 | |||
| 2769 | Ga0587094_066580 | |||
| 2770 | Ga0587094_085313 | |||
| 2771 | Ga0587095_014951 | |||
| 2772 | Ga0587097_04718 | |||
| 2773 | Ga0587098_003422 | |||
| 2774 | Ga0587098_027475 | |||
| 2775 | Ga0587098_064646 | |||
| 2776 | Ga0587106_004918 | |||
| 2777 | Ga0587106_022386 | |||
| 2778 | Ga0587106_109047 | |||
| 2779 | Ga0587099_009695 | |||
| 2780 | Ga0587101_005345 | |||
| 2781 | Ga0587101_010389 | |||
| 2782 | Ga0587101_064865 | |||
| 2783 | Ga0587101_092923 | |||
| 2784 | Ga0587109_013974 | |||
| 2785 | Ga0587109_037677 | |||
| 2786 | Ga0587109_090453 | |||
| 2787 | Ga0587113_040128 | |||
| 2788 | Ga0587117_012462 | |||
| 2789 | Ga0587117_068196 | |||
| 2790 | Ga0587117_106426 | |||
| 2791 | Ga0587122_039863 | |||
| 2792 | Ga0587128_006927 | |||
| 2793 | Ga0587128_047518 | |||
| 2794 | Ga0587128_068546 | |||
| 2795 | Ga0587062_029227 | |||
| 2796 | Ga0587062_090492 | |||
| 2797 | Ga0587067_001455 | |||
| 2798 | Ga0587067_091754 | |||
| 2799 | Ga0587068_009221 | |||
| 2800 | Ga0587068_019527 | |||
| 2801 | Ga0587068_025175 | |||
| 2802 | Ga0587068_080168 | |||
| 2803 | Ga0587068_160640 | |||
| 2804 | Ga0587069_007418 | |||
| 2805 | Ga0587069_012315 | |||
| 2806 | Ga0587069_115643 | |||
| 2807 | Ga0587072_000318 | |||
| 2808 | Ga0587072_015319 | |||
| 2809 | Ga0587075_006769 | |||
| 2810 | Ga0587075_007812 | |||
| 2811 | Ga0587075_120187 | |||
| 2812 | Ga0587075_129184 | |||
| 2813 | Ga0587076_001018 | |||
| 2814 | Ga0587076_053980 | |||
| 2815 | Ga0587076_096236 | |||
| 2816 | Ga0587076_154540 | |||
| 2817 | Ga0587078_004582 | |||
| 2818 | Ga0587078_005901 | |||
| 2819 | Ga0587078_025270 | |||
| 2820 | Ga0587078_038185 | |||
| 2821 | Ga0587079_005815 | |||
| 2822 | Ga0587079_008433 | |||
| 2823 | Ga0587079_040050 | |||
| 2824 | Ga0587079_250102 | |||
| 2825 | Ga0587100_015477 | |||
| 2826 | Ga0587102_002623 | |||
| 2827 | Ga0587102_003037 | |||
| 2828 | Ga0587104_000990 | |||
| 2829 | Ga0587105_008812 | |||
| 2830 | Ga0587105_014206 | |||
| 2831 | Ga0587107_050553 | |||
| 2832 | Ga0587108_004500 | |||
| 2833 | Ga0587108_007881 | |||
| 2834 | Ga0587110_017285 | |||
| 2835 | Ga0587118_25462 | |||
| 2836 | Ga0587120_011487 | |||
| 2837 | Ga0587124_001169 | |||
| 2838 | Ga0587124_024105 | |||
| 2839 | Ga0587071_013457 | |||
| 2840 | Ga0587071_069557 | |||
| 2841 | Ga0587071_086867 | |||
| 2842 | Ga0587071_161341 | |||
| 2843 | Ga0587071_222899 | |||
| 2844 | Ga0587111_0005708 | |||
| 2845 | Ga0587111_0015287 | |||
| 2846 | Ga0587111_0023929 | |||
| 2847 | Ga0587111_0035749 | |||
| 2848 | Ga0587111_0108202 | |||
| 2849 | Ga0587111_0129360 | |||
| 2850 | Ga0587111_0222049 | |||
| 2851 | Ga0501082_0403934 | |||
| 2852 | Ga0501082_0726448 | |||
| 2853 | Ga0466962_0018616 | |||
| 2854 | Ga0466962_0019466 | |||
| 2855 | Ga0466962_0133377 | |||
| 2856 | Ga0466962_0174343 | |||
| 2857 | Ga0466962_0342271 | |||
| 2858 | Ga0530510_0782690 | |||
| 2859 | 2511250639 | |||
| 2860 | 2511384947 | |||
| 2861 | 2521557885 | |||
| 2862 | 2548499938 | |||
| 2863 | 2550693924 | |||
| 2864 | 2553003008 | |||
| 2865 | 2601667669 | |||
| 2866 | 2643786927 | |||
| 2867 | 2643802363 | |||
| 2868 | 2643868168 | |||
| 2869 | 2643993837 | |||
| 2870 | 2644059731 | |||
| 2871 | 2644074874 | |||
| 2872 | 2644215984 | |||
| 2873 | 2644254474 | |||
| 2874 | 2644293775 | |||
| 2875 | 2644357861 | |||
| 2876 | 2644475876 | |||
| 2877 | 2644644744 | |||
| 2878 | 2738741281 | |||
| 2879 | 2738829178 | |||
| 2880 | 2738845750 | |||
| 2881 | 2739152974 | |||
| 2882 | 2739194894 | |||
| 2883 | 2739241259 | |||
| 2884 | 2739248155 | |||
| 2885 | 2739277558 | |||
| 2886 | 2739321370 | |||
| 2887 | 2739340074 | |||
| 2888 | 2739346519 | |||
| 2889 | 2765569006 | |||
| 2890 | 2808984486 | |||
| 2891 | 2809131213 | |||
| 2892 | 2809145415 | |||
| 2893 | 2809150452 | |||
| 2894 | 2816473425 | |||
| 2895 | 2819542546 | |||
| 2896 | 2819591174 | |||
| 2897 | 2819614974 | |||
| 2898 | 2839096109 | |||
| 2899 | 2842717744 | |||
| 2900 | 2842721370 | |||
| 2901 | 2842734294 | |||
| 2902 | 2842749455 | |||
| 2903 | 2852621968 | |||
| 2904 | 2857550304 | |||
| 2905 | 2857554476 | |||
| 2906 | 2857559445 | |||
| 2907 | 2857564717 | |||
| 2908 | 2881105478 | |||
| 2909 | 2884812292 | |||
| 2910 | 2884836899 | |||
| 2911 | 2884853190 | |||
| 2912 | 2885085396 | |||
| 2913 | 2885197881 | |||
| 2914 | 2894026947 | |||
| 2915 | 2896155692 | |||
| 2916 | 2904425976 | |||
| 2917 | 2904441349 | |||
| 2918 | 2904531711 | |||
| 2919 | 2904544513 | |||
| 2920 | 2904588064 | |||
| 2921 | 2904589776 | |||
| 2922 | 2904602838 | |||
| 2923 | 2919046347 | |||
| 2924 | 2919079658 | |||
| 2925 | 2919478420 | |||
| 2926 | 2919707237 | |||
| 2927 | 2923511117 | |||
| 2928 | 2928115670 | |||
| 2929 | 2928131053 | |||
| 2930 | 2929161917 | |||
| 2931 | 2932411274 | |||
| 2932 | 2932419159 | |||
| 2933 | 2932423744 | |||
| 2934 | 2939632643 | |||
| 2935 | 2990713472 | |||
| 2936 | 8047673774 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy