F494200

General Info

Members Datasets Scaffolds Average Seq Length
1470 449 2940 193

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10122506|Ga0268265_101225062
Length 217
Sequence MSPDLVALFLSALVTFVVVIDPPGCAPIFASLTAGTTPAHRRAMAVRSVAVASVVLILFSLFGEAFLDMLGISLAAFRIAGGIMLFLIAIDMVFEKRTQRREERAEEISKRAADEHRPLEAEDISVFPMGIPMIAGPGSIATAMLLTSRANGWMEGGIVLGALAATLLLTLLALLAAGPLMNALGHKVEAMITRVLGVILAALAVQFVIDGLKASFG

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
120 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
127 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
235 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
251 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
254 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
258 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
259 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
260 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
282 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
283 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
289 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
302 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
303 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
316 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
317 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
321 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
328 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
345 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
350 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
364 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
365 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
366 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
367 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
368 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
369 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
370 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
371 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
372 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
376 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
379 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
385 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
386 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
387 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
388 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
389 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
390 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
391 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
392 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
393 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
394 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
395 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
396 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
397 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
398 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
399 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
400 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
401 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
402 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
403 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
404 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
405 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
406 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
407 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
408 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
409 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
410 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
411 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
412 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
413 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
414 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
415 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
416 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
417 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
418 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
419 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
420 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
421 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
422 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
423 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
424 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
425 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
426 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
427 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
428 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
429 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
430 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
431 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
432 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
433 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
434 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
435 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
436 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
437 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
438 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
439 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
440 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
441 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
442 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
443 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
444 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
445 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
446 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
447 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
448 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
449 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.07
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 6.87
Nodule 0.14
Rhizoplane 2.79
Rhizosphere 82.04
Stem 0
Stem Tuber 0
Unclassified 0.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10122506 3300028380 Bacteria 2145
2 SwRhRL2b_contig_1673102 2162886007 Bacteria 13823
3 SwRhRL2b_contig_1893398 2162886007 Bacteria 12143
4 SwRhRL2b_contig_67628 2162886007 Bacteria 1414
5 JGI24736J21556_1001983 3300001904 Bacteria 3633
6 JGI24736J21556_1005378 3300001904 Bacteria 2163
7 JGI24741J21665_1000122 3300001915 Bacteria 20977
8 JGI24741J21665_1039325 3300001915 Bacteria 699
9 JGI24752J21851_1001492 3300001976 Bacteria 3157
10 JGI24747J21853_1004386 3300001978 Bacteria 1263
11 JGI24740J21852_10010138 3300001979 Bacteria 3644
12 JGI24740J21852_10025066 3300001979 Bacteria 2015
13 JGI24740J21852_10046169 3300001979 Bacteria 1280
14 JGI24740J21852_10074931 3300001979 Bacteria 897
15 JGI24740J21852_10082943 3300001979 Bacteria 837
16 JGI24739J22299_10000391 3300001989 Bacteria 15156
17 JGI24739J22299_10002839 3300001989 Bacteria 6655
18 JGI24739J22299_10003277 3300001989 Bacteria 6175
19 JGI24739J22299_10008673 3300001989 Bacteria 3792
20 JGI24739J22299_10010024 3300001989 Bacteria 3522
21 JGI24739J22299_10020971 3300001989 Bacteria 2331
22 JGI24737J22298_10001243 3300001990 Bacteria 9004
23 JGI24737J22298_10004308 3300001990 Bacteria 4970
24 JGI24737J22298_10042356 3300001990 Bacteria 1395
25 JGI24737J22298_10050139 3300001990 Bacteria 1269
26 JGI24743J22301_10019238 3300001991 Bacteria 1296
27 JGI24735J21928_10002241 3300002067 Bacteria 6764
28 JGI24735J21928_10004078 3300002067 Bacteria 4929
29 JGI24735J21928_10007186 3300002067 Bacteria 3634
30 JGI24735J21928_10026692 3300002067 Bacteria 1734
31 JGI24735J21928_10043417 3300002067 Bacteria 1307
32 JGI24735J21928_10192644 3300002067 Bacteria 591
33 JGI24738J21930_10000436 3300002075 Bacteria 11806
34 JGI24738J21930_10011972 3300002075 Bacteria 1899
35 JGI24738J21930_10022102 3300002075 Bacteria 1317
36 JGI24738J21930_10052632 3300002075 Bacteria 831
37 JGI24749J21850_1000069 3300002076 Bacteria 18624
38 JGI24744J21845_10007524 3300002077 Bacteria 2250
39 JGI24744J21845_10038565 3300002077 Bacteria 898
40 JGI24742J22300_10039055 3300002244 Bacteria 843
41 JGI24751J29686_10000391 3300002459 Bacteria 14670
42 JGI24751J29686_10037791 3300002459 Bacteria 999
43 JGI25165J46597_1000071 3300003214 Bacteria 193222
44 JGI25153J46596_10000007 3300003215 Bacteria 377573
45 rootH2_10174559 3300003320 Bacteria 1998
46 rootH1_10040862 3300003323 Bacteria 5300
47 rootH1_10162866 3300003323 Bacteria 1025
48 Ga0055525_1000127 3300003759 Bacteria 113683
49 Ga0055542_1000038 3300003762 Bacteria 224625
50 Ga0055542_1001654 3300003762 Bacteria 9990
51 Ga0055529_1000002 3300003763 Bacteria 537914
52 Ga0055529_1000021 3300003763 Bacteria 321484
53 Ga0055536_1003088 3300003781 Bacteria 9071
54 Ga0055536_1006967 3300003781 Bacteria 5147
55 Ga0055534_1008222 3300003784 Bacteria 2385
56 Ga0055530_10000048 3300003791 Bacteria 107993
57 Ga0055530_10011789 3300003791 Bacteria 3107
58 Ga0055531_10000929 3300003794 Bacteria 23705
59 Ga0055531_10004331 3300003794 Bacteria 8683
60 Ga0065165_1004328 3300005262 Bacteria 8919
61 Ga0065165_1053500 3300005262 Bacteria 1136
62 Ga0065704_10070193 3300005289 Bacteria 98570
63 Ga0065704_10094687 3300005289 Bacteria 2530
64 Ga0065704_10127076 3300005289 Bacteria 1680
65 Ga0065704_10173616 3300005289 Bacteria 1277
66 Ga0065715_10007711 3300005293 Bacteria 4049
67 Ga0065707_10081811 3300005295 Bacteria 37556
68 Ga0065707_10105390 3300005295 Bacteria 2647
69 Ga0065707_10260882 3300005295 Bacteria 1097
70 Ga0070658_10000377 3300005327 Bacteria 38853
71 Ga0070658_10000716 3300005327 Bacteria 28749
72 Ga0070658_10003584 3300005327 Bacteria 12730
73 Ga0070658_10003723 3300005327 Bacteria 12473
74 Ga0070658_10004008 3300005327 Bacteria 12067
75 Ga0070658_10007308 3300005327 Bacteria 8922
76 Ga0070658_10021861 3300005327 Bacteria 5128
77 Ga0070658_10075150 3300005327 Bacteria 2771
78 Ga0070658_10153726 3300005327 Bacteria 1928
79 Ga0070676_10001215 3300005328 Bacteria 12921
80 Ga0070676_10005501 3300005328 Bacteria 6745
81 Ga0070676_10176436 3300005328 Bacteria 1386
82 Ga0070676_10652559 3300005328 Bacteria 764
83 Ga0070683_100001819 3300005329 Bacteria 16631
84 Ga0070683_100018052 3300005329 Bacteria 6241
85 Ga0070683_100168475 3300005329 Bacteria 2079
86 Ga0070690_100128620 3300005330 Bacteria 1708
87 Ga0070670_100000027 3300005331 Bacteria 186072
88 Ga0070670_100000047 3300005331 Bacteria 136625
89 Ga0070670_100012449 3300005331 Bacteria 7280
90 Ga0070670_100042597 3300005331 Bacteria 3903
91 Ga0070670_100302451 3300005331 Bacteria 1399
92 Ga0070670_100775340 3300005331 Bacteria 865
93 Ga0070677_10000079 3300005333 Bacteria 30894
94 Ga0070677_10011544 3300005333 Bacteria 3049
95 Ga0070677_10034331 3300005333 Bacteria 1959
96 Ga0068869_100000031 3300005334 Bacteria 60884
97 Ga0070666_10000779 3300005335 Bacteria 19305
98 Ga0070666_10054458 3300005335 Bacteria 2699
99 Ga0070666_10093259 3300005335 Bacteria 2070
100 Ga0070666_10581678 3300005335 Bacteria 816
101 Ga0070680_100000177 3300005336 Bacteria 41002
102 Ga0070680_100003469 3300005336 Bacteria 11774
103 Ga0070680_100245996 3300005336 Bacteria 1512
104 Ga0070680_100602927 3300005336 Bacteria 942
105 Ga0070682_100058066 3300005337 Bacteria 2439
106 Ga0070682_100128504 3300005337 Bacteria 1712
107 Ga0070682_101075427 3300005337 Bacteria 672
108 Ga0068868_100000060 3300005338 Bacteria 61952
109 Ga0068868_100058542 3300005338 Bacteria 3045
110 Ga0068868_100192305 3300005338 Bacteria 1697
111 Ga0068868_100202519 3300005338 Bacteria 1655
112 Ga0070660_100000751 3300005339 Bacteria 21524
113 Ga0070660_100000986 3300005339 Bacteria 19065
114 Ga0070660_100002934 3300005339 Bacteria 11737
115 Ga0070660_100005512 3300005339 Bacteria 8765
116 Ga0070660_100009089 3300005339 Bacteria 6976
117 Ga0070660_100016075 3300005339 Bacteria 5423
118 Ga0070660_100024083 3300005339 Bacteria 4516
119 Ga0070660_100111630 3300005339 Bacteria 2175
120 Ga0070660_100273648 3300005339 Bacteria 1381
121 Ga0070660_100347733 3300005339 Bacteria 1220
122 Ga0070687_100111831 3300005343 Bacteria 1547
123 Ga0070687_100150704 3300005343 Bacteria 1365
124 Ga0070661_100000156 3300005344 Bacteria 55675
125 Ga0070661_100000187 3300005344 Bacteria 51095
126 Ga0070661_100006527 3300005344 Bacteria 8049
127 Ga0070661_100021041 3300005344 Bacteria 4657
128 Ga0070661_100032184 3300005344 Bacteria 3795
129 Ga0070661_100036795 3300005344 Bacteria 3557
130 Ga0070661_100069996 3300005344 Bacteria 2580
131 Ga0070661_100284668 3300005344 Bacteria 1283
132 Ga0070661_100726035 3300005344 Bacteria 811
133 Ga0070692_10033345 3300005345 Bacteria 2594
134 Ga0070692_10268070 3300005345 Bacteria 1029
135 Ga0070668_100016101 3300005347 Bacteria 5596
136 Ga0070668_100018871 3300005347 Bacteria 5181
137 Ga0070668_100033002 3300005347 Bacteria 3940
138 Ga0070668_100078104 3300005347 Bacteria 2588
139 Ga0070668_100089092 3300005347 Bacteria 2430
140 Ga0070668_100100733 3300005347 Bacteria 2288
141 Ga0070668_100114109 3300005347 Bacteria 2153
142 Ga0070668_100125621 3300005347 Bacteria 2054
143 Ga0070668_100167545 3300005347 Bacteria 1786
144 Ga0070669_100000072 3300005353 Bacteria 99184
145 Ga0070669_100000470 3300005353 Bacteria 30618
146 Ga0070669_100030653 3300005353 Bacteria 3882
147 Ga0070669_100075371 3300005353 Bacteria 2502
148 Ga0070669_100133445 3300005353 Bacteria 1907
149 Ga0070669_100147500 3300005353 Bacteria 1819
150 Ga0070669_100177785 3300005353 Bacteria 1663
151 Ga0070669_100660071 3300005353 Bacteria 880
152 Ga0070675_100005311 3300005354 Bacteria 9842
153 Ga0070675_100014931 3300005354 Bacteria 6133
154 Ga0070675_100246966 3300005354 Bacteria 1561
155 Ga0070671_100000845 3300005355 Bacteria 22289
156 Ga0070671_100039002 3300005355 Bacteria 3943
157 Ga0070671_100054381 3300005355 Bacteria 3329
158 Ga0070671_100080339 3300005355 Bacteria 2726
159 Ga0070671_100241581 3300005355 Bacteria 1533
160 Ga0070671_100352852 3300005355 Bacteria 1255
161 Ga0070671_100489394 3300005355 Bacteria 1057
162 Ga0070674_100000209 3300005356 Bacteria 28138
163 Ga0070674_100027045 3300005356 Bacteria 3755
164 Ga0070674_100127342 3300005356 Bacteria 1894
165 Ga0070673_100000009 3300005364 Bacteria 155005
166 Ga0070673_100031597 3300005364 Bacteria 3976
167 Ga0070673_100226433 3300005364 Bacteria 1621
168 Ga0070673_100658848 3300005364 Bacteria 959
169 Ga0070659_100000191 3300005366 Bacteria 47035
170 Ga0070659_100017756 3300005366 Bacteria 5358
171 Ga0070659_100033034 3300005366 Bacteria 4018
172 Ga0070659_100039493 3300005366 Bacteria 3685
173 Ga0070659_100043632 3300005366 Bacteria 3507
174 Ga0070659_100066651 3300005366 Bacteria 2853
175 Ga0070659_100067036 3300005366 Bacteria 2846
176 Ga0070659_100423186 3300005366 Bacteria 1126
177 Ga0070659_100448781 3300005366 Bacteria 1094
178 Ga0070667_100000143 3300005367 Bacteria 90358
179 Ga0070667_100000286 3300005367 Bacteria 57006
180 Ga0070667_100000367 3300005367 Bacteria 49149
181 Ga0070667_100000725 3300005367 Bacteria 31653
182 Ga0070667_100034211 3300005367 Bacteria 4250
183 Ga0070667_100038587 3300005367 Bacteria 4004
184 Ga0070667_100265935 3300005367 Bacteria 1537
185 Ga0070667_100533049 3300005367 Bacteria 1078
186 Ga0070709_10016498 3300005434 Bacteria 4218
187 Ga0070714_100011330 3300005435 Bacteria 7071
188 Ga0070714_100156723 3300005435 Bacteria 2056
189 Ga0070713_100064528 3300005436 Bacteria 3074
190 Ga0070713_100087188 3300005436 Bacteria 2677
191 Ga0070713_100165627 3300005436 Bacteria 1976
192 Ga0070694_100086015 3300005444 Bacteria 2196
193 Ga0070663_100004783 3300005455 Bacteria 7986
194 Ga0070663_100008779 3300005455 Bacteria 6234
195 Ga0070663_100046160 3300005455 Bacteria 3081
196 Ga0070663_100083683 3300005455 Bacteria 2350
197 Ga0070663_100236458 3300005455 Bacteria 1441
198 Ga0070663_100377050 3300005455 Bacteria 1154
199 Ga0070678_100001063 3300005456 Bacteria 14344
200 Ga0070678_100033684 3300005456 Bacteria 3560
201 Ga0070678_100299879 3300005456 Bacteria 1365
202 Ga0070678_100334470 3300005456 Bacteria 1297
203 Ga0070662_100000012 3300005457 Bacteria 129380
204 Ga0070662_100001324 3300005457 Bacteria 15218
205 Ga0070662_100001565 3300005457 Bacteria 14148
206 Ga0070662_100002043 3300005457 Bacteria 12365
207 Ga0070662_100026436 3300005457 Bacteria 4020
208 Ga0070662_100049752 3300005457 Bacteria 3023
209 Ga0070662_100165319 3300005457 Bacteria 1733
210 Ga0070662_100827040 3300005457 Bacteria 788
211 Ga0070681_10006366 3300005458 Bacteria 11476
212 Ga0070681_10010175 3300005458 Bacteria 9277
213 Ga0068867_100000002 3300005459 Bacteria 247206
214 Ga0068867_100006572 3300005459 Bacteria 8214
215 Ga0068867_100071011 3300005459 Bacteria 2604
216 Ga0068867_100133018 3300005459 Bacteria 1935
217 Ga0070685_10077284 3300005466 Bacteria 1987
218 Ga0070679_100000001 3300005530 Bacteria 764811
219 Ga0070679_100005339 3300005530 Bacteria 11892
220 Ga0070679_100006705 3300005530 Bacteria 10738
221 Ga0070679_100080732 3300005530 Bacteria 3242
222 Ga0070679_100100254 3300005530 Bacteria 2883
223 Ga0070679_100589659 3300005530 Bacteria 1055
224 Ga0070684_100009174 3300005535 Bacteria 7780
225 Ga0070684_100559518 3300005535 Bacteria 1062
226 Ga0068853_100000032 3300005539 Bacteria 114306
227 Ga0068853_100003550 3300005539 Bacteria 11929
228 Ga0068853_100014991 3300005539 Bacteria 6368
229 Ga0068853_100065019 3300005539 Bacteria 3165
230 Ga0068853_100174373 3300005539 Bacteria 1947
231 Ga0070672_100224484 3300005543 Bacteria 1576
232 Ga0070672_100643002 3300005543 Bacteria 926
233 Ga0070695_100100790 3300005545 Bacteria 1945
234 Ga0070693_100000332 3300005547 Bacteria 21624
235 Ga0070693_100036501 3300005547 Bacteria 2733
236 Ga0070665_100000079 3300005548 Bacteria 186925
237 Ga0070665_100000084 3300005548 Bacteria 180481
238 Ga0070665_100003604 3300005548 Bacteria 16399
239 Ga0070665_100012237 3300005548 Bacteria 8649
240 Ga0070665_100034424 3300005548 Bacteria 5094
241 Ga0070665_100080538 3300005548 Bacteria 3262
242 Ga0068855_100000591 3300005563 Bacteria 44412
243 Ga0068855_100001164 3300005563 Bacteria 32603
244 Ga0068855_100007295 3300005563 Bacteria 13389
245 Ga0068855_100018573 3300005563 Bacteria 8362
246 Ga0068855_100032731 3300005563 Bacteria 6207
247 Ga0068855_100034640 3300005563 Bacteria 6018
248 Ga0068855_100095837 3300005563 Bacteria 3420
249 Ga0068855_100153975 3300005563 Bacteria 2613
250 Ga0068855_100245833 3300005563 Bacteria 1997
251 Ga0068855_100449134 3300005563 Bacteria 1407
252 Ga0068855_100789685 3300005563 Bacteria 1010
253 Ga0070664_100000187 3300005564 Bacteria 43750
254 Ga0070664_100002928 3300005564 Bacteria 13816
255 Ga0070664_100016865 3300005564 Bacteria 5993
256 Ga0070664_100025790 3300005564 Bacteria 4872
257 Ga0070664_100073402 3300005564 Bacteria 2935
258 Ga0070664_100177595 3300005564 Bacteria 1891
259 Ga0070664_100767854 3300005564 Bacteria 900
260 Ga0068857_100007902 3300005577 Bacteria 9175
261 Ga0068857_100190219 3300005577 Bacteria 1869
262 Ga0068857_100436038 3300005577 Bacteria 1223
263 Ga0068857_100542997 3300005577 Bacteria 1094
264 Ga0068854_100003204 3300005578 Bacteria 10212
265 Ga0068854_100007226 3300005578 Bacteria 7091
266 Ga0068854_100026804 3300005578 Bacteria 3965
267 Ga0068854_100090117 3300005578 Bacteria 2280
268 Ga0068854_100111295 3300005578 Bacteria 2066
269 Ga0068854_100112344 3300005578 Bacteria 2057
270 Ga0068854_100252199 3300005578 Bacteria 1409
271 Ga0068854_100336372 3300005578 Bacteria 1232
272 Ga0068854_100552291 3300005578 Bacteria 977
273 Ga0068856_100000291 3300005614 Bacteria 54890
274 Ga0068856_100005719 3300005614 Bacteria 12247
275 Ga0068856_100143419 3300005614 Bacteria 2396
276 Ga0068852_100000906 3300005616 Bacteria 19629
277 Ga0068852_100001541 3300005616 Bacteria 15633
278 Ga0068852_100058362 3300005616 Bacteria 3343
279 Ga0068852_100137652 3300005616 Bacteria 2256
280 Ga0068852_100476231 3300005616 Bacteria 1240
281 Ga0068852_100647544 3300005616 Bacteria 1064
282 Ga0068852_101080088 3300005616 Bacteria 822
283 Ga0068859_100008247 3300005617 Bacteria 10565
284 Ga0068859_100090073 3300005617 Bacteria 3118
285 Ga0068859_100310836 3300005617 Bacteria 1669
286 Ga0068859_100603103 3300005617 Bacteria 1191
287 Ga0068864_100000051 3300005618 Bacteria 136621
288 Ga0068864_100000100 3300005618 Bacteria 85101
289 Ga0068864_100034890 3300005618 Bacteria 4281
290 Ga0068864_100104055 3300005618 Bacteria 2521
291 Ga0068864_100113092 3300005618 Bacteria 2420
292 Ga0068866_10096709 3300005718 Bacteria 1620
293 Ga0068861_100038439 3300005719 Bacteria 3564
294 Ga0068851_10010180 3300005834 Bacteria 4384
295 Ga0068851_10019263 3300005834 Bacteria 3296
296 Ga0068851_10019743 3300005834 Bacteria 3257
297 Ga0068851_10090672 3300005834 Bacteria 1609
298 Ga0068851_10096921 3300005834 Bacteria 1560
299 Ga0068851_10335431 3300005834 Bacteria 876
300 Ga0068870_10039947 3300005840 Bacteria 2430
301 Ga0068870_10262608 3300005840 Bacteria 1075
302 Ga0068863_100000025 3300005841 Bacteria 186072
303 Ga0068863_100000168 3300005841 Bacteria 70935
304 Ga0068863_100001489 3300005841 Bacteria 23203
305 Ga0068863_100058470 3300005841 Bacteria 3648
306 Ga0068863_100081951 3300005841 Bacteria 3057
307 Ga0068863_100193604 3300005841 Bacteria 1954
308 Ga0068858_100000673 3300005842 Bacteria 35672
309 Ga0068858_100000848 3300005842 Bacteria 31661
310 Ga0068858_100023512 3300005842 Bacteria 5740
311 Ga0068858_100043159 3300005842 Bacteria 4181
312 Ga0068858_100052186 3300005842 Bacteria 3783
313 Ga0068858_100071318 3300005842 Bacteria 3222
314 Ga0068858_100665973 3300005842 Bacteria 1012
315 Ga0068860_100000181 3300005843 Bacteria 101627
316 Ga0068860_100027199 3300005843 Bacteria 5511
317 Ga0068860_100067993 3300005843 Bacteria 3385
318 Ga0068860_100096161 3300005843 Bacteria 2823
319 Ga0068860_100166266 3300005843 Bacteria 2129
320 Ga0068862_100000027 3300005844 Bacteria 186072
321 Ga0068862_100000036 3300005844 Bacteria 173453
322 Ga0068862_100004531 3300005844 Bacteria 11717
323 Ga0068862_100024495 3300005844 Bacteria 5064
324 Ga0068862_100386147 3300005844 Bacteria 1307
325 Ga0068862_100431342 3300005844 Bacteria 1239
326 Ga0068862_100749193 3300005844 Bacteria 950
327 Ga0081540_1099998 3300005983 Bacteria 1251
328 Ga0081539_10008794 3300005985 Bacteria 8651
329 Ga0081539_10019519 3300005985 Bacteria 4633
330 Ga0070717_10004794 3300006028 Bacteria 9837
331 Ga0070717_10109103 3300006028 Bacteria 2358
332 Ga0075368_10000304 3300006042 Bacteria 14246
333 Ga0075368_10000450 3300006042 Bacteria 12161
334 Ga0075363_100093715 3300006048 Bacteria 1655
335 Ga0075364_10341720 3300006051 Bacteria 1020
336 Ga0070716_100017029 3300006173 Bacteria 3761
337 Ga0070716_100129508 3300006173 Bacteria 1593
338 Ga0070712_100043513 3300006175 Bacteria 3091
339 Ga0070712_100203183 3300006175 Bacteria 1558
340 Ga0075362_10001064 3300006177 Bacteria 8483
341 Ga0075362_10034007 3300006177 Bacteria 2220
342 Ga0075367_10007487 3300006178 Bacteria 5593
343 Ga0075367_10022925 3300006178 Bacteria 3508
344 Ga0075369_10005423 3300006186 Bacteria 4766
345 Ga0075369_10096406 3300006186 Bacteria 1324
346 Ga0075366_10087603 3300006195 Bacteria 1864
347 Ga0097621_100001876 3300006237 Bacteria 14391
348 Ga0097621_100081758 3300006237 Bacteria 2689
349 Ga0097621_100104675 3300006237 Bacteria 2385
350 Ga0097621_100202373 3300006237 Bacteria 1724
351 Ga0097621_100244043 3300006237 Bacteria 1571
352 Ga0097621_100397715 3300006237 Bacteria 1233
353 Ga0068871_100007505 3300006358 Bacteria 7797
354 Ga0068871_100062791 3300006358 Bacteria 3037
355 Ga0068871_100120505 3300006358 Bacteria 2216
356 Ga0068871_100224978 3300006358 Bacteria 1627
357 Ga0068871_100672249 3300006358 Bacteria 947
358 Ga0075429_100129397 3300006880 Bacteria 2208
359 Ga0068865_100000014 3300006881 Bacteria 138727
360 Ga0068865_100073741 3300006881 Bacteria 2428
361 Ga0068865_100830307 3300006881 Bacteria 799
362 Ga0097620_100008247 3300006931 Bacteria 10565
363 Ga0097620_100024043 3300006931 Bacteria 6114
364 Ga0097620_100090076 3300006931 Bacteria 3118
365 Ga0097620_100310844 3300006931 Bacteria 1669
366 Ga0097620_100603134 3300006931 Bacteria 1191
367 Ga0079104_1016890 3300006946 Bacteria 2116
368 Ga0079104_1030833 3300006946 Bacteria 1335
369 Ga0105251_10000232 3300009011 Bacteria 56006
370 Ga0105251_10000554 3300009011 Bacteria 35071
371 Ga0105251_10030739 3300009011 Bacteria 2693
372 Ga0105251_10127682 3300009011 Bacteria 1153
373 Ga0105250_10127622 3300009092 Bacteria 1048
374 Ga0105240_10108042 3300009093 Bacteria 3371
375 Ga0105240_10163937 3300009093 Bacteria 2638
376 Ga0105240_10243049 3300009093 Bacteria 2086
377 Ga0105240_10292795 3300009093 Bacteria 1865
378 Ga0105240_11331320 3300009093 Bacteria 757
379 Ga0105245_10000160 3300009098 Bacteria 63445
380 Ga0105245_10013224 3300009098 Bacteria 7191
381 Ga0105245_10018347 3300009098 Bacteria 6118
382 Ga0105247_10057877 3300009101 Bacteria 2397
383 Ga0114129_10257351 3300009147 Bacteria 2341
384 Ga0105243_10000070 3300009148 Bacteria 120851
385 Ga0105243_10005193 3300009148 Bacteria 10193
386 Ga0105243_10055563 3300009148 Bacteria 3146
387 Ga0105243_10130908 3300009148 Bacteria 2128
388 Ga0105243_10229689 3300009148 Bacteria 1645
389 Ga0105243_10745781 3300009148 Bacteria 959
390 Ga0105241_10030368 3300009174 Bacteria 4037
391 Ga0105241_10077362 3300009174 Bacteria 2597
392 Ga0105241_10158703 3300009174 Bacteria 1857
393 Ga0105241_10266923 3300009174 Bacteria 1456
394 Ga0105241_10762377 3300009174 Bacteria 888
395 Ga0105242_10001604 3300009176 Bacteria 17808
396 Ga0105242_10188683 3300009176 Bacteria 1823
397 Ga0105248_10000083 3300009177 Bacteria 110619
398 Ga0105248_10001385 3300009177 Bacteria 27005
399 Ga0105248_10002034 3300009177 Bacteria 22430
400 Ga0105248_10023944 3300009177 Bacteria 6787
401 Ga0105248_10024368 3300009177 Bacteria 6730
402 Ga0105248_10032701 3300009177 Bacteria 5810
403 Ga0105248_10091313 3300009177 Bacteria 3430
404 Ga0105248_10155436 3300009177 Bacteria 2581
405 Ga0105248_10354956 3300009177 Bacteria 1651
406 Ga0105237_10005695 3300009545 Bacteria 14014
407 Ga0105237_10017062 3300009545 Bacteria 7535
408 Ga0105237_10097580 3300009545 Bacteria 2929
409 Ga0105237_10215362 3300009545 Bacteria 1921
410 Ga0105238_10015678 3300009551 Bacteria 7672
411 Ga0105238_10024071 3300009551 Bacteria 6208
412 Ga0105238_10116826 3300009551 Bacteria 2647
413 Ga0105238_10173208 3300009551 Bacteria 2134
414 Ga0105238_10373185 3300009551 Bacteria 1417
415 Ga0105238_11024103 3300009551 Bacteria 847
416 Ga0105238_11607096 3300009551 Bacteria 680
417 Ga0105249_10000110 3300009553 Bacteria 111292
418 Ga0105249_10015328 3300009553 Bacteria 6783
419 Ga0105249_10096719 3300009553 Bacteria 2771
420 Ga0105249_10201195 3300009553 Bacteria 1949
421 Ga0105249_10433131 3300009553 Bacteria 1351
422 Ga0105249_11029498 3300009553 Bacteria 892
423 Ga0105148_100275 3300009978 Bacteria 6836
424 Ga0105148_117869 3300009978 Bacteria 564
425 Ga0105147_101564 3300009982 Bacteria 1876
426 Ga0105239_10000271 3300010375 Bacteria 76812
427 Ga0105239_10102466 3300010375 Bacteria 3168
428 Ga0105239_10110863 3300010375 Bacteria 3041
429 Ga0105239_10147805 3300010375 Bacteria 2622
430 Ga0105239_11069256 3300010375 Bacteria 928
431 Ga0105239_11248926 3300010375 Bacteria 856
432 Ga0105246_10002314 3300011119 Bacteria 11507
433 Ga0105246_10003501 3300011119 Bacteria 9510
434 Ga0105246_10008646 3300011119 Bacteria 6261
435 Ga0105246_10080366 3300011119 Bacteria 2321
436 Ga0157326_1000005 3300012513 Bacteria 18291
437 Ga0157326_1003871 3300012513 Bacteria 1572
438 Ga0157373_10006989 3300013100 Bacteria 8406
439 Ga0157373_10029859 3300013100 Bacteria 3925
440 Ga0157373_10039126 3300013100 Bacteria 3396
441 Ga0157373_10147818 3300013100 Bacteria 1653
442 Ga0157373_10231884 3300013100 Bacteria 1304
443 Ga0157373_10476278 3300013100 Bacteria 900
444 Ga0157373_10671609 3300013100 Bacteria 758
445 Ga0157371_10000011 3300013102 Bacteria 377608
446 Ga0157371_10001091 3300013102 Bacteria 29403
447 Ga0157371_10007915 3300013102 Bacteria 8529
448 Ga0157371_10077146 3300013102 Bacteria 2359
449 Ga0157371_10167994 3300013102 Bacteria 1567
450 Ga0157371_10203577 3300013102 Bacteria 1419
451 Ga0157371_10235898 3300013102 Bacteria 1315
452 Ga0157371_10606890 3300013102 Bacteria 814
453 Ga0157371_10608377 3300013102 Bacteria 813
454 Ga0157370_10002905 3300013104 Bacteria 20434
455 Ga0157370_11001809 3300013104 Bacteria 756
456 Ga0157369_10021625 3300013105 Bacteria 7194
457 Ga0157369_10157781 3300013105 Bacteria 2396
458 Ga0157369_10780179 3300013105 Bacteria 982
459 Ga0157374_10000542 3300013296 Bacteria 33699
460 Ga0157374_10186177 3300013296 Bacteria 2030
461 Ga0157374_10244501 3300013296 Bacteria 1765
462 Ga0157374_10389936 3300013296 Bacteria 1388
463 Ga0157374_10836077 3300013296 Bacteria 937
464 Ga0157378_10000624 3300013297 Bacteria 33307
465 Ga0157378_10021072 3300013297 Bacteria 5734
466 Ga0157378_10060444 3300013297 Bacteria 3382
467 Ga0157378_11306933 3300013297 Bacteria 766
468 Ga0163162_10009970 3300013306 Bacteria 9240
469 Ga0163162_10015197 3300013306 Bacteria 7520
470 Ga0163162_10305478 3300013306 Bacteria 1723
471 Ga0163162_10335390 3300013306 Bacteria 1645
472 Ga0163162_10363202 3300013306 Bacteria 1581
473 Ga0157372_10008443 3300013307 Bacteria 10936
474 Ga0157372_10093707 3300013307 Bacteria 3418
475 Ga0157372_10293339 3300013307 Bacteria 1891
476 Ga0157372_11391257 3300013307 Bacteria 809
477 Ga0157375_10027717 3300013308 Bacteria 5299
478 Ga0157375_10090533 3300013308 Bacteria 3118
479 Ga0163163_10001064 3300014325 Bacteria 23319
480 Ga0163163_10006906 3300014325 Bacteria 9963
481 Ga0163163_10015984 3300014325 Bacteria 6955
482 Ga0157380_10000315 3300014326 Bacteria 29340
483 Ga0157380_10000763 3300014326 Bacteria 20083
484 Ga0157380_10022724 3300014326 Bacteria 4728
485 Ga0157380_10113655 3300014326 Bacteria 2280
486 Ga0157380_10194137 3300014326 Bacteria 1795
487 Ga0157380_10410985 3300014326 Bacteria 1287
488 Ga0182008_10126272 3300014497 Bacteria 1274
489 Ga0157377_10037303 3300014745 Bacteria 2677
490 Ga0157377_10271498 3300014745 Bacteria 1108
491 Ga0157379_10003811 3300014968 Bacteria 12853
492 Ga0157379_10104620 3300014968 Bacteria 2540
493 Ga0157379_10702359 3300014968 Bacteria 949
494 Ga0157376_10000096 3300014969 Bacteria 65482
495 Ga0183363_1003 3300015690 Bacteria 421263
496 Ga0163161_10044190 3300017792 Bacteria 3209
497 Ga0163161_10046559 3300017792 Bacteria 3129
498 Ga0163161_10106148 3300017792 Bacteria 2096
499 Ga0163161_10107867 3300017792 Bacteria 2079
500 Ga0163161_10295126 3300017792 Bacteria 1275
501 Ga0209147_100298 3300025229 Bacteria 40972
502 Ga0209563_100125 3300025230 Bacteria 113854
503 Ga0209148_1000008 3300025254 Bacteria 1504371
504 Ga0209148_1000147 3300025254 Bacteria 160231
505 Ga0209148_1002428 3300025254 Bacteria 6428
506 Ga0209233_1000140 3300025261 Bacteria 193274
507 Ga0209233_1027364 3300025261 Bacteria 1382
508 Ga0209455_1000002 3300025272 Bacteria 1505459
509 Ga0209455_1000707 3300025272 Bacteria 19438
510 Ga0209455_1009390 3300025272 Bacteria 2573
511 Ga0209675_1000181 3300025291 Bacteria 71490
512 Ga0209676_1000084 3300025292 Bacteria 274330
513 Ga0209676_1000330 3300025292 Bacteria 91216
514 Ga0209676_1000479 3300025292 Bacteria 65868
515 Ga0209676_1032030 3300025292 Bacteria 1587
516 Ga0209025_1022687 3300025294 Bacteria 3316
517 Ga0209758_1000017 3300025297 Bacteria 754393
518 Ga0209050_1000113 3300025298 Bacteria 209222
519 Ga0209050_1000254 3300025298 Bacteria 114395
520 Ga0209050_1001453 3300025298 Bacteria 25414
521 Ga0209050_1048216 3300025298 Bacteria 1102
522 Ga0209257_1000083 3300025304 Bacteria 296207
523 Ga0209257_1000126 3300025304 Bacteria 215705
524 Ga0209257_1000340 3300025304 Bacteria 97492
525 Ga0209257_1001209 3300025304 Bacteria 32418
526 Ga0209257_1053361 3300025304 Bacteria 1131
527 Ga0207697_10035799 3300025315 Bacteria 2033
528 Ga0207697_10047244 3300025315 Bacteria 1774
529 Ga0207697_10077367 3300025315 Bacteria 1399
530 Ga0207697_10084306 3300025315 Bacteria 1341
531 Ga0207697_10211268 3300025315 Bacteria 855
532 Ga0207656_10001253 3300025321 Bacteria 8367
533 Ga0207656_10034991 3300025321 Bacteria 2100
534 Ga0207656_10069520 3300025321 Bacteria 1562
535 Ga0207656_10079265 3300025321 Bacteria 1473
536 Ga0207656_10196397 3300025321 Bacteria 973
537 Ga0207713_1000615 3300025735 Bacteria 35051
538 Ga0207713_1001012 3300025735 Bacteria 24466
539 Ga0207713_1060220 3300025735 Bacteria 1452
540 Ga0207682_10000542 3300025893 Bacteria 17400
541 Ga0207682_10035626 3300025893 Bacteria 2011
542 Ga0207642_10064108 3300025899 Bacteria 1721
543 Ga0207688_10067605 3300025901 Bacteria 2022
544 Ga0207688_10145818 3300025901 Bacteria 1395
545 Ga0207688_10148226 3300025901 Bacteria 1384
546 Ga0207688_10198933 3300025901 Bacteria 1201
547 Ga0207680_10001307 3300025903 Bacteria 11765
548 Ga0207680_10053944 3300025903 Bacteria 2416
549 Ga0207680_10555348 3300025903 Bacteria 820
550 Ga0207647_10000389 3300025904 Bacteria 35906
551 Ga0207647_10000850 3300025904 Bacteria 23703
552 Ga0207647_10019227 3300025904 Bacteria 4597
553 Ga0207647_10041178 3300025904 Bacteria 2906
554 Ga0207647_10084197 3300025904 Bacteria 1903
555 Ga0207647_10085879 3300025904 Bacteria 1881
556 Ga0207645_10000470 3300025907 Bacteria 33310
557 Ga0207645_10008376 3300025907 Bacteria 7213
558 Ga0207645_10030439 3300025907 Bacteria 3477
559 Ga0207645_10044108 3300025907 Bacteria 2854
560 Ga0207645_10208853 3300025907 Bacteria 1286
561 Ga0207643_10033802 3300025908 Bacteria 2861
562 Ga0207705_10000042 3300025909 Bacteria 182120
563 Ga0207705_10000072 3300025909 Bacteria 126043
564 Ga0207705_10000236 3300025909 Bacteria 54788
565 Ga0207705_10007727 3300025909 Bacteria 7904
566 Ga0207705_10009210 3300025909 Bacteria 7190
567 Ga0207705_10018377 3300025909 Bacteria 4999
568 Ga0207705_10028048 3300025909 Bacteria 4014
569 Ga0207705_10093631 3300025909 Bacteria 2203
570 Ga0207705_10151259 3300025909 Bacteria 1739
571 Ga0207705_10318355 3300025909 Bacteria 1195
572 Ga0207705_10479483 3300025909 Bacteria 965
573 Ga0207654_10000246 3300025911 Bacteria 32849
574 Ga0207654_10159335 3300025911 Bacteria 1456
575 Ga0207654_10230549 3300025911 Bacteria 1233
576 Ga0207654_10480107 3300025911 Bacteria 875
577 Ga0207707_10006710 3300025912 Bacteria 10049
578 Ga0207707_10047954 3300025912 Bacteria 3721
579 Ga0207695_10005291 3300025913 Bacteria 17200
580 Ga0207695_10124680 3300025913 Bacteria 2540
581 Ga0207695_11005375 3300025913 Bacteria 714
582 Ga0207671_10000955 3300025914 Bacteria 35890
583 Ga0207671_10044155 3300025914 Bacteria 3296
584 Ga0207693_10014544 3300025915 Bacteria 6324
585 Ga0207693_10053263 3300025915 Bacteria 3175
586 Ga0207660_10001102 3300025917 Bacteria 18028
587 Ga0207657_10000176 3300025919 Bacteria 65856
588 Ga0207657_10000764 3300025919 Bacteria 34123
589 Ga0207657_10000837 3300025919 Bacteria 32516
590 Ga0207657_10000900 3300025919 Bacteria 31430
591 Ga0207657_10003875 3300025919 Bacteria 15879
592 Ga0207657_10005081 3300025919 Bacteria 13794
593 Ga0207657_10008183 3300025919 Bacteria 10654
594 Ga0207657_10009556 3300025919 Bacteria 9733
595 Ga0207657_10024081 3300025919 Bacteria 5651
596 Ga0207657_10027473 3300025919 Bacteria 5211
597 Ga0207657_10164063 3300025919 Bacteria 1803
598 Ga0207657_10434088 3300025919 Bacteria 1031
599 Ga0207649_10000027 3300025920 Bacteria 161926
600 Ga0207649_10000810 3300025920 Bacteria 20093
601 Ga0207649_10002323 3300025920 Bacteria 10680
602 Ga0207649_10005378 3300025920 Bacteria 6931
603 Ga0207649_10086734 3300025920 Bacteria 2040
604 Ga0207649_10199137 3300025920 Bacteria 1414
605 Ga0207649_10388902 3300025920 Bacteria 1041
606 Ga0207652_10000003 3300025921 Bacteria 502441
607 Ga0207652_10000489 3300025921 Bacteria 40293
608 Ga0207652_10027113 3300025921 Bacteria 4774
609 Ga0207652_10035093 3300025921 Bacteria 4232
610 Ga0207652_10068878 3300025921 Bacteria 3071
611 Ga0207652_10181942 3300025921 Bacteria 1889
612 Ga0207652_10378410 3300025921 Bacteria 1278
613 Ga0207681_10000061 3300025923 Bacteria 102257
614 Ga0207681_10002744 3300025923 Bacteria 11146
615 Ga0207681_10005152 3300025923 Bacteria 8028
616 Ga0207681_10090692 3300025923 Bacteria 2182
617 Ga0207681_10131345 3300025923 Bacteria 1852
618 Ga0207681_10254450 3300025923 Bacteria 1372
619 Ga0207694_10005386 3300025924 Bacteria 9850
620 Ga0207694_10036581 3300025924 Bacteria 3768
621 Ga0207694_10098020 3300025924 Bacteria 2320
622 Ga0207694_10443780 3300025924 Bacteria 1083
623 Ga0207694_10822103 3300025924 Bacteria 785
624 Ga0207694_10905958 3300025924 Bacteria 746
625 Ga0207650_10000056 3300025925 Bacteria 157972
626 Ga0207650_10000645 3300025925 Bacteria 27715
627 Ga0207650_10007357 3300025925 Bacteria 7494
628 Ga0207650_10034652 3300025925 Bacteria 3662
629 Ga0207650_10071175 3300025925 Bacteria 2615
630 Ga0207650_10137220 3300025925 Bacteria 1920
631 Ga0207659_10011390 3300025926 Bacteria 5616
632 Ga0207659_10069623 3300025926 Bacteria 2563
633 Ga0207659_10137601 3300025926 Bacteria 1892
634 Ga0207659_10783826 3300025926 Bacteria 819
635 Ga0207687_10000252 3300025927 Bacteria 36302
636 Ga0207687_10000892 3300025927 Bacteria 20277
637 Ga0207687_10059042 3300025927 Bacteria 2701
638 Ga0207700_10032777 3300025928 Bacteria 3710
639 Ga0207700_10255321 3300025928 Bacteria 1499
640 Ga0207664_10149793 3300025929 Bacteria 1981
641 Ga0207664_10509315 3300025929 Bacteria 1078
642 Ga0207644_10018835 3300025931 Bacteria 4677
643 Ga0207644_10026256 3300025931 Bacteria 4011
644 Ga0207644_10059655 3300025931 Bacteria 2759
645 Ga0207644_10063814 3300025931 Bacteria 2675
646 Ga0207644_10190814 3300025931 Bacteria 1611
647 Ga0207644_10200922 3300025931 Bacteria 1572
648 Ga0207690_10000245 3300025932 Bacteria 39464
649 Ga0207690_10000630 3300025932 Bacteria 22732
650 Ga0207690_10001503 3300025932 Bacteria 14574
651 Ga0207690_10022521 3300025932 Bacteria 3921
652 Ga0207690_10071040 3300025932 Bacteria 2400
653 Ga0207690_10083137 3300025932 Bacteria 2241
654 Ga0207690_10171137 3300025932 Bacteria 1627
655 Ga0207690_10198124 3300025932 Bacteria 1523
656 Ga0207690_10227900 3300025932 Bacteria 1429
657 Ga0207690_10229078 3300025932 Bacteria 1425
658 Ga0207690_10244142 3300025932 Bacteria 1384
659 Ga0207690_10259225 3300025932 Bacteria 1346
660 Ga0207690_10390236 3300025932 Bacteria 1108
661 Ga0207690_10645490 3300025932 Bacteria 867
662 Ga0207690_10798539 3300025932 Bacteria 780
663 Ga0207690_10934350 3300025932 Bacteria 720
664 Ga0207706_10000041 3300025933 Bacteria 130090
665 Ga0207706_10001361 3300025933 Bacteria 24433
666 Ga0207706_10009320 3300025933 Bacteria 9013
667 Ga0207706_10021878 3300025933 Bacteria 5739
668 Ga0207706_10028567 3300025933 Bacteria 4981
669 Ga0207706_10032833 3300025933 Bacteria 4619
670 Ga0207706_10327574 3300025933 Bacteria 1333
671 Ga0207706_10401387 3300025933 Bacteria 1188
672 Ga0207686_10002334 3300025934 Bacteria 10371
673 Ga0207686_10048837 3300025934 Bacteria 2624
674 Ga0207709_10000066 3300025935 Bacteria 189194
675 Ga0207709_10000116 3300025935 Bacteria 123061
676 Ga0207709_10018879 3300025935 Bacteria 3867
677 Ga0207709_10033589 3300025935 Bacteria 3014
678 Ga0207709_10183311 3300025935 Bacteria 1480
679 Ga0207669_10000022 3300025937 Bacteria 100002
680 Ga0207669_10015833 3300025937 Bacteria 3814
681 Ga0207669_10062042 3300025937 Bacteria 2300
682 Ga0207669_10101776 3300025937 Bacteria 1901
683 Ga0207669_10113323 3300025937 Bacteria 1823
684 Ga0207704_10000002 3300025938 Bacteria 303025
685 Ga0207704_10000007 3300025938 Bacteria 211230
686 Ga0207704_10054761 3300025938 Bacteria 2434
687 Ga0207704_10164991 3300025938 Bacteria 1581
688 Ga0207704_10183549 3300025938 Bacteria 1514
689 Ga0207665_10013175 3300025939 Bacteria 5437
690 Ga0207691_10010000 3300025940 Bacteria 9107
691 Ga0207691_10017215 3300025940 Bacteria 6857
692 Ga0207691_10513215 3300025940 Bacteria 1017
693 Ga0207691_10519937 3300025940 Bacteria 1010
694 Ga0207711_10000254 3300025941 Bacteria 57648
695 Ga0207711_10002858 3300025941 Bacteria 15138
696 Ga0207711_10019188 3300025941 Bacteria 5693
697 Ga0207711_10033796 3300025941 Bacteria 4329
698 Ga0207711_10043144 3300025941 Bacteria 3846
699 Ga0207711_11183716 3300025941 Bacteria 706
700 Ga0207689_10000060 3300025942 Bacteria 85326
701 Ga0207689_10003854 3300025942 Bacteria 13672
702 Ga0207689_10156309 3300025942 Bacteria 1880
703 Ga0207661_10000953 3300025944 Bacteria 19059
704 Ga0207661_10019161 3300025944 Bacteria 5096
705 Ga0207679_10000243 3300025945 Bacteria 41706
706 Ga0207679_10006441 3300025945 Bacteria 7418
707 Ga0207679_10016805 3300025945 Bacteria 4864
708 Ga0207679_10025671 3300025945 Bacteria 4055
709 Ga0207679_10049249 3300025945 Bacteria 3073
710 Ga0207679_10062972 3300025945 Bacteria 2766
711 Ga0207679_10094259 3300025945 Bacteria 2324
712 Ga0207679_10206807 3300025945 Bacteria 1643
713 Ga0207679_10728949 3300025945 Bacteria 901
714 Ga0207667_10000001 3300025949 Bacteria 1178522
715 Ga0207667_10000017 3300025949 Bacteria 390654
716 Ga0207667_10006092 3300025949 Bacteria 14659
717 Ga0207667_10007578 3300025949 Bacteria 13019
718 Ga0207667_10017260 3300025949 Bacteria 8130
719 Ga0207667_10017604 3300025949 Bacteria 8036
720 Ga0207667_10028549 3300025949 Bacteria 6059
721 Ga0207667_10031849 3300025949 Bacteria 5688
722 Ga0207667_10033839 3300025949 Bacteria 5491
723 Ga0207667_10064139 3300025949 Bacteria 3836
724 Ga0207667_10201249 3300025949 Bacteria 2043
725 Ga0207667_11003548 3300025949 Bacteria 822
726 Ga0207651_10000004 3300025960 Bacteria 290191
727 Ga0207651_10099174 3300025960 Bacteria 2156
728 Ga0207651_10201365 3300025960 Bacteria 1596
729 Ga0207651_10501208 3300025960 Bacteria 1049
730 Ga0207651_10557147 3300025960 Bacteria 997
731 Ga0207712_10001154 3300025961 Bacteria 18388
732 Ga0207712_10007169 3300025961 Bacteria 7030
733 Ga0207712_10009916 3300025961 Bacteria 6038
734 Ga0207712_10068412 3300025961 Bacteria 2544
735 Ga0207712_10519690 3300025961 Bacteria 1020
736 Ga0207712_10574041 3300025961 Bacteria 972
737 Ga0207668_10000050 3300025972 Bacteria 98767
738 Ga0207668_10008350 3300025972 Bacteria 6167
739 Ga0207668_10024423 3300025972 Bacteria 3900
740 Ga0207668_10025165 3300025972 Bacteria 3849
741 Ga0207668_10036914 3300025972 Bacteria 3266
742 Ga0207668_10060121 3300025972 Bacteria 2666
743 Ga0207668_10096392 3300025972 Bacteria 2186
744 Ga0207668_10100343 3300025972 Bacteria 2149
745 Ga0207668_10136193 3300025972 Bacteria 1882
746 Ga0207668_10196533 3300025972 Bacteria 1603
747 Ga0207640_10000695 3300025981 Bacteria 19606
748 Ga0207640_10003242 3300025981 Bacteria 8767
749 Ga0207640_10009695 3300025981 Bacteria 5401
750 Ga0207640_10010412 3300025981 Bacteria 5240
751 Ga0207640_10022324 3300025981 Bacteria 3786
752 Ga0207640_10022842 3300025981 Bacteria 3750
753 Ga0207640_10050304 3300025981 Bacteria 2703
754 Ga0207640_10057393 3300025981 Bacteria 2560
755 Ga0207640_10254719 3300025981 Bacteria 1364
756 Ga0207640_10848116 3300025981 Bacteria 795
757 Ga0207658_10000109 3300025986 Bacteria 89979
758 Ga0207658_10000243 3300025986 Bacteria 57023
759 Ga0207658_10000831 3300025986 Bacteria 25797
760 Ga0207658_10001229 3300025986 Bacteria 20259
761 Ga0207658_10007072 3300025986 Bacteria 7643
762 Ga0207658_10019968 3300025986 Bacteria 4637
763 Ga0207658_10333312 3300025986 Bacteria 1317
764 Ga0207658_10469643 3300025986 Bacteria 1116
765 Ga0207658_10482858 3300025986 Bacteria 1101
766 Ga0207677_10000231 3300026023 Bacteria 43615
767 Ga0207677_10105098 3300026023 Bacteria 2089
768 Ga0207677_10150276 3300026023 Bacteria 1796
769 Ga0207703_10000167 3300026035 Bacteria 76517
770 Ga0207703_10000302 3300026035 Bacteria 54142
771 Ga0207703_10001218 3300026035 Bacteria 24067
772 Ga0207703_10022812 3300026035 Bacteria 4917
773 Ga0207703_10165021 3300026035 Bacteria 1943
774 Ga0207703_11233867 3300026035 Bacteria 719
775 Ga0207639_10000222 3300026041 Bacteria 42464
776 Ga0207639_10001618 3300026041 Bacteria 15148
777 Ga0207639_10002807 3300026041 Bacteria 11688
778 Ga0207639_10004222 3300026041 Bacteria 9682
779 Ga0207639_10044491 3300026041 Bacteria 3339
780 Ga0207639_10119275 3300026041 Bacteria 2165
781 Ga0207639_10192428 3300026041 Bacteria 1743
782 Ga0207639_10372545 3300026041 Bacteria 1280
783 Ga0207678_10000427 3300026067 Bacteria 38170
784 Ga0207678_10002526 3300026067 Bacteria 16670
785 Ga0207678_10009305 3300026067 Bacteria 8648
786 Ga0207678_10009690 3300026067 Bacteria 8475
787 Ga0207678_10025204 3300026067 Bacteria 5191
788 Ga0207678_10029423 3300026067 Bacteria 4794
789 Ga0207678_10033366 3300026067 Bacteria 4485
790 Ga0207678_10130264 3300026067 Bacteria 2145
791 Ga0207678_10349584 3300026067 Bacteria 1275
792 Ga0207702_10000074 3300026078 Bacteria 113070
793 Ga0207702_10004354 3300026078 Bacteria 12627
794 Ga0207702_10067615 3300026078 Bacteria 3067
795 Ga0207702_10142238 3300026078 Bacteria 2172
796 Ga0207702_10245637 3300026078 Bacteria 1679
797 Ga0207702_10931312 3300026078 Bacteria 861
798 Ga0207702_10954380 3300026078 Bacteria 850
799 Ga0207641_10000018 3300026088 Bacteria 298209
800 Ga0207641_10000241 3300026088 Bacteria 71027
801 Ga0207641_10000755 3300026088 Bacteria 34850
802 Ga0207641_10001790 3300026088 Bacteria 20701
803 Ga0207641_10033823 3300026088 Bacteria 4248
804 Ga0207641_10232662 3300026088 Bacteria 1713
805 Ga0207641_10306438 3300026088 Bacteria 1502
806 Ga0207641_10331658 3300026088 Bacteria 1445
807 Ga0207648_10000003 3300026089 Bacteria 289983
808 Ga0207648_10004533 3300026089 Bacteria 14239
809 Ga0207648_10008748 3300026089 Bacteria 9757
810 Ga0207648_10043805 3300026089 Bacteria 3929
811 Ga0207648_10059901 3300026089 Bacteria 3320
812 Ga0207676_10000021 3300026095 Bacteria 296572
813 Ga0207676_10000027 3300026095 Bacteria 245868
814 Ga0207676_10000344 3300026095 Bacteria 39948
815 Ga0207676_10007462 3300026095 Bacteria 7760
816 Ga0207676_10036224 3300026095 Bacteria 3752
817 Ga0207676_10698306 3300026095 Bacteria 983
818 Ga0207674_10004106 3300026116 Bacteria 17638
819 Ga0207674_10006823 3300026116 Bacteria 13393
820 Ga0207674_10012801 3300026116 Bacteria 9366
821 Ga0207674_10038792 3300026116 Bacteria 4941
822 Ga0207674_10154090 3300026116 Bacteria 2253
823 Ga0207674_10155404 3300026116 Bacteria 2243
824 Ga0207674_10372997 3300026116 Bacteria 1379
825 Ga0207675_100001147 3300026118 Bacteria 26263
826 Ga0207675_100440544 3300026118 Bacteria 1289
827 Ga0207683_10015482 3300026121 Bacteria 6496
828 Ga0207683_10015611 3300026121 Bacteria 6464
829 Ga0207683_10058649 3300026121 Bacteria 3380
830 Ga0207683_10320182 3300026121 Bacteria 1421
831 Ga0207683_10335183 3300026121 Bacteria 1387
832 Ga0207698_10000892 3300026142 Bacteria 17333
833 Ga0207698_10001072 3300026142 Bacteria 15905
834 Ga0207698_10006957 3300026142 Bacteria 7077
835 Ga0207698_10033576 3300026142 Bacteria 3730
836 Ga0207698_10034897 3300026142 Bacteria 3673
837 Ga0207698_10080661 3300026142 Bacteria 2622
838 Ga0207698_10173871 3300026142 Bacteria 1900
839 Ga0207698_10397770 3300026142 Bacteria 1316
840 Ga0207698_11204589 3300026142 Bacteria 771
841 Ga0209973_1085743 3300027252 Bacteria 504
842 Ga0209983_1013449 3300027665 Bacteria 1683
843 Ga0209971_1038769 3300027682 Bacteria 1147
844 Ga0209813_10000007 3300027866 Bacteria 104066
845 Ga0209813_10000279 3300027866 Bacteria 14382
846 Ga0209974_10003536 3300027876 Bacteria 5619
847 Ga0268266_10000002 3300028379 Bacteria 3059047
848 Ga0268266_10000175 3300028379 Bacteria 115897
849 Ga0268266_10001810 3300028379 Bacteria 24195
850 Ga0268266_10005157 3300028379 Bacteria 12305
851 Ga0268266_10013052 3300028379 Bacteria 7163
852 Ga0268266_10025965 3300028379 Bacteria 4983
853 Ga0268266_10258148 3300028379 Bacteria 1614
854 Ga0268266_10502646 3300028379 Bacteria 1158
855 Ga0268266_10623025 3300028379 Bacteria 1037
856 Ga0268265_10000042 3300028380 Bacteria 186086
857 Ga0268265_10000052 3300028380 Bacteria 174254
858 Ga0268265_10003957 3300028380 Bacteria 10437
859 Ga0268265_10014248 3300028380 Bacteria 5416
860 Ga0268265_10080018 3300028380 Bacteria 2575
861 Ga0268265_10167444 3300028380 Bacteria 1874
862 Ga0268265_10320645 3300028380 Bacteria 1403
863 Ga0268265_10651549 3300028380 Bacteria 1012
864 Ga0268264_10000144 3300028381 Bacteria 168841
865 Ga0268264_10000268 3300028381 Bacteria 91477
866 Ga0268264_10001327 3300028381 Bacteria 23270
867 Ga0268264_10013849 3300028381 Bacteria 6632
868 Ga0268264_10016760 3300028381 Bacteria 5996
869 Ga0268264_10045605 3300028381 Bacteria 3640
870 Ga0268264_10065024 3300028381 Bacteria 3071
871 Ga0268264_10095824 3300028381 Bacteria 2569
872 Ga0268264_10565079 3300028381 Bacteria 1117
873 Ga0307517_10020643 3300028786 Bacteria 8380
874 Ga0307517_10295058 3300028786 Bacteria 913
875 Ga0316183_1203243 3300030742 Bacteria 1049
876 Ga0265327_10116288 3300031251 Bacteria 1272
877 Ga0307509_10476517 3300031507 Bacteria 937
878 Ga0307408_100004452 3300031548 Bacteria 9514
879 Ga0307408_100006152 3300031548 Bacteria 7968
880 Ga0307408_100013781 3300031548 Bacteria 5367
881 Ga0307408_100045019 3300031548 Bacteria 3149
882 Ga0307408_100047429 3300031548 Bacteria 3077
883 Ga0307408_100115622 3300031548 Bacteria 2069
884 Ga0307408_100219274 3300031548 Bacteria 1551
885 Ga0307408_100454895 3300031548 Bacteria 1111
886 Ga0307408_100490889 3300031548 Bacteria 1073
887 Ga0307408_100499911 3300031548 Bacteria 1064
888 Ga0307508_10013978 3300031616 Bacteria 7324
889 Ga0307508_10100659 3300031616 Bacteria 2485
890 Ga0307405_10002843 3300031731 Bacteria 7780
891 Ga0307405_10004479 3300031731 Bacteria 6608
892 Ga0307405_10021552 3300031731 Bacteria 3624
893 Ga0307413_10002654 3300031824 Bacteria 7323
894 Ga0307413_10011213 3300031824 Bacteria 4394
895 Ga0307413_10017328 3300031824 Bacteria 3748
896 Ga0307413_10023177 3300031824 Bacteria 3361
897 Ga0307413_10135136 3300031824 Bacteria 1694
898 Ga0307413_10301424 3300031824 Bacteria 1215
899 Ga0307413_10822024 3300031824 Bacteria 783
900 Ga0307410_10012132 3300031852 Bacteria 4965
901 Ga0307410_10045244 3300031852 Bacteria 2929
902 Ga0307410_10074163 3300031852 Bacteria 2369
903 Ga0307410_10075902 3300031852 Bacteria 2344
904 Ga0307410_10118726 3300031852 Bacteria 1925
905 Ga0307410_10243550 3300031852 Bacteria 1394
906 Ga0307410_10303694 3300031852 Bacteria 1260
907 Ga0307410_10425944 3300031852 Bacteria 1077
908 Ga0307410_10746693 3300031852 Bacteria 828
909 Ga0307410_10842397 3300031852 Bacteria 782
910 Ga0307406_10010388 3300031901 Bacteria 5248
911 Ga0307406_10032616 3300031901 Bacteria 3182
912 Ga0307406_10049849 3300031901 Bacteria 2651
913 Ga0307406_10293774 3300031901 Bacteria 1245
914 Ga0307406_10354532 3300031901 Bacteria 1148
915 Ga0307406_10355532 3300031901 Bacteria 1146
916 Ga0307406_10430414 3300031901 Bacteria 1054
917 Ga0307406_10463989 3300031901 Bacteria 1019
918 Ga0307407_10000642 3300031903 Bacteria 11183
919 Ga0307407_10001660 3300031903 Bacteria 8234
920 Ga0307407_10018963 3300031903 Bacteria 3493
921 Ga0307407_10064069 3300031903 Bacteria 2158
922 Ga0307407_10215283 3300031903 Bacteria 1296
923 Ga0307412_10003000 3300031911 Bacteria 9343
924 Ga0307412_10011723 3300031911 Bacteria 5085
925 Ga0307412_10023555 3300031911 Bacteria 3790
926 Ga0307412_10031872 3300031911 Bacteria 3333
927 Ga0307412_10068448 3300031911 Bacteria 2414
928 Ga0307412_10133370 3300031911 Bacteria 1808
929 Ga0307412_10147821 3300031911 Bacteria 1730
930 Ga0307412_10504704 3300031911 Bacteria 1008
931 Ga0307412_10550438 3300031911 Bacteria 969
932 Ga0307412_10673933 3300031911 Bacteria 885
933 Ga0307412_11301028 3300031911 Bacteria 654
934 Ga0307409_100001134 3300031995 Bacteria 12647
935 Ga0307409_100014600 3300031995 Bacteria 5118
936 Ga0307409_100042286 3300031995 Bacteria 3411
937 Ga0307409_100097867 3300031995 Bacteria 2424
938 Ga0307409_100107575 3300031995 Bacteria 2330
939 Ga0307409_100375613 3300031995 Bacteria 1349
940 Ga0307409_100462246 3300031995 Bacteria 1227
941 Ga0307409_100574396 3300031995 Bacteria 1110
942 Ga0307409_100609696 3300031995 Bacteria 1080
943 Ga0307416_100021275 3300032002 Bacteria 4652
944 Ga0307416_100024603 3300032002 Bacteria 4399
945 Ga0307416_100025294 3300032002 Bacteria 4350
946 Ga0307416_100026146 3300032002 Bacteria 4295
947 Ga0307416_100039060 3300032002 Bacteria 3670
948 Ga0307416_100117251 3300032002 Bacteria 2363
949 Ga0307416_100660589 3300032002 Bacteria 1131
950 Ga0307414_10000073 3300032004 Bacteria 94656
951 Ga0307414_10004382 3300032004 Bacteria 7664
952 Ga0307414_10004615 3300032004 Bacteria 7494
953 Ga0307414_10004943 3300032004 Bacteria 7281
954 Ga0307414_10049760 3300032004 Bacteria 2899
955 Ga0307414_10085299 3300032004 Bacteria 2326
956 Ga0307414_10096376 3300032004 Bacteria 2213
957 Ga0307414_10129051 3300032004 Bacteria 1959
958 Ga0307414_10154175 3300032004 Bacteria 1816
959 Ga0307414_10181450 3300032004 Bacteria 1693
960 Ga0307414_10292136 3300032004 Bacteria 1374
961 Ga0307414_10323515 3300032004 Bacteria 1313
962 Ga0307414_10340417 3300032004 Bacteria 1284
963 Ga0307414_10410604 3300032004 Bacteria 1178
964 Ga0307414_10647308 3300032004 Bacteria 952
965 Ga0307414_10764060 3300032004 Bacteria 879
966 Ga0307414_10992884 3300032004 Bacteria 772
967 Ga0307411_10005275 3300032005 Bacteria 6327
968 Ga0307411_10016683 3300032005 Bacteria 4161
969 Ga0307411_10028900 3300032005 Bacteria 3377
970 Ga0307411_10041569 3300032005 Bacteria 2926
971 Ga0307411_10041899 3300032005 Bacteria 2917
972 Ga0307411_10208079 3300032005 Bacteria 1508
973 Ga0307411_10220221 3300032005 Bacteria 1472
974 Ga0307411_10257744 3300032005 Bacteria 1375
975 Ga0307411_10301566 3300032005 Bacteria 1285
976 Ga0307411_10303104 3300032005 Bacteria 1282
977 Ga0307411_10311678 3300032005 Bacteria 1266
978 Ga0307415_100009294 3300032126 Bacteria 5499
979 Ga0307415_100288064 3300032126 Bacteria 1354
980 Ga0307415_100321955 3300032126 Bacteria 1289
981 Ga0307415_100335672 3300032126 Bacteria 1266
982 Ga0307415_100439992 3300032126 Bacteria 1124
983 Ga0307510_10066259 3300033180 Bacteria 3649
984 Ga0373951_0046907 3300035091 Bacteria 1055
985 Ga0373923_0004223 3300035111 Bacteria 4744
986 Ga0373923_0127740 3300035111 Bacteria 1140
987 Ga0373943_0005666 3300035170 Bacteria 5602
988 Ga0373946_0061644 3300035171 Bacteria 1598
989 Ga0373935_0002322 3300035692 Bacteria 10863
990 Ga0373933_0031583 3300035724 Bacteria 3072
991 Ga0373947_0022791 3300035725 Bacteria 3635
992 Ga0373947_0129808 3300035725 Bacteria 1608
993 Ga0373937_0045789 3300036401 Bacteria 3998
994 Ga0373925_0277898 3300037068 Bacteria 1348
995 Ga0395899_0010252 3300037312 Bacteria 7182
996 Ga0395899_0036681 3300037312 Bacteria 3677
997 Ga0395899_0044714 3300037312 Bacteria 3299
998 Ga0395899_0053580 3300037312 Bacteria 2986
999 Ga0395899_0134149 3300037312 Bacteria 1766
1000 Ga0395899_0162236 3300037312 Bacteria 1578
1001 Ga0395900_0027388 3300037418 Bacteria 5837
1002 Ga0395900_0028928 3300037418 Bacteria 5681
1003 Ga0395900_0092721 3300037418 Bacteria 3103
1004 Ga0395900_0120079 3300037418 Bacteria 2697
1005 Ga0395900_0164384 3300037418 Bacteria 2262
1006 Ga0395900_0335785 3300037418 Bacteria 1488
1007 Ga0395898_0054496 3300037466 Bacteria 3902
1008 Ga0395898_0085987 3300037466 Bacteria 3031
1009 Ga0395905_0025080 3300037471 Bacteria 5623
1010 Ga0395905_0030632 3300037471 Bacteria 5067
1011 Ga0395905_0047368 3300037471 Bacteria 4029
1012 Ga0395905_0133408 3300037471 Bacteria 2336
1013 Ga0395905_0160398 3300037471 Bacteria 2114
1014 Ga0395905_0292187 3300037471 Bacteria 1516
1015 Ga0395905_0315237 3300037471 Bacteria 1453
1016 Ga0395905_0370430 3300037471 Bacteria 1326
1017 Ga0395905_0377023 3300037471 Bacteria 1312
1018 Ga0436364_0804686 3300037853 Bacteria 1283
1019 Ga0395901_0041174 3300038443 Bacteria 4786
1020 Ga0395901_0048282 3300038443 Bacteria 4420
1021 Ga0395901_0099018 3300038443 Bacteria 3057
1022 Ga0395901_0647004 3300038443 Bacteria 1061
1023 Ga0237819_02628 3300038705 Bacteria 3517
1024 Ga0237816_03757 3300039145 Bacteria 1089
1025 Ga0436365_1638035 3300039437 Bacteria 1898
1026 Ga0439466_0065068 3300041411 Bacteria 1169
1027 Ga0451791_1549013 3300041451 Bacteria 673
1028 Ga0451853_4106881 3300041512 Bacteria 1545
1029 Ga0439432_002749 3300042006 Bacteria 6573
1030 Ga0439449_0061824 3300042007 Bacteria 1382
1031 Ga0439462_0000274 3300042015 Bacteria 9429
1032 Ga0439458_0000616 3300042157 Bacteria 9192
1033 Ga0439460_0265782 3300042461 Bacteria 595
1034 Ga0451577_0219644 3300042876 Bacteria 1718
1035 Ga0466972_0001135 3300044658 Bacteria 12760
1036 Ga0466972_0040609 3300044658 Bacteria 2266
1037 Ga0466973_0033687 3300044659 Bacteria 4879
1038 Ga0466965_0074211 3300044683 Bacteria 1714
1039 Ga0466966_0001152 3300044684 Bacteria 16994
1040 Ga0466966_0229375 3300044684 Bacteria 1120
1041 Ga0466961_0017645 3300044693 Bacteria 4585
1042 Ga0466961_0039301 3300044693 Bacteria 3033
1043 Ga0466963_0050836 3300044694 Bacteria 2744
1044 Ga0466963_0321751 3300044694 Bacteria 1088
1045 Ga0466964_0023350 3300044706 Bacteria 2405
1046 Ga0466971_0001276 3300044719 Bacteria 10502
1047 Ga0466971_0371524 3300044719 Bacteria 694
1048 Ga0466968_0043206 3300044735 Bacteria 1907
1049 Ga0466968_0054968 3300044735 Bacteria 1707
1050 Ga0466970_0114927 3300044765 Bacteria 1471
1051 Ga0466970_0116316 3300044765 Bacteria 1462
1052 Ga0466970_0161930 3300044765 Bacteria 1238
1053 Ga0466970_0492336 3300044765 Bacteria 705
1054 Ga0466957_0008816 3300044842 Bacteria 5743
1055 Ga0466960_0001716 3300044901 Bacteria 8043
1056 Ga0466959_0084865 3300045049 Bacteria 2279
1057 Ga0466959_0160252 3300045049 Unclassified 1582
1058 Ga0466959_0213418 3300045049 Bacteria 1340
1059 Ga0466958_0010021 3300045836 Bacteria 5294
1060 Ga0466958_0025024 3300045836 Bacteria 3516
1061 Ga0466967_0083449 3300045976 Bacteria 2889
1062 Ga0466967_0373387 3300045976 Bacteria 1383
1063 Ga0466967_0433627 3300045976 Bacteria 1282
1064 Ga0495617_008380 3300046452 Bacteria 3565
1065 Ga0495627_000024 3300046453 Bacteria 250480
1066 Ga0495627_000582 3300046453 Bacteria 29200
1067 Ga0495627_020847 3300046453 Bacteria 2179
1068 Ga0495627_036429 3300046453 Bacteria 1529
1069 Ga0495638_0000051 3300046460 Bacteria 206003
1070 Ga0495638_0015201 3300046460 Bacteria 5175
1071 Ga0495638_0127999 3300046460 Bacteria 1495
1072 Ga0495650_0000967 3300046471 Bacteria 32924
1073 Ga0495650_0001090 3300046471 Bacteria 29761
1074 Ga0495650_0003223 3300046471 Bacteria 12124
1075 Ga0495605_0024857 3300046474 Bacteria 3129
1076 Ga0495584_0483584 3300046491 Bacteria 630
1077 Ga0495585_0040991 3300046492 Bacteria 2598
1078 Ga0495585_0061915 3300046492 Bacteria 2056
1079 Ga0495585_0062413 3300046492 Bacteria 2047
1080 Ga0495585_0081005 3300046492 Bacteria 1759
1081 Ga0495585_0094743 3300046492 Bacteria 1604
1082 Ga0495596_0000008 3300046500 Bacteria 150860
1083 Ga0495596_0002823 3300046500 Bacteria 9077
1084 Ga0495607_0006279 3300046501 Bacteria 8378
1085 Ga0495607_0013977 3300046501 Bacteria 5243
1086 Ga0495607_0037379 3300046501 Bacteria 2917
1087 Ga0495583_0000582 3300046506 Bacteria 50059
1088 Ga0495583_0001392 3300046506 Bacteria 24725
1089 Ga0495583_0005396 3300046506 Bacteria 8696
1090 Ga0495583_0030469 3300046506 Bacteria 2626
1091 Ga0495583_0074163 3300046506 Bacteria 1490
1092 Ga0495583_0077084 3300046506 Bacteria 1455
1093 Ga0495583_0085684 3300046506 Bacteria 1363
1094 Ga0495606_0000178 3300046507 Bacteria 112329
1095 Ga0495606_0010737 3300046507 Bacteria 7554
1096 Ga0495606_0013877 3300046507 Bacteria 6325
1097 Ga0495606_0027882 3300046507 Bacteria 3995
1098 Ga0495606_0163301 3300046507 Bacteria 1298
1099 Ga0495606_0173376 3300046507 Bacteria 1249
1100 Ga0495610_0000053 3300046512 Bacteria 142545
1101 Ga0495610_0000081 3300046512 Bacteria 113513
1102 Ga0495610_0001175 3300046512 Bacteria 23733
1103 Ga0495610_0004173 3300046512 Bacteria 10803
1104 Ga0495610_0093412 3300046512 Bacteria 1359
1105 Ga0495610_0151897 3300046512 Bacteria 987
1106 Ga0495616_0223663 3300046513 Bacteria 818
1107 Ga0495620_0024916 3300046515 Bacteria 2839
1108 Ga0495631_0026871 3300046518 Bacteria 2638
1109 Ga0495631_0045866 3300046518 Bacteria 1923
1110 Ga0495631_0252731 3300046518 Bacteria 751
1111 Ga0495632_0000006 3300046519 Bacteria 345883
1112 Ga0495632_0000306 3300046519 Bacteria 47401
1113 Ga0495632_0000356 3300046519 Bacteria 43508
1114 Ga0495632_0014842 3300046519 Bacteria 4392
1115 Ga0495632_0185855 3300046519 Bacteria 950
1116 Ga0495637_0000784 3300046520 Bacteria 21358
1117 Ga0495637_0023493 3300046520 Bacteria 2801
1118 Ga0495643_0000021 3300046522 Bacteria 293465
1119 Ga0495643_0000042 3300046522 Bacteria 229665
1120 Ga0495643_0001768 3300046522 Bacteria 18571
1121 Ga0495643_0002744 3300046522 Bacteria 13525
1122 Ga0495643_0002897 3300046522 Bacteria 13016
1123 Ga0495643_0012066 3300046522 Bacteria 5226
1124 Ga0495643_0018146 3300046522 Bacteria 4097
1125 Ga0495643_0018970 3300046522 Bacteria 3984
1126 Ga0495643_0045444 3300046522 Bacteria 2384
1127 Ga0495643_0055387 3300046522 Bacteria 2120
1128 Ga0495643_0064246 3300046522 Bacteria 1939
1129 Ga0495643_0108432 3300046522 Bacteria 1414
1130 Ga0495643_0183112 3300046522 Bacteria 1016
1131 Ga0495643_0232909 3300046522 Bacteria 868
1132 Ga0495643_0406652 3300046522 Bacteria 599
1133 Ga0495648_0000032 3300046524 Bacteria 205970
1134 Ga0495648_0004587 3300046524 Bacteria 11770
1135 Ga0495648_0026511 3300046524 Bacteria 3899
1136 Ga0495648_0038726 3300046524 Bacteria 3044
1137 Ga0495648_0148282 3300046524 Bacteria 1226
1138 Ga0495648_0215116 3300046524 Bacteria 952
1139 Ga0495663_0000008 3300046525 Bacteria 260614
1140 Ga0495663_0000758 3300046525 Bacteria 11077
1141 Ga0495663_0021992 3300046525 Bacteria 1840
1142 Ga0495663_0054540 3300046525 Bacteria 1245
1143 Ga0495663_0128851 3300046525 Bacteria 852
1144 Ga0495652_0539811 3300046529 Bacteria 803
1145 Ga0495609_0003619 3300046538 Bacteria 8776
1146 Ga0495609_0161424 3300046538 Bacteria 950
1147 Ga0495597_0021634 3300046542 Bacteria 2989
1148 Ga0495622_0002170 3300046557 Bacteria 9561
1149 Ga0495633_0000247 3300046558 Bacteria 64533
1150 Ga0495633_0000308 3300046558 Bacteria 55659
1151 Ga0495633_0001265 3300046558 Bacteria 20151
1152 Ga0495633_0009196 3300046558 Bacteria 5479
1153 Ga0495633_0015315 3300046558 Bacteria 3980
1154 Ga0495633_0043814 3300046558 Bacteria 2122
1155 Ga0495633_0100529 3300046558 Bacteria 1342
1156 Ga0495633_0188828 3300046558 Bacteria 947
1157 Ga0495668_0000004 3300046616 Bacteria 574236
1158 Ga0495668_0000013 3300046616 Bacteria 452938
1159 Ga0495668_0015322 3300046616 Bacteria 4481
1160 Ga0495668_0021352 3300046616 Bacteria 3714
1161 Ga0495668_0216745 3300046616 Bacteria 1048
1162 Ga0495668_0434163 3300046616 Bacteria 722
1163 Ga0495611_0014367 3300046648 Bacteria 3381
1164 Ga0495611_0066649 3300046648 Bacteria 1642
1165 Ga0495625_0000321 3300046660 Bacteria 72983
1166 Ga0495625_0000914 3300046660 Bacteria 39744
1167 Ga0495625_0003636 3300046660 Bacteria 15121
1168 Ga0495625_0042735 3300046660 Bacteria 3290
1169 Ga0495625_0043217 3300046660 Bacteria 3269
1170 Ga0495625_0071562 3300046660 Bacteria 2434
1171 Ga0495625_0119010 3300046660 Bacteria 1799
1172 Ga0495625_0226451 3300046660 Bacteria 1223
1173 Ga0495661_0072319 3300046665 Bacteria 2012
1174 Ga0495661_0194740 3300046665 Bacteria 1065
1175 Ga0495623_0070991 3300046679 Bacteria 2168
1176 Ga0495669_0002087 3300046684 Bacteria 8185
1177 Ga0495669_0009712 3300046684 Bacteria 4060
1178 Ga0495669_0014347 3300046684 Bacteria 3387
1179 Ga0495669_0062574 3300046684 Bacteria 1686
1180 Ga0495671_0000017 3300046692 Bacteria 293465
1181 Ga0495671_0000020 3300046692 Bacteria 268306
1182 Ga0495671_0005841 3300046692 Bacteria 7166
1183 Ga0495671_0006324 3300046692 Bacteria 6852
1184 Ga0495671_0022403 3300046692 Bacteria 3312
1185 Ga0495649_0031039 3300046694 Bacteria 2948
1186 Ga0495649_0038474 3300046694 Bacteria 2624
1187 Ga0495600_0001554 3300046809 Bacteria 12763
1188 Ga0495660_0047286 3300046810 Bacteria 2357
1189 Ga0495660_0087149 3300046810 Bacteria 1629
1190 Ga0495672_0117903 3300047320 Bacteria 1416
1191 Ga0495683_0006805 3300047323 Bacteria 6213
1192 Ga0495687_000250 3300047443 Bacteria 72797
1193 Ga0495687_000614 3300047443 Bacteria 41339
1194 Ga0495677_0001865 3300047445 Bacteria 8422
1195 Ga0495673_0000076 3300047469 Bacteria 205985
1196 Ga0495673_0020724 3300047469 Bacteria 3265
1197 Ga0495673_0030495 3300047469 Bacteria 2532
1198 Ga0495673_0034699 3300047469 Bacteria 2331
1199 Ga0495673_0041073 3300047469 Bacteria 2085
1200 Ga0495681_0000099 3300047470 Bacteria 75808
1201 Ga0495681_0000517 3300047470 Bacteria 29470
1202 Ga0495681_0032888 3300047470 Bacteria 2604
1203 Ga0495686_0000262 3300047472 Bacteria 94462
1204 Ga0495686_0000273 3300047472 Bacteria 91936
1205 Ga0495686_0000669 3300047472 Bacteria 46516
1206 Ga0495686_0000680 3300047472 Bacteria 46007
1207 Ga0495686_0103361 3300047472 Bacteria 1716
1208 Ga0495686_0154042 3300047472 Bacteria 1347
1209 Ga0495686_0201852 3300047472 Bacteria 1141
1210 Ga0495602_0046500 3300048088 Bacteria 3920
1211 Ga0495615_0000135 3300048090 Bacteria 18517
1212 Ga0495626_0000139 3300048091 Bacteria 92719
1213 Ga0496100_0427862 3300048903 Bacteria 1012
1214 Ga0496101_0353643 3300048904 Bacteria 1155
1215 Ga0496102_0001391 3300048905 Bacteria 21494
1216 Ga0496102_0009613 3300048905 Bacteria 8316
1217 Ga0496102_0030551 3300048905 Bacteria 4823
1218 Ga0496102_0517366 3300048905 Bacteria 1116
1219 Ga0496102_0557811 3300048905 Bacteria 1068
1220 Ga0496102_0851955 3300048905 Bacteria 834
1221 Ga0496103_0000055 3300048906 Bacteria 143870
1222 Ga0496103_0007593 3300048906 Bacteria 6455
1223 Ga0496103_0041420 3300048906 Bacteria 2831
1224 Ga0496103_0477353 3300048906 Bacteria 799
1225 Ga0496104_0026298 3300048907 Bacteria 5371
1226 Ga0496104_1127604 3300048907 Bacteria 688
1227 Ga0496104_1166181 3300048907 Bacteria 674
1228 Ga0496105_0000358 3300048908 Bacteria 30167
1229 Ga0496105_0740658 3300048908 Bacteria 751
1230 Ga0496106_0019385 3300048909 Bacteria 5045
1231 Ga0496107_0020666 3300048910 Bacteria 4651
1232 Ga0496108_0054733 3300048911 Bacteria 3348
1233 Ga0496108_0296198 3300048911 Bacteria 1409
1234 Ga0496109_0022187 3300048912 Bacteria 5620
1235 Ga0496109_0098706 3300048912 Bacteria 2708
1236 Ga0496109_0215343 3300048912 Bacteria 1806
1237 Ga0496109_0284074 3300048912 Bacteria 1560
1238 Ga0496110_0009627 3300048913 Bacteria 7823
1239 Ga0496110_0026654 3300048913 Bacteria 4948
1240 Ga0496110_0062006 3300048913 Bacteria 3302
1241 Ga0496111_0021635 3300048914 Bacteria 4495
1242 Ga0496111_0103898 3300048914 Bacteria 2090
1243 Ga0496112_0041602 3300048915 Bacteria 4496
1244 Ga0496112_0274805 3300048915 Bacteria 1632
1245 Ga0496113_0009411 3300048916 Bacteria 6407
1246 Ga0496113_0103450 3300048916 Bacteria 2209
1247 Ga0496113_0145461 3300048916 Bacteria 1867
1248 Ga0496113_1273601 3300048916 Bacteria 572
1249 Ga0496114_0000016 3300048917 Bacteria 274656
1250 Ga0496114_0010092 3300048917 Bacteria 7512
1251 Ga0496114_0118522 3300048917 Bacteria 2274
1252 Ga0496115_0000267 3300048918 Bacteria 46248
1253 Ga0496116_0000045 3300048919 Bacteria 324307
1254 Ga0496116_0023536 3300048919 Bacteria 4585
1255 Ga0496116_0028810 3300048919 Bacteria 4016
1256 Ga0496116_0064603 3300048919 Bacteria 2352
1257 Ga0496117_0000549 3300048920 Bacteria 61657
1258 Ga0496117_0002463 3300048920 Bacteria 23295
1259 Ga0496117_0004882 3300048920 Bacteria 14459
1260 Ga0496117_0017345 3300048920 Bacteria 6016
1261 Ga0496117_0070619 3300048920 Bacteria 2344
1262 Ga0496117_0166788 3300048920 Bacteria 1283
1263 Ga0496117_0232443 3300048920 Bacteria 1018
1264 Ga0496118_0000552 3300048921 Bacteria 61677
1265 Ga0496118_0000811 3300048921 Bacteria 49879
1266 Ga0496118_0003823 3300048921 Bacteria 18542
1267 Ga0496118_0007786 3300048921 Bacteria 11249
1268 Ga0496118_0017208 3300048921 Bacteria 6592
1269 Ga0496118_0017950 3300048921 Bacteria 6414
1270 Ga0496118_0034239 3300048921 Bacteria 4149
1271 Ga0496118_0347199 3300048921 Bacteria 792
1272 Ga0496119_0031108 3300048922 Bacteria 3586
1273 Ga0496119_0077162 3300048922 Bacteria 1931
1274 Ga0496119_0089316 3300048922 Bacteria 1755
1275 Ga0496119_0248753 3300048922 Bacteria 897
1276 Ga0496120_0013820 3300048923 Bacteria 5411
1277 Ga0496120_0151706 3300048923 Bacteria 1164
1278 Ga0496121_0000652 3300048924 Bacteria 64960
1279 Ga0496121_0000930 3300048924 Bacteria 52952
1280 Ga0496121_0001191 3300048924 Bacteria 45526
1281 Ga0496121_0003000 3300048924 Bacteria 24522
1282 Ga0496121_0005432 3300048924 Bacteria 16336
1283 Ga0496121_0024091 3300048924 Bacteria 5832
1284 Ga0496121_0031341 3300048924 Bacteria 4859
1285 Ga0496121_0031916 3300048924 Bacteria 4802
1286 Ga0496121_0068404 3300048924 Bacteria 2873
1287 Ga0496121_0078566 3300048924 Bacteria 2623
1288 Ga0496121_0192677 3300048924 Bacteria 1460
1289 Ga0496122_0003938 3300048925 Bacteria 18968
1290 Ga0496122_0005345 3300048925 Bacteria 15345
1291 Ga0496122_0011792 3300048925 Bacteria 8795
1292 Ga0496122_0017572 3300048925 Bacteria 6675
1293 Ga0496122_0036518 3300048925 Bacteria 3971
1294 Ga0496122_0081358 3300048925 Bacteria 2255
1295 Ga0496122_0147769 3300048925 Bacteria 1457
1296 Ga0496123_0001272 3300048926 Bacteria 36131
1297 Ga0496123_0001952 3300048926 Bacteria 26806
1298 Ga0496123_0011382 3300048926 Bacteria 7717
1299 Ga0496123_0011531 3300048926 Bacteria 7650
1300 Ga0496123_0037600 3300048926 Bacteria 3416
1301 Ga0496123_0067977 3300048926 Bacteria 2247
1302 Ga0496123_0079556 3300048926 Bacteria 2002
1303 Ga0496123_0106909 3300048926 Bacteria 1611
1304 Ga0496123_0233381 3300048926 Bacteria 919
1305 Ga0496124_0000585 3300048927 Bacteria 61469
1306 Ga0496124_0003632 3300048927 Bacteria 18723
1307 Ga0496124_0008726 3300048927 Bacteria 10530
1308 Ga0496124_0013710 3300048927 Bacteria 7893
1309 Ga0496124_0019318 3300048927 Bacteria 6345
1310 Ga0496124_0026758 3300048927 Bacteria 5195
1311 Ga0496124_0030502 3300048927 Bacteria 4785
1312 Ga0496124_0099254 3300048927 Bacteria 2362
1313 Ga0496124_0132861 3300048927 Bacteria 1975
1314 Ga0496124_0134357 3300048927 Bacteria 1961
1315 Ga0496124_0166346 3300048927 Bacteria 1713
1316 Ga0496125_0001142 3300048928 Bacteria 40357
1317 Ga0496125_0010180 3300048928 Bacteria 9531
1318 Ga0496125_0010701 3300048928 Bacteria 9252
1319 Ga0496125_0032339 3300048928 Bacteria 4648
1320 Ga0496125_0035059 3300048928 Bacteria 4410
1321 Ga0496125_0036806 3300048928 Bacteria 4265
1322 Ga0496125_0041123 3300048928 Bacteria 3956
1323 Ga0496125_0042756 3300048928 Bacteria 3854
1324 Ga0496125_0059204 3300048928 Bacteria 3088
1325 Ga0496125_0085882 3300048928 Bacteria 2382
1326 Ga0496125_0099292 3300048928 Bacteria 2151
1327 Ga0496125_0107311 3300048928 Bacteria 2035
1328 Ga0496125_0155799 3300048928 Bacteria 1561
1329 Ga0496126_0000519 3300048929 Bacteria 74968
1330 Ga0496126_0001094 3300048929 Bacteria 45520
1331 Ga0496126_0004852 3300048929 Bacteria 15748
1332 Ga0496126_0014259 3300048929 Bacteria 8041
1333 Ga0496126_0064441 3300048929 Bacteria 3283
1334 Ga0496126_0093822 3300048929 Bacteria 2635
1335 Ga0496126_0271213 3300048929 Bacteria 1408
1336 Ga0496126_0501897 3300048929 Bacteria 969
1337 Ga0496126_0536572 3300048929 Bacteria 930
1338 Ga0495678_201105 3300049459 Bacteria 614
1339 Ga0501335_005898 3300049551 Bacteria 1104
1340 Ga0501032_0019920 3300049569 Bacteria 4682
1341 Ga0501032_0022006 3300049569 Bacteria 4426
1342 Ga0501033_0058368 3300049570 Bacteria 2850
1343 Ga0501033_0127471 3300049570 Bacteria 1845
1344 Ga0501034_0108545 3300049571 Bacteria 2766
1345 Ga0501034_0880013 3300049571 Bacteria 785
1346 Ga0501036_0189107 3300049572 Bacteria 1732
1347 Ga0501036_0718870 3300049572 Bacteria 825
1348 Ga0501037_0046165 3300049573 Bacteria 3195
1349 Ga0501038_0253946 3300049574 Bacteria 1392
1350 Ga0501039_0717338 3300049575 Bacteria 781
1351 Ga0501043_0007449 3300049579 Bacteria 8691
1352 Ga0501043_0011321 3300049579 Bacteria 6982
1353 Ga0501043_0059629 3300049579 Bacteria 2995
1354 Ga0501043_0813160 3300049579 Bacteria 675
1355 Ga0501046_0030557 3300049580 Bacteria 4371
1356 Ga0501046_0269958 3300049580 Bacteria 1248
1357 Ga0501047_0000795 3300049581 Bacteria 32971
1358 Ga0501047_0277926 3300049581 Bacteria 1519
1359 Ga0501047_0472231 3300049581 Bacteria 1082
1360 Ga0501047_0701199 3300049581 Bacteria 830
1361 Ga0501048_0086339 3300049582 Bacteria 2213
1362 Ga0501067_0016919 3300049583 Bacteria 4029
1363 Ga0501067_0060171 3300049583 Bacteria 2102
1364 Ga0501070_0297898 3300049586 Bacteria 1314
1365 Ga0501208_042684 3300049655 Bacteria 843
1366 Ga0501223_000092 3300049663 Bacteria 26431
1367 Ga0501224_010003 3300049664 Bacteria 1389
1368 Ga0501235_014004 3300049669 Bacteria 1767
1369 Ga0501235_034142 3300049669 Bacteria 1154
1370 Ga0501249_001325 3300049679 Bacteria 5149
1371 Ga0501257_087543 3300049686 Bacteria 808
1372 Ga0501225_0009956 3300049705 Bacteria 2699
1373 Ga0501225_0118260 3300049705 Bacteria 786
1374 Ga0501245_127857 3300049708 Bacteria 542
1375 Ga0501267_012879 3300049764 Bacteria 866
1376 Ga0501035_0289634 3300049822 Bacteria 1382
1377 Ga0501044_0013098 3300049823 Bacteria 8977
1378 Ga0501044_0035147 3300049823 Bacteria 5250
1379 Ga0501044_0044292 3300049823 Bacteria 4618
1380 Ga0501044_0376795 3300049823 Bacteria 1335
1381 Ga0501044_0401751 3300049823 Bacteria 1283
1382 Ga0501044_0582299 3300049823 Bacteria 1013
1383 nmdc:mga03683_126171_c1 3300050489 Bacteria 1142
1384 nmdc:mga03683_276_c1 3300050489 Bacteria 15419
1385 nmdc:mga03n38_89329_c1 3300050490 Bacteria 1464
1386 nmdc:mga00v17_68256_c1 3300050491 Bacteria 2198
1387 nmdc:mga00v17_81142_c1 3300050491 Bacteria 2025
1388 nmdc:mga0k408_63396_c1 3300050493 Bacteria 2150
1389 nmdc:mga06z11_134_c1 3300050494 Bacteria 29598
1390 nmdc:mga06z11_85_c1 3300050494 Bacteria 39933
1391 nmdc:mga07m45_12_c1 3300050496 Bacteria 158130
1392 nmdc:mga05p37_324492_c1 3300050507 Bacteria 1821
1393 nmdc:mga0n895_1010399_c1 3300050512 Bacteria 812
1394 nmdc:mga0n895_1523631_c1 3300050512 Bacteria 634
1395 nmdc:mga0rr50_135562_c1 3300050513 Bacteria 1975
1396 nmdc:mga0rr50_141418_c1 3300050513 Bacteria 1936
1397 nmdc:mga0sz30_10812_c2 3300050516 Bacteria 1345
1398 nmdc:mga0sz30_11490_c1 3300050516 Bacteria 3420
1399 Ga0500610_0000092 3300053079 Bacteria 27411
1400 Ga0500643_000001 3300053087 Bacteria 1440111
1401 Ga0500643_001742 3300053087 Bacteria 12055
1402 Ga0500643_004433 3300053087 Bacteria 6350
1403 Ga0500643_006129 3300053087 Bacteria 5074
1404 Ga0500647_0042393 3300053091 Bacteria 2185
1405 Ga0500651_0009774 3300053093 Bacteria 5721
1406 Ga0500566_0005455 3300053094 Bacteria 7567
1407 Ga0500562_003322 3300053108 Bacteria 4023
1408 Ga0500592_005424 3300053116 Bacteria 2032
1409 Ga0500592_019794 3300053116 Bacteria 1082
1410 Ga0500594_0009825 3300053118 Bacteria 2210
1411 Ga0500595_007737 3300053119 Bacteria 4442
1412 Ga0500607_001489 3300053121 Bacteria 21049
1413 Ga0500642_0000187 3300053130 Bacteria 25531
1414 Ga0500642_0002784 3300053130 Bacteria 5187
1415 Ga0500655_000107 3300053133 Bacteria 21512
1416 Ga0500658_0034924 3300053134 Bacteria 1988
1417 Ga0500559_0022339 3300053136 Bacteria 2683
1418 Ga0500559_0046716 3300053136 Bacteria 1899
1419 Ga0500564_027808 3300053138 Bacteria 2603
1420 Ga0500568_0003230 3300053139 Bacteria 9223
1421 Ga0500573_0000065 3300053140 Bacteria 64628
1422 Ga0500616_0002096 3300053153 Bacteria 17390
1423 Ga0500616_0051227 3300053153 Bacteria 2176
1424 Ga0500619_024218 3300053154 Bacteria 1783
1425 Ga0500622_0003412 3300053156 Bacteria 10669
1426 Ga0500624_000002 3300053157 Bacteria 257900
1427 Ga0500627_0000089 3300053158 Bacteria 30989
1428 Ga0500636_0005106 3300053177 Bacteria 7457
1429 Ga0500567_002040 3300053723 Bacteria 8449
1430 Ga0500570_000192 3300053724 Bacteria 19388
1431 Ga0500625_000026 3300053729 Bacteria 60801
1432 Ga0500645_000024 3300053730 Bacteria 126024
1433 Ga0500596_000659 3300053735 Bacteria 6672
1434 Ga0466962_0013450 3300061719 Bacteria 3940
1435 2511130872 2510917021 Bacteria 5705459
1436 2512644588 2512564014 Bacteria 4639632
1437 2585261427 2582581305 Bacteria 4895574
1438 2643730797 2643221541 Bacteria 5498788
1439 2643819380 2643221560 Bacteria 4801179
1440 2643836094 2643221563 Bacteria 4726935
1441 2643951674 2643221588 Bacteria 3692460
1442 2644040797 2643221605 Bacteria 4772303
1443 2644044550 2643221606 Bacteria 5588032
1444 2644052571 2643221608 Bacteria 4724829
1445 2644391525 2643221671 Bacteria 5496681
1446 2739651109 2739367664 Bacteria 4114334
1447 2740029582 2739367865 Bacteria 4114482
1448 2778126675 2775507255 Bacteria 3945731
1449 2809062608 2808606401 Bacteria 4586670
1450 2809078708 2808606404 Bacteria 4652788
1451 2809082997 2808606405 Bacteria 4586632
1452 2819551416 2818991438 Bacteria 5793701
1453 2848298713 2848297114 Bacteria 3608511
1454 2852656068 2852653556 Bacteria 4050083
1455 2852683203 2852680915 Bacteria 4100189
1456 2880521586 2880518877 Bacteria 5012590
1457 2885432554 2885429604 Bacteria 3642894
1458 2895881321 2895880812 Bacteria 11255272
1459 2896253805 2896253425 Bacteria 3418029
1460 2919709521 2919709256 Bacteria 4318106
1461 2928029412 2928027323 Bacteria 4382488
1462 2946790184 2946787523 Bacteria 4366789
1463 2984556609 2984555340 Bacteria 4247089
1464 2984565218 2984564862 Bacteria 4339992
1465 2990265954 2990265787 Bacteria 3943888
1466 2993356294 2993356040 Bacteria 4247105
1467 2993696255 2993693658 Bacteria 4040749
1468 3000867203 3000865235 Bacteria 3106258
1469 8054305113 8054302542 Bacteria 5698134
1470 8057101585 8057101203 Bacteria 5034064
1471 Ga0268265_10122506
1472 SwRhRL2b_contig_1673102
1473 SwRhRL2b_contig_1893398
1474 SwRhRL2b_contig_67628
1475 JGI24736J21556_1001983
1476 JGI24736J21556_1005378
1477 JGI24741J21665_1000122
1478 JGI24741J21665_1039325
1479 JGI24752J21851_1001492
1480 JGI24747J21853_1004386
1481 JGI24740J21852_10010138
1482 JGI24740J21852_10025066
1483 JGI24740J21852_10046169
1484 JGI24740J21852_10074931
1485 JGI24740J21852_10082943
1486 JGI24739J22299_10000391
1487 JGI24739J22299_10002839
1488 JGI24739J22299_10003277
1489 JGI24739J22299_10008673
1490 JGI24739J22299_10010024
1491 JGI24739J22299_10020971
1492 JGI24737J22298_10001243
1493 JGI24737J22298_10004308
1494 JGI24737J22298_10042356
1495 JGI24737J22298_10050139
1496 JGI24743J22301_10019238
1497 JGI24735J21928_10002241
1498 JGI24735J21928_10004078
1499 JGI24735J21928_10007186
1500 JGI24735J21928_10026692
1501 JGI24735J21928_10043417
1502 JGI24735J21928_10192644
1503 JGI24738J21930_10000436
1504 JGI24738J21930_10011972
1505 JGI24738J21930_10022102
1506 JGI24738J21930_10052632
1507 JGI24749J21850_1000069
1508 JGI24744J21845_10007524
1509 JGI24744J21845_10038565
1510 JGI24742J22300_10039055
1511 JGI24751J29686_10000391
1512 JGI24751J29686_10037791
1513 JGI25165J46597_1000071
1514 JGI25153J46596_10000007
1515 rootH2_10174559
1516 rootH1_10040862
1517 rootH1_10162866
1518 Ga0055525_1000127
1519 Ga0055542_1000038
1520 Ga0055542_1001654
1521 Ga0055529_1000002
1522 Ga0055529_1000021
1523 Ga0055536_1003088
1524 Ga0055536_1006967
1525 Ga0055534_1008222
1526 Ga0055530_10000048
1527 Ga0055530_10011789
1528 Ga0055531_10000929
1529 Ga0055531_10004331
1530 Ga0065165_1004328
1531 Ga0065165_1053500
1532 Ga0065704_10070193
1533 Ga0065704_10094687
1534 Ga0065704_10127076
1535 Ga0065704_10173616
1536 Ga0065715_10007711
1537 Ga0065707_10081811
1538 Ga0065707_10105390
1539 Ga0065707_10260882
1540 Ga0070658_10000377
1541 Ga0070658_10000716
1542 Ga0070658_10003584
1543 Ga0070658_10003723
1544 Ga0070658_10004008
1545 Ga0070658_10007308
1546 Ga0070658_10021861
1547 Ga0070658_10075150
1548 Ga0070658_10153726
1549 Ga0070676_10001215
1550 Ga0070676_10005501
1551 Ga0070676_10176436
1552 Ga0070676_10652559
1553 Ga0070683_100001819
1554 Ga0070683_100018052
1555 Ga0070683_100168475
1556 Ga0070690_100128620
1557 Ga0070670_100000027
1558 Ga0070670_100000047
1559 Ga0070670_100012449
1560 Ga0070670_100042597
1561 Ga0070670_100302451
1562 Ga0070670_100775340
1563 Ga0070677_10000079
1564 Ga0070677_10011544
1565 Ga0070677_10034331
1566 Ga0068869_100000031
1567 Ga0070666_10000779
1568 Ga0070666_10054458
1569 Ga0070666_10093259
1570 Ga0070666_10581678
1571 Ga0070680_100000177
1572 Ga0070680_100003469
1573 Ga0070680_100245996
1574 Ga0070680_100602927
1575 Ga0070682_100058066
1576 Ga0070682_100128504
1577 Ga0070682_101075427
1578 Ga0068868_100000060
1579 Ga0068868_100058542
1580 Ga0068868_100192305
1581 Ga0068868_100202519
1582 Ga0070660_100000751
1583 Ga0070660_100000986
1584 Ga0070660_100002934
1585 Ga0070660_100005512
1586 Ga0070660_100009089
1587 Ga0070660_100016075
1588 Ga0070660_100024083
1589 Ga0070660_100111630
1590 Ga0070660_100273648
1591 Ga0070660_100347733
1592 Ga0070687_100111831
1593 Ga0070687_100150704
1594 Ga0070661_100000156
1595 Ga0070661_100000187
1596 Ga0070661_100006527
1597 Ga0070661_100021041
1598 Ga0070661_100032184
1599 Ga0070661_100036795
1600 Ga0070661_100069996
1601 Ga0070661_100284668
1602 Ga0070661_100726035
1603 Ga0070692_10033345
1604 Ga0070692_10268070
1605 Ga0070668_100016101
1606 Ga0070668_100018871
1607 Ga0070668_100033002
1608 Ga0070668_100078104
1609 Ga0070668_100089092
1610 Ga0070668_100100733
1611 Ga0070668_100114109
1612 Ga0070668_100125621
1613 Ga0070668_100167545
1614 Ga0070669_100000072
1615 Ga0070669_100000470
1616 Ga0070669_100030653
1617 Ga0070669_100075371
1618 Ga0070669_100133445
1619 Ga0070669_100147500
1620 Ga0070669_100177785
1621 Ga0070669_100660071
1622 Ga0070675_100005311
1623 Ga0070675_100014931
1624 Ga0070675_100246966
1625 Ga0070671_100000845
1626 Ga0070671_100039002
1627 Ga0070671_100054381
1628 Ga0070671_100080339
1629 Ga0070671_100241581
1630 Ga0070671_100352852
1631 Ga0070671_100489394
1632 Ga0070674_100000209
1633 Ga0070674_100027045
1634 Ga0070674_100127342
1635 Ga0070673_100000009
1636 Ga0070673_100031597
1637 Ga0070673_100226433
1638 Ga0070673_100658848
1639 Ga0070659_100000191
1640 Ga0070659_100017756
1641 Ga0070659_100033034
1642 Ga0070659_100039493
1643 Ga0070659_100043632
1644 Ga0070659_100066651
1645 Ga0070659_100067036
1646 Ga0070659_100423186
1647 Ga0070659_100448781
1648 Ga0070667_100000143
1649 Ga0070667_100000286
1650 Ga0070667_100000367
1651 Ga0070667_100000725
1652 Ga0070667_100034211
1653 Ga0070667_100038587
1654 Ga0070667_100265935
1655 Ga0070667_100533049
1656 Ga0070709_10016498
1657 Ga0070714_100011330
1658 Ga0070714_100156723
1659 Ga0070713_100064528
1660 Ga0070713_100087188
1661 Ga0070713_100165627
1662 Ga0070694_100086015
1663 Ga0070663_100004783
1664 Ga0070663_100008779
1665 Ga0070663_100046160
1666 Ga0070663_100083683
1667 Ga0070663_100236458
1668 Ga0070663_100377050
1669 Ga0070678_100001063
1670 Ga0070678_100033684
1671 Ga0070678_100299879
1672 Ga0070678_100334470
1673 Ga0070662_100000012
1674 Ga0070662_100001324
1675 Ga0070662_100001565
1676 Ga0070662_100002043
1677 Ga0070662_100026436
1678 Ga0070662_100049752
1679 Ga0070662_100165319
1680 Ga0070662_100827040
1681 Ga0070681_10006366
1682 Ga0070681_10010175
1683 Ga0068867_100000002
1684 Ga0068867_100006572
1685 Ga0068867_100071011
1686 Ga0068867_100133018
1687 Ga0070685_10077284
1688 Ga0070679_100000001
1689 Ga0070679_100005339
1690 Ga0070679_100006705
1691 Ga0070679_100080732
1692 Ga0070679_100100254
1693 Ga0070679_100589659
1694 Ga0070684_100009174
1695 Ga0070684_100559518
1696 Ga0068853_100000032
1697 Ga0068853_100003550
1698 Ga0068853_100014991
1699 Ga0068853_100065019
1700 Ga0068853_100174373
1701 Ga0070672_100224484
1702 Ga0070672_100643002
1703 Ga0070695_100100790
1704 Ga0070693_100000332
1705 Ga0070693_100036501
1706 Ga0070665_100000079
1707 Ga0070665_100000084
1708 Ga0070665_100003604
1709 Ga0070665_100012237
1710 Ga0070665_100034424
1711 Ga0070665_100080538
1712 Ga0068855_100000591
1713 Ga0068855_100001164
1714 Ga0068855_100007295
1715 Ga0068855_100018573
1716 Ga0068855_100032731
1717 Ga0068855_100034640
1718 Ga0068855_100095837
1719 Ga0068855_100153975
1720 Ga0068855_100245833
1721 Ga0068855_100449134
1722 Ga0068855_100789685
1723 Ga0070664_100000187
1724 Ga0070664_100002928
1725 Ga0070664_100016865
1726 Ga0070664_100025790
1727 Ga0070664_100073402
1728 Ga0070664_100177595
1729 Ga0070664_100767854
1730 Ga0068857_100007902
1731 Ga0068857_100190219
1732 Ga0068857_100436038
1733 Ga0068857_100542997
1734 Ga0068854_100003204
1735 Ga0068854_100007226
1736 Ga0068854_100026804
1737 Ga0068854_100090117
1738 Ga0068854_100111295
1739 Ga0068854_100112344
1740 Ga0068854_100252199
1741 Ga0068854_100336372
1742 Ga0068854_100552291
1743 Ga0068856_100000291
1744 Ga0068856_100005719
1745 Ga0068856_100143419
1746 Ga0068852_100000906
1747 Ga0068852_100001541
1748 Ga0068852_100058362
1749 Ga0068852_100137652
1750 Ga0068852_100476231
1751 Ga0068852_100647544
1752 Ga0068852_101080088
1753 Ga0068859_100008247
1754 Ga0068859_100090073
1755 Ga0068859_100310836
1756 Ga0068859_100603103
1757 Ga0068864_100000051
1758 Ga0068864_100000100
1759 Ga0068864_100034890
1760 Ga0068864_100104055
1761 Ga0068864_100113092
1762 Ga0068866_10096709
1763 Ga0068861_100038439
1764 Ga0068851_10010180
1765 Ga0068851_10019263
1766 Ga0068851_10019743
1767 Ga0068851_10090672
1768 Ga0068851_10096921
1769 Ga0068851_10335431
1770 Ga0068870_10039947
1771 Ga0068870_10262608
1772 Ga0068863_100000025
1773 Ga0068863_100000168
1774 Ga0068863_100001489
1775 Ga0068863_100058470
1776 Ga0068863_100081951
1777 Ga0068863_100193604
1778 Ga0068858_100000673
1779 Ga0068858_100000848
1780 Ga0068858_100023512
1781 Ga0068858_100043159
1782 Ga0068858_100052186
1783 Ga0068858_100071318
1784 Ga0068858_100665973
1785 Ga0068860_100000181
1786 Ga0068860_100027199
1787 Ga0068860_100067993
1788 Ga0068860_100096161
1789 Ga0068860_100166266
1790 Ga0068862_100000027
1791 Ga0068862_100000036
1792 Ga0068862_100004531
1793 Ga0068862_100024495
1794 Ga0068862_100386147
1795 Ga0068862_100431342
1796 Ga0068862_100749193
1797 Ga0081540_1099998
1798 Ga0081539_10008794
1799 Ga0081539_10019519
1800 Ga0070717_10004794
1801 Ga0070717_10109103
1802 Ga0075368_10000304
1803 Ga0075368_10000450
1804 Ga0075363_100093715
1805 Ga0075364_10341720
1806 Ga0070716_100017029
1807 Ga0070716_100129508
1808 Ga0070712_100043513
1809 Ga0070712_100203183
1810 Ga0075362_10001064
1811 Ga0075362_10034007
1812 Ga0075367_10007487
1813 Ga0075367_10022925
1814 Ga0075369_10005423
1815 Ga0075369_10096406
1816 Ga0075366_10087603
1817 Ga0097621_100001876
1818 Ga0097621_100081758
1819 Ga0097621_100104675
1820 Ga0097621_100202373
1821 Ga0097621_100244043
1822 Ga0097621_100397715
1823 Ga0068871_100007505
1824 Ga0068871_100062791
1825 Ga0068871_100120505
1826 Ga0068871_100224978
1827 Ga0068871_100672249
1828 Ga0075429_100129397
1829 Ga0068865_100000014
1830 Ga0068865_100073741
1831 Ga0068865_100830307
1832 Ga0097620_100008247
1833 Ga0097620_100024043
1834 Ga0097620_100090076
1835 Ga0097620_100310844
1836 Ga0097620_100603134
1837 Ga0079104_1016890
1838 Ga0079104_1030833
1839 Ga0105251_10000232
1840 Ga0105251_10000554
1841 Ga0105251_10030739
1842 Ga0105251_10127682
1843 Ga0105250_10127622
1844 Ga0105240_10108042
1845 Ga0105240_10163937
1846 Ga0105240_10243049
1847 Ga0105240_10292795
1848 Ga0105240_11331320
1849 Ga0105245_10000160
1850 Ga0105245_10013224
1851 Ga0105245_10018347
1852 Ga0105247_10057877
1853 Ga0114129_10257351
1854 Ga0105243_10000070
1855 Ga0105243_10005193
1856 Ga0105243_10055563
1857 Ga0105243_10130908
1858 Ga0105243_10229689
1859 Ga0105243_10745781
1860 Ga0105241_10030368
1861 Ga0105241_10077362
1862 Ga0105241_10158703
1863 Ga0105241_10266923
1864 Ga0105241_10762377
1865 Ga0105242_10001604
1866 Ga0105242_10188683
1867 Ga0105248_10000083
1868 Ga0105248_10001385
1869 Ga0105248_10002034
1870 Ga0105248_10023944
1871 Ga0105248_10024368
1872 Ga0105248_10032701
1873 Ga0105248_10091313
1874 Ga0105248_10155436
1875 Ga0105248_10354956
1876 Ga0105237_10005695
1877 Ga0105237_10017062
1878 Ga0105237_10097580
1879 Ga0105237_10215362
1880 Ga0105238_10015678
1881 Ga0105238_10024071
1882 Ga0105238_10116826
1883 Ga0105238_10173208
1884 Ga0105238_10373185
1885 Ga0105238_11024103
1886 Ga0105238_11607096
1887 Ga0105249_10000110
1888 Ga0105249_10015328
1889 Ga0105249_10096719
1890 Ga0105249_10201195
1891 Ga0105249_10433131
1892 Ga0105249_11029498
1893 Ga0105148_100275
1894 Ga0105148_117869
1895 Ga0105147_101564
1896 Ga0105239_10000271
1897 Ga0105239_10102466
1898 Ga0105239_10110863
1899 Ga0105239_10147805
1900 Ga0105239_11069256
1901 Ga0105239_11248926
1902 Ga0105246_10002314
1903 Ga0105246_10003501
1904 Ga0105246_10008646
1905 Ga0105246_10080366
1906 Ga0157326_1000005
1907 Ga0157326_1003871
1908 Ga0157373_10006989
1909 Ga0157373_10029859
1910 Ga0157373_10039126
1911 Ga0157373_10147818
1912 Ga0157373_10231884
1913 Ga0157373_10476278
1914 Ga0157373_10671609
1915 Ga0157371_10000011
1916 Ga0157371_10001091
1917 Ga0157371_10007915
1918 Ga0157371_10077146
1919 Ga0157371_10167994
1920 Ga0157371_10203577
1921 Ga0157371_10235898
1922 Ga0157371_10606890
1923 Ga0157371_10608377
1924 Ga0157370_10002905
1925 Ga0157370_11001809
1926 Ga0157369_10021625
1927 Ga0157369_10157781
1928 Ga0157369_10780179
1929 Ga0157374_10000542
1930 Ga0157374_10186177
1931 Ga0157374_10244501
1932 Ga0157374_10389936
1933 Ga0157374_10836077
1934 Ga0157378_10000624
1935 Ga0157378_10021072
1936 Ga0157378_10060444
1937 Ga0157378_11306933
1938 Ga0163162_10009970
1939 Ga0163162_10015197
1940 Ga0163162_10305478
1941 Ga0163162_10335390
1942 Ga0163162_10363202
1943 Ga0157372_10008443
1944 Ga0157372_10093707
1945 Ga0157372_10293339
1946 Ga0157372_11391257
1947 Ga0157375_10027717
1948 Ga0157375_10090533
1949 Ga0163163_10001064
1950 Ga0163163_10006906
1951 Ga0163163_10015984
1952 Ga0157380_10000315
1953 Ga0157380_10000763
1954 Ga0157380_10022724
1955 Ga0157380_10113655
1956 Ga0157380_10194137
1957 Ga0157380_10410985
1958 Ga0182008_10126272
1959 Ga0157377_10037303
1960 Ga0157377_10271498
1961 Ga0157379_10003811
1962 Ga0157379_10104620
1963 Ga0157379_10702359
1964 Ga0157376_10000096
1965 Ga0183363_1003
1966 Ga0163161_10044190
1967 Ga0163161_10046559
1968 Ga0163161_10106148
1969 Ga0163161_10107867
1970 Ga0163161_10295126
1971 Ga0209147_100298
1972 Ga0209563_100125
1973 Ga0209148_1000008
1974 Ga0209148_1000147
1975 Ga0209148_1002428
1976 Ga0209233_1000140
1977 Ga0209233_1027364
1978 Ga0209455_1000002
1979 Ga0209455_1000707
1980 Ga0209455_1009390
1981 Ga0209675_1000181
1982 Ga0209676_1000084
1983 Ga0209676_1000330
1984 Ga0209676_1000479
1985 Ga0209676_1032030
1986 Ga0209025_1022687
1987 Ga0209758_1000017
1988 Ga0209050_1000113
1989 Ga0209050_1000254
1990 Ga0209050_1001453
1991 Ga0209050_1048216
1992 Ga0209257_1000083
1993 Ga0209257_1000126
1994 Ga0209257_1000340
1995 Ga0209257_1001209
1996 Ga0209257_1053361
1997 Ga0207697_10035799
1998 Ga0207697_10047244
1999 Ga0207697_10077367
2000 Ga0207697_10084306
2001 Ga0207697_10211268
2002 Ga0207656_10001253
2003 Ga0207656_10034991
2004 Ga0207656_10069520
2005 Ga0207656_10079265
2006 Ga0207656_10196397
2007 Ga0207713_1000615
2008 Ga0207713_1001012
2009 Ga0207713_1060220
2010 Ga0207682_10000542
2011 Ga0207682_10035626
2012 Ga0207642_10064108
2013 Ga0207688_10067605
2014 Ga0207688_10145818
2015 Ga0207688_10148226
2016 Ga0207688_10198933
2017 Ga0207680_10001307
2018 Ga0207680_10053944
2019 Ga0207680_10555348
2020 Ga0207647_10000389
2021 Ga0207647_10000850
2022 Ga0207647_10019227
2023 Ga0207647_10041178
2024 Ga0207647_10084197
2025 Ga0207647_10085879
2026 Ga0207645_10000470
2027 Ga0207645_10008376
2028 Ga0207645_10030439
2029 Ga0207645_10044108
2030 Ga0207645_10208853
2031 Ga0207643_10033802
2032 Ga0207705_10000042
2033 Ga0207705_10000072
2034 Ga0207705_10000236
2035 Ga0207705_10007727
2036 Ga0207705_10009210
2037 Ga0207705_10018377
2038 Ga0207705_10028048
2039 Ga0207705_10093631
2040 Ga0207705_10151259
2041 Ga0207705_10318355
2042 Ga0207705_10479483
2043 Ga0207654_10000246
2044 Ga0207654_10159335
2045 Ga0207654_10230549
2046 Ga0207654_10480107
2047 Ga0207707_10006710
2048 Ga0207707_10047954
2049 Ga0207695_10005291
2050 Ga0207695_10124680
2051 Ga0207695_11005375
2052 Ga0207671_10000955
2053 Ga0207671_10044155
2054 Ga0207693_10014544
2055 Ga0207693_10053263
2056 Ga0207660_10001102
2057 Ga0207657_10000176
2058 Ga0207657_10000764
2059 Ga0207657_10000837
2060 Ga0207657_10000900
2061 Ga0207657_10003875
2062 Ga0207657_10005081
2063 Ga0207657_10008183
2064 Ga0207657_10009556
2065 Ga0207657_10024081
2066 Ga0207657_10027473
2067 Ga0207657_10164063
2068 Ga0207657_10434088
2069 Ga0207649_10000027
2070 Ga0207649_10000810
2071 Ga0207649_10002323
2072 Ga0207649_10005378
2073 Ga0207649_10086734
2074 Ga0207649_10199137
2075 Ga0207649_10388902
2076 Ga0207652_10000003
2077 Ga0207652_10000489
2078 Ga0207652_10027113
2079 Ga0207652_10035093
2080 Ga0207652_10068878
2081 Ga0207652_10181942
2082 Ga0207652_10378410
2083 Ga0207681_10000061
2084 Ga0207681_10002744
2085 Ga0207681_10005152
2086 Ga0207681_10090692
2087 Ga0207681_10131345
2088 Ga0207681_10254450
2089 Ga0207694_10005386
2090 Ga0207694_10036581
2091 Ga0207694_10098020
2092 Ga0207694_10443780
2093 Ga0207694_10822103
2094 Ga0207694_10905958
2095 Ga0207650_10000056
2096 Ga0207650_10000645
2097 Ga0207650_10007357
2098 Ga0207650_10034652
2099 Ga0207650_10071175
2100 Ga0207650_10137220
2101 Ga0207659_10011390
2102 Ga0207659_10069623
2103 Ga0207659_10137601
2104 Ga0207659_10783826
2105 Ga0207687_10000252
2106 Ga0207687_10000892
2107 Ga0207687_10059042
2108 Ga0207700_10032777
2109 Ga0207700_10255321
2110 Ga0207664_10149793
2111 Ga0207664_10509315
2112 Ga0207644_10018835
2113 Ga0207644_10026256
2114 Ga0207644_10059655
2115 Ga0207644_10063814
2116 Ga0207644_10190814
2117 Ga0207644_10200922
2118 Ga0207690_10000245
2119 Ga0207690_10000630
2120 Ga0207690_10001503
2121 Ga0207690_10022521
2122 Ga0207690_10071040
2123 Ga0207690_10083137
2124 Ga0207690_10171137
2125 Ga0207690_10198124
2126 Ga0207690_10227900
2127 Ga0207690_10229078
2128 Ga0207690_10244142
2129 Ga0207690_10259225
2130 Ga0207690_10390236
2131 Ga0207690_10645490
2132 Ga0207690_10798539
2133 Ga0207690_10934350
2134 Ga0207706_10000041
2135 Ga0207706_10001361
2136 Ga0207706_10009320
2137 Ga0207706_10021878
2138 Ga0207706_10028567
2139 Ga0207706_10032833
2140 Ga0207706_10327574
2141 Ga0207706_10401387
2142 Ga0207686_10002334
2143 Ga0207686_10048837
2144 Ga0207709_10000066
2145 Ga0207709_10000116
2146 Ga0207709_10018879
2147 Ga0207709_10033589
2148 Ga0207709_10183311
2149 Ga0207669_10000022
2150 Ga0207669_10015833
2151 Ga0207669_10062042
2152 Ga0207669_10101776
2153 Ga0207669_10113323
2154 Ga0207704_10000002
2155 Ga0207704_10000007
2156 Ga0207704_10054761
2157 Ga0207704_10164991
2158 Ga0207704_10183549
2159 Ga0207665_10013175
2160 Ga0207691_10010000
2161 Ga0207691_10017215
2162 Ga0207691_10513215
2163 Ga0207691_10519937
2164 Ga0207711_10000254
2165 Ga0207711_10002858
2166 Ga0207711_10019188
2167 Ga0207711_10033796
2168 Ga0207711_10043144
2169 Ga0207711_11183716
2170 Ga0207689_10000060
2171 Ga0207689_10003854
2172 Ga0207689_10156309
2173 Ga0207661_10000953
2174 Ga0207661_10019161
2175 Ga0207679_10000243
2176 Ga0207679_10006441
2177 Ga0207679_10016805
2178 Ga0207679_10025671
2179 Ga0207679_10049249
2180 Ga0207679_10062972
2181 Ga0207679_10094259
2182 Ga0207679_10206807
2183 Ga0207679_10728949
2184 Ga0207667_10000001
2185 Ga0207667_10000017
2186 Ga0207667_10006092
2187 Ga0207667_10007578
2188 Ga0207667_10017260
2189 Ga0207667_10017604
2190 Ga0207667_10028549
2191 Ga0207667_10031849
2192 Ga0207667_10033839
2193 Ga0207667_10064139
2194 Ga0207667_10201249
2195 Ga0207667_11003548
2196 Ga0207651_10000004
2197 Ga0207651_10099174
2198 Ga0207651_10201365
2199 Ga0207651_10501208
2200 Ga0207651_10557147
2201 Ga0207712_10001154
2202 Ga0207712_10007169
2203 Ga0207712_10009916
2204 Ga0207712_10068412
2205 Ga0207712_10519690
2206 Ga0207712_10574041
2207 Ga0207668_10000050
2208 Ga0207668_10008350
2209 Ga0207668_10024423
2210 Ga0207668_10025165
2211 Ga0207668_10036914
2212 Ga0207668_10060121
2213 Ga0207668_10096392
2214 Ga0207668_10100343
2215 Ga0207668_10136193
2216 Ga0207668_10196533
2217 Ga0207640_10000695
2218 Ga0207640_10003242
2219 Ga0207640_10009695
2220 Ga0207640_10010412
2221 Ga0207640_10022324
2222 Ga0207640_10022842
2223 Ga0207640_10050304
2224 Ga0207640_10057393
2225 Ga0207640_10254719
2226 Ga0207640_10848116
2227 Ga0207658_10000109
2228 Ga0207658_10000243
2229 Ga0207658_10000831
2230 Ga0207658_10001229
2231 Ga0207658_10007072
2232 Ga0207658_10019968
2233 Ga0207658_10333312
2234 Ga0207658_10469643
2235 Ga0207658_10482858
2236 Ga0207677_10000231
2237 Ga0207677_10105098
2238 Ga0207677_10150276
2239 Ga0207703_10000167
2240 Ga0207703_10000302
2241 Ga0207703_10001218
2242 Ga0207703_10022812
2243 Ga0207703_10165021
2244 Ga0207703_11233867
2245 Ga0207639_10000222
2246 Ga0207639_10001618
2247 Ga0207639_10002807
2248 Ga0207639_10004222
2249 Ga0207639_10044491
2250 Ga0207639_10119275
2251 Ga0207639_10192428
2252 Ga0207639_10372545
2253 Ga0207678_10000427
2254 Ga0207678_10002526
2255 Ga0207678_10009305
2256 Ga0207678_10009690
2257 Ga0207678_10025204
2258 Ga0207678_10029423
2259 Ga0207678_10033366
2260 Ga0207678_10130264
2261 Ga0207678_10349584
2262 Ga0207702_10000074
2263 Ga0207702_10004354
2264 Ga0207702_10067615
2265 Ga0207702_10142238
2266 Ga0207702_10245637
2267 Ga0207702_10931312
2268 Ga0207702_10954380
2269 Ga0207641_10000018
2270 Ga0207641_10000241
2271 Ga0207641_10000755
2272 Ga0207641_10001790
2273 Ga0207641_10033823
2274 Ga0207641_10232662
2275 Ga0207641_10306438
2276 Ga0207641_10331658
2277 Ga0207648_10000003
2278 Ga0207648_10004533
2279 Ga0207648_10008748
2280 Ga0207648_10043805
2281 Ga0207648_10059901
2282 Ga0207676_10000021
2283 Ga0207676_10000027
2284 Ga0207676_10000344
2285 Ga0207676_10007462
2286 Ga0207676_10036224
2287 Ga0207676_10698306
2288 Ga0207674_10004106
2289 Ga0207674_10006823
2290 Ga0207674_10012801
2291 Ga0207674_10038792
2292 Ga0207674_10154090
2293 Ga0207674_10155404
2294 Ga0207674_10372997
2295 Ga0207675_100001147
2296 Ga0207675_100440544
2297 Ga0207683_10015482
2298 Ga0207683_10015611
2299 Ga0207683_10058649
2300 Ga0207683_10320182
2301 Ga0207683_10335183
2302 Ga0207698_10000892
2303 Ga0207698_10001072
2304 Ga0207698_10006957
2305 Ga0207698_10033576
2306 Ga0207698_10034897
2307 Ga0207698_10080661
2308 Ga0207698_10173871
2309 Ga0207698_10397770
2310 Ga0207698_11204589
2311 Ga0209973_1085743
2312 Ga0209983_1013449
2313 Ga0209971_1038769
2314 Ga0209813_10000007
2315 Ga0209813_10000279
2316 Ga0209974_10003536
2317 Ga0268266_10000002
2318 Ga0268266_10000175
2319 Ga0268266_10001810
2320 Ga0268266_10005157
2321 Ga0268266_10013052
2322 Ga0268266_10025965
2323 Ga0268266_10258148
2324 Ga0268266_10502646
2325 Ga0268266_10623025
2326 Ga0268265_10000042
2327 Ga0268265_10000052
2328 Ga0268265_10003957
2329 Ga0268265_10014248
2330 Ga0268265_10080018
2331 Ga0268265_10167444
2332 Ga0268265_10320645
2333 Ga0268265_10651549
2334 Ga0268264_10000144
2335 Ga0268264_10000268
2336 Ga0268264_10001327
2337 Ga0268264_10013849
2338 Ga0268264_10016760
2339 Ga0268264_10045605
2340 Ga0268264_10065024
2341 Ga0268264_10095824
2342 Ga0268264_10565079
2343 Ga0307517_10020643
2344 Ga0307517_10295058
2345 Ga0316183_1203243
2346 Ga0265327_10116288
2347 Ga0307509_10476517
2348 Ga0307408_100004452
2349 Ga0307408_100006152
2350 Ga0307408_100013781
2351 Ga0307408_100045019
2352 Ga0307408_100047429
2353 Ga0307408_100115622
2354 Ga0307408_100219274
2355 Ga0307408_100454895
2356 Ga0307408_100490889
2357 Ga0307408_100499911
2358 Ga0307508_10013978
2359 Ga0307508_10100659
2360 Ga0307405_10002843
2361 Ga0307405_10004479
2362 Ga0307405_10021552
2363 Ga0307413_10002654
2364 Ga0307413_10011213
2365 Ga0307413_10017328
2366 Ga0307413_10023177
2367 Ga0307413_10135136
2368 Ga0307413_10301424
2369 Ga0307413_10822024
2370 Ga0307410_10012132
2371 Ga0307410_10045244
2372 Ga0307410_10074163
2373 Ga0307410_10075902
2374 Ga0307410_10118726
2375 Ga0307410_10243550
2376 Ga0307410_10303694
2377 Ga0307410_10425944
2378 Ga0307410_10746693
2379 Ga0307410_10842397
2380 Ga0307406_10010388
2381 Ga0307406_10032616
2382 Ga0307406_10049849
2383 Ga0307406_10293774
2384 Ga0307406_10354532
2385 Ga0307406_10355532
2386 Ga0307406_10430414
2387 Ga0307406_10463989
2388 Ga0307407_10000642
2389 Ga0307407_10001660
2390 Ga0307407_10018963
2391 Ga0307407_10064069
2392 Ga0307407_10215283
2393 Ga0307412_10003000
2394 Ga0307412_10011723
2395 Ga0307412_10023555
2396 Ga0307412_10031872
2397 Ga0307412_10068448
2398 Ga0307412_10133370
2399 Ga0307412_10147821
2400 Ga0307412_10504704
2401 Ga0307412_10550438
2402 Ga0307412_10673933
2403 Ga0307412_11301028
2404 Ga0307409_100001134
2405 Ga0307409_100014600
2406 Ga0307409_100042286
2407 Ga0307409_100097867
2408 Ga0307409_100107575
2409 Ga0307409_100375613
2410 Ga0307409_100462246
2411 Ga0307409_100574396
2412 Ga0307409_100609696
2413 Ga0307416_100021275
2414 Ga0307416_100024603
2415 Ga0307416_100025294
2416 Ga0307416_100026146
2417 Ga0307416_100039060
2418 Ga0307416_100117251
2419 Ga0307416_100660589
2420 Ga0307414_10000073
2421 Ga0307414_10004382
2422 Ga0307414_10004615
2423 Ga0307414_10004943
2424 Ga0307414_10049760
2425 Ga0307414_10085299
2426 Ga0307414_10096376
2427 Ga0307414_10129051
2428 Ga0307414_10154175
2429 Ga0307414_10181450
2430 Ga0307414_10292136
2431 Ga0307414_10323515
2432 Ga0307414_10340417
2433 Ga0307414_10410604
2434 Ga0307414_10647308
2435 Ga0307414_10764060
2436 Ga0307414_10992884
2437 Ga0307411_10005275
2438 Ga0307411_10016683
2439 Ga0307411_10028900
2440 Ga0307411_10041569
2441 Ga0307411_10041899
2442 Ga0307411_10208079
2443 Ga0307411_10220221
2444 Ga0307411_10257744
2445 Ga0307411_10301566
2446 Ga0307411_10303104
2447 Ga0307411_10311678
2448 Ga0307415_100009294
2449 Ga0307415_100288064
2450 Ga0307415_100321955
2451 Ga0307415_100335672
2452 Ga0307415_100439992
2453 Ga0307510_10066259
2454 Ga0373951_0046907
2455 Ga0373923_0004223
2456 Ga0373923_0127740
2457 Ga0373943_0005666
2458 Ga0373946_0061644
2459 Ga0373935_0002322
2460 Ga0373933_0031583
2461 Ga0373947_0022791
2462 Ga0373947_0129808
2463 Ga0373937_0045789
2464 Ga0373925_0277898
2465 Ga0395899_0010252
2466 Ga0395899_0036681
2467 Ga0395899_0044714
2468 Ga0395899_0053580
2469 Ga0395899_0134149
2470 Ga0395899_0162236
2471 Ga0395900_0027388
2472 Ga0395900_0028928
2473 Ga0395900_0092721
2474 Ga0395900_0120079
2475 Ga0395900_0164384
2476 Ga0395900_0335785
2477 Ga0395898_0054496
2478 Ga0395898_0085987
2479 Ga0395905_0025080
2480 Ga0395905_0030632
2481 Ga0395905_0047368
2482 Ga0395905_0133408
2483 Ga0395905_0160398
2484 Ga0395905_0292187
2485 Ga0395905_0315237
2486 Ga0395905_0370430
2487 Ga0395905_0377023
2488 Ga0436364_0804686
2489 Ga0395901_0041174
2490 Ga0395901_0048282
2491 Ga0395901_0099018
2492 Ga0395901_0647004
2493 Ga0237819_02628
2494 Ga0237816_03757
2495 Ga0436365_1638035
2496 Ga0439466_0065068
2497 Ga0451791_1549013
2498 Ga0451853_4106881
2499 Ga0439432_002749
2500 Ga0439449_0061824
2501 Ga0439462_0000274
2502 Ga0439458_0000616
2503 Ga0439460_0265782
2504 Ga0451577_0219644
2505 Ga0466972_0001135
2506 Ga0466972_0040609
2507 Ga0466973_0033687
2508 Ga0466965_0074211
2509 Ga0466966_0001152
2510 Ga0466966_0229375
2511 Ga0466961_0017645
2512 Ga0466961_0039301
2513 Ga0466963_0050836
2514 Ga0466963_0321751
2515 Ga0466964_0023350
2516 Ga0466971_0001276
2517 Ga0466971_0371524
2518 Ga0466968_0043206
2519 Ga0466968_0054968
2520 Ga0466970_0114927
2521 Ga0466970_0116316
2522 Ga0466970_0161930
2523 Ga0466970_0492336
2524 Ga0466957_0008816
2525 Ga0466960_0001716
2526 Ga0466959_0084865
2527 Ga0466959_0160252
2528 Ga0466959_0213418
2529 Ga0466958_0010021
2530 Ga0466958_0025024
2531 Ga0466967_0083449
2532 Ga0466967_0373387
2533 Ga0466967_0433627
2534 Ga0495617_008380
2535 Ga0495627_000024
2536 Ga0495627_000582
2537 Ga0495627_020847
2538 Ga0495627_036429
2539 Ga0495638_0000051
2540 Ga0495638_0015201
2541 Ga0495638_0127999
2542 Ga0495650_0000967
2543 Ga0495650_0001090
2544 Ga0495650_0003223
2545 Ga0495605_0024857
2546 Ga0495584_0483584
2547 Ga0495585_0040991
2548 Ga0495585_0061915
2549 Ga0495585_0062413
2550 Ga0495585_0081005
2551 Ga0495585_0094743
2552 Ga0495596_0000008
2553 Ga0495596_0002823
2554 Ga0495607_0006279
2555 Ga0495607_0013977
2556 Ga0495607_0037379
2557 Ga0495583_0000582
2558 Ga0495583_0001392
2559 Ga0495583_0005396
2560 Ga0495583_0030469
2561 Ga0495583_0074163
2562 Ga0495583_0077084
2563 Ga0495583_0085684
2564 Ga0495606_0000178
2565 Ga0495606_0010737
2566 Ga0495606_0013877
2567 Ga0495606_0027882
2568 Ga0495606_0163301
2569 Ga0495606_0173376
2570 Ga0495610_0000053
2571 Ga0495610_0000081
2572 Ga0495610_0001175
2573 Ga0495610_0004173
2574 Ga0495610_0093412
2575 Ga0495610_0151897
2576 Ga0495616_0223663
2577 Ga0495620_0024916
2578 Ga0495631_0026871
2579 Ga0495631_0045866
2580 Ga0495631_0252731
2581 Ga0495632_0000006
2582 Ga0495632_0000306
2583 Ga0495632_0000356
2584 Ga0495632_0014842
2585 Ga0495632_0185855
2586 Ga0495637_0000784
2587 Ga0495637_0023493
2588 Ga0495643_0000021
2589 Ga0495643_0000042
2590 Ga0495643_0001768
2591 Ga0495643_0002744
2592 Ga0495643_0002897
2593 Ga0495643_0012066
2594 Ga0495643_0018146
2595 Ga0495643_0018970
2596 Ga0495643_0045444
2597 Ga0495643_0055387
2598 Ga0495643_0064246
2599 Ga0495643_0108432
2600 Ga0495643_0183112
2601 Ga0495643_0232909
2602 Ga0495643_0406652
2603 Ga0495648_0000032
2604 Ga0495648_0004587
2605 Ga0495648_0026511
2606 Ga0495648_0038726
2607 Ga0495648_0148282
2608 Ga0495648_0215116
2609 Ga0495663_0000008
2610 Ga0495663_0000758
2611 Ga0495663_0021992
2612 Ga0495663_0054540
2613 Ga0495663_0128851
2614 Ga0495652_0539811
2615 Ga0495609_0003619
2616 Ga0495609_0161424
2617 Ga0495597_0021634
2618 Ga0495622_0002170
2619 Ga0495633_0000247
2620 Ga0495633_0000308
2621 Ga0495633_0001265
2622 Ga0495633_0009196
2623 Ga0495633_0015315
2624 Ga0495633_0043814
2625 Ga0495633_0100529
2626 Ga0495633_0188828
2627 Ga0495668_0000004
2628 Ga0495668_0000013
2629 Ga0495668_0015322
2630 Ga0495668_0021352
2631 Ga0495668_0216745
2632 Ga0495668_0434163
2633 Ga0495611_0014367
2634 Ga0495611_0066649
2635 Ga0495625_0000321
2636 Ga0495625_0000914
2637 Ga0495625_0003636
2638 Ga0495625_0042735
2639 Ga0495625_0043217
2640 Ga0495625_0071562
2641 Ga0495625_0119010
2642 Ga0495625_0226451
2643 Ga0495661_0072319
2644 Ga0495661_0194740
2645 Ga0495623_0070991
2646 Ga0495669_0002087
2647 Ga0495669_0009712
2648 Ga0495669_0014347
2649 Ga0495669_0062574
2650 Ga0495671_0000017
2651 Ga0495671_0000020
2652 Ga0495671_0005841
2653 Ga0495671_0006324
2654 Ga0495671_0022403
2655 Ga0495649_0031039
2656 Ga0495649_0038474
2657 Ga0495600_0001554
2658 Ga0495660_0047286
2659 Ga0495660_0087149
2660 Ga0495672_0117903
2661 Ga0495683_0006805
2662 Ga0495687_000250
2663 Ga0495687_000614
2664 Ga0495677_0001865
2665 Ga0495673_0000076
2666 Ga0495673_0020724
2667 Ga0495673_0030495
2668 Ga0495673_0034699
2669 Ga0495673_0041073
2670 Ga0495681_0000099
2671 Ga0495681_0000517
2672 Ga0495681_0032888
2673 Ga0495686_0000262
2674 Ga0495686_0000273
2675 Ga0495686_0000669
2676 Ga0495686_0000680
2677 Ga0495686_0103361
2678 Ga0495686_0154042
2679 Ga0495686_0201852
2680 Ga0495602_0046500
2681 Ga0495615_0000135
2682 Ga0495626_0000139
2683 Ga0496100_0427862
2684 Ga0496101_0353643
2685 Ga0496102_0001391
2686 Ga0496102_0009613
2687 Ga0496102_0030551
2688 Ga0496102_0517366
2689 Ga0496102_0557811
2690 Ga0496102_0851955
2691 Ga0496103_0000055
2692 Ga0496103_0007593
2693 Ga0496103_0041420
2694 Ga0496103_0477353
2695 Ga0496104_0026298
2696 Ga0496104_1127604
2697 Ga0496104_1166181
2698 Ga0496105_0000358
2699 Ga0496105_0740658
2700 Ga0496106_0019385
2701 Ga0496107_0020666
2702 Ga0496108_0054733
2703 Ga0496108_0296198
2704 Ga0496109_0022187
2705 Ga0496109_0098706
2706 Ga0496109_0215343
2707 Ga0496109_0284074
2708 Ga0496110_0009627
2709 Ga0496110_0026654
2710 Ga0496110_0062006
2711 Ga0496111_0021635
2712 Ga0496111_0103898
2713 Ga0496112_0041602
2714 Ga0496112_0274805
2715 Ga0496113_0009411
2716 Ga0496113_0103450
2717 Ga0496113_0145461
2718 Ga0496113_1273601
2719 Ga0496114_0000016
2720 Ga0496114_0010092
2721 Ga0496114_0118522
2722 Ga0496115_0000267
2723 Ga0496116_0000045
2724 Ga0496116_0023536
2725 Ga0496116_0028810
2726 Ga0496116_0064603
2727 Ga0496117_0000549
2728 Ga0496117_0002463
2729 Ga0496117_0004882
2730 Ga0496117_0017345
2731 Ga0496117_0070619
2732 Ga0496117_0166788
2733 Ga0496117_0232443
2734 Ga0496118_0000552
2735 Ga0496118_0000811
2736 Ga0496118_0003823
2737 Ga0496118_0007786
2738 Ga0496118_0017208
2739 Ga0496118_0017950
2740 Ga0496118_0034239
2741 Ga0496118_0347199
2742 Ga0496119_0031108
2743 Ga0496119_0077162
2744 Ga0496119_0089316
2745 Ga0496119_0248753
2746 Ga0496120_0013820
2747 Ga0496120_0151706
2748 Ga0496121_0000652
2749 Ga0496121_0000930
2750 Ga0496121_0001191
2751 Ga0496121_0003000
2752 Ga0496121_0005432
2753 Ga0496121_0024091
2754 Ga0496121_0031341
2755 Ga0496121_0031916
2756 Ga0496121_0068404
2757 Ga0496121_0078566
2758 Ga0496121_0192677
2759 Ga0496122_0003938
2760 Ga0496122_0005345
2761 Ga0496122_0011792
2762 Ga0496122_0017572
2763 Ga0496122_0036518
2764 Ga0496122_0081358
2765 Ga0496122_0147769
2766 Ga0496123_0001272
2767 Ga0496123_0001952
2768 Ga0496123_0011382
2769 Ga0496123_0011531
2770 Ga0496123_0037600
2771 Ga0496123_0067977
2772 Ga0496123_0079556
2773 Ga0496123_0106909
2774 Ga0496123_0233381
2775 Ga0496124_0000585
2776 Ga0496124_0003632
2777 Ga0496124_0008726
2778 Ga0496124_0013710
2779 Ga0496124_0019318
2780 Ga0496124_0026758
2781 Ga0496124_0030502
2782 Ga0496124_0099254
2783 Ga0496124_0132861
2784 Ga0496124_0134357
2785 Ga0496124_0166346
2786 Ga0496125_0001142
2787 Ga0496125_0010180
2788 Ga0496125_0010701
2789 Ga0496125_0032339
2790 Ga0496125_0035059
2791 Ga0496125_0036806
2792 Ga0496125_0041123
2793 Ga0496125_0042756
2794 Ga0496125_0059204
2795 Ga0496125_0085882
2796 Ga0496125_0099292
2797 Ga0496125_0107311
2798 Ga0496125_0155799
2799 Ga0496126_0000519
2800 Ga0496126_0001094
2801 Ga0496126_0004852
2802 Ga0496126_0014259
2803 Ga0496126_0064441
2804 Ga0496126_0093822
2805 Ga0496126_0271213
2806 Ga0496126_0501897
2807 Ga0496126_0536572
2808 Ga0495678_201105
2809 Ga0501335_005898
2810 Ga0501032_0019920
2811 Ga0501032_0022006
2812 Ga0501033_0058368
2813 Ga0501033_0127471
2814 Ga0501034_0108545
2815 Ga0501034_0880013
2816 Ga0501036_0189107
2817 Ga0501036_0718870
2818 Ga0501037_0046165
2819 Ga0501038_0253946
2820 Ga0501039_0717338
2821 Ga0501043_0007449
2822 Ga0501043_0011321
2823 Ga0501043_0059629
2824 Ga0501043_0813160
2825 Ga0501046_0030557
2826 Ga0501046_0269958
2827 Ga0501047_0000795
2828 Ga0501047_0277926
2829 Ga0501047_0472231
2830 Ga0501047_0701199
2831 Ga0501048_0086339
2832 Ga0501067_0016919
2833 Ga0501067_0060171
2834 Ga0501070_0297898
2835 Ga0501208_042684
2836 Ga0501223_000092
2837 Ga0501224_010003
2838 Ga0501235_014004
2839 Ga0501235_034142
2840 Ga0501249_001325
2841 Ga0501257_087543
2842 Ga0501225_0009956
2843 Ga0501225_0118260
2844 Ga0501245_127857
2845 Ga0501267_012879
2846 Ga0501035_0289634
2847 Ga0501044_0013098
2848 Ga0501044_0035147
2849 Ga0501044_0044292
2850 Ga0501044_0376795
2851 Ga0501044_0401751
2852 Ga0501044_0582299
2853 nmdc:mga03683_126171_c1
2854 nmdc:mga03683_276_c1
2855 nmdc:mga03n38_89329_c1
2856 nmdc:mga00v17_68256_c1
2857 nmdc:mga00v17_81142_c1
2858 nmdc:mga0k408_63396_c1
2859 nmdc:mga06z11_134_c1
2860 nmdc:mga06z11_85_c1
2861 nmdc:mga07m45_12_c1
2862 nmdc:mga05p37_324492_c1
2863 nmdc:mga0n895_1010399_c1
2864 nmdc:mga0n895_1523631_c1
2865 nmdc:mga0rr50_135562_c1
2866 nmdc:mga0rr50_141418_c1
2867 nmdc:mga0sz30_10812_c2
2868 nmdc:mga0sz30_11490_c1
2869 Ga0500610_0000092
2870 Ga0500643_000001
2871 Ga0500643_001742
2872 Ga0500643_004433
2873 Ga0500643_006129
2874 Ga0500647_0042393
2875 Ga0500651_0009774
2876 Ga0500566_0005455
2877 Ga0500562_003322
2878 Ga0500592_005424
2879 Ga0500592_019794
2880 Ga0500594_0009825
2881 Ga0500595_007737
2882 Ga0500607_001489
2883 Ga0500642_0000187
2884 Ga0500642_0002784
2885 Ga0500655_000107
2886 Ga0500658_0034924
2887 Ga0500559_0022339
2888 Ga0500559_0046716
2889 Ga0500564_027808
2890 Ga0500568_0003230
2891 Ga0500573_0000065
2892 Ga0500616_0002096
2893 Ga0500616_0051227
2894 Ga0500619_024218
2895 Ga0500622_0003412
2896 Ga0500624_000002
2897 Ga0500627_0000089
2898 Ga0500636_0005106
2899 Ga0500567_002040
2900 Ga0500570_000192
2901 Ga0500625_000026
2902 Ga0500645_000024
2903 Ga0500596_000659
2904 Ga0466962_0013450
2905 2511130872
2906 2512644588
2907 2585261427
2908 2643730797
2909 2643819380
2910 2643836094
2911 2643951674
2912 2644040797
2913 2644044550
2914 2644052571
2915 2644391525
2916 2739651109
2917 2740029582
2918 2778126675
2919 2809062608
2920 2809078708
2921 2809082997
2922 2819551416
2923 2848298713
2924 2852656068
2925 2852683203
2926 2880521586
2927 2885432554
2928 2895881321
2929 2896253805
2930 2919709521
2931 2928029412
2932 2946790184
2933 2984556609
2934 2984565218
2935 2990265954
2936 2993356294
2937 2993696255
2938 3000867203
2939 8054305113
2940 8057101585

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01914

MarC

MarC family integral membrane protein

6

216

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sc2-assembly1.cif.gz_A human oct1 bound to diltiazem in inward-open conformation 0.5222 5 187
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.5049 1 193
6gv1-assembly1.cif.gz_A crystal structure of e.coli multidrug/h+ antiporter mdfa in outward open conformation with bound fab fragment 0.4982 3 189
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.4807 5 187
6vs2-assembly1.cif.gz_A protein d 0.4667 4 198
ID Description Score Start End Superfamily
af_Q9XUL2_18_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5236 3 197 1.20.1250.20
af_A0A4V0IJT1_312_502_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.52 4 189 1.20.1250.20
af_A0A0P0X7B4_1_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5177 4 191 1.20.1250.20
af_E7FF19_1_301_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5115 2 187 1.20.1250.20
af_P9WGE5_1_282_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5097 4 194 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3D3LTE6-F1-model_v4 UPF0056 membrane protein 0.7734 2 197 GO:0005886
AF-A0A839J1R9-F1-model_v4 UPF0056 membrane protein 0.7669 41 198 GO:0005886
AF-A0A7Y2G823-F1-model_v4 UPF0056 membrane protein 0.7645 4 198 GO:0005886
AF-A0A3D3Q9Z2-F1-model_v4 UPF0056 membrane protein 0.7594 13 197 GO:0005886
AF-A0A1C3DT85-F1-model_v4 UPF0056 membrane protein 0.7593 5 197 GO:0005886

Map