F494200
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1470 | 449 | 2940 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300028380|Ga0268265_10122506|Ga0268265_101225062 |
| Length | 217 |
| Sequence | MSPDLVALFLSALVTFVVVIDPPGCAPIFASLTAGTTPAHRRAMAVRSVAVASVVLILFSLFGEAFLDMLGISLAAFRIAGGIMLFLIAIDMVFEKRTQRREERAEEISKRAADEHRPLEAEDISVFPMGIPMIAGPGSIATAMLLTSRANGWMEGGIVLGALAATLLLTLLALLAAGPLMNALGHKVEAMITRVLGVILAALAVQFVIDGLKASFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 120 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 219 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 235 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 251 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 254 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 257 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 258 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 259 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 260 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 264 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 328 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 339 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 342 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 343 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 344 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 345 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 346 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 347 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 348 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 349 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 365 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 369 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 370 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 372 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 378 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 379 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 381 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 387 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 388 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 389 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 391 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 392 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 394 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 395 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 396 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 397 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 401 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 402 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 405 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 406 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 409 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 410 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 411 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 413 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 414 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 415 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 416 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 417 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 418 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 419 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 420 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 421 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 422 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 423 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 424 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 425 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 426 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 427 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 428 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 429 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 430 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 431 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 432 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 433 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 434 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 435 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 436 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 437 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 438 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 439 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 440 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 441 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 442 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 443 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 444 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 445 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 446 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 447 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 448 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 449 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 0.07 |
| Isolates | 2.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.34 |
| Bulb | 0 |
| Endosphere | 6.87 |
| Nodule | 0.14 |
| Rhizoplane | 2.79 |
| Rhizosphere | 82.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0268265_10122506 | 3300028380 | Bacteria | 2145 |
| 2 | SwRhRL2b_contig_1673102 | 2162886007 | Bacteria | 13823 |
| 3 | SwRhRL2b_contig_1893398 | 2162886007 | Bacteria | 12143 |
| 4 | SwRhRL2b_contig_67628 | 2162886007 | Bacteria | 1414 |
| 5 | JGI24736J21556_1001983 | 3300001904 | Bacteria | 3633 |
| 6 | JGI24736J21556_1005378 | 3300001904 | Bacteria | 2163 |
| 7 | JGI24741J21665_1000122 | 3300001915 | Bacteria | 20977 |
| 8 | JGI24741J21665_1039325 | 3300001915 | Bacteria | 699 |
| 9 | JGI24752J21851_1001492 | 3300001976 | Bacteria | 3157 |
| 10 | JGI24747J21853_1004386 | 3300001978 | Bacteria | 1263 |
| 11 | JGI24740J21852_10010138 | 3300001979 | Bacteria | 3644 |
| 12 | JGI24740J21852_10025066 | 3300001979 | Bacteria | 2015 |
| 13 | JGI24740J21852_10046169 | 3300001979 | Bacteria | 1280 |
| 14 | JGI24740J21852_10074931 | 3300001979 | Bacteria | 897 |
| 15 | JGI24740J21852_10082943 | 3300001979 | Bacteria | 837 |
| 16 | JGI24739J22299_10000391 | 3300001989 | Bacteria | 15156 |
| 17 | JGI24739J22299_10002839 | 3300001989 | Bacteria | 6655 |
| 18 | JGI24739J22299_10003277 | 3300001989 | Bacteria | 6175 |
| 19 | JGI24739J22299_10008673 | 3300001989 | Bacteria | 3792 |
| 20 | JGI24739J22299_10010024 | 3300001989 | Bacteria | 3522 |
| 21 | JGI24739J22299_10020971 | 3300001989 | Bacteria | 2331 |
| 22 | JGI24737J22298_10001243 | 3300001990 | Bacteria | 9004 |
| 23 | JGI24737J22298_10004308 | 3300001990 | Bacteria | 4970 |
| 24 | JGI24737J22298_10042356 | 3300001990 | Bacteria | 1395 |
| 25 | JGI24737J22298_10050139 | 3300001990 | Bacteria | 1269 |
| 26 | JGI24743J22301_10019238 | 3300001991 | Bacteria | 1296 |
| 27 | JGI24735J21928_10002241 | 3300002067 | Bacteria | 6764 |
| 28 | JGI24735J21928_10004078 | 3300002067 | Bacteria | 4929 |
| 29 | JGI24735J21928_10007186 | 3300002067 | Bacteria | 3634 |
| 30 | JGI24735J21928_10026692 | 3300002067 | Bacteria | 1734 |
| 31 | JGI24735J21928_10043417 | 3300002067 | Bacteria | 1307 |
| 32 | JGI24735J21928_10192644 | 3300002067 | Bacteria | 591 |
| 33 | JGI24738J21930_10000436 | 3300002075 | Bacteria | 11806 |
| 34 | JGI24738J21930_10011972 | 3300002075 | Bacteria | 1899 |
| 35 | JGI24738J21930_10022102 | 3300002075 | Bacteria | 1317 |
| 36 | JGI24738J21930_10052632 | 3300002075 | Bacteria | 831 |
| 37 | JGI24749J21850_1000069 | 3300002076 | Bacteria | 18624 |
| 38 | JGI24744J21845_10007524 | 3300002077 | Bacteria | 2250 |
| 39 | JGI24744J21845_10038565 | 3300002077 | Bacteria | 898 |
| 40 | JGI24742J22300_10039055 | 3300002244 | Bacteria | 843 |
| 41 | JGI24751J29686_10000391 | 3300002459 | Bacteria | 14670 |
| 42 | JGI24751J29686_10037791 | 3300002459 | Bacteria | 999 |
| 43 | JGI25165J46597_1000071 | 3300003214 | Bacteria | 193222 |
| 44 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 45 | rootH2_10174559 | 3300003320 | Bacteria | 1998 |
| 46 | rootH1_10040862 | 3300003323 | Bacteria | 5300 |
| 47 | rootH1_10162866 | 3300003323 | Bacteria | 1025 |
| 48 | Ga0055525_1000127 | 3300003759 | Bacteria | 113683 |
| 49 | Ga0055542_1000038 | 3300003762 | Bacteria | 224625 |
| 50 | Ga0055542_1001654 | 3300003762 | Bacteria | 9990 |
| 51 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 52 | Ga0055529_1000021 | 3300003763 | Bacteria | 321484 |
| 53 | Ga0055536_1003088 | 3300003781 | Bacteria | 9071 |
| 54 | Ga0055536_1006967 | 3300003781 | Bacteria | 5147 |
| 55 | Ga0055534_1008222 | 3300003784 | Bacteria | 2385 |
| 56 | Ga0055530_10000048 | 3300003791 | Bacteria | 107993 |
| 57 | Ga0055530_10011789 | 3300003791 | Bacteria | 3107 |
| 58 | Ga0055531_10000929 | 3300003794 | Bacteria | 23705 |
| 59 | Ga0055531_10004331 | 3300003794 | Bacteria | 8683 |
| 60 | Ga0065165_1004328 | 3300005262 | Bacteria | 8919 |
| 61 | Ga0065165_1053500 | 3300005262 | Bacteria | 1136 |
| 62 | Ga0065704_10070193 | 3300005289 | Bacteria | 98570 |
| 63 | Ga0065704_10094687 | 3300005289 | Bacteria | 2530 |
| 64 | Ga0065704_10127076 | 3300005289 | Bacteria | 1680 |
| 65 | Ga0065704_10173616 | 3300005289 | Bacteria | 1277 |
| 66 | Ga0065715_10007711 | 3300005293 | Bacteria | 4049 |
| 67 | Ga0065707_10081811 | 3300005295 | Bacteria | 37556 |
| 68 | Ga0065707_10105390 | 3300005295 | Bacteria | 2647 |
| 69 | Ga0065707_10260882 | 3300005295 | Bacteria | 1097 |
| 70 | Ga0070658_10000377 | 3300005327 | Bacteria | 38853 |
| 71 | Ga0070658_10000716 | 3300005327 | Bacteria | 28749 |
| 72 | Ga0070658_10003584 | 3300005327 | Bacteria | 12730 |
| 73 | Ga0070658_10003723 | 3300005327 | Bacteria | 12473 |
| 74 | Ga0070658_10004008 | 3300005327 | Bacteria | 12067 |
| 75 | Ga0070658_10007308 | 3300005327 | Bacteria | 8922 |
| 76 | Ga0070658_10021861 | 3300005327 | Bacteria | 5128 |
| 77 | Ga0070658_10075150 | 3300005327 | Bacteria | 2771 |
| 78 | Ga0070658_10153726 | 3300005327 | Bacteria | 1928 |
| 79 | Ga0070676_10001215 | 3300005328 | Bacteria | 12921 |
| 80 | Ga0070676_10005501 | 3300005328 | Bacteria | 6745 |
| 81 | Ga0070676_10176436 | 3300005328 | Bacteria | 1386 |
| 82 | Ga0070676_10652559 | 3300005328 | Bacteria | 764 |
| 83 | Ga0070683_100001819 | 3300005329 | Bacteria | 16631 |
| 84 | Ga0070683_100018052 | 3300005329 | Bacteria | 6241 |
| 85 | Ga0070683_100168475 | 3300005329 | Bacteria | 2079 |
| 86 | Ga0070690_100128620 | 3300005330 | Bacteria | 1708 |
| 87 | Ga0070670_100000027 | 3300005331 | Bacteria | 186072 |
| 88 | Ga0070670_100000047 | 3300005331 | Bacteria | 136625 |
| 89 | Ga0070670_100012449 | 3300005331 | Bacteria | 7280 |
| 90 | Ga0070670_100042597 | 3300005331 | Bacteria | 3903 |
| 91 | Ga0070670_100302451 | 3300005331 | Bacteria | 1399 |
| 92 | Ga0070670_100775340 | 3300005331 | Bacteria | 865 |
| 93 | Ga0070677_10000079 | 3300005333 | Bacteria | 30894 |
| 94 | Ga0070677_10011544 | 3300005333 | Bacteria | 3049 |
| 95 | Ga0070677_10034331 | 3300005333 | Bacteria | 1959 |
| 96 | Ga0068869_100000031 | 3300005334 | Bacteria | 60884 |
| 97 | Ga0070666_10000779 | 3300005335 | Bacteria | 19305 |
| 98 | Ga0070666_10054458 | 3300005335 | Bacteria | 2699 |
| 99 | Ga0070666_10093259 | 3300005335 | Bacteria | 2070 |
| 100 | Ga0070666_10581678 | 3300005335 | Bacteria | 816 |
| 101 | Ga0070680_100000177 | 3300005336 | Bacteria | 41002 |
| 102 | Ga0070680_100003469 | 3300005336 | Bacteria | 11774 |
| 103 | Ga0070680_100245996 | 3300005336 | Bacteria | 1512 |
| 104 | Ga0070680_100602927 | 3300005336 | Bacteria | 942 |
| 105 | Ga0070682_100058066 | 3300005337 | Bacteria | 2439 |
| 106 | Ga0070682_100128504 | 3300005337 | Bacteria | 1712 |
| 107 | Ga0070682_101075427 | 3300005337 | Bacteria | 672 |
| 108 | Ga0068868_100000060 | 3300005338 | Bacteria | 61952 |
| 109 | Ga0068868_100058542 | 3300005338 | Bacteria | 3045 |
| 110 | Ga0068868_100192305 | 3300005338 | Bacteria | 1697 |
| 111 | Ga0068868_100202519 | 3300005338 | Bacteria | 1655 |
| 112 | Ga0070660_100000751 | 3300005339 | Bacteria | 21524 |
| 113 | Ga0070660_100000986 | 3300005339 | Bacteria | 19065 |
| 114 | Ga0070660_100002934 | 3300005339 | Bacteria | 11737 |
| 115 | Ga0070660_100005512 | 3300005339 | Bacteria | 8765 |
| 116 | Ga0070660_100009089 | 3300005339 | Bacteria | 6976 |
| 117 | Ga0070660_100016075 | 3300005339 | Bacteria | 5423 |
| 118 | Ga0070660_100024083 | 3300005339 | Bacteria | 4516 |
| 119 | Ga0070660_100111630 | 3300005339 | Bacteria | 2175 |
| 120 | Ga0070660_100273648 | 3300005339 | Bacteria | 1381 |
| 121 | Ga0070660_100347733 | 3300005339 | Bacteria | 1220 |
| 122 | Ga0070687_100111831 | 3300005343 | Bacteria | 1547 |
| 123 | Ga0070687_100150704 | 3300005343 | Bacteria | 1365 |
| 124 | Ga0070661_100000156 | 3300005344 | Bacteria | 55675 |
| 125 | Ga0070661_100000187 | 3300005344 | Bacteria | 51095 |
| 126 | Ga0070661_100006527 | 3300005344 | Bacteria | 8049 |
| 127 | Ga0070661_100021041 | 3300005344 | Bacteria | 4657 |
| 128 | Ga0070661_100032184 | 3300005344 | Bacteria | 3795 |
| 129 | Ga0070661_100036795 | 3300005344 | Bacteria | 3557 |
| 130 | Ga0070661_100069996 | 3300005344 | Bacteria | 2580 |
| 131 | Ga0070661_100284668 | 3300005344 | Bacteria | 1283 |
| 132 | Ga0070661_100726035 | 3300005344 | Bacteria | 811 |
| 133 | Ga0070692_10033345 | 3300005345 | Bacteria | 2594 |
| 134 | Ga0070692_10268070 | 3300005345 | Bacteria | 1029 |
| 135 | Ga0070668_100016101 | 3300005347 | Bacteria | 5596 |
| 136 | Ga0070668_100018871 | 3300005347 | Bacteria | 5181 |
| 137 | Ga0070668_100033002 | 3300005347 | Bacteria | 3940 |
| 138 | Ga0070668_100078104 | 3300005347 | Bacteria | 2588 |
| 139 | Ga0070668_100089092 | 3300005347 | Bacteria | 2430 |
| 140 | Ga0070668_100100733 | 3300005347 | Bacteria | 2288 |
| 141 | Ga0070668_100114109 | 3300005347 | Bacteria | 2153 |
| 142 | Ga0070668_100125621 | 3300005347 | Bacteria | 2054 |
| 143 | Ga0070668_100167545 | 3300005347 | Bacteria | 1786 |
| 144 | Ga0070669_100000072 | 3300005353 | Bacteria | 99184 |
| 145 | Ga0070669_100000470 | 3300005353 | Bacteria | 30618 |
| 146 | Ga0070669_100030653 | 3300005353 | Bacteria | 3882 |
| 147 | Ga0070669_100075371 | 3300005353 | Bacteria | 2502 |
| 148 | Ga0070669_100133445 | 3300005353 | Bacteria | 1907 |
| 149 | Ga0070669_100147500 | 3300005353 | Bacteria | 1819 |
| 150 | Ga0070669_100177785 | 3300005353 | Bacteria | 1663 |
| 151 | Ga0070669_100660071 | 3300005353 | Bacteria | 880 |
| 152 | Ga0070675_100005311 | 3300005354 | Bacteria | 9842 |
| 153 | Ga0070675_100014931 | 3300005354 | Bacteria | 6133 |
| 154 | Ga0070675_100246966 | 3300005354 | Bacteria | 1561 |
| 155 | Ga0070671_100000845 | 3300005355 | Bacteria | 22289 |
| 156 | Ga0070671_100039002 | 3300005355 | Bacteria | 3943 |
| 157 | Ga0070671_100054381 | 3300005355 | Bacteria | 3329 |
| 158 | Ga0070671_100080339 | 3300005355 | Bacteria | 2726 |
| 159 | Ga0070671_100241581 | 3300005355 | Bacteria | 1533 |
| 160 | Ga0070671_100352852 | 3300005355 | Bacteria | 1255 |
| 161 | Ga0070671_100489394 | 3300005355 | Bacteria | 1057 |
| 162 | Ga0070674_100000209 | 3300005356 | Bacteria | 28138 |
| 163 | Ga0070674_100027045 | 3300005356 | Bacteria | 3755 |
| 164 | Ga0070674_100127342 | 3300005356 | Bacteria | 1894 |
| 165 | Ga0070673_100000009 | 3300005364 | Bacteria | 155005 |
| 166 | Ga0070673_100031597 | 3300005364 | Bacteria | 3976 |
| 167 | Ga0070673_100226433 | 3300005364 | Bacteria | 1621 |
| 168 | Ga0070673_100658848 | 3300005364 | Bacteria | 959 |
| 169 | Ga0070659_100000191 | 3300005366 | Bacteria | 47035 |
| 170 | Ga0070659_100017756 | 3300005366 | Bacteria | 5358 |
| 171 | Ga0070659_100033034 | 3300005366 | Bacteria | 4018 |
| 172 | Ga0070659_100039493 | 3300005366 | Bacteria | 3685 |
| 173 | Ga0070659_100043632 | 3300005366 | Bacteria | 3507 |
| 174 | Ga0070659_100066651 | 3300005366 | Bacteria | 2853 |
| 175 | Ga0070659_100067036 | 3300005366 | Bacteria | 2846 |
| 176 | Ga0070659_100423186 | 3300005366 | Bacteria | 1126 |
| 177 | Ga0070659_100448781 | 3300005366 | Bacteria | 1094 |
| 178 | Ga0070667_100000143 | 3300005367 | Bacteria | 90358 |
| 179 | Ga0070667_100000286 | 3300005367 | Bacteria | 57006 |
| 180 | Ga0070667_100000367 | 3300005367 | Bacteria | 49149 |
| 181 | Ga0070667_100000725 | 3300005367 | Bacteria | 31653 |
| 182 | Ga0070667_100034211 | 3300005367 | Bacteria | 4250 |
| 183 | Ga0070667_100038587 | 3300005367 | Bacteria | 4004 |
| 184 | Ga0070667_100265935 | 3300005367 | Bacteria | 1537 |
| 185 | Ga0070667_100533049 | 3300005367 | Bacteria | 1078 |
| 186 | Ga0070709_10016498 | 3300005434 | Bacteria | 4218 |
| 187 | Ga0070714_100011330 | 3300005435 | Bacteria | 7071 |
| 188 | Ga0070714_100156723 | 3300005435 | Bacteria | 2056 |
| 189 | Ga0070713_100064528 | 3300005436 | Bacteria | 3074 |
| 190 | Ga0070713_100087188 | 3300005436 | Bacteria | 2677 |
| 191 | Ga0070713_100165627 | 3300005436 | Bacteria | 1976 |
| 192 | Ga0070694_100086015 | 3300005444 | Bacteria | 2196 |
| 193 | Ga0070663_100004783 | 3300005455 | Bacteria | 7986 |
| 194 | Ga0070663_100008779 | 3300005455 | Bacteria | 6234 |
| 195 | Ga0070663_100046160 | 3300005455 | Bacteria | 3081 |
| 196 | Ga0070663_100083683 | 3300005455 | Bacteria | 2350 |
| 197 | Ga0070663_100236458 | 3300005455 | Bacteria | 1441 |
| 198 | Ga0070663_100377050 | 3300005455 | Bacteria | 1154 |
| 199 | Ga0070678_100001063 | 3300005456 | Bacteria | 14344 |
| 200 | Ga0070678_100033684 | 3300005456 | Bacteria | 3560 |
| 201 | Ga0070678_100299879 | 3300005456 | Bacteria | 1365 |
| 202 | Ga0070678_100334470 | 3300005456 | Bacteria | 1297 |
| 203 | Ga0070662_100000012 | 3300005457 | Bacteria | 129380 |
| 204 | Ga0070662_100001324 | 3300005457 | Bacteria | 15218 |
| 205 | Ga0070662_100001565 | 3300005457 | Bacteria | 14148 |
| 206 | Ga0070662_100002043 | 3300005457 | Bacteria | 12365 |
| 207 | Ga0070662_100026436 | 3300005457 | Bacteria | 4020 |
| 208 | Ga0070662_100049752 | 3300005457 | Bacteria | 3023 |
| 209 | Ga0070662_100165319 | 3300005457 | Bacteria | 1733 |
| 210 | Ga0070662_100827040 | 3300005457 | Bacteria | 788 |
| 211 | Ga0070681_10006366 | 3300005458 | Bacteria | 11476 |
| 212 | Ga0070681_10010175 | 3300005458 | Bacteria | 9277 |
| 213 | Ga0068867_100000002 | 3300005459 | Bacteria | 247206 |
| 214 | Ga0068867_100006572 | 3300005459 | Bacteria | 8214 |
| 215 | Ga0068867_100071011 | 3300005459 | Bacteria | 2604 |
| 216 | Ga0068867_100133018 | 3300005459 | Bacteria | 1935 |
| 217 | Ga0070685_10077284 | 3300005466 | Bacteria | 1987 |
| 218 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 219 | Ga0070679_100005339 | 3300005530 | Bacteria | 11892 |
| 220 | Ga0070679_100006705 | 3300005530 | Bacteria | 10738 |
| 221 | Ga0070679_100080732 | 3300005530 | Bacteria | 3242 |
| 222 | Ga0070679_100100254 | 3300005530 | Bacteria | 2883 |
| 223 | Ga0070679_100589659 | 3300005530 | Bacteria | 1055 |
| 224 | Ga0070684_100009174 | 3300005535 | Bacteria | 7780 |
| 225 | Ga0070684_100559518 | 3300005535 | Bacteria | 1062 |
| 226 | Ga0068853_100000032 | 3300005539 | Bacteria | 114306 |
| 227 | Ga0068853_100003550 | 3300005539 | Bacteria | 11929 |
| 228 | Ga0068853_100014991 | 3300005539 | Bacteria | 6368 |
| 229 | Ga0068853_100065019 | 3300005539 | Bacteria | 3165 |
| 230 | Ga0068853_100174373 | 3300005539 | Bacteria | 1947 |
| 231 | Ga0070672_100224484 | 3300005543 | Bacteria | 1576 |
| 232 | Ga0070672_100643002 | 3300005543 | Bacteria | 926 |
| 233 | Ga0070695_100100790 | 3300005545 | Bacteria | 1945 |
| 234 | Ga0070693_100000332 | 3300005547 | Bacteria | 21624 |
| 235 | Ga0070693_100036501 | 3300005547 | Bacteria | 2733 |
| 236 | Ga0070665_100000079 | 3300005548 | Bacteria | 186925 |
| 237 | Ga0070665_100000084 | 3300005548 | Bacteria | 180481 |
| 238 | Ga0070665_100003604 | 3300005548 | Bacteria | 16399 |
| 239 | Ga0070665_100012237 | 3300005548 | Bacteria | 8649 |
| 240 | Ga0070665_100034424 | 3300005548 | Bacteria | 5094 |
| 241 | Ga0070665_100080538 | 3300005548 | Bacteria | 3262 |
| 242 | Ga0068855_100000591 | 3300005563 | Bacteria | 44412 |
| 243 | Ga0068855_100001164 | 3300005563 | Bacteria | 32603 |
| 244 | Ga0068855_100007295 | 3300005563 | Bacteria | 13389 |
| 245 | Ga0068855_100018573 | 3300005563 | Bacteria | 8362 |
| 246 | Ga0068855_100032731 | 3300005563 | Bacteria | 6207 |
| 247 | Ga0068855_100034640 | 3300005563 | Bacteria | 6018 |
| 248 | Ga0068855_100095837 | 3300005563 | Bacteria | 3420 |
| 249 | Ga0068855_100153975 | 3300005563 | Bacteria | 2613 |
| 250 | Ga0068855_100245833 | 3300005563 | Bacteria | 1997 |
| 251 | Ga0068855_100449134 | 3300005563 | Bacteria | 1407 |
| 252 | Ga0068855_100789685 | 3300005563 | Bacteria | 1010 |
| 253 | Ga0070664_100000187 | 3300005564 | Bacteria | 43750 |
| 254 | Ga0070664_100002928 | 3300005564 | Bacteria | 13816 |
| 255 | Ga0070664_100016865 | 3300005564 | Bacteria | 5993 |
| 256 | Ga0070664_100025790 | 3300005564 | Bacteria | 4872 |
| 257 | Ga0070664_100073402 | 3300005564 | Bacteria | 2935 |
| 258 | Ga0070664_100177595 | 3300005564 | Bacteria | 1891 |
| 259 | Ga0070664_100767854 | 3300005564 | Bacteria | 900 |
| 260 | Ga0068857_100007902 | 3300005577 | Bacteria | 9175 |
| 261 | Ga0068857_100190219 | 3300005577 | Bacteria | 1869 |
| 262 | Ga0068857_100436038 | 3300005577 | Bacteria | 1223 |
| 263 | Ga0068857_100542997 | 3300005577 | Bacteria | 1094 |
| 264 | Ga0068854_100003204 | 3300005578 | Bacteria | 10212 |
| 265 | Ga0068854_100007226 | 3300005578 | Bacteria | 7091 |
| 266 | Ga0068854_100026804 | 3300005578 | Bacteria | 3965 |
| 267 | Ga0068854_100090117 | 3300005578 | Bacteria | 2280 |
| 268 | Ga0068854_100111295 | 3300005578 | Bacteria | 2066 |
| 269 | Ga0068854_100112344 | 3300005578 | Bacteria | 2057 |
| 270 | Ga0068854_100252199 | 3300005578 | Bacteria | 1409 |
| 271 | Ga0068854_100336372 | 3300005578 | Bacteria | 1232 |
| 272 | Ga0068854_100552291 | 3300005578 | Bacteria | 977 |
| 273 | Ga0068856_100000291 | 3300005614 | Bacteria | 54890 |
| 274 | Ga0068856_100005719 | 3300005614 | Bacteria | 12247 |
| 275 | Ga0068856_100143419 | 3300005614 | Bacteria | 2396 |
| 276 | Ga0068852_100000906 | 3300005616 | Bacteria | 19629 |
| 277 | Ga0068852_100001541 | 3300005616 | Bacteria | 15633 |
| 278 | Ga0068852_100058362 | 3300005616 | Bacteria | 3343 |
| 279 | Ga0068852_100137652 | 3300005616 | Bacteria | 2256 |
| 280 | Ga0068852_100476231 | 3300005616 | Bacteria | 1240 |
| 281 | Ga0068852_100647544 | 3300005616 | Bacteria | 1064 |
| 282 | Ga0068852_101080088 | 3300005616 | Bacteria | 822 |
| 283 | Ga0068859_100008247 | 3300005617 | Bacteria | 10565 |
| 284 | Ga0068859_100090073 | 3300005617 | Bacteria | 3118 |
| 285 | Ga0068859_100310836 | 3300005617 | Bacteria | 1669 |
| 286 | Ga0068859_100603103 | 3300005617 | Bacteria | 1191 |
| 287 | Ga0068864_100000051 | 3300005618 | Bacteria | 136621 |
| 288 | Ga0068864_100000100 | 3300005618 | Bacteria | 85101 |
| 289 | Ga0068864_100034890 | 3300005618 | Bacteria | 4281 |
| 290 | Ga0068864_100104055 | 3300005618 | Bacteria | 2521 |
| 291 | Ga0068864_100113092 | 3300005618 | Bacteria | 2420 |
| 292 | Ga0068866_10096709 | 3300005718 | Bacteria | 1620 |
| 293 | Ga0068861_100038439 | 3300005719 | Bacteria | 3564 |
| 294 | Ga0068851_10010180 | 3300005834 | Bacteria | 4384 |
| 295 | Ga0068851_10019263 | 3300005834 | Bacteria | 3296 |
| 296 | Ga0068851_10019743 | 3300005834 | Bacteria | 3257 |
| 297 | Ga0068851_10090672 | 3300005834 | Bacteria | 1609 |
| 298 | Ga0068851_10096921 | 3300005834 | Bacteria | 1560 |
| 299 | Ga0068851_10335431 | 3300005834 | Bacteria | 876 |
| 300 | Ga0068870_10039947 | 3300005840 | Bacteria | 2430 |
| 301 | Ga0068870_10262608 | 3300005840 | Bacteria | 1075 |
| 302 | Ga0068863_100000025 | 3300005841 | Bacteria | 186072 |
| 303 | Ga0068863_100000168 | 3300005841 | Bacteria | 70935 |
| 304 | Ga0068863_100001489 | 3300005841 | Bacteria | 23203 |
| 305 | Ga0068863_100058470 | 3300005841 | Bacteria | 3648 |
| 306 | Ga0068863_100081951 | 3300005841 | Bacteria | 3057 |
| 307 | Ga0068863_100193604 | 3300005841 | Bacteria | 1954 |
| 308 | Ga0068858_100000673 | 3300005842 | Bacteria | 35672 |
| 309 | Ga0068858_100000848 | 3300005842 | Bacteria | 31661 |
| 310 | Ga0068858_100023512 | 3300005842 | Bacteria | 5740 |
| 311 | Ga0068858_100043159 | 3300005842 | Bacteria | 4181 |
| 312 | Ga0068858_100052186 | 3300005842 | Bacteria | 3783 |
| 313 | Ga0068858_100071318 | 3300005842 | Bacteria | 3222 |
| 314 | Ga0068858_100665973 | 3300005842 | Bacteria | 1012 |
| 315 | Ga0068860_100000181 | 3300005843 | Bacteria | 101627 |
| 316 | Ga0068860_100027199 | 3300005843 | Bacteria | 5511 |
| 317 | Ga0068860_100067993 | 3300005843 | Bacteria | 3385 |
| 318 | Ga0068860_100096161 | 3300005843 | Bacteria | 2823 |
| 319 | Ga0068860_100166266 | 3300005843 | Bacteria | 2129 |
| 320 | Ga0068862_100000027 | 3300005844 | Bacteria | 186072 |
| 321 | Ga0068862_100000036 | 3300005844 | Bacteria | 173453 |
| 322 | Ga0068862_100004531 | 3300005844 | Bacteria | 11717 |
| 323 | Ga0068862_100024495 | 3300005844 | Bacteria | 5064 |
| 324 | Ga0068862_100386147 | 3300005844 | Bacteria | 1307 |
| 325 | Ga0068862_100431342 | 3300005844 | Bacteria | 1239 |
| 326 | Ga0068862_100749193 | 3300005844 | Bacteria | 950 |
| 327 | Ga0081540_1099998 | 3300005983 | Bacteria | 1251 |
| 328 | Ga0081539_10008794 | 3300005985 | Bacteria | 8651 |
| 329 | Ga0081539_10019519 | 3300005985 | Bacteria | 4633 |
| 330 | Ga0070717_10004794 | 3300006028 | Bacteria | 9837 |
| 331 | Ga0070717_10109103 | 3300006028 | Bacteria | 2358 |
| 332 | Ga0075368_10000304 | 3300006042 | Bacteria | 14246 |
| 333 | Ga0075368_10000450 | 3300006042 | Bacteria | 12161 |
| 334 | Ga0075363_100093715 | 3300006048 | Bacteria | 1655 |
| 335 | Ga0075364_10341720 | 3300006051 | Bacteria | 1020 |
| 336 | Ga0070716_100017029 | 3300006173 | Bacteria | 3761 |
| 337 | Ga0070716_100129508 | 3300006173 | Bacteria | 1593 |
| 338 | Ga0070712_100043513 | 3300006175 | Bacteria | 3091 |
| 339 | Ga0070712_100203183 | 3300006175 | Bacteria | 1558 |
| 340 | Ga0075362_10001064 | 3300006177 | Bacteria | 8483 |
| 341 | Ga0075362_10034007 | 3300006177 | Bacteria | 2220 |
| 342 | Ga0075367_10007487 | 3300006178 | Bacteria | 5593 |
| 343 | Ga0075367_10022925 | 3300006178 | Bacteria | 3508 |
| 344 | Ga0075369_10005423 | 3300006186 | Bacteria | 4766 |
| 345 | Ga0075369_10096406 | 3300006186 | Bacteria | 1324 |
| 346 | Ga0075366_10087603 | 3300006195 | Bacteria | 1864 |
| 347 | Ga0097621_100001876 | 3300006237 | Bacteria | 14391 |
| 348 | Ga0097621_100081758 | 3300006237 | Bacteria | 2689 |
| 349 | Ga0097621_100104675 | 3300006237 | Bacteria | 2385 |
| 350 | Ga0097621_100202373 | 3300006237 | Bacteria | 1724 |
| 351 | Ga0097621_100244043 | 3300006237 | Bacteria | 1571 |
| 352 | Ga0097621_100397715 | 3300006237 | Bacteria | 1233 |
| 353 | Ga0068871_100007505 | 3300006358 | Bacteria | 7797 |
| 354 | Ga0068871_100062791 | 3300006358 | Bacteria | 3037 |
| 355 | Ga0068871_100120505 | 3300006358 | Bacteria | 2216 |
| 356 | Ga0068871_100224978 | 3300006358 | Bacteria | 1627 |
| 357 | Ga0068871_100672249 | 3300006358 | Bacteria | 947 |
| 358 | Ga0075429_100129397 | 3300006880 | Bacteria | 2208 |
| 359 | Ga0068865_100000014 | 3300006881 | Bacteria | 138727 |
| 360 | Ga0068865_100073741 | 3300006881 | Bacteria | 2428 |
| 361 | Ga0068865_100830307 | 3300006881 | Bacteria | 799 |
| 362 | Ga0097620_100008247 | 3300006931 | Bacteria | 10565 |
| 363 | Ga0097620_100024043 | 3300006931 | Bacteria | 6114 |
| 364 | Ga0097620_100090076 | 3300006931 | Bacteria | 3118 |
| 365 | Ga0097620_100310844 | 3300006931 | Bacteria | 1669 |
| 366 | Ga0097620_100603134 | 3300006931 | Bacteria | 1191 |
| 367 | Ga0079104_1016890 | 3300006946 | Bacteria | 2116 |
| 368 | Ga0079104_1030833 | 3300006946 | Bacteria | 1335 |
| 369 | Ga0105251_10000232 | 3300009011 | Bacteria | 56006 |
| 370 | Ga0105251_10000554 | 3300009011 | Bacteria | 35071 |
| 371 | Ga0105251_10030739 | 3300009011 | Bacteria | 2693 |
| 372 | Ga0105251_10127682 | 3300009011 | Bacteria | 1153 |
| 373 | Ga0105250_10127622 | 3300009092 | Bacteria | 1048 |
| 374 | Ga0105240_10108042 | 3300009093 | Bacteria | 3371 |
| 375 | Ga0105240_10163937 | 3300009093 | Bacteria | 2638 |
| 376 | Ga0105240_10243049 | 3300009093 | Bacteria | 2086 |
| 377 | Ga0105240_10292795 | 3300009093 | Bacteria | 1865 |
| 378 | Ga0105240_11331320 | 3300009093 | Bacteria | 757 |
| 379 | Ga0105245_10000160 | 3300009098 | Bacteria | 63445 |
| 380 | Ga0105245_10013224 | 3300009098 | Bacteria | 7191 |
| 381 | Ga0105245_10018347 | 3300009098 | Bacteria | 6118 |
| 382 | Ga0105247_10057877 | 3300009101 | Bacteria | 2397 |
| 383 | Ga0114129_10257351 | 3300009147 | Bacteria | 2341 |
| 384 | Ga0105243_10000070 | 3300009148 | Bacteria | 120851 |
| 385 | Ga0105243_10005193 | 3300009148 | Bacteria | 10193 |
| 386 | Ga0105243_10055563 | 3300009148 | Bacteria | 3146 |
| 387 | Ga0105243_10130908 | 3300009148 | Bacteria | 2128 |
| 388 | Ga0105243_10229689 | 3300009148 | Bacteria | 1645 |
| 389 | Ga0105243_10745781 | 3300009148 | Bacteria | 959 |
| 390 | Ga0105241_10030368 | 3300009174 | Bacteria | 4037 |
| 391 | Ga0105241_10077362 | 3300009174 | Bacteria | 2597 |
| 392 | Ga0105241_10158703 | 3300009174 | Bacteria | 1857 |
| 393 | Ga0105241_10266923 | 3300009174 | Bacteria | 1456 |
| 394 | Ga0105241_10762377 | 3300009174 | Bacteria | 888 |
| 395 | Ga0105242_10001604 | 3300009176 | Bacteria | 17808 |
| 396 | Ga0105242_10188683 | 3300009176 | Bacteria | 1823 |
| 397 | Ga0105248_10000083 | 3300009177 | Bacteria | 110619 |
| 398 | Ga0105248_10001385 | 3300009177 | Bacteria | 27005 |
| 399 | Ga0105248_10002034 | 3300009177 | Bacteria | 22430 |
| 400 | Ga0105248_10023944 | 3300009177 | Bacteria | 6787 |
| 401 | Ga0105248_10024368 | 3300009177 | Bacteria | 6730 |
| 402 | Ga0105248_10032701 | 3300009177 | Bacteria | 5810 |
| 403 | Ga0105248_10091313 | 3300009177 | Bacteria | 3430 |
| 404 | Ga0105248_10155436 | 3300009177 | Bacteria | 2581 |
| 405 | Ga0105248_10354956 | 3300009177 | Bacteria | 1651 |
| 406 | Ga0105237_10005695 | 3300009545 | Bacteria | 14014 |
| 407 | Ga0105237_10017062 | 3300009545 | Bacteria | 7535 |
| 408 | Ga0105237_10097580 | 3300009545 | Bacteria | 2929 |
| 409 | Ga0105237_10215362 | 3300009545 | Bacteria | 1921 |
| 410 | Ga0105238_10015678 | 3300009551 | Bacteria | 7672 |
| 411 | Ga0105238_10024071 | 3300009551 | Bacteria | 6208 |
| 412 | Ga0105238_10116826 | 3300009551 | Bacteria | 2647 |
| 413 | Ga0105238_10173208 | 3300009551 | Bacteria | 2134 |
| 414 | Ga0105238_10373185 | 3300009551 | Bacteria | 1417 |
| 415 | Ga0105238_11024103 | 3300009551 | Bacteria | 847 |
| 416 | Ga0105238_11607096 | 3300009551 | Bacteria | 680 |
| 417 | Ga0105249_10000110 | 3300009553 | Bacteria | 111292 |
| 418 | Ga0105249_10015328 | 3300009553 | Bacteria | 6783 |
| 419 | Ga0105249_10096719 | 3300009553 | Bacteria | 2771 |
| 420 | Ga0105249_10201195 | 3300009553 | Bacteria | 1949 |
| 421 | Ga0105249_10433131 | 3300009553 | Bacteria | 1351 |
| 422 | Ga0105249_11029498 | 3300009553 | Bacteria | 892 |
| 423 | Ga0105148_100275 | 3300009978 | Bacteria | 6836 |
| 424 | Ga0105148_117869 | 3300009978 | Bacteria | 564 |
| 425 | Ga0105147_101564 | 3300009982 | Bacteria | 1876 |
| 426 | Ga0105239_10000271 | 3300010375 | Bacteria | 76812 |
| 427 | Ga0105239_10102466 | 3300010375 | Bacteria | 3168 |
| 428 | Ga0105239_10110863 | 3300010375 | Bacteria | 3041 |
| 429 | Ga0105239_10147805 | 3300010375 | Bacteria | 2622 |
| 430 | Ga0105239_11069256 | 3300010375 | Bacteria | 928 |
| 431 | Ga0105239_11248926 | 3300010375 | Bacteria | 856 |
| 432 | Ga0105246_10002314 | 3300011119 | Bacteria | 11507 |
| 433 | Ga0105246_10003501 | 3300011119 | Bacteria | 9510 |
| 434 | Ga0105246_10008646 | 3300011119 | Bacteria | 6261 |
| 435 | Ga0105246_10080366 | 3300011119 | Bacteria | 2321 |
| 436 | Ga0157326_1000005 | 3300012513 | Bacteria | 18291 |
| 437 | Ga0157326_1003871 | 3300012513 | Bacteria | 1572 |
| 438 | Ga0157373_10006989 | 3300013100 | Bacteria | 8406 |
| 439 | Ga0157373_10029859 | 3300013100 | Bacteria | 3925 |
| 440 | Ga0157373_10039126 | 3300013100 | Bacteria | 3396 |
| 441 | Ga0157373_10147818 | 3300013100 | Bacteria | 1653 |
| 442 | Ga0157373_10231884 | 3300013100 | Bacteria | 1304 |
| 443 | Ga0157373_10476278 | 3300013100 | Bacteria | 900 |
| 444 | Ga0157373_10671609 | 3300013100 | Bacteria | 758 |
| 445 | Ga0157371_10000011 | 3300013102 | Bacteria | 377608 |
| 446 | Ga0157371_10001091 | 3300013102 | Bacteria | 29403 |
| 447 | Ga0157371_10007915 | 3300013102 | Bacteria | 8529 |
| 448 | Ga0157371_10077146 | 3300013102 | Bacteria | 2359 |
| 449 | Ga0157371_10167994 | 3300013102 | Bacteria | 1567 |
| 450 | Ga0157371_10203577 | 3300013102 | Bacteria | 1419 |
| 451 | Ga0157371_10235898 | 3300013102 | Bacteria | 1315 |
| 452 | Ga0157371_10606890 | 3300013102 | Bacteria | 814 |
| 453 | Ga0157371_10608377 | 3300013102 | Bacteria | 813 |
| 454 | Ga0157370_10002905 | 3300013104 | Bacteria | 20434 |
| 455 | Ga0157370_11001809 | 3300013104 | Bacteria | 756 |
| 456 | Ga0157369_10021625 | 3300013105 | Bacteria | 7194 |
| 457 | Ga0157369_10157781 | 3300013105 | Bacteria | 2396 |
| 458 | Ga0157369_10780179 | 3300013105 | Bacteria | 982 |
| 459 | Ga0157374_10000542 | 3300013296 | Bacteria | 33699 |
| 460 | Ga0157374_10186177 | 3300013296 | Bacteria | 2030 |
| 461 | Ga0157374_10244501 | 3300013296 | Bacteria | 1765 |
| 462 | Ga0157374_10389936 | 3300013296 | Bacteria | 1388 |
| 463 | Ga0157374_10836077 | 3300013296 | Bacteria | 937 |
| 464 | Ga0157378_10000624 | 3300013297 | Bacteria | 33307 |
| 465 | Ga0157378_10021072 | 3300013297 | Bacteria | 5734 |
| 466 | Ga0157378_10060444 | 3300013297 | Bacteria | 3382 |
| 467 | Ga0157378_11306933 | 3300013297 | Bacteria | 766 |
| 468 | Ga0163162_10009970 | 3300013306 | Bacteria | 9240 |
| 469 | Ga0163162_10015197 | 3300013306 | Bacteria | 7520 |
| 470 | Ga0163162_10305478 | 3300013306 | Bacteria | 1723 |
| 471 | Ga0163162_10335390 | 3300013306 | Bacteria | 1645 |
| 472 | Ga0163162_10363202 | 3300013306 | Bacteria | 1581 |
| 473 | Ga0157372_10008443 | 3300013307 | Bacteria | 10936 |
| 474 | Ga0157372_10093707 | 3300013307 | Bacteria | 3418 |
| 475 | Ga0157372_10293339 | 3300013307 | Bacteria | 1891 |
| 476 | Ga0157372_11391257 | 3300013307 | Bacteria | 809 |
| 477 | Ga0157375_10027717 | 3300013308 | Bacteria | 5299 |
| 478 | Ga0157375_10090533 | 3300013308 | Bacteria | 3118 |
| 479 | Ga0163163_10001064 | 3300014325 | Bacteria | 23319 |
| 480 | Ga0163163_10006906 | 3300014325 | Bacteria | 9963 |
| 481 | Ga0163163_10015984 | 3300014325 | Bacteria | 6955 |
| 482 | Ga0157380_10000315 | 3300014326 | Bacteria | 29340 |
| 483 | Ga0157380_10000763 | 3300014326 | Bacteria | 20083 |
| 484 | Ga0157380_10022724 | 3300014326 | Bacteria | 4728 |
| 485 | Ga0157380_10113655 | 3300014326 | Bacteria | 2280 |
| 486 | Ga0157380_10194137 | 3300014326 | Bacteria | 1795 |
| 487 | Ga0157380_10410985 | 3300014326 | Bacteria | 1287 |
| 488 | Ga0182008_10126272 | 3300014497 | Bacteria | 1274 |
| 489 | Ga0157377_10037303 | 3300014745 | Bacteria | 2677 |
| 490 | Ga0157377_10271498 | 3300014745 | Bacteria | 1108 |
| 491 | Ga0157379_10003811 | 3300014968 | Bacteria | 12853 |
| 492 | Ga0157379_10104620 | 3300014968 | Bacteria | 2540 |
| 493 | Ga0157379_10702359 | 3300014968 | Bacteria | 949 |
| 494 | Ga0157376_10000096 | 3300014969 | Bacteria | 65482 |
| 495 | Ga0183363_1003 | 3300015690 | Bacteria | 421263 |
| 496 | Ga0163161_10044190 | 3300017792 | Bacteria | 3209 |
| 497 | Ga0163161_10046559 | 3300017792 | Bacteria | 3129 |
| 498 | Ga0163161_10106148 | 3300017792 | Bacteria | 2096 |
| 499 | Ga0163161_10107867 | 3300017792 | Bacteria | 2079 |
| 500 | Ga0163161_10295126 | 3300017792 | Bacteria | 1275 |
| 501 | Ga0209147_100298 | 3300025229 | Bacteria | 40972 |
| 502 | Ga0209563_100125 | 3300025230 | Bacteria | 113854 |
| 503 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 504 | Ga0209148_1000147 | 3300025254 | Bacteria | 160231 |
| 505 | Ga0209148_1002428 | 3300025254 | Bacteria | 6428 |
| 506 | Ga0209233_1000140 | 3300025261 | Bacteria | 193274 |
| 507 | Ga0209233_1027364 | 3300025261 | Bacteria | 1382 |
| 508 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 509 | Ga0209455_1000707 | 3300025272 | Bacteria | 19438 |
| 510 | Ga0209455_1009390 | 3300025272 | Bacteria | 2573 |
| 511 | Ga0209675_1000181 | 3300025291 | Bacteria | 71490 |
| 512 | Ga0209676_1000084 | 3300025292 | Bacteria | 274330 |
| 513 | Ga0209676_1000330 | 3300025292 | Bacteria | 91216 |
| 514 | Ga0209676_1000479 | 3300025292 | Bacteria | 65868 |
| 515 | Ga0209676_1032030 | 3300025292 | Bacteria | 1587 |
| 516 | Ga0209025_1022687 | 3300025294 | Bacteria | 3316 |
| 517 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 518 | Ga0209050_1000113 | 3300025298 | Bacteria | 209222 |
| 519 | Ga0209050_1000254 | 3300025298 | Bacteria | 114395 |
| 520 | Ga0209050_1001453 | 3300025298 | Bacteria | 25414 |
| 521 | Ga0209050_1048216 | 3300025298 | Bacteria | 1102 |
| 522 | Ga0209257_1000083 | 3300025304 | Bacteria | 296207 |
| 523 | Ga0209257_1000126 | 3300025304 | Bacteria | 215705 |
| 524 | Ga0209257_1000340 | 3300025304 | Bacteria | 97492 |
| 525 | Ga0209257_1001209 | 3300025304 | Bacteria | 32418 |
| 526 | Ga0209257_1053361 | 3300025304 | Bacteria | 1131 |
| 527 | Ga0207697_10035799 | 3300025315 | Bacteria | 2033 |
| 528 | Ga0207697_10047244 | 3300025315 | Bacteria | 1774 |
| 529 | Ga0207697_10077367 | 3300025315 | Bacteria | 1399 |
| 530 | Ga0207697_10084306 | 3300025315 | Bacteria | 1341 |
| 531 | Ga0207697_10211268 | 3300025315 | Bacteria | 855 |
| 532 | Ga0207656_10001253 | 3300025321 | Bacteria | 8367 |
| 533 | Ga0207656_10034991 | 3300025321 | Bacteria | 2100 |
| 534 | Ga0207656_10069520 | 3300025321 | Bacteria | 1562 |
| 535 | Ga0207656_10079265 | 3300025321 | Bacteria | 1473 |
| 536 | Ga0207656_10196397 | 3300025321 | Bacteria | 973 |
| 537 | Ga0207713_1000615 | 3300025735 | Bacteria | 35051 |
| 538 | Ga0207713_1001012 | 3300025735 | Bacteria | 24466 |
| 539 | Ga0207713_1060220 | 3300025735 | Bacteria | 1452 |
| 540 | Ga0207682_10000542 | 3300025893 | Bacteria | 17400 |
| 541 | Ga0207682_10035626 | 3300025893 | Bacteria | 2011 |
| 542 | Ga0207642_10064108 | 3300025899 | Bacteria | 1721 |
| 543 | Ga0207688_10067605 | 3300025901 | Bacteria | 2022 |
| 544 | Ga0207688_10145818 | 3300025901 | Bacteria | 1395 |
| 545 | Ga0207688_10148226 | 3300025901 | Bacteria | 1384 |
| 546 | Ga0207688_10198933 | 3300025901 | Bacteria | 1201 |
| 547 | Ga0207680_10001307 | 3300025903 | Bacteria | 11765 |
| 548 | Ga0207680_10053944 | 3300025903 | Bacteria | 2416 |
| 549 | Ga0207680_10555348 | 3300025903 | Bacteria | 820 |
| 550 | Ga0207647_10000389 | 3300025904 | Bacteria | 35906 |
| 551 | Ga0207647_10000850 | 3300025904 | Bacteria | 23703 |
| 552 | Ga0207647_10019227 | 3300025904 | Bacteria | 4597 |
| 553 | Ga0207647_10041178 | 3300025904 | Bacteria | 2906 |
| 554 | Ga0207647_10084197 | 3300025904 | Bacteria | 1903 |
| 555 | Ga0207647_10085879 | 3300025904 | Bacteria | 1881 |
| 556 | Ga0207645_10000470 | 3300025907 | Bacteria | 33310 |
| 557 | Ga0207645_10008376 | 3300025907 | Bacteria | 7213 |
| 558 | Ga0207645_10030439 | 3300025907 | Bacteria | 3477 |
| 559 | Ga0207645_10044108 | 3300025907 | Bacteria | 2854 |
| 560 | Ga0207645_10208853 | 3300025907 | Bacteria | 1286 |
| 561 | Ga0207643_10033802 | 3300025908 | Bacteria | 2861 |
| 562 | Ga0207705_10000042 | 3300025909 | Bacteria | 182120 |
| 563 | Ga0207705_10000072 | 3300025909 | Bacteria | 126043 |
| 564 | Ga0207705_10000236 | 3300025909 | Bacteria | 54788 |
| 565 | Ga0207705_10007727 | 3300025909 | Bacteria | 7904 |
| 566 | Ga0207705_10009210 | 3300025909 | Bacteria | 7190 |
| 567 | Ga0207705_10018377 | 3300025909 | Bacteria | 4999 |
| 568 | Ga0207705_10028048 | 3300025909 | Bacteria | 4014 |
| 569 | Ga0207705_10093631 | 3300025909 | Bacteria | 2203 |
| 570 | Ga0207705_10151259 | 3300025909 | Bacteria | 1739 |
| 571 | Ga0207705_10318355 | 3300025909 | Bacteria | 1195 |
| 572 | Ga0207705_10479483 | 3300025909 | Bacteria | 965 |
| 573 | Ga0207654_10000246 | 3300025911 | Bacteria | 32849 |
| 574 | Ga0207654_10159335 | 3300025911 | Bacteria | 1456 |
| 575 | Ga0207654_10230549 | 3300025911 | Bacteria | 1233 |
| 576 | Ga0207654_10480107 | 3300025911 | Bacteria | 875 |
| 577 | Ga0207707_10006710 | 3300025912 | Bacteria | 10049 |
| 578 | Ga0207707_10047954 | 3300025912 | Bacteria | 3721 |
| 579 | Ga0207695_10005291 | 3300025913 | Bacteria | 17200 |
| 580 | Ga0207695_10124680 | 3300025913 | Bacteria | 2540 |
| 581 | Ga0207695_11005375 | 3300025913 | Bacteria | 714 |
| 582 | Ga0207671_10000955 | 3300025914 | Bacteria | 35890 |
| 583 | Ga0207671_10044155 | 3300025914 | Bacteria | 3296 |
| 584 | Ga0207693_10014544 | 3300025915 | Bacteria | 6324 |
| 585 | Ga0207693_10053263 | 3300025915 | Bacteria | 3175 |
| 586 | Ga0207660_10001102 | 3300025917 | Bacteria | 18028 |
| 587 | Ga0207657_10000176 | 3300025919 | Bacteria | 65856 |
| 588 | Ga0207657_10000764 | 3300025919 | Bacteria | 34123 |
| 589 | Ga0207657_10000837 | 3300025919 | Bacteria | 32516 |
| 590 | Ga0207657_10000900 | 3300025919 | Bacteria | 31430 |
| 591 | Ga0207657_10003875 | 3300025919 | Bacteria | 15879 |
| 592 | Ga0207657_10005081 | 3300025919 | Bacteria | 13794 |
| 593 | Ga0207657_10008183 | 3300025919 | Bacteria | 10654 |
| 594 | Ga0207657_10009556 | 3300025919 | Bacteria | 9733 |
| 595 | Ga0207657_10024081 | 3300025919 | Bacteria | 5651 |
| 596 | Ga0207657_10027473 | 3300025919 | Bacteria | 5211 |
| 597 | Ga0207657_10164063 | 3300025919 | Bacteria | 1803 |
| 598 | Ga0207657_10434088 | 3300025919 | Bacteria | 1031 |
| 599 | Ga0207649_10000027 | 3300025920 | Bacteria | 161926 |
| 600 | Ga0207649_10000810 | 3300025920 | Bacteria | 20093 |
| 601 | Ga0207649_10002323 | 3300025920 | Bacteria | 10680 |
| 602 | Ga0207649_10005378 | 3300025920 | Bacteria | 6931 |
| 603 | Ga0207649_10086734 | 3300025920 | Bacteria | 2040 |
| 604 | Ga0207649_10199137 | 3300025920 | Bacteria | 1414 |
| 605 | Ga0207649_10388902 | 3300025920 | Bacteria | 1041 |
| 606 | Ga0207652_10000003 | 3300025921 | Bacteria | 502441 |
| 607 | Ga0207652_10000489 | 3300025921 | Bacteria | 40293 |
| 608 | Ga0207652_10027113 | 3300025921 | Bacteria | 4774 |
| 609 | Ga0207652_10035093 | 3300025921 | Bacteria | 4232 |
| 610 | Ga0207652_10068878 | 3300025921 | Bacteria | 3071 |
| 611 | Ga0207652_10181942 | 3300025921 | Bacteria | 1889 |
| 612 | Ga0207652_10378410 | 3300025921 | Bacteria | 1278 |
| 613 | Ga0207681_10000061 | 3300025923 | Bacteria | 102257 |
| 614 | Ga0207681_10002744 | 3300025923 | Bacteria | 11146 |
| 615 | Ga0207681_10005152 | 3300025923 | Bacteria | 8028 |
| 616 | Ga0207681_10090692 | 3300025923 | Bacteria | 2182 |
| 617 | Ga0207681_10131345 | 3300025923 | Bacteria | 1852 |
| 618 | Ga0207681_10254450 | 3300025923 | Bacteria | 1372 |
| 619 | Ga0207694_10005386 | 3300025924 | Bacteria | 9850 |
| 620 | Ga0207694_10036581 | 3300025924 | Bacteria | 3768 |
| 621 | Ga0207694_10098020 | 3300025924 | Bacteria | 2320 |
| 622 | Ga0207694_10443780 | 3300025924 | Bacteria | 1083 |
| 623 | Ga0207694_10822103 | 3300025924 | Bacteria | 785 |
| 624 | Ga0207694_10905958 | 3300025924 | Bacteria | 746 |
| 625 | Ga0207650_10000056 | 3300025925 | Bacteria | 157972 |
| 626 | Ga0207650_10000645 | 3300025925 | Bacteria | 27715 |
| 627 | Ga0207650_10007357 | 3300025925 | Bacteria | 7494 |
| 628 | Ga0207650_10034652 | 3300025925 | Bacteria | 3662 |
| 629 | Ga0207650_10071175 | 3300025925 | Bacteria | 2615 |
| 630 | Ga0207650_10137220 | 3300025925 | Bacteria | 1920 |
| 631 | Ga0207659_10011390 | 3300025926 | Bacteria | 5616 |
| 632 | Ga0207659_10069623 | 3300025926 | Bacteria | 2563 |
| 633 | Ga0207659_10137601 | 3300025926 | Bacteria | 1892 |
| 634 | Ga0207659_10783826 | 3300025926 | Bacteria | 819 |
| 635 | Ga0207687_10000252 | 3300025927 | Bacteria | 36302 |
| 636 | Ga0207687_10000892 | 3300025927 | Bacteria | 20277 |
| 637 | Ga0207687_10059042 | 3300025927 | Bacteria | 2701 |
| 638 | Ga0207700_10032777 | 3300025928 | Bacteria | 3710 |
| 639 | Ga0207700_10255321 | 3300025928 | Bacteria | 1499 |
| 640 | Ga0207664_10149793 | 3300025929 | Bacteria | 1981 |
| 641 | Ga0207664_10509315 | 3300025929 | Bacteria | 1078 |
| 642 | Ga0207644_10018835 | 3300025931 | Bacteria | 4677 |
| 643 | Ga0207644_10026256 | 3300025931 | Bacteria | 4011 |
| 644 | Ga0207644_10059655 | 3300025931 | Bacteria | 2759 |
| 645 | Ga0207644_10063814 | 3300025931 | Bacteria | 2675 |
| 646 | Ga0207644_10190814 | 3300025931 | Bacteria | 1611 |
| 647 | Ga0207644_10200922 | 3300025931 | Bacteria | 1572 |
| 648 | Ga0207690_10000245 | 3300025932 | Bacteria | 39464 |
| 649 | Ga0207690_10000630 | 3300025932 | Bacteria | 22732 |
| 650 | Ga0207690_10001503 | 3300025932 | Bacteria | 14574 |
| 651 | Ga0207690_10022521 | 3300025932 | Bacteria | 3921 |
| 652 | Ga0207690_10071040 | 3300025932 | Bacteria | 2400 |
| 653 | Ga0207690_10083137 | 3300025932 | Bacteria | 2241 |
| 654 | Ga0207690_10171137 | 3300025932 | Bacteria | 1627 |
| 655 | Ga0207690_10198124 | 3300025932 | Bacteria | 1523 |
| 656 | Ga0207690_10227900 | 3300025932 | Bacteria | 1429 |
| 657 | Ga0207690_10229078 | 3300025932 | Bacteria | 1425 |
| 658 | Ga0207690_10244142 | 3300025932 | Bacteria | 1384 |
| 659 | Ga0207690_10259225 | 3300025932 | Bacteria | 1346 |
| 660 | Ga0207690_10390236 | 3300025932 | Bacteria | 1108 |
| 661 | Ga0207690_10645490 | 3300025932 | Bacteria | 867 |
| 662 | Ga0207690_10798539 | 3300025932 | Bacteria | 780 |
| 663 | Ga0207690_10934350 | 3300025932 | Bacteria | 720 |
| 664 | Ga0207706_10000041 | 3300025933 | Bacteria | 130090 |
| 665 | Ga0207706_10001361 | 3300025933 | Bacteria | 24433 |
| 666 | Ga0207706_10009320 | 3300025933 | Bacteria | 9013 |
| 667 | Ga0207706_10021878 | 3300025933 | Bacteria | 5739 |
| 668 | Ga0207706_10028567 | 3300025933 | Bacteria | 4981 |
| 669 | Ga0207706_10032833 | 3300025933 | Bacteria | 4619 |
| 670 | Ga0207706_10327574 | 3300025933 | Bacteria | 1333 |
| 671 | Ga0207706_10401387 | 3300025933 | Bacteria | 1188 |
| 672 | Ga0207686_10002334 | 3300025934 | Bacteria | 10371 |
| 673 | Ga0207686_10048837 | 3300025934 | Bacteria | 2624 |
| 674 | Ga0207709_10000066 | 3300025935 | Bacteria | 189194 |
| 675 | Ga0207709_10000116 | 3300025935 | Bacteria | 123061 |
| 676 | Ga0207709_10018879 | 3300025935 | Bacteria | 3867 |
| 677 | Ga0207709_10033589 | 3300025935 | Bacteria | 3014 |
| 678 | Ga0207709_10183311 | 3300025935 | Bacteria | 1480 |
| 679 | Ga0207669_10000022 | 3300025937 | Bacteria | 100002 |
| 680 | Ga0207669_10015833 | 3300025937 | Bacteria | 3814 |
| 681 | Ga0207669_10062042 | 3300025937 | Bacteria | 2300 |
| 682 | Ga0207669_10101776 | 3300025937 | Bacteria | 1901 |
| 683 | Ga0207669_10113323 | 3300025937 | Bacteria | 1823 |
| 684 | Ga0207704_10000002 | 3300025938 | Bacteria | 303025 |
| 685 | Ga0207704_10000007 | 3300025938 | Bacteria | 211230 |
| 686 | Ga0207704_10054761 | 3300025938 | Bacteria | 2434 |
| 687 | Ga0207704_10164991 | 3300025938 | Bacteria | 1581 |
| 688 | Ga0207704_10183549 | 3300025938 | Bacteria | 1514 |
| 689 | Ga0207665_10013175 | 3300025939 | Bacteria | 5437 |
| 690 | Ga0207691_10010000 | 3300025940 | Bacteria | 9107 |
| 691 | Ga0207691_10017215 | 3300025940 | Bacteria | 6857 |
| 692 | Ga0207691_10513215 | 3300025940 | Bacteria | 1017 |
| 693 | Ga0207691_10519937 | 3300025940 | Bacteria | 1010 |
| 694 | Ga0207711_10000254 | 3300025941 | Bacteria | 57648 |
| 695 | Ga0207711_10002858 | 3300025941 | Bacteria | 15138 |
| 696 | Ga0207711_10019188 | 3300025941 | Bacteria | 5693 |
| 697 | Ga0207711_10033796 | 3300025941 | Bacteria | 4329 |
| 698 | Ga0207711_10043144 | 3300025941 | Bacteria | 3846 |
| 699 | Ga0207711_11183716 | 3300025941 | Bacteria | 706 |
| 700 | Ga0207689_10000060 | 3300025942 | Bacteria | 85326 |
| 701 | Ga0207689_10003854 | 3300025942 | Bacteria | 13672 |
| 702 | Ga0207689_10156309 | 3300025942 | Bacteria | 1880 |
| 703 | Ga0207661_10000953 | 3300025944 | Bacteria | 19059 |
| 704 | Ga0207661_10019161 | 3300025944 | Bacteria | 5096 |
| 705 | Ga0207679_10000243 | 3300025945 | Bacteria | 41706 |
| 706 | Ga0207679_10006441 | 3300025945 | Bacteria | 7418 |
| 707 | Ga0207679_10016805 | 3300025945 | Bacteria | 4864 |
| 708 | Ga0207679_10025671 | 3300025945 | Bacteria | 4055 |
| 709 | Ga0207679_10049249 | 3300025945 | Bacteria | 3073 |
| 710 | Ga0207679_10062972 | 3300025945 | Bacteria | 2766 |
| 711 | Ga0207679_10094259 | 3300025945 | Bacteria | 2324 |
| 712 | Ga0207679_10206807 | 3300025945 | Bacteria | 1643 |
| 713 | Ga0207679_10728949 | 3300025945 | Bacteria | 901 |
| 714 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 715 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 716 | Ga0207667_10006092 | 3300025949 | Bacteria | 14659 |
| 717 | Ga0207667_10007578 | 3300025949 | Bacteria | 13019 |
| 718 | Ga0207667_10017260 | 3300025949 | Bacteria | 8130 |
| 719 | Ga0207667_10017604 | 3300025949 | Bacteria | 8036 |
| 720 | Ga0207667_10028549 | 3300025949 | Bacteria | 6059 |
| 721 | Ga0207667_10031849 | 3300025949 | Bacteria | 5688 |
| 722 | Ga0207667_10033839 | 3300025949 | Bacteria | 5491 |
| 723 | Ga0207667_10064139 | 3300025949 | Bacteria | 3836 |
| 724 | Ga0207667_10201249 | 3300025949 | Bacteria | 2043 |
| 725 | Ga0207667_11003548 | 3300025949 | Bacteria | 822 |
| 726 | Ga0207651_10000004 | 3300025960 | Bacteria | 290191 |
| 727 | Ga0207651_10099174 | 3300025960 | Bacteria | 2156 |
| 728 | Ga0207651_10201365 | 3300025960 | Bacteria | 1596 |
| 729 | Ga0207651_10501208 | 3300025960 | Bacteria | 1049 |
| 730 | Ga0207651_10557147 | 3300025960 | Bacteria | 997 |
| 731 | Ga0207712_10001154 | 3300025961 | Bacteria | 18388 |
| 732 | Ga0207712_10007169 | 3300025961 | Bacteria | 7030 |
| 733 | Ga0207712_10009916 | 3300025961 | Bacteria | 6038 |
| 734 | Ga0207712_10068412 | 3300025961 | Bacteria | 2544 |
| 735 | Ga0207712_10519690 | 3300025961 | Bacteria | 1020 |
| 736 | Ga0207712_10574041 | 3300025961 | Bacteria | 972 |
| 737 | Ga0207668_10000050 | 3300025972 | Bacteria | 98767 |
| 738 | Ga0207668_10008350 | 3300025972 | Bacteria | 6167 |
| 739 | Ga0207668_10024423 | 3300025972 | Bacteria | 3900 |
| 740 | Ga0207668_10025165 | 3300025972 | Bacteria | 3849 |
| 741 | Ga0207668_10036914 | 3300025972 | Bacteria | 3266 |
| 742 | Ga0207668_10060121 | 3300025972 | Bacteria | 2666 |
| 743 | Ga0207668_10096392 | 3300025972 | Bacteria | 2186 |
| 744 | Ga0207668_10100343 | 3300025972 | Bacteria | 2149 |
| 745 | Ga0207668_10136193 | 3300025972 | Bacteria | 1882 |
| 746 | Ga0207668_10196533 | 3300025972 | Bacteria | 1603 |
| 747 | Ga0207640_10000695 | 3300025981 | Bacteria | 19606 |
| 748 | Ga0207640_10003242 | 3300025981 | Bacteria | 8767 |
| 749 | Ga0207640_10009695 | 3300025981 | Bacteria | 5401 |
| 750 | Ga0207640_10010412 | 3300025981 | Bacteria | 5240 |
| 751 | Ga0207640_10022324 | 3300025981 | Bacteria | 3786 |
| 752 | Ga0207640_10022842 | 3300025981 | Bacteria | 3750 |
| 753 | Ga0207640_10050304 | 3300025981 | Bacteria | 2703 |
| 754 | Ga0207640_10057393 | 3300025981 | Bacteria | 2560 |
| 755 | Ga0207640_10254719 | 3300025981 | Bacteria | 1364 |
| 756 | Ga0207640_10848116 | 3300025981 | Bacteria | 795 |
| 757 | Ga0207658_10000109 | 3300025986 | Bacteria | 89979 |
| 758 | Ga0207658_10000243 | 3300025986 | Bacteria | 57023 |
| 759 | Ga0207658_10000831 | 3300025986 | Bacteria | 25797 |
| 760 | Ga0207658_10001229 | 3300025986 | Bacteria | 20259 |
| 761 | Ga0207658_10007072 | 3300025986 | Bacteria | 7643 |
| 762 | Ga0207658_10019968 | 3300025986 | Bacteria | 4637 |
| 763 | Ga0207658_10333312 | 3300025986 | Bacteria | 1317 |
| 764 | Ga0207658_10469643 | 3300025986 | Bacteria | 1116 |
| 765 | Ga0207658_10482858 | 3300025986 | Bacteria | 1101 |
| 766 | Ga0207677_10000231 | 3300026023 | Bacteria | 43615 |
| 767 | Ga0207677_10105098 | 3300026023 | Bacteria | 2089 |
| 768 | Ga0207677_10150276 | 3300026023 | Bacteria | 1796 |
| 769 | Ga0207703_10000167 | 3300026035 | Bacteria | 76517 |
| 770 | Ga0207703_10000302 | 3300026035 | Bacteria | 54142 |
| 771 | Ga0207703_10001218 | 3300026035 | Bacteria | 24067 |
| 772 | Ga0207703_10022812 | 3300026035 | Bacteria | 4917 |
| 773 | Ga0207703_10165021 | 3300026035 | Bacteria | 1943 |
| 774 | Ga0207703_11233867 | 3300026035 | Bacteria | 719 |
| 775 | Ga0207639_10000222 | 3300026041 | Bacteria | 42464 |
| 776 | Ga0207639_10001618 | 3300026041 | Bacteria | 15148 |
| 777 | Ga0207639_10002807 | 3300026041 | Bacteria | 11688 |
| 778 | Ga0207639_10004222 | 3300026041 | Bacteria | 9682 |
| 779 | Ga0207639_10044491 | 3300026041 | Bacteria | 3339 |
| 780 | Ga0207639_10119275 | 3300026041 | Bacteria | 2165 |
| 781 | Ga0207639_10192428 | 3300026041 | Bacteria | 1743 |
| 782 | Ga0207639_10372545 | 3300026041 | Bacteria | 1280 |
| 783 | Ga0207678_10000427 | 3300026067 | Bacteria | 38170 |
| 784 | Ga0207678_10002526 | 3300026067 | Bacteria | 16670 |
| 785 | Ga0207678_10009305 | 3300026067 | Bacteria | 8648 |
| 786 | Ga0207678_10009690 | 3300026067 | Bacteria | 8475 |
| 787 | Ga0207678_10025204 | 3300026067 | Bacteria | 5191 |
| 788 | Ga0207678_10029423 | 3300026067 | Bacteria | 4794 |
| 789 | Ga0207678_10033366 | 3300026067 | Bacteria | 4485 |
| 790 | Ga0207678_10130264 | 3300026067 | Bacteria | 2145 |
| 791 | Ga0207678_10349584 | 3300026067 | Bacteria | 1275 |
| 792 | Ga0207702_10000074 | 3300026078 | Bacteria | 113070 |
| 793 | Ga0207702_10004354 | 3300026078 | Bacteria | 12627 |
| 794 | Ga0207702_10067615 | 3300026078 | Bacteria | 3067 |
| 795 | Ga0207702_10142238 | 3300026078 | Bacteria | 2172 |
| 796 | Ga0207702_10245637 | 3300026078 | Bacteria | 1679 |
| 797 | Ga0207702_10931312 | 3300026078 | Bacteria | 861 |
| 798 | Ga0207702_10954380 | 3300026078 | Bacteria | 850 |
| 799 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 800 | Ga0207641_10000241 | 3300026088 | Bacteria | 71027 |
| 801 | Ga0207641_10000755 | 3300026088 | Bacteria | 34850 |
| 802 | Ga0207641_10001790 | 3300026088 | Bacteria | 20701 |
| 803 | Ga0207641_10033823 | 3300026088 | Bacteria | 4248 |
| 804 | Ga0207641_10232662 | 3300026088 | Bacteria | 1713 |
| 805 | Ga0207641_10306438 | 3300026088 | Bacteria | 1502 |
| 806 | Ga0207641_10331658 | 3300026088 | Bacteria | 1445 |
| 807 | Ga0207648_10000003 | 3300026089 | Bacteria | 289983 |
| 808 | Ga0207648_10004533 | 3300026089 | Bacteria | 14239 |
| 809 | Ga0207648_10008748 | 3300026089 | Bacteria | 9757 |
| 810 | Ga0207648_10043805 | 3300026089 | Bacteria | 3929 |
| 811 | Ga0207648_10059901 | 3300026089 | Bacteria | 3320 |
| 812 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 813 | Ga0207676_10000027 | 3300026095 | Bacteria | 245868 |
| 814 | Ga0207676_10000344 | 3300026095 | Bacteria | 39948 |
| 815 | Ga0207676_10007462 | 3300026095 | Bacteria | 7760 |
| 816 | Ga0207676_10036224 | 3300026095 | Bacteria | 3752 |
| 817 | Ga0207676_10698306 | 3300026095 | Bacteria | 983 |
| 818 | Ga0207674_10004106 | 3300026116 | Bacteria | 17638 |
| 819 | Ga0207674_10006823 | 3300026116 | Bacteria | 13393 |
| 820 | Ga0207674_10012801 | 3300026116 | Bacteria | 9366 |
| 821 | Ga0207674_10038792 | 3300026116 | Bacteria | 4941 |
| 822 | Ga0207674_10154090 | 3300026116 | Bacteria | 2253 |
| 823 | Ga0207674_10155404 | 3300026116 | Bacteria | 2243 |
| 824 | Ga0207674_10372997 | 3300026116 | Bacteria | 1379 |
| 825 | Ga0207675_100001147 | 3300026118 | Bacteria | 26263 |
| 826 | Ga0207675_100440544 | 3300026118 | Bacteria | 1289 |
| 827 | Ga0207683_10015482 | 3300026121 | Bacteria | 6496 |
| 828 | Ga0207683_10015611 | 3300026121 | Bacteria | 6464 |
| 829 | Ga0207683_10058649 | 3300026121 | Bacteria | 3380 |
| 830 | Ga0207683_10320182 | 3300026121 | Bacteria | 1421 |
| 831 | Ga0207683_10335183 | 3300026121 | Bacteria | 1387 |
| 832 | Ga0207698_10000892 | 3300026142 | Bacteria | 17333 |
| 833 | Ga0207698_10001072 | 3300026142 | Bacteria | 15905 |
| 834 | Ga0207698_10006957 | 3300026142 | Bacteria | 7077 |
| 835 | Ga0207698_10033576 | 3300026142 | Bacteria | 3730 |
| 836 | Ga0207698_10034897 | 3300026142 | Bacteria | 3673 |
| 837 | Ga0207698_10080661 | 3300026142 | Bacteria | 2622 |
| 838 | Ga0207698_10173871 | 3300026142 | Bacteria | 1900 |
| 839 | Ga0207698_10397770 | 3300026142 | Bacteria | 1316 |
| 840 | Ga0207698_11204589 | 3300026142 | Bacteria | 771 |
| 841 | Ga0209973_1085743 | 3300027252 | Bacteria | 504 |
| 842 | Ga0209983_1013449 | 3300027665 | Bacteria | 1683 |
| 843 | Ga0209971_1038769 | 3300027682 | Bacteria | 1147 |
| 844 | Ga0209813_10000007 | 3300027866 | Bacteria | 104066 |
| 845 | Ga0209813_10000279 | 3300027866 | Bacteria | 14382 |
| 846 | Ga0209974_10003536 | 3300027876 | Bacteria | 5619 |
| 847 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 848 | Ga0268266_10000175 | 3300028379 | Bacteria | 115897 |
| 849 | Ga0268266_10001810 | 3300028379 | Bacteria | 24195 |
| 850 | Ga0268266_10005157 | 3300028379 | Bacteria | 12305 |
| 851 | Ga0268266_10013052 | 3300028379 | Bacteria | 7163 |
| 852 | Ga0268266_10025965 | 3300028379 | Bacteria | 4983 |
| 853 | Ga0268266_10258148 | 3300028379 | Bacteria | 1614 |
| 854 | Ga0268266_10502646 | 3300028379 | Bacteria | 1158 |
| 855 | Ga0268266_10623025 | 3300028379 | Bacteria | 1037 |
| 856 | Ga0268265_10000042 | 3300028380 | Bacteria | 186086 |
| 857 | Ga0268265_10000052 | 3300028380 | Bacteria | 174254 |
| 858 | Ga0268265_10003957 | 3300028380 | Bacteria | 10437 |
| 859 | Ga0268265_10014248 | 3300028380 | Bacteria | 5416 |
| 860 | Ga0268265_10080018 | 3300028380 | Bacteria | 2575 |
| 861 | Ga0268265_10167444 | 3300028380 | Bacteria | 1874 |
| 862 | Ga0268265_10320645 | 3300028380 | Bacteria | 1403 |
| 863 | Ga0268265_10651549 | 3300028380 | Bacteria | 1012 |
| 864 | Ga0268264_10000144 | 3300028381 | Bacteria | 168841 |
| 865 | Ga0268264_10000268 | 3300028381 | Bacteria | 91477 |
| 866 | Ga0268264_10001327 | 3300028381 | Bacteria | 23270 |
| 867 | Ga0268264_10013849 | 3300028381 | Bacteria | 6632 |
| 868 | Ga0268264_10016760 | 3300028381 | Bacteria | 5996 |
| 869 | Ga0268264_10045605 | 3300028381 | Bacteria | 3640 |
| 870 | Ga0268264_10065024 | 3300028381 | Bacteria | 3071 |
| 871 | Ga0268264_10095824 | 3300028381 | Bacteria | 2569 |
| 872 | Ga0268264_10565079 | 3300028381 | Bacteria | 1117 |
| 873 | Ga0307517_10020643 | 3300028786 | Bacteria | 8380 |
| 874 | Ga0307517_10295058 | 3300028786 | Bacteria | 913 |
| 875 | Ga0316183_1203243 | 3300030742 | Bacteria | 1049 |
| 876 | Ga0265327_10116288 | 3300031251 | Bacteria | 1272 |
| 877 | Ga0307509_10476517 | 3300031507 | Bacteria | 937 |
| 878 | Ga0307408_100004452 | 3300031548 | Bacteria | 9514 |
| 879 | Ga0307408_100006152 | 3300031548 | Bacteria | 7968 |
| 880 | Ga0307408_100013781 | 3300031548 | Bacteria | 5367 |
| 881 | Ga0307408_100045019 | 3300031548 | Bacteria | 3149 |
| 882 | Ga0307408_100047429 | 3300031548 | Bacteria | 3077 |
| 883 | Ga0307408_100115622 | 3300031548 | Bacteria | 2069 |
| 884 | Ga0307408_100219274 | 3300031548 | Bacteria | 1551 |
| 885 | Ga0307408_100454895 | 3300031548 | Bacteria | 1111 |
| 886 | Ga0307408_100490889 | 3300031548 | Bacteria | 1073 |
| 887 | Ga0307408_100499911 | 3300031548 | Bacteria | 1064 |
| 888 | Ga0307508_10013978 | 3300031616 | Bacteria | 7324 |
| 889 | Ga0307508_10100659 | 3300031616 | Bacteria | 2485 |
| 890 | Ga0307405_10002843 | 3300031731 | Bacteria | 7780 |
| 891 | Ga0307405_10004479 | 3300031731 | Bacteria | 6608 |
| 892 | Ga0307405_10021552 | 3300031731 | Bacteria | 3624 |
| 893 | Ga0307413_10002654 | 3300031824 | Bacteria | 7323 |
| 894 | Ga0307413_10011213 | 3300031824 | Bacteria | 4394 |
| 895 | Ga0307413_10017328 | 3300031824 | Bacteria | 3748 |
| 896 | Ga0307413_10023177 | 3300031824 | Bacteria | 3361 |
| 897 | Ga0307413_10135136 | 3300031824 | Bacteria | 1694 |
| 898 | Ga0307413_10301424 | 3300031824 | Bacteria | 1215 |
| 899 | Ga0307413_10822024 | 3300031824 | Bacteria | 783 |
| 900 | Ga0307410_10012132 | 3300031852 | Bacteria | 4965 |
| 901 | Ga0307410_10045244 | 3300031852 | Bacteria | 2929 |
| 902 | Ga0307410_10074163 | 3300031852 | Bacteria | 2369 |
| 903 | Ga0307410_10075902 | 3300031852 | Bacteria | 2344 |
| 904 | Ga0307410_10118726 | 3300031852 | Bacteria | 1925 |
| 905 | Ga0307410_10243550 | 3300031852 | Bacteria | 1394 |
| 906 | Ga0307410_10303694 | 3300031852 | Bacteria | 1260 |
| 907 | Ga0307410_10425944 | 3300031852 | Bacteria | 1077 |
| 908 | Ga0307410_10746693 | 3300031852 | Bacteria | 828 |
| 909 | Ga0307410_10842397 | 3300031852 | Bacteria | 782 |
| 910 | Ga0307406_10010388 | 3300031901 | Bacteria | 5248 |
| 911 | Ga0307406_10032616 | 3300031901 | Bacteria | 3182 |
| 912 | Ga0307406_10049849 | 3300031901 | Bacteria | 2651 |
| 913 | Ga0307406_10293774 | 3300031901 | Bacteria | 1245 |
| 914 | Ga0307406_10354532 | 3300031901 | Bacteria | 1148 |
| 915 | Ga0307406_10355532 | 3300031901 | Bacteria | 1146 |
| 916 | Ga0307406_10430414 | 3300031901 | Bacteria | 1054 |
| 917 | Ga0307406_10463989 | 3300031901 | Bacteria | 1019 |
| 918 | Ga0307407_10000642 | 3300031903 | Bacteria | 11183 |
| 919 | Ga0307407_10001660 | 3300031903 | Bacteria | 8234 |
| 920 | Ga0307407_10018963 | 3300031903 | Bacteria | 3493 |
| 921 | Ga0307407_10064069 | 3300031903 | Bacteria | 2158 |
| 922 | Ga0307407_10215283 | 3300031903 | Bacteria | 1296 |
| 923 | Ga0307412_10003000 | 3300031911 | Bacteria | 9343 |
| 924 | Ga0307412_10011723 | 3300031911 | Bacteria | 5085 |
| 925 | Ga0307412_10023555 | 3300031911 | Bacteria | 3790 |
| 926 | Ga0307412_10031872 | 3300031911 | Bacteria | 3333 |
| 927 | Ga0307412_10068448 | 3300031911 | Bacteria | 2414 |
| 928 | Ga0307412_10133370 | 3300031911 | Bacteria | 1808 |
| 929 | Ga0307412_10147821 | 3300031911 | Bacteria | 1730 |
| 930 | Ga0307412_10504704 | 3300031911 | Bacteria | 1008 |
| 931 | Ga0307412_10550438 | 3300031911 | Bacteria | 969 |
| 932 | Ga0307412_10673933 | 3300031911 | Bacteria | 885 |
| 933 | Ga0307412_11301028 | 3300031911 | Bacteria | 654 |
| 934 | Ga0307409_100001134 | 3300031995 | Bacteria | 12647 |
| 935 | Ga0307409_100014600 | 3300031995 | Bacteria | 5118 |
| 936 | Ga0307409_100042286 | 3300031995 | Bacteria | 3411 |
| 937 | Ga0307409_100097867 | 3300031995 | Bacteria | 2424 |
| 938 | Ga0307409_100107575 | 3300031995 | Bacteria | 2330 |
| 939 | Ga0307409_100375613 | 3300031995 | Bacteria | 1349 |
| 940 | Ga0307409_100462246 | 3300031995 | Bacteria | 1227 |
| 941 | Ga0307409_100574396 | 3300031995 | Bacteria | 1110 |
| 942 | Ga0307409_100609696 | 3300031995 | Bacteria | 1080 |
| 943 | Ga0307416_100021275 | 3300032002 | Bacteria | 4652 |
| 944 | Ga0307416_100024603 | 3300032002 | Bacteria | 4399 |
| 945 | Ga0307416_100025294 | 3300032002 | Bacteria | 4350 |
| 946 | Ga0307416_100026146 | 3300032002 | Bacteria | 4295 |
| 947 | Ga0307416_100039060 | 3300032002 | Bacteria | 3670 |
| 948 | Ga0307416_100117251 | 3300032002 | Bacteria | 2363 |
| 949 | Ga0307416_100660589 | 3300032002 | Bacteria | 1131 |
| 950 | Ga0307414_10000073 | 3300032004 | Bacteria | 94656 |
| 951 | Ga0307414_10004382 | 3300032004 | Bacteria | 7664 |
| 952 | Ga0307414_10004615 | 3300032004 | Bacteria | 7494 |
| 953 | Ga0307414_10004943 | 3300032004 | Bacteria | 7281 |
| 954 | Ga0307414_10049760 | 3300032004 | Bacteria | 2899 |
| 955 | Ga0307414_10085299 | 3300032004 | Bacteria | 2326 |
| 956 | Ga0307414_10096376 | 3300032004 | Bacteria | 2213 |
| 957 | Ga0307414_10129051 | 3300032004 | Bacteria | 1959 |
| 958 | Ga0307414_10154175 | 3300032004 | Bacteria | 1816 |
| 959 | Ga0307414_10181450 | 3300032004 | Bacteria | 1693 |
| 960 | Ga0307414_10292136 | 3300032004 | Bacteria | 1374 |
| 961 | Ga0307414_10323515 | 3300032004 | Bacteria | 1313 |
| 962 | Ga0307414_10340417 | 3300032004 | Bacteria | 1284 |
| 963 | Ga0307414_10410604 | 3300032004 | Bacteria | 1178 |
| 964 | Ga0307414_10647308 | 3300032004 | Bacteria | 952 |
| 965 | Ga0307414_10764060 | 3300032004 | Bacteria | 879 |
| 966 | Ga0307414_10992884 | 3300032004 | Bacteria | 772 |
| 967 | Ga0307411_10005275 | 3300032005 | Bacteria | 6327 |
| 968 | Ga0307411_10016683 | 3300032005 | Bacteria | 4161 |
| 969 | Ga0307411_10028900 | 3300032005 | Bacteria | 3377 |
| 970 | Ga0307411_10041569 | 3300032005 | Bacteria | 2926 |
| 971 | Ga0307411_10041899 | 3300032005 | Bacteria | 2917 |
| 972 | Ga0307411_10208079 | 3300032005 | Bacteria | 1508 |
| 973 | Ga0307411_10220221 | 3300032005 | Bacteria | 1472 |
| 974 | Ga0307411_10257744 | 3300032005 | Bacteria | 1375 |
| 975 | Ga0307411_10301566 | 3300032005 | Bacteria | 1285 |
| 976 | Ga0307411_10303104 | 3300032005 | Bacteria | 1282 |
| 977 | Ga0307411_10311678 | 3300032005 | Bacteria | 1266 |
| 978 | Ga0307415_100009294 | 3300032126 | Bacteria | 5499 |
| 979 | Ga0307415_100288064 | 3300032126 | Bacteria | 1354 |
| 980 | Ga0307415_100321955 | 3300032126 | Bacteria | 1289 |
| 981 | Ga0307415_100335672 | 3300032126 | Bacteria | 1266 |
| 982 | Ga0307415_100439992 | 3300032126 | Bacteria | 1124 |
| 983 | Ga0307510_10066259 | 3300033180 | Bacteria | 3649 |
| 984 | Ga0373951_0046907 | 3300035091 | Bacteria | 1055 |
| 985 | Ga0373923_0004223 | 3300035111 | Bacteria | 4744 |
| 986 | Ga0373923_0127740 | 3300035111 | Bacteria | 1140 |
| 987 | Ga0373943_0005666 | 3300035170 | Bacteria | 5602 |
| 988 | Ga0373946_0061644 | 3300035171 | Bacteria | 1598 |
| 989 | Ga0373935_0002322 | 3300035692 | Bacteria | 10863 |
| 990 | Ga0373933_0031583 | 3300035724 | Bacteria | 3072 |
| 991 | Ga0373947_0022791 | 3300035725 | Bacteria | 3635 |
| 992 | Ga0373947_0129808 | 3300035725 | Bacteria | 1608 |
| 993 | Ga0373937_0045789 | 3300036401 | Bacteria | 3998 |
| 994 | Ga0373925_0277898 | 3300037068 | Bacteria | 1348 |
| 995 | Ga0395899_0010252 | 3300037312 | Bacteria | 7182 |
| 996 | Ga0395899_0036681 | 3300037312 | Bacteria | 3677 |
| 997 | Ga0395899_0044714 | 3300037312 | Bacteria | 3299 |
| 998 | Ga0395899_0053580 | 3300037312 | Bacteria | 2986 |
| 999 | Ga0395899_0134149 | 3300037312 | Bacteria | 1766 |
| 1000 | Ga0395899_0162236 | 3300037312 | Bacteria | 1578 |
| 1001 | Ga0395900_0027388 | 3300037418 | Bacteria | 5837 |
| 1002 | Ga0395900_0028928 | 3300037418 | Bacteria | 5681 |
| 1003 | Ga0395900_0092721 | 3300037418 | Bacteria | 3103 |
| 1004 | Ga0395900_0120079 | 3300037418 | Bacteria | 2697 |
| 1005 | Ga0395900_0164384 | 3300037418 | Bacteria | 2262 |
| 1006 | Ga0395900_0335785 | 3300037418 | Bacteria | 1488 |
| 1007 | Ga0395898_0054496 | 3300037466 | Bacteria | 3902 |
| 1008 | Ga0395898_0085987 | 3300037466 | Bacteria | 3031 |
| 1009 | Ga0395905_0025080 | 3300037471 | Bacteria | 5623 |
| 1010 | Ga0395905_0030632 | 3300037471 | Bacteria | 5067 |
| 1011 | Ga0395905_0047368 | 3300037471 | Bacteria | 4029 |
| 1012 | Ga0395905_0133408 | 3300037471 | Bacteria | 2336 |
| 1013 | Ga0395905_0160398 | 3300037471 | Bacteria | 2114 |
| 1014 | Ga0395905_0292187 | 3300037471 | Bacteria | 1516 |
| 1015 | Ga0395905_0315237 | 3300037471 | Bacteria | 1453 |
| 1016 | Ga0395905_0370430 | 3300037471 | Bacteria | 1326 |
| 1017 | Ga0395905_0377023 | 3300037471 | Bacteria | 1312 |
| 1018 | Ga0436364_0804686 | 3300037853 | Bacteria | 1283 |
| 1019 | Ga0395901_0041174 | 3300038443 | Bacteria | 4786 |
| 1020 | Ga0395901_0048282 | 3300038443 | Bacteria | 4420 |
| 1021 | Ga0395901_0099018 | 3300038443 | Bacteria | 3057 |
| 1022 | Ga0395901_0647004 | 3300038443 | Bacteria | 1061 |
| 1023 | Ga0237819_02628 | 3300038705 | Bacteria | 3517 |
| 1024 | Ga0237816_03757 | 3300039145 | Bacteria | 1089 |
| 1025 | Ga0436365_1638035 | 3300039437 | Bacteria | 1898 |
| 1026 | Ga0439466_0065068 | 3300041411 | Bacteria | 1169 |
| 1027 | Ga0451791_1549013 | 3300041451 | Bacteria | 673 |
| 1028 | Ga0451853_4106881 | 3300041512 | Bacteria | 1545 |
| 1029 | Ga0439432_002749 | 3300042006 | Bacteria | 6573 |
| 1030 | Ga0439449_0061824 | 3300042007 | Bacteria | 1382 |
| 1031 | Ga0439462_0000274 | 3300042015 | Bacteria | 9429 |
| 1032 | Ga0439458_0000616 | 3300042157 | Bacteria | 9192 |
| 1033 | Ga0439460_0265782 | 3300042461 | Bacteria | 595 |
| 1034 | Ga0451577_0219644 | 3300042876 | Bacteria | 1718 |
| 1035 | Ga0466972_0001135 | 3300044658 | Bacteria | 12760 |
| 1036 | Ga0466972_0040609 | 3300044658 | Bacteria | 2266 |
| 1037 | Ga0466973_0033687 | 3300044659 | Bacteria | 4879 |
| 1038 | Ga0466965_0074211 | 3300044683 | Bacteria | 1714 |
| 1039 | Ga0466966_0001152 | 3300044684 | Bacteria | 16994 |
| 1040 | Ga0466966_0229375 | 3300044684 | Bacteria | 1120 |
| 1041 | Ga0466961_0017645 | 3300044693 | Bacteria | 4585 |
| 1042 | Ga0466961_0039301 | 3300044693 | Bacteria | 3033 |
| 1043 | Ga0466963_0050836 | 3300044694 | Bacteria | 2744 |
| 1044 | Ga0466963_0321751 | 3300044694 | Bacteria | 1088 |
| 1045 | Ga0466964_0023350 | 3300044706 | Bacteria | 2405 |
| 1046 | Ga0466971_0001276 | 3300044719 | Bacteria | 10502 |
| 1047 | Ga0466971_0371524 | 3300044719 | Bacteria | 694 |
| 1048 | Ga0466968_0043206 | 3300044735 | Bacteria | 1907 |
| 1049 | Ga0466968_0054968 | 3300044735 | Bacteria | 1707 |
| 1050 | Ga0466970_0114927 | 3300044765 | Bacteria | 1471 |
| 1051 | Ga0466970_0116316 | 3300044765 | Bacteria | 1462 |
| 1052 | Ga0466970_0161930 | 3300044765 | Bacteria | 1238 |
| 1053 | Ga0466970_0492336 | 3300044765 | Bacteria | 705 |
| 1054 | Ga0466957_0008816 | 3300044842 | Bacteria | 5743 |
| 1055 | Ga0466960_0001716 | 3300044901 | Bacteria | 8043 |
| 1056 | Ga0466959_0084865 | 3300045049 | Bacteria | 2279 |
| 1057 | Ga0466959_0160252 | 3300045049 | Unclassified | 1582 |
| 1058 | Ga0466959_0213418 | 3300045049 | Bacteria | 1340 |
| 1059 | Ga0466958_0010021 | 3300045836 | Bacteria | 5294 |
| 1060 | Ga0466958_0025024 | 3300045836 | Bacteria | 3516 |
| 1061 | Ga0466967_0083449 | 3300045976 | Bacteria | 2889 |
| 1062 | Ga0466967_0373387 | 3300045976 | Bacteria | 1383 |
| 1063 | Ga0466967_0433627 | 3300045976 | Bacteria | 1282 |
| 1064 | Ga0495617_008380 | 3300046452 | Bacteria | 3565 |
| 1065 | Ga0495627_000024 | 3300046453 | Bacteria | 250480 |
| 1066 | Ga0495627_000582 | 3300046453 | Bacteria | 29200 |
| 1067 | Ga0495627_020847 | 3300046453 | Bacteria | 2179 |
| 1068 | Ga0495627_036429 | 3300046453 | Bacteria | 1529 |
| 1069 | Ga0495638_0000051 | 3300046460 | Bacteria | 206003 |
| 1070 | Ga0495638_0015201 | 3300046460 | Bacteria | 5175 |
| 1071 | Ga0495638_0127999 | 3300046460 | Bacteria | 1495 |
| 1072 | Ga0495650_0000967 | 3300046471 | Bacteria | 32924 |
| 1073 | Ga0495650_0001090 | 3300046471 | Bacteria | 29761 |
| 1074 | Ga0495650_0003223 | 3300046471 | Bacteria | 12124 |
| 1075 | Ga0495605_0024857 | 3300046474 | Bacteria | 3129 |
| 1076 | Ga0495584_0483584 | 3300046491 | Bacteria | 630 |
| 1077 | Ga0495585_0040991 | 3300046492 | Bacteria | 2598 |
| 1078 | Ga0495585_0061915 | 3300046492 | Bacteria | 2056 |
| 1079 | Ga0495585_0062413 | 3300046492 | Bacteria | 2047 |
| 1080 | Ga0495585_0081005 | 3300046492 | Bacteria | 1759 |
| 1081 | Ga0495585_0094743 | 3300046492 | Bacteria | 1604 |
| 1082 | Ga0495596_0000008 | 3300046500 | Bacteria | 150860 |
| 1083 | Ga0495596_0002823 | 3300046500 | Bacteria | 9077 |
| 1084 | Ga0495607_0006279 | 3300046501 | Bacteria | 8378 |
| 1085 | Ga0495607_0013977 | 3300046501 | Bacteria | 5243 |
| 1086 | Ga0495607_0037379 | 3300046501 | Bacteria | 2917 |
| 1087 | Ga0495583_0000582 | 3300046506 | Bacteria | 50059 |
| 1088 | Ga0495583_0001392 | 3300046506 | Bacteria | 24725 |
| 1089 | Ga0495583_0005396 | 3300046506 | Bacteria | 8696 |
| 1090 | Ga0495583_0030469 | 3300046506 | Bacteria | 2626 |
| 1091 | Ga0495583_0074163 | 3300046506 | Bacteria | 1490 |
| 1092 | Ga0495583_0077084 | 3300046506 | Bacteria | 1455 |
| 1093 | Ga0495583_0085684 | 3300046506 | Bacteria | 1363 |
| 1094 | Ga0495606_0000178 | 3300046507 | Bacteria | 112329 |
| 1095 | Ga0495606_0010737 | 3300046507 | Bacteria | 7554 |
| 1096 | Ga0495606_0013877 | 3300046507 | Bacteria | 6325 |
| 1097 | Ga0495606_0027882 | 3300046507 | Bacteria | 3995 |
| 1098 | Ga0495606_0163301 | 3300046507 | Bacteria | 1298 |
| 1099 | Ga0495606_0173376 | 3300046507 | Bacteria | 1249 |
| 1100 | Ga0495610_0000053 | 3300046512 | Bacteria | 142545 |
| 1101 | Ga0495610_0000081 | 3300046512 | Bacteria | 113513 |
| 1102 | Ga0495610_0001175 | 3300046512 | Bacteria | 23733 |
| 1103 | Ga0495610_0004173 | 3300046512 | Bacteria | 10803 |
| 1104 | Ga0495610_0093412 | 3300046512 | Bacteria | 1359 |
| 1105 | Ga0495610_0151897 | 3300046512 | Bacteria | 987 |
| 1106 | Ga0495616_0223663 | 3300046513 | Bacteria | 818 |
| 1107 | Ga0495620_0024916 | 3300046515 | Bacteria | 2839 |
| 1108 | Ga0495631_0026871 | 3300046518 | Bacteria | 2638 |
| 1109 | Ga0495631_0045866 | 3300046518 | Bacteria | 1923 |
| 1110 | Ga0495631_0252731 | 3300046518 | Bacteria | 751 |
| 1111 | Ga0495632_0000006 | 3300046519 | Bacteria | 345883 |
| 1112 | Ga0495632_0000306 | 3300046519 | Bacteria | 47401 |
| 1113 | Ga0495632_0000356 | 3300046519 | Bacteria | 43508 |
| 1114 | Ga0495632_0014842 | 3300046519 | Bacteria | 4392 |
| 1115 | Ga0495632_0185855 | 3300046519 | Bacteria | 950 |
| 1116 | Ga0495637_0000784 | 3300046520 | Bacteria | 21358 |
| 1117 | Ga0495637_0023493 | 3300046520 | Bacteria | 2801 |
| 1118 | Ga0495643_0000021 | 3300046522 | Bacteria | 293465 |
| 1119 | Ga0495643_0000042 | 3300046522 | Bacteria | 229665 |
| 1120 | Ga0495643_0001768 | 3300046522 | Bacteria | 18571 |
| 1121 | Ga0495643_0002744 | 3300046522 | Bacteria | 13525 |
| 1122 | Ga0495643_0002897 | 3300046522 | Bacteria | 13016 |
| 1123 | Ga0495643_0012066 | 3300046522 | Bacteria | 5226 |
| 1124 | Ga0495643_0018146 | 3300046522 | Bacteria | 4097 |
| 1125 | Ga0495643_0018970 | 3300046522 | Bacteria | 3984 |
| 1126 | Ga0495643_0045444 | 3300046522 | Bacteria | 2384 |
| 1127 | Ga0495643_0055387 | 3300046522 | Bacteria | 2120 |
| 1128 | Ga0495643_0064246 | 3300046522 | Bacteria | 1939 |
| 1129 | Ga0495643_0108432 | 3300046522 | Bacteria | 1414 |
| 1130 | Ga0495643_0183112 | 3300046522 | Bacteria | 1016 |
| 1131 | Ga0495643_0232909 | 3300046522 | Bacteria | 868 |
| 1132 | Ga0495643_0406652 | 3300046522 | Bacteria | 599 |
| 1133 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 1134 | Ga0495648_0004587 | 3300046524 | Bacteria | 11770 |
| 1135 | Ga0495648_0026511 | 3300046524 | Bacteria | 3899 |
| 1136 | Ga0495648_0038726 | 3300046524 | Bacteria | 3044 |
| 1137 | Ga0495648_0148282 | 3300046524 | Bacteria | 1226 |
| 1138 | Ga0495648_0215116 | 3300046524 | Bacteria | 952 |
| 1139 | Ga0495663_0000008 | 3300046525 | Bacteria | 260614 |
| 1140 | Ga0495663_0000758 | 3300046525 | Bacteria | 11077 |
| 1141 | Ga0495663_0021992 | 3300046525 | Bacteria | 1840 |
| 1142 | Ga0495663_0054540 | 3300046525 | Bacteria | 1245 |
| 1143 | Ga0495663_0128851 | 3300046525 | Bacteria | 852 |
| 1144 | Ga0495652_0539811 | 3300046529 | Bacteria | 803 |
| 1145 | Ga0495609_0003619 | 3300046538 | Bacteria | 8776 |
| 1146 | Ga0495609_0161424 | 3300046538 | Bacteria | 950 |
| 1147 | Ga0495597_0021634 | 3300046542 | Bacteria | 2989 |
| 1148 | Ga0495622_0002170 | 3300046557 | Bacteria | 9561 |
| 1149 | Ga0495633_0000247 | 3300046558 | Bacteria | 64533 |
| 1150 | Ga0495633_0000308 | 3300046558 | Bacteria | 55659 |
| 1151 | Ga0495633_0001265 | 3300046558 | Bacteria | 20151 |
| 1152 | Ga0495633_0009196 | 3300046558 | Bacteria | 5479 |
| 1153 | Ga0495633_0015315 | 3300046558 | Bacteria | 3980 |
| 1154 | Ga0495633_0043814 | 3300046558 | Bacteria | 2122 |
| 1155 | Ga0495633_0100529 | 3300046558 | Bacteria | 1342 |
| 1156 | Ga0495633_0188828 | 3300046558 | Bacteria | 947 |
| 1157 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 1158 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 1159 | Ga0495668_0015322 | 3300046616 | Bacteria | 4481 |
| 1160 | Ga0495668_0021352 | 3300046616 | Bacteria | 3714 |
| 1161 | Ga0495668_0216745 | 3300046616 | Bacteria | 1048 |
| 1162 | Ga0495668_0434163 | 3300046616 | Bacteria | 722 |
| 1163 | Ga0495611_0014367 | 3300046648 | Bacteria | 3381 |
| 1164 | Ga0495611_0066649 | 3300046648 | Bacteria | 1642 |
| 1165 | Ga0495625_0000321 | 3300046660 | Bacteria | 72983 |
| 1166 | Ga0495625_0000914 | 3300046660 | Bacteria | 39744 |
| 1167 | Ga0495625_0003636 | 3300046660 | Bacteria | 15121 |
| 1168 | Ga0495625_0042735 | 3300046660 | Bacteria | 3290 |
| 1169 | Ga0495625_0043217 | 3300046660 | Bacteria | 3269 |
| 1170 | Ga0495625_0071562 | 3300046660 | Bacteria | 2434 |
| 1171 | Ga0495625_0119010 | 3300046660 | Bacteria | 1799 |
| 1172 | Ga0495625_0226451 | 3300046660 | Bacteria | 1223 |
| 1173 | Ga0495661_0072319 | 3300046665 | Bacteria | 2012 |
| 1174 | Ga0495661_0194740 | 3300046665 | Bacteria | 1065 |
| 1175 | Ga0495623_0070991 | 3300046679 | Bacteria | 2168 |
| 1176 | Ga0495669_0002087 | 3300046684 | Bacteria | 8185 |
| 1177 | Ga0495669_0009712 | 3300046684 | Bacteria | 4060 |
| 1178 | Ga0495669_0014347 | 3300046684 | Bacteria | 3387 |
| 1179 | Ga0495669_0062574 | 3300046684 | Bacteria | 1686 |
| 1180 | Ga0495671_0000017 | 3300046692 | Bacteria | 293465 |
| 1181 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 1182 | Ga0495671_0005841 | 3300046692 | Bacteria | 7166 |
| 1183 | Ga0495671_0006324 | 3300046692 | Bacteria | 6852 |
| 1184 | Ga0495671_0022403 | 3300046692 | Bacteria | 3312 |
| 1185 | Ga0495649_0031039 | 3300046694 | Bacteria | 2948 |
| 1186 | Ga0495649_0038474 | 3300046694 | Bacteria | 2624 |
| 1187 | Ga0495600_0001554 | 3300046809 | Bacteria | 12763 |
| 1188 | Ga0495660_0047286 | 3300046810 | Bacteria | 2357 |
| 1189 | Ga0495660_0087149 | 3300046810 | Bacteria | 1629 |
| 1190 | Ga0495672_0117903 | 3300047320 | Bacteria | 1416 |
| 1191 | Ga0495683_0006805 | 3300047323 | Bacteria | 6213 |
| 1192 | Ga0495687_000250 | 3300047443 | Bacteria | 72797 |
| 1193 | Ga0495687_000614 | 3300047443 | Bacteria | 41339 |
| 1194 | Ga0495677_0001865 | 3300047445 | Bacteria | 8422 |
| 1195 | Ga0495673_0000076 | 3300047469 | Bacteria | 205985 |
| 1196 | Ga0495673_0020724 | 3300047469 | Bacteria | 3265 |
| 1197 | Ga0495673_0030495 | 3300047469 | Bacteria | 2532 |
| 1198 | Ga0495673_0034699 | 3300047469 | Bacteria | 2331 |
| 1199 | Ga0495673_0041073 | 3300047469 | Bacteria | 2085 |
| 1200 | Ga0495681_0000099 | 3300047470 | Bacteria | 75808 |
| 1201 | Ga0495681_0000517 | 3300047470 | Bacteria | 29470 |
| 1202 | Ga0495681_0032888 | 3300047470 | Bacteria | 2604 |
| 1203 | Ga0495686_0000262 | 3300047472 | Bacteria | 94462 |
| 1204 | Ga0495686_0000273 | 3300047472 | Bacteria | 91936 |
| 1205 | Ga0495686_0000669 | 3300047472 | Bacteria | 46516 |
| 1206 | Ga0495686_0000680 | 3300047472 | Bacteria | 46007 |
| 1207 | Ga0495686_0103361 | 3300047472 | Bacteria | 1716 |
| 1208 | Ga0495686_0154042 | 3300047472 | Bacteria | 1347 |
| 1209 | Ga0495686_0201852 | 3300047472 | Bacteria | 1141 |
| 1210 | Ga0495602_0046500 | 3300048088 | Bacteria | 3920 |
| 1211 | Ga0495615_0000135 | 3300048090 | Bacteria | 18517 |
| 1212 | Ga0495626_0000139 | 3300048091 | Bacteria | 92719 |
| 1213 | Ga0496100_0427862 | 3300048903 | Bacteria | 1012 |
| 1214 | Ga0496101_0353643 | 3300048904 | Bacteria | 1155 |
| 1215 | Ga0496102_0001391 | 3300048905 | Bacteria | 21494 |
| 1216 | Ga0496102_0009613 | 3300048905 | Bacteria | 8316 |
| 1217 | Ga0496102_0030551 | 3300048905 | Bacteria | 4823 |
| 1218 | Ga0496102_0517366 | 3300048905 | Bacteria | 1116 |
| 1219 | Ga0496102_0557811 | 3300048905 | Bacteria | 1068 |
| 1220 | Ga0496102_0851955 | 3300048905 | Bacteria | 834 |
| 1221 | Ga0496103_0000055 | 3300048906 | Bacteria | 143870 |
| 1222 | Ga0496103_0007593 | 3300048906 | Bacteria | 6455 |
| 1223 | Ga0496103_0041420 | 3300048906 | Bacteria | 2831 |
| 1224 | Ga0496103_0477353 | 3300048906 | Bacteria | 799 |
| 1225 | Ga0496104_0026298 | 3300048907 | Bacteria | 5371 |
| 1226 | Ga0496104_1127604 | 3300048907 | Bacteria | 688 |
| 1227 | Ga0496104_1166181 | 3300048907 | Bacteria | 674 |
| 1228 | Ga0496105_0000358 | 3300048908 | Bacteria | 30167 |
| 1229 | Ga0496105_0740658 | 3300048908 | Bacteria | 751 |
| 1230 | Ga0496106_0019385 | 3300048909 | Bacteria | 5045 |
| 1231 | Ga0496107_0020666 | 3300048910 | Bacteria | 4651 |
| 1232 | Ga0496108_0054733 | 3300048911 | Bacteria | 3348 |
| 1233 | Ga0496108_0296198 | 3300048911 | Bacteria | 1409 |
| 1234 | Ga0496109_0022187 | 3300048912 | Bacteria | 5620 |
| 1235 | Ga0496109_0098706 | 3300048912 | Bacteria | 2708 |
| 1236 | Ga0496109_0215343 | 3300048912 | Bacteria | 1806 |
| 1237 | Ga0496109_0284074 | 3300048912 | Bacteria | 1560 |
| 1238 | Ga0496110_0009627 | 3300048913 | Bacteria | 7823 |
| 1239 | Ga0496110_0026654 | 3300048913 | Bacteria | 4948 |
| 1240 | Ga0496110_0062006 | 3300048913 | Bacteria | 3302 |
| 1241 | Ga0496111_0021635 | 3300048914 | Bacteria | 4495 |
| 1242 | Ga0496111_0103898 | 3300048914 | Bacteria | 2090 |
| 1243 | Ga0496112_0041602 | 3300048915 | Bacteria | 4496 |
| 1244 | Ga0496112_0274805 | 3300048915 | Bacteria | 1632 |
| 1245 | Ga0496113_0009411 | 3300048916 | Bacteria | 6407 |
| 1246 | Ga0496113_0103450 | 3300048916 | Bacteria | 2209 |
| 1247 | Ga0496113_0145461 | 3300048916 | Bacteria | 1867 |
| 1248 | Ga0496113_1273601 | 3300048916 | Bacteria | 572 |
| 1249 | Ga0496114_0000016 | 3300048917 | Bacteria | 274656 |
| 1250 | Ga0496114_0010092 | 3300048917 | Bacteria | 7512 |
| 1251 | Ga0496114_0118522 | 3300048917 | Bacteria | 2274 |
| 1252 | Ga0496115_0000267 | 3300048918 | Bacteria | 46248 |
| 1253 | Ga0496116_0000045 | 3300048919 | Bacteria | 324307 |
| 1254 | Ga0496116_0023536 | 3300048919 | Bacteria | 4585 |
| 1255 | Ga0496116_0028810 | 3300048919 | Bacteria | 4016 |
| 1256 | Ga0496116_0064603 | 3300048919 | Bacteria | 2352 |
| 1257 | Ga0496117_0000549 | 3300048920 | Bacteria | 61657 |
| 1258 | Ga0496117_0002463 | 3300048920 | Bacteria | 23295 |
| 1259 | Ga0496117_0004882 | 3300048920 | Bacteria | 14459 |
| 1260 | Ga0496117_0017345 | 3300048920 | Bacteria | 6016 |
| 1261 | Ga0496117_0070619 | 3300048920 | Bacteria | 2344 |
| 1262 | Ga0496117_0166788 | 3300048920 | Bacteria | 1283 |
| 1263 | Ga0496117_0232443 | 3300048920 | Bacteria | 1018 |
| 1264 | Ga0496118_0000552 | 3300048921 | Bacteria | 61677 |
| 1265 | Ga0496118_0000811 | 3300048921 | Bacteria | 49879 |
| 1266 | Ga0496118_0003823 | 3300048921 | Bacteria | 18542 |
| 1267 | Ga0496118_0007786 | 3300048921 | Bacteria | 11249 |
| 1268 | Ga0496118_0017208 | 3300048921 | Bacteria | 6592 |
| 1269 | Ga0496118_0017950 | 3300048921 | Bacteria | 6414 |
| 1270 | Ga0496118_0034239 | 3300048921 | Bacteria | 4149 |
| 1271 | Ga0496118_0347199 | 3300048921 | Bacteria | 792 |
| 1272 | Ga0496119_0031108 | 3300048922 | Bacteria | 3586 |
| 1273 | Ga0496119_0077162 | 3300048922 | Bacteria | 1931 |
| 1274 | Ga0496119_0089316 | 3300048922 | Bacteria | 1755 |
| 1275 | Ga0496119_0248753 | 3300048922 | Bacteria | 897 |
| 1276 | Ga0496120_0013820 | 3300048923 | Bacteria | 5411 |
| 1277 | Ga0496120_0151706 | 3300048923 | Bacteria | 1164 |
| 1278 | Ga0496121_0000652 | 3300048924 | Bacteria | 64960 |
| 1279 | Ga0496121_0000930 | 3300048924 | Bacteria | 52952 |
| 1280 | Ga0496121_0001191 | 3300048924 | Bacteria | 45526 |
| 1281 | Ga0496121_0003000 | 3300048924 | Bacteria | 24522 |
| 1282 | Ga0496121_0005432 | 3300048924 | Bacteria | 16336 |
| 1283 | Ga0496121_0024091 | 3300048924 | Bacteria | 5832 |
| 1284 | Ga0496121_0031341 | 3300048924 | Bacteria | 4859 |
| 1285 | Ga0496121_0031916 | 3300048924 | Bacteria | 4802 |
| 1286 | Ga0496121_0068404 | 3300048924 | Bacteria | 2873 |
| 1287 | Ga0496121_0078566 | 3300048924 | Bacteria | 2623 |
| 1288 | Ga0496121_0192677 | 3300048924 | Bacteria | 1460 |
| 1289 | Ga0496122_0003938 | 3300048925 | Bacteria | 18968 |
| 1290 | Ga0496122_0005345 | 3300048925 | Bacteria | 15345 |
| 1291 | Ga0496122_0011792 | 3300048925 | Bacteria | 8795 |
| 1292 | Ga0496122_0017572 | 3300048925 | Bacteria | 6675 |
| 1293 | Ga0496122_0036518 | 3300048925 | Bacteria | 3971 |
| 1294 | Ga0496122_0081358 | 3300048925 | Bacteria | 2255 |
| 1295 | Ga0496122_0147769 | 3300048925 | Bacteria | 1457 |
| 1296 | Ga0496123_0001272 | 3300048926 | Bacteria | 36131 |
| 1297 | Ga0496123_0001952 | 3300048926 | Bacteria | 26806 |
| 1298 | Ga0496123_0011382 | 3300048926 | Bacteria | 7717 |
| 1299 | Ga0496123_0011531 | 3300048926 | Bacteria | 7650 |
| 1300 | Ga0496123_0037600 | 3300048926 | Bacteria | 3416 |
| 1301 | Ga0496123_0067977 | 3300048926 | Bacteria | 2247 |
| 1302 | Ga0496123_0079556 | 3300048926 | Bacteria | 2002 |
| 1303 | Ga0496123_0106909 | 3300048926 | Bacteria | 1611 |
| 1304 | Ga0496123_0233381 | 3300048926 | Bacteria | 919 |
| 1305 | Ga0496124_0000585 | 3300048927 | Bacteria | 61469 |
| 1306 | Ga0496124_0003632 | 3300048927 | Bacteria | 18723 |
| 1307 | Ga0496124_0008726 | 3300048927 | Bacteria | 10530 |
| 1308 | Ga0496124_0013710 | 3300048927 | Bacteria | 7893 |
| 1309 | Ga0496124_0019318 | 3300048927 | Bacteria | 6345 |
| 1310 | Ga0496124_0026758 | 3300048927 | Bacteria | 5195 |
| 1311 | Ga0496124_0030502 | 3300048927 | Bacteria | 4785 |
| 1312 | Ga0496124_0099254 | 3300048927 | Bacteria | 2362 |
| 1313 | Ga0496124_0132861 | 3300048927 | Bacteria | 1975 |
| 1314 | Ga0496124_0134357 | 3300048927 | Bacteria | 1961 |
| 1315 | Ga0496124_0166346 | 3300048927 | Bacteria | 1713 |
| 1316 | Ga0496125_0001142 | 3300048928 | Bacteria | 40357 |
| 1317 | Ga0496125_0010180 | 3300048928 | Bacteria | 9531 |
| 1318 | Ga0496125_0010701 | 3300048928 | Bacteria | 9252 |
| 1319 | Ga0496125_0032339 | 3300048928 | Bacteria | 4648 |
| 1320 | Ga0496125_0035059 | 3300048928 | Bacteria | 4410 |
| 1321 | Ga0496125_0036806 | 3300048928 | Bacteria | 4265 |
| 1322 | Ga0496125_0041123 | 3300048928 | Bacteria | 3956 |
| 1323 | Ga0496125_0042756 | 3300048928 | Bacteria | 3854 |
| 1324 | Ga0496125_0059204 | 3300048928 | Bacteria | 3088 |
| 1325 | Ga0496125_0085882 | 3300048928 | Bacteria | 2382 |
| 1326 | Ga0496125_0099292 | 3300048928 | Bacteria | 2151 |
| 1327 | Ga0496125_0107311 | 3300048928 | Bacteria | 2035 |
| 1328 | Ga0496125_0155799 | 3300048928 | Bacteria | 1561 |
| 1329 | Ga0496126_0000519 | 3300048929 | Bacteria | 74968 |
| 1330 | Ga0496126_0001094 | 3300048929 | Bacteria | 45520 |
| 1331 | Ga0496126_0004852 | 3300048929 | Bacteria | 15748 |
| 1332 | Ga0496126_0014259 | 3300048929 | Bacteria | 8041 |
| 1333 | Ga0496126_0064441 | 3300048929 | Bacteria | 3283 |
| 1334 | Ga0496126_0093822 | 3300048929 | Bacteria | 2635 |
| 1335 | Ga0496126_0271213 | 3300048929 | Bacteria | 1408 |
| 1336 | Ga0496126_0501897 | 3300048929 | Bacteria | 969 |
| 1337 | Ga0496126_0536572 | 3300048929 | Bacteria | 930 |
| 1338 | Ga0495678_201105 | 3300049459 | Bacteria | 614 |
| 1339 | Ga0501335_005898 | 3300049551 | Bacteria | 1104 |
| 1340 | Ga0501032_0019920 | 3300049569 | Bacteria | 4682 |
| 1341 | Ga0501032_0022006 | 3300049569 | Bacteria | 4426 |
| 1342 | Ga0501033_0058368 | 3300049570 | Bacteria | 2850 |
| 1343 | Ga0501033_0127471 | 3300049570 | Bacteria | 1845 |
| 1344 | Ga0501034_0108545 | 3300049571 | Bacteria | 2766 |
| 1345 | Ga0501034_0880013 | 3300049571 | Bacteria | 785 |
| 1346 | Ga0501036_0189107 | 3300049572 | Bacteria | 1732 |
| 1347 | Ga0501036_0718870 | 3300049572 | Bacteria | 825 |
| 1348 | Ga0501037_0046165 | 3300049573 | Bacteria | 3195 |
| 1349 | Ga0501038_0253946 | 3300049574 | Bacteria | 1392 |
| 1350 | Ga0501039_0717338 | 3300049575 | Bacteria | 781 |
| 1351 | Ga0501043_0007449 | 3300049579 | Bacteria | 8691 |
| 1352 | Ga0501043_0011321 | 3300049579 | Bacteria | 6982 |
| 1353 | Ga0501043_0059629 | 3300049579 | Bacteria | 2995 |
| 1354 | Ga0501043_0813160 | 3300049579 | Bacteria | 675 |
| 1355 | Ga0501046_0030557 | 3300049580 | Bacteria | 4371 |
| 1356 | Ga0501046_0269958 | 3300049580 | Bacteria | 1248 |
| 1357 | Ga0501047_0000795 | 3300049581 | Bacteria | 32971 |
| 1358 | Ga0501047_0277926 | 3300049581 | Bacteria | 1519 |
| 1359 | Ga0501047_0472231 | 3300049581 | Bacteria | 1082 |
| 1360 | Ga0501047_0701199 | 3300049581 | Bacteria | 830 |
| 1361 | Ga0501048_0086339 | 3300049582 | Bacteria | 2213 |
| 1362 | Ga0501067_0016919 | 3300049583 | Bacteria | 4029 |
| 1363 | Ga0501067_0060171 | 3300049583 | Bacteria | 2102 |
| 1364 | Ga0501070_0297898 | 3300049586 | Bacteria | 1314 |
| 1365 | Ga0501208_042684 | 3300049655 | Bacteria | 843 |
| 1366 | Ga0501223_000092 | 3300049663 | Bacteria | 26431 |
| 1367 | Ga0501224_010003 | 3300049664 | Bacteria | 1389 |
| 1368 | Ga0501235_014004 | 3300049669 | Bacteria | 1767 |
| 1369 | Ga0501235_034142 | 3300049669 | Bacteria | 1154 |
| 1370 | Ga0501249_001325 | 3300049679 | Bacteria | 5149 |
| 1371 | Ga0501257_087543 | 3300049686 | Bacteria | 808 |
| 1372 | Ga0501225_0009956 | 3300049705 | Bacteria | 2699 |
| 1373 | Ga0501225_0118260 | 3300049705 | Bacteria | 786 |
| 1374 | Ga0501245_127857 | 3300049708 | Bacteria | 542 |
| 1375 | Ga0501267_012879 | 3300049764 | Bacteria | 866 |
| 1376 | Ga0501035_0289634 | 3300049822 | Bacteria | 1382 |
| 1377 | Ga0501044_0013098 | 3300049823 | Bacteria | 8977 |
| 1378 | Ga0501044_0035147 | 3300049823 | Bacteria | 5250 |
| 1379 | Ga0501044_0044292 | 3300049823 | Bacteria | 4618 |
| 1380 | Ga0501044_0376795 | 3300049823 | Bacteria | 1335 |
| 1381 | Ga0501044_0401751 | 3300049823 | Bacteria | 1283 |
| 1382 | Ga0501044_0582299 | 3300049823 | Bacteria | 1013 |
| 1383 | nmdc:mga03683_126171_c1 | 3300050489 | Bacteria | 1142 |
| 1384 | nmdc:mga03683_276_c1 | 3300050489 | Bacteria | 15419 |
| 1385 | nmdc:mga03n38_89329_c1 | 3300050490 | Bacteria | 1464 |
| 1386 | nmdc:mga00v17_68256_c1 | 3300050491 | Bacteria | 2198 |
| 1387 | nmdc:mga00v17_81142_c1 | 3300050491 | Bacteria | 2025 |
| 1388 | nmdc:mga0k408_63396_c1 | 3300050493 | Bacteria | 2150 |
| 1389 | nmdc:mga06z11_134_c1 | 3300050494 | Bacteria | 29598 |
| 1390 | nmdc:mga06z11_85_c1 | 3300050494 | Bacteria | 39933 |
| 1391 | nmdc:mga07m45_12_c1 | 3300050496 | Bacteria | 158130 |
| 1392 | nmdc:mga05p37_324492_c1 | 3300050507 | Bacteria | 1821 |
| 1393 | nmdc:mga0n895_1010399_c1 | 3300050512 | Bacteria | 812 |
| 1394 | nmdc:mga0n895_1523631_c1 | 3300050512 | Bacteria | 634 |
| 1395 | nmdc:mga0rr50_135562_c1 | 3300050513 | Bacteria | 1975 |
| 1396 | nmdc:mga0rr50_141418_c1 | 3300050513 | Bacteria | 1936 |
| 1397 | nmdc:mga0sz30_10812_c2 | 3300050516 | Bacteria | 1345 |
| 1398 | nmdc:mga0sz30_11490_c1 | 3300050516 | Bacteria | 3420 |
| 1399 | Ga0500610_0000092 | 3300053079 | Bacteria | 27411 |
| 1400 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 1401 | Ga0500643_001742 | 3300053087 | Bacteria | 12055 |
| 1402 | Ga0500643_004433 | 3300053087 | Bacteria | 6350 |
| 1403 | Ga0500643_006129 | 3300053087 | Bacteria | 5074 |
| 1404 | Ga0500647_0042393 | 3300053091 | Bacteria | 2185 |
| 1405 | Ga0500651_0009774 | 3300053093 | Bacteria | 5721 |
| 1406 | Ga0500566_0005455 | 3300053094 | Bacteria | 7567 |
| 1407 | Ga0500562_003322 | 3300053108 | Bacteria | 4023 |
| 1408 | Ga0500592_005424 | 3300053116 | Bacteria | 2032 |
| 1409 | Ga0500592_019794 | 3300053116 | Bacteria | 1082 |
| 1410 | Ga0500594_0009825 | 3300053118 | Bacteria | 2210 |
| 1411 | Ga0500595_007737 | 3300053119 | Bacteria | 4442 |
| 1412 | Ga0500607_001489 | 3300053121 | Bacteria | 21049 |
| 1413 | Ga0500642_0000187 | 3300053130 | Bacteria | 25531 |
| 1414 | Ga0500642_0002784 | 3300053130 | Bacteria | 5187 |
| 1415 | Ga0500655_000107 | 3300053133 | Bacteria | 21512 |
| 1416 | Ga0500658_0034924 | 3300053134 | Bacteria | 1988 |
| 1417 | Ga0500559_0022339 | 3300053136 | Bacteria | 2683 |
| 1418 | Ga0500559_0046716 | 3300053136 | Bacteria | 1899 |
| 1419 | Ga0500564_027808 | 3300053138 | Bacteria | 2603 |
| 1420 | Ga0500568_0003230 | 3300053139 | Bacteria | 9223 |
| 1421 | Ga0500573_0000065 | 3300053140 | Bacteria | 64628 |
| 1422 | Ga0500616_0002096 | 3300053153 | Bacteria | 17390 |
| 1423 | Ga0500616_0051227 | 3300053153 | Bacteria | 2176 |
| 1424 | Ga0500619_024218 | 3300053154 | Bacteria | 1783 |
| 1425 | Ga0500622_0003412 | 3300053156 | Bacteria | 10669 |
| 1426 | Ga0500624_000002 | 3300053157 | Bacteria | 257900 |
| 1427 | Ga0500627_0000089 | 3300053158 | Bacteria | 30989 |
| 1428 | Ga0500636_0005106 | 3300053177 | Bacteria | 7457 |
| 1429 | Ga0500567_002040 | 3300053723 | Bacteria | 8449 |
| 1430 | Ga0500570_000192 | 3300053724 | Bacteria | 19388 |
| 1431 | Ga0500625_000026 | 3300053729 | Bacteria | 60801 |
| 1432 | Ga0500645_000024 | 3300053730 | Bacteria | 126024 |
| 1433 | Ga0500596_000659 | 3300053735 | Bacteria | 6672 |
| 1434 | Ga0466962_0013450 | 3300061719 | Bacteria | 3940 |
| 1435 | 2511130872 | 2510917021 | Bacteria | 5705459 |
| 1436 | 2512644588 | 2512564014 | Bacteria | 4639632 |
| 1437 | 2585261427 | 2582581305 | Bacteria | 4895574 |
| 1438 | 2643730797 | 2643221541 | Bacteria | 5498788 |
| 1439 | 2643819380 | 2643221560 | Bacteria | 4801179 |
| 1440 | 2643836094 | 2643221563 | Bacteria | 4726935 |
| 1441 | 2643951674 | 2643221588 | Bacteria | 3692460 |
| 1442 | 2644040797 | 2643221605 | Bacteria | 4772303 |
| 1443 | 2644044550 | 2643221606 | Bacteria | 5588032 |
| 1444 | 2644052571 | 2643221608 | Bacteria | 4724829 |
| 1445 | 2644391525 | 2643221671 | Bacteria | 5496681 |
| 1446 | 2739651109 | 2739367664 | Bacteria | 4114334 |
| 1447 | 2740029582 | 2739367865 | Bacteria | 4114482 |
| 1448 | 2778126675 | 2775507255 | Bacteria | 3945731 |
| 1449 | 2809062608 | 2808606401 | Bacteria | 4586670 |
| 1450 | 2809078708 | 2808606404 | Bacteria | 4652788 |
| 1451 | 2809082997 | 2808606405 | Bacteria | 4586632 |
| 1452 | 2819551416 | 2818991438 | Bacteria | 5793701 |
| 1453 | 2848298713 | 2848297114 | Bacteria | 3608511 |
| 1454 | 2852656068 | 2852653556 | Bacteria | 4050083 |
| 1455 | 2852683203 | 2852680915 | Bacteria | 4100189 |
| 1456 | 2880521586 | 2880518877 | Bacteria | 5012590 |
| 1457 | 2885432554 | 2885429604 | Bacteria | 3642894 |
| 1458 | 2895881321 | 2895880812 | Bacteria | 11255272 |
| 1459 | 2896253805 | 2896253425 | Bacteria | 3418029 |
| 1460 | 2919709521 | 2919709256 | Bacteria | 4318106 |
| 1461 | 2928029412 | 2928027323 | Bacteria | 4382488 |
| 1462 | 2946790184 | 2946787523 | Bacteria | 4366789 |
| 1463 | 2984556609 | 2984555340 | Bacteria | 4247089 |
| 1464 | 2984565218 | 2984564862 | Bacteria | 4339992 |
| 1465 | 2990265954 | 2990265787 | Bacteria | 3943888 |
| 1466 | 2993356294 | 2993356040 | Bacteria | 4247105 |
| 1467 | 2993696255 | 2993693658 | Bacteria | 4040749 |
| 1468 | 3000867203 | 3000865235 | Bacteria | 3106258 |
| 1469 | 8054305113 | 8054302542 | Bacteria | 5698134 |
| 1470 | 8057101585 | 8057101203 | Bacteria | 5034064 |
| 1471 | Ga0268265_10122506 | |||
| 1472 | SwRhRL2b_contig_1673102 | |||
| 1473 | SwRhRL2b_contig_1893398 | |||
| 1474 | SwRhRL2b_contig_67628 | |||
| 1475 | JGI24736J21556_1001983 | |||
| 1476 | JGI24736J21556_1005378 | |||
| 1477 | JGI24741J21665_1000122 | |||
| 1478 | JGI24741J21665_1039325 | |||
| 1479 | JGI24752J21851_1001492 | |||
| 1480 | JGI24747J21853_1004386 | |||
| 1481 | JGI24740J21852_10010138 | |||
| 1482 | JGI24740J21852_10025066 | |||
| 1483 | JGI24740J21852_10046169 | |||
| 1484 | JGI24740J21852_10074931 | |||
| 1485 | JGI24740J21852_10082943 | |||
| 1486 | JGI24739J22299_10000391 | |||
| 1487 | JGI24739J22299_10002839 | |||
| 1488 | JGI24739J22299_10003277 | |||
| 1489 | JGI24739J22299_10008673 | |||
| 1490 | JGI24739J22299_10010024 | |||
| 1491 | JGI24739J22299_10020971 | |||
| 1492 | JGI24737J22298_10001243 | |||
| 1493 | JGI24737J22298_10004308 | |||
| 1494 | JGI24737J22298_10042356 | |||
| 1495 | JGI24737J22298_10050139 | |||
| 1496 | JGI24743J22301_10019238 | |||
| 1497 | JGI24735J21928_10002241 | |||
| 1498 | JGI24735J21928_10004078 | |||
| 1499 | JGI24735J21928_10007186 | |||
| 1500 | JGI24735J21928_10026692 | |||
| 1501 | JGI24735J21928_10043417 | |||
| 1502 | JGI24735J21928_10192644 | |||
| 1503 | JGI24738J21930_10000436 | |||
| 1504 | JGI24738J21930_10011972 | |||
| 1505 | JGI24738J21930_10022102 | |||
| 1506 | JGI24738J21930_10052632 | |||
| 1507 | JGI24749J21850_1000069 | |||
| 1508 | JGI24744J21845_10007524 | |||
| 1509 | JGI24744J21845_10038565 | |||
| 1510 | JGI24742J22300_10039055 | |||
| 1511 | JGI24751J29686_10000391 | |||
| 1512 | JGI24751J29686_10037791 | |||
| 1513 | JGI25165J46597_1000071 | |||
| 1514 | JGI25153J46596_10000007 | |||
| 1515 | rootH2_10174559 | |||
| 1516 | rootH1_10040862 | |||
| 1517 | rootH1_10162866 | |||
| 1518 | Ga0055525_1000127 | |||
| 1519 | Ga0055542_1000038 | |||
| 1520 | Ga0055542_1001654 | |||
| 1521 | Ga0055529_1000002 | |||
| 1522 | Ga0055529_1000021 | |||
| 1523 | Ga0055536_1003088 | |||
| 1524 | Ga0055536_1006967 | |||
| 1525 | Ga0055534_1008222 | |||
| 1526 | Ga0055530_10000048 | |||
| 1527 | Ga0055530_10011789 | |||
| 1528 | Ga0055531_10000929 | |||
| 1529 | Ga0055531_10004331 | |||
| 1530 | Ga0065165_1004328 | |||
| 1531 | Ga0065165_1053500 | |||
| 1532 | Ga0065704_10070193 | |||
| 1533 | Ga0065704_10094687 | |||
| 1534 | Ga0065704_10127076 | |||
| 1535 | Ga0065704_10173616 | |||
| 1536 | Ga0065715_10007711 | |||
| 1537 | Ga0065707_10081811 | |||
| 1538 | Ga0065707_10105390 | |||
| 1539 | Ga0065707_10260882 | |||
| 1540 | Ga0070658_10000377 | |||
| 1541 | Ga0070658_10000716 | |||
| 1542 | Ga0070658_10003584 | |||
| 1543 | Ga0070658_10003723 | |||
| 1544 | Ga0070658_10004008 | |||
| 1545 | Ga0070658_10007308 | |||
| 1546 | Ga0070658_10021861 | |||
| 1547 | Ga0070658_10075150 | |||
| 1548 | Ga0070658_10153726 | |||
| 1549 | Ga0070676_10001215 | |||
| 1550 | Ga0070676_10005501 | |||
| 1551 | Ga0070676_10176436 | |||
| 1552 | Ga0070676_10652559 | |||
| 1553 | Ga0070683_100001819 | |||
| 1554 | Ga0070683_100018052 | |||
| 1555 | Ga0070683_100168475 | |||
| 1556 | Ga0070690_100128620 | |||
| 1557 | Ga0070670_100000027 | |||
| 1558 | Ga0070670_100000047 | |||
| 1559 | Ga0070670_100012449 | |||
| 1560 | Ga0070670_100042597 | |||
| 1561 | Ga0070670_100302451 | |||
| 1562 | Ga0070670_100775340 | |||
| 1563 | Ga0070677_10000079 | |||
| 1564 | Ga0070677_10011544 | |||
| 1565 | Ga0070677_10034331 | |||
| 1566 | Ga0068869_100000031 | |||
| 1567 | Ga0070666_10000779 | |||
| 1568 | Ga0070666_10054458 | |||
| 1569 | Ga0070666_10093259 | |||
| 1570 | Ga0070666_10581678 | |||
| 1571 | Ga0070680_100000177 | |||
| 1572 | Ga0070680_100003469 | |||
| 1573 | Ga0070680_100245996 | |||
| 1574 | Ga0070680_100602927 | |||
| 1575 | Ga0070682_100058066 | |||
| 1576 | Ga0070682_100128504 | |||
| 1577 | Ga0070682_101075427 | |||
| 1578 | Ga0068868_100000060 | |||
| 1579 | Ga0068868_100058542 | |||
| 1580 | Ga0068868_100192305 | |||
| 1581 | Ga0068868_100202519 | |||
| 1582 | Ga0070660_100000751 | |||
| 1583 | Ga0070660_100000986 | |||
| 1584 | Ga0070660_100002934 | |||
| 1585 | Ga0070660_100005512 | |||
| 1586 | Ga0070660_100009089 | |||
| 1587 | Ga0070660_100016075 | |||
| 1588 | Ga0070660_100024083 | |||
| 1589 | Ga0070660_100111630 | |||
| 1590 | Ga0070660_100273648 | |||
| 1591 | Ga0070660_100347733 | |||
| 1592 | Ga0070687_100111831 | |||
| 1593 | Ga0070687_100150704 | |||
| 1594 | Ga0070661_100000156 | |||
| 1595 | Ga0070661_100000187 | |||
| 1596 | Ga0070661_100006527 | |||
| 1597 | Ga0070661_100021041 | |||
| 1598 | Ga0070661_100032184 | |||
| 1599 | Ga0070661_100036795 | |||
| 1600 | Ga0070661_100069996 | |||
| 1601 | Ga0070661_100284668 | |||
| 1602 | Ga0070661_100726035 | |||
| 1603 | Ga0070692_10033345 | |||
| 1604 | Ga0070692_10268070 | |||
| 1605 | Ga0070668_100016101 | |||
| 1606 | Ga0070668_100018871 | |||
| 1607 | Ga0070668_100033002 | |||
| 1608 | Ga0070668_100078104 | |||
| 1609 | Ga0070668_100089092 | |||
| 1610 | Ga0070668_100100733 | |||
| 1611 | Ga0070668_100114109 | |||
| 1612 | Ga0070668_100125621 | |||
| 1613 | Ga0070668_100167545 | |||
| 1614 | Ga0070669_100000072 | |||
| 1615 | Ga0070669_100000470 | |||
| 1616 | Ga0070669_100030653 | |||
| 1617 | Ga0070669_100075371 | |||
| 1618 | Ga0070669_100133445 | |||
| 1619 | Ga0070669_100147500 | |||
| 1620 | Ga0070669_100177785 | |||
| 1621 | Ga0070669_100660071 | |||
| 1622 | Ga0070675_100005311 | |||
| 1623 | Ga0070675_100014931 | |||
| 1624 | Ga0070675_100246966 | |||
| 1625 | Ga0070671_100000845 | |||
| 1626 | Ga0070671_100039002 | |||
| 1627 | Ga0070671_100054381 | |||
| 1628 | Ga0070671_100080339 | |||
| 1629 | Ga0070671_100241581 | |||
| 1630 | Ga0070671_100352852 | |||
| 1631 | Ga0070671_100489394 | |||
| 1632 | Ga0070674_100000209 | |||
| 1633 | Ga0070674_100027045 | |||
| 1634 | Ga0070674_100127342 | |||
| 1635 | Ga0070673_100000009 | |||
| 1636 | Ga0070673_100031597 | |||
| 1637 | Ga0070673_100226433 | |||
| 1638 | Ga0070673_100658848 | |||
| 1639 | Ga0070659_100000191 | |||
| 1640 | Ga0070659_100017756 | |||
| 1641 | Ga0070659_100033034 | |||
| 1642 | Ga0070659_100039493 | |||
| 1643 | Ga0070659_100043632 | |||
| 1644 | Ga0070659_100066651 | |||
| 1645 | Ga0070659_100067036 | |||
| 1646 | Ga0070659_100423186 | |||
| 1647 | Ga0070659_100448781 | |||
| 1648 | Ga0070667_100000143 | |||
| 1649 | Ga0070667_100000286 | |||
| 1650 | Ga0070667_100000367 | |||
| 1651 | Ga0070667_100000725 | |||
| 1652 | Ga0070667_100034211 | |||
| 1653 | Ga0070667_100038587 | |||
| 1654 | Ga0070667_100265935 | |||
| 1655 | Ga0070667_100533049 | |||
| 1656 | Ga0070709_10016498 | |||
| 1657 | Ga0070714_100011330 | |||
| 1658 | Ga0070714_100156723 | |||
| 1659 | Ga0070713_100064528 | |||
| 1660 | Ga0070713_100087188 | |||
| 1661 | Ga0070713_100165627 | |||
| 1662 | Ga0070694_100086015 | |||
| 1663 | Ga0070663_100004783 | |||
| 1664 | Ga0070663_100008779 | |||
| 1665 | Ga0070663_100046160 | |||
| 1666 | Ga0070663_100083683 | |||
| 1667 | Ga0070663_100236458 | |||
| 1668 | Ga0070663_100377050 | |||
| 1669 | Ga0070678_100001063 | |||
| 1670 | Ga0070678_100033684 | |||
| 1671 | Ga0070678_100299879 | |||
| 1672 | Ga0070678_100334470 | |||
| 1673 | Ga0070662_100000012 | |||
| 1674 | Ga0070662_100001324 | |||
| 1675 | Ga0070662_100001565 | |||
| 1676 | Ga0070662_100002043 | |||
| 1677 | Ga0070662_100026436 | |||
| 1678 | Ga0070662_100049752 | |||
| 1679 | Ga0070662_100165319 | |||
| 1680 | Ga0070662_100827040 | |||
| 1681 | Ga0070681_10006366 | |||
| 1682 | Ga0070681_10010175 | |||
| 1683 | Ga0068867_100000002 | |||
| 1684 | Ga0068867_100006572 | |||
| 1685 | Ga0068867_100071011 | |||
| 1686 | Ga0068867_100133018 | |||
| 1687 | Ga0070685_10077284 | |||
| 1688 | Ga0070679_100000001 | |||
| 1689 | Ga0070679_100005339 | |||
| 1690 | Ga0070679_100006705 | |||
| 1691 | Ga0070679_100080732 | |||
| 1692 | Ga0070679_100100254 | |||
| 1693 | Ga0070679_100589659 | |||
| 1694 | Ga0070684_100009174 | |||
| 1695 | Ga0070684_100559518 | |||
| 1696 | Ga0068853_100000032 | |||
| 1697 | Ga0068853_100003550 | |||
| 1698 | Ga0068853_100014991 | |||
| 1699 | Ga0068853_100065019 | |||
| 1700 | Ga0068853_100174373 | |||
| 1701 | Ga0070672_100224484 | |||
| 1702 | Ga0070672_100643002 | |||
| 1703 | Ga0070695_100100790 | |||
| 1704 | Ga0070693_100000332 | |||
| 1705 | Ga0070693_100036501 | |||
| 1706 | Ga0070665_100000079 | |||
| 1707 | Ga0070665_100000084 | |||
| 1708 | Ga0070665_100003604 | |||
| 1709 | Ga0070665_100012237 | |||
| 1710 | Ga0070665_100034424 | |||
| 1711 | Ga0070665_100080538 | |||
| 1712 | Ga0068855_100000591 | |||
| 1713 | Ga0068855_100001164 | |||
| 1714 | Ga0068855_100007295 | |||
| 1715 | Ga0068855_100018573 | |||
| 1716 | Ga0068855_100032731 | |||
| 1717 | Ga0068855_100034640 | |||
| 1718 | Ga0068855_100095837 | |||
| 1719 | Ga0068855_100153975 | |||
| 1720 | Ga0068855_100245833 | |||
| 1721 | Ga0068855_100449134 | |||
| 1722 | Ga0068855_100789685 | |||
| 1723 | Ga0070664_100000187 | |||
| 1724 | Ga0070664_100002928 | |||
| 1725 | Ga0070664_100016865 | |||
| 1726 | Ga0070664_100025790 | |||
| 1727 | Ga0070664_100073402 | |||
| 1728 | Ga0070664_100177595 | |||
| 1729 | Ga0070664_100767854 | |||
| 1730 | Ga0068857_100007902 | |||
| 1731 | Ga0068857_100190219 | |||
| 1732 | Ga0068857_100436038 | |||
| 1733 | Ga0068857_100542997 | |||
| 1734 | Ga0068854_100003204 | |||
| 1735 | Ga0068854_100007226 | |||
| 1736 | Ga0068854_100026804 | |||
| 1737 | Ga0068854_100090117 | |||
| 1738 | Ga0068854_100111295 | |||
| 1739 | Ga0068854_100112344 | |||
| 1740 | Ga0068854_100252199 | |||
| 1741 | Ga0068854_100336372 | |||
| 1742 | Ga0068854_100552291 | |||
| 1743 | Ga0068856_100000291 | |||
| 1744 | Ga0068856_100005719 | |||
| 1745 | Ga0068856_100143419 | |||
| 1746 | Ga0068852_100000906 | |||
| 1747 | Ga0068852_100001541 | |||
| 1748 | Ga0068852_100058362 | |||
| 1749 | Ga0068852_100137652 | |||
| 1750 | Ga0068852_100476231 | |||
| 1751 | Ga0068852_100647544 | |||
| 1752 | Ga0068852_101080088 | |||
| 1753 | Ga0068859_100008247 | |||
| 1754 | Ga0068859_100090073 | |||
| 1755 | Ga0068859_100310836 | |||
| 1756 | Ga0068859_100603103 | |||
| 1757 | Ga0068864_100000051 | |||
| 1758 | Ga0068864_100000100 | |||
| 1759 | Ga0068864_100034890 | |||
| 1760 | Ga0068864_100104055 | |||
| 1761 | Ga0068864_100113092 | |||
| 1762 | Ga0068866_10096709 | |||
| 1763 | Ga0068861_100038439 | |||
| 1764 | Ga0068851_10010180 | |||
| 1765 | Ga0068851_10019263 | |||
| 1766 | Ga0068851_10019743 | |||
| 1767 | Ga0068851_10090672 | |||
| 1768 | Ga0068851_10096921 | |||
| 1769 | Ga0068851_10335431 | |||
| 1770 | Ga0068870_10039947 | |||
| 1771 | Ga0068870_10262608 | |||
| 1772 | Ga0068863_100000025 | |||
| 1773 | Ga0068863_100000168 | |||
| 1774 | Ga0068863_100001489 | |||
| 1775 | Ga0068863_100058470 | |||
| 1776 | Ga0068863_100081951 | |||
| 1777 | Ga0068863_100193604 | |||
| 1778 | Ga0068858_100000673 | |||
| 1779 | Ga0068858_100000848 | |||
| 1780 | Ga0068858_100023512 | |||
| 1781 | Ga0068858_100043159 | |||
| 1782 | Ga0068858_100052186 | |||
| 1783 | Ga0068858_100071318 | |||
| 1784 | Ga0068858_100665973 | |||
| 1785 | Ga0068860_100000181 | |||
| 1786 | Ga0068860_100027199 | |||
| 1787 | Ga0068860_100067993 | |||
| 1788 | Ga0068860_100096161 | |||
| 1789 | Ga0068860_100166266 | |||
| 1790 | Ga0068862_100000027 | |||
| 1791 | Ga0068862_100000036 | |||
| 1792 | Ga0068862_100004531 | |||
| 1793 | Ga0068862_100024495 | |||
| 1794 | Ga0068862_100386147 | |||
| 1795 | Ga0068862_100431342 | |||
| 1796 | Ga0068862_100749193 | |||
| 1797 | Ga0081540_1099998 | |||
| 1798 | Ga0081539_10008794 | |||
| 1799 | Ga0081539_10019519 | |||
| 1800 | Ga0070717_10004794 | |||
| 1801 | Ga0070717_10109103 | |||
| 1802 | Ga0075368_10000304 | |||
| 1803 | Ga0075368_10000450 | |||
| 1804 | Ga0075363_100093715 | |||
| 1805 | Ga0075364_10341720 | |||
| 1806 | Ga0070716_100017029 | |||
| 1807 | Ga0070716_100129508 | |||
| 1808 | Ga0070712_100043513 | |||
| 1809 | Ga0070712_100203183 | |||
| 1810 | Ga0075362_10001064 | |||
| 1811 | Ga0075362_10034007 | |||
| 1812 | Ga0075367_10007487 | |||
| 1813 | Ga0075367_10022925 | |||
| 1814 | Ga0075369_10005423 | |||
| 1815 | Ga0075369_10096406 | |||
| 1816 | Ga0075366_10087603 | |||
| 1817 | Ga0097621_100001876 | |||
| 1818 | Ga0097621_100081758 | |||
| 1819 | Ga0097621_100104675 | |||
| 1820 | Ga0097621_100202373 | |||
| 1821 | Ga0097621_100244043 | |||
| 1822 | Ga0097621_100397715 | |||
| 1823 | Ga0068871_100007505 | |||
| 1824 | Ga0068871_100062791 | |||
| 1825 | Ga0068871_100120505 | |||
| 1826 | Ga0068871_100224978 | |||
| 1827 | Ga0068871_100672249 | |||
| 1828 | Ga0075429_100129397 | |||
| 1829 | Ga0068865_100000014 | |||
| 1830 | Ga0068865_100073741 | |||
| 1831 | Ga0068865_100830307 | |||
| 1832 | Ga0097620_100008247 | |||
| 1833 | Ga0097620_100024043 | |||
| 1834 | Ga0097620_100090076 | |||
| 1835 | Ga0097620_100310844 | |||
| 1836 | Ga0097620_100603134 | |||
| 1837 | Ga0079104_1016890 | |||
| 1838 | Ga0079104_1030833 | |||
| 1839 | Ga0105251_10000232 | |||
| 1840 | Ga0105251_10000554 | |||
| 1841 | Ga0105251_10030739 | |||
| 1842 | Ga0105251_10127682 | |||
| 1843 | Ga0105250_10127622 | |||
| 1844 | Ga0105240_10108042 | |||
| 1845 | Ga0105240_10163937 | |||
| 1846 | Ga0105240_10243049 | |||
| 1847 | Ga0105240_10292795 | |||
| 1848 | Ga0105240_11331320 | |||
| 1849 | Ga0105245_10000160 | |||
| 1850 | Ga0105245_10013224 | |||
| 1851 | Ga0105245_10018347 | |||
| 1852 | Ga0105247_10057877 | |||
| 1853 | Ga0114129_10257351 | |||
| 1854 | Ga0105243_10000070 | |||
| 1855 | Ga0105243_10005193 | |||
| 1856 | Ga0105243_10055563 | |||
| 1857 | Ga0105243_10130908 | |||
| 1858 | Ga0105243_10229689 | |||
| 1859 | Ga0105243_10745781 | |||
| 1860 | Ga0105241_10030368 | |||
| 1861 | Ga0105241_10077362 | |||
| 1862 | Ga0105241_10158703 | |||
| 1863 | Ga0105241_10266923 | |||
| 1864 | Ga0105241_10762377 | |||
| 1865 | Ga0105242_10001604 | |||
| 1866 | Ga0105242_10188683 | |||
| 1867 | Ga0105248_10000083 | |||
| 1868 | Ga0105248_10001385 | |||
| 1869 | Ga0105248_10002034 | |||
| 1870 | Ga0105248_10023944 | |||
| 1871 | Ga0105248_10024368 | |||
| 1872 | Ga0105248_10032701 | |||
| 1873 | Ga0105248_10091313 | |||
| 1874 | Ga0105248_10155436 | |||
| 1875 | Ga0105248_10354956 | |||
| 1876 | Ga0105237_10005695 | |||
| 1877 | Ga0105237_10017062 | |||
| 1878 | Ga0105237_10097580 | |||
| 1879 | Ga0105237_10215362 | |||
| 1880 | Ga0105238_10015678 | |||
| 1881 | Ga0105238_10024071 | |||
| 1882 | Ga0105238_10116826 | |||
| 1883 | Ga0105238_10173208 | |||
| 1884 | Ga0105238_10373185 | |||
| 1885 | Ga0105238_11024103 | |||
| 1886 | Ga0105238_11607096 | |||
| 1887 | Ga0105249_10000110 | |||
| 1888 | Ga0105249_10015328 | |||
| 1889 | Ga0105249_10096719 | |||
| 1890 | Ga0105249_10201195 | |||
| 1891 | Ga0105249_10433131 | |||
| 1892 | Ga0105249_11029498 | |||
| 1893 | Ga0105148_100275 | |||
| 1894 | Ga0105148_117869 | |||
| 1895 | Ga0105147_101564 | |||
| 1896 | Ga0105239_10000271 | |||
| 1897 | Ga0105239_10102466 | |||
| 1898 | Ga0105239_10110863 | |||
| 1899 | Ga0105239_10147805 | |||
| 1900 | Ga0105239_11069256 | |||
| 1901 | Ga0105239_11248926 | |||
| 1902 | Ga0105246_10002314 | |||
| 1903 | Ga0105246_10003501 | |||
| 1904 | Ga0105246_10008646 | |||
| 1905 | Ga0105246_10080366 | |||
| 1906 | Ga0157326_1000005 | |||
| 1907 | Ga0157326_1003871 | |||
| 1908 | Ga0157373_10006989 | |||
| 1909 | Ga0157373_10029859 | |||
| 1910 | Ga0157373_10039126 | |||
| 1911 | Ga0157373_10147818 | |||
| 1912 | Ga0157373_10231884 | |||
| 1913 | Ga0157373_10476278 | |||
| 1914 | Ga0157373_10671609 | |||
| 1915 | Ga0157371_10000011 | |||
| 1916 | Ga0157371_10001091 | |||
| 1917 | Ga0157371_10007915 | |||
| 1918 | Ga0157371_10077146 | |||
| 1919 | Ga0157371_10167994 | |||
| 1920 | Ga0157371_10203577 | |||
| 1921 | Ga0157371_10235898 | |||
| 1922 | Ga0157371_10606890 | |||
| 1923 | Ga0157371_10608377 | |||
| 1924 | Ga0157370_10002905 | |||
| 1925 | Ga0157370_11001809 | |||
| 1926 | Ga0157369_10021625 | |||
| 1927 | Ga0157369_10157781 | |||
| 1928 | Ga0157369_10780179 | |||
| 1929 | Ga0157374_10000542 | |||
| 1930 | Ga0157374_10186177 | |||
| 1931 | Ga0157374_10244501 | |||
| 1932 | Ga0157374_10389936 | |||
| 1933 | Ga0157374_10836077 | |||
| 1934 | Ga0157378_10000624 | |||
| 1935 | Ga0157378_10021072 | |||
| 1936 | Ga0157378_10060444 | |||
| 1937 | Ga0157378_11306933 | |||
| 1938 | Ga0163162_10009970 | |||
| 1939 | Ga0163162_10015197 | |||
| 1940 | Ga0163162_10305478 | |||
| 1941 | Ga0163162_10335390 | |||
| 1942 | Ga0163162_10363202 | |||
| 1943 | Ga0157372_10008443 | |||
| 1944 | Ga0157372_10093707 | |||
| 1945 | Ga0157372_10293339 | |||
| 1946 | Ga0157372_11391257 | |||
| 1947 | Ga0157375_10027717 | |||
| 1948 | Ga0157375_10090533 | |||
| 1949 | Ga0163163_10001064 | |||
| 1950 | Ga0163163_10006906 | |||
| 1951 | Ga0163163_10015984 | |||
| 1952 | Ga0157380_10000315 | |||
| 1953 | Ga0157380_10000763 | |||
| 1954 | Ga0157380_10022724 | |||
| 1955 | Ga0157380_10113655 | |||
| 1956 | Ga0157380_10194137 | |||
| 1957 | Ga0157380_10410985 | |||
| 1958 | Ga0182008_10126272 | |||
| 1959 | Ga0157377_10037303 | |||
| 1960 | Ga0157377_10271498 | |||
| 1961 | Ga0157379_10003811 | |||
| 1962 | Ga0157379_10104620 | |||
| 1963 | Ga0157379_10702359 | |||
| 1964 | Ga0157376_10000096 | |||
| 1965 | Ga0183363_1003 | |||
| 1966 | Ga0163161_10044190 | |||
| 1967 | Ga0163161_10046559 | |||
| 1968 | Ga0163161_10106148 | |||
| 1969 | Ga0163161_10107867 | |||
| 1970 | Ga0163161_10295126 | |||
| 1971 | Ga0209147_100298 | |||
| 1972 | Ga0209563_100125 | |||
| 1973 | Ga0209148_1000008 | |||
| 1974 | Ga0209148_1000147 | |||
| 1975 | Ga0209148_1002428 | |||
| 1976 | Ga0209233_1000140 | |||
| 1977 | Ga0209233_1027364 | |||
| 1978 | Ga0209455_1000002 | |||
| 1979 | Ga0209455_1000707 | |||
| 1980 | Ga0209455_1009390 | |||
| 1981 | Ga0209675_1000181 | |||
| 1982 | Ga0209676_1000084 | |||
| 1983 | Ga0209676_1000330 | |||
| 1984 | Ga0209676_1000479 | |||
| 1985 | Ga0209676_1032030 | |||
| 1986 | Ga0209025_1022687 | |||
| 1987 | Ga0209758_1000017 | |||
| 1988 | Ga0209050_1000113 | |||
| 1989 | Ga0209050_1000254 | |||
| 1990 | Ga0209050_1001453 | |||
| 1991 | Ga0209050_1048216 | |||
| 1992 | Ga0209257_1000083 | |||
| 1993 | Ga0209257_1000126 | |||
| 1994 | Ga0209257_1000340 | |||
| 1995 | Ga0209257_1001209 | |||
| 1996 | Ga0209257_1053361 | |||
| 1997 | Ga0207697_10035799 | |||
| 1998 | Ga0207697_10047244 | |||
| 1999 | Ga0207697_10077367 | |||
| 2000 | Ga0207697_10084306 | |||
| 2001 | Ga0207697_10211268 | |||
| 2002 | Ga0207656_10001253 | |||
| 2003 | Ga0207656_10034991 | |||
| 2004 | Ga0207656_10069520 | |||
| 2005 | Ga0207656_10079265 | |||
| 2006 | Ga0207656_10196397 | |||
| 2007 | Ga0207713_1000615 | |||
| 2008 | Ga0207713_1001012 | |||
| 2009 | Ga0207713_1060220 | |||
| 2010 | Ga0207682_10000542 | |||
| 2011 | Ga0207682_10035626 | |||
| 2012 | Ga0207642_10064108 | |||
| 2013 | Ga0207688_10067605 | |||
| 2014 | Ga0207688_10145818 | |||
| 2015 | Ga0207688_10148226 | |||
| 2016 | Ga0207688_10198933 | |||
| 2017 | Ga0207680_10001307 | |||
| 2018 | Ga0207680_10053944 | |||
| 2019 | Ga0207680_10555348 | |||
| 2020 | Ga0207647_10000389 | |||
| 2021 | Ga0207647_10000850 | |||
| 2022 | Ga0207647_10019227 | |||
| 2023 | Ga0207647_10041178 | |||
| 2024 | Ga0207647_10084197 | |||
| 2025 | Ga0207647_10085879 | |||
| 2026 | Ga0207645_10000470 | |||
| 2027 | Ga0207645_10008376 | |||
| 2028 | Ga0207645_10030439 | |||
| 2029 | Ga0207645_10044108 | |||
| 2030 | Ga0207645_10208853 | |||
| 2031 | Ga0207643_10033802 | |||
| 2032 | Ga0207705_10000042 | |||
| 2033 | Ga0207705_10000072 | |||
| 2034 | Ga0207705_10000236 | |||
| 2035 | Ga0207705_10007727 | |||
| 2036 | Ga0207705_10009210 | |||
| 2037 | Ga0207705_10018377 | |||
| 2038 | Ga0207705_10028048 | |||
| 2039 | Ga0207705_10093631 | |||
| 2040 | Ga0207705_10151259 | |||
| 2041 | Ga0207705_10318355 | |||
| 2042 | Ga0207705_10479483 | |||
| 2043 | Ga0207654_10000246 | |||
| 2044 | Ga0207654_10159335 | |||
| 2045 | Ga0207654_10230549 | |||
| 2046 | Ga0207654_10480107 | |||
| 2047 | Ga0207707_10006710 | |||
| 2048 | Ga0207707_10047954 | |||
| 2049 | Ga0207695_10005291 | |||
| 2050 | Ga0207695_10124680 | |||
| 2051 | Ga0207695_11005375 | |||
| 2052 | Ga0207671_10000955 | |||
| 2053 | Ga0207671_10044155 | |||
| 2054 | Ga0207693_10014544 | |||
| 2055 | Ga0207693_10053263 | |||
| 2056 | Ga0207660_10001102 | |||
| 2057 | Ga0207657_10000176 | |||
| 2058 | Ga0207657_10000764 | |||
| 2059 | Ga0207657_10000837 | |||
| 2060 | Ga0207657_10000900 | |||
| 2061 | Ga0207657_10003875 | |||
| 2062 | Ga0207657_10005081 | |||
| 2063 | Ga0207657_10008183 | |||
| 2064 | Ga0207657_10009556 | |||
| 2065 | Ga0207657_10024081 | |||
| 2066 | Ga0207657_10027473 | |||
| 2067 | Ga0207657_10164063 | |||
| 2068 | Ga0207657_10434088 | |||
| 2069 | Ga0207649_10000027 | |||
| 2070 | Ga0207649_10000810 | |||
| 2071 | Ga0207649_10002323 | |||
| 2072 | Ga0207649_10005378 | |||
| 2073 | Ga0207649_10086734 | |||
| 2074 | Ga0207649_10199137 | |||
| 2075 | Ga0207649_10388902 | |||
| 2076 | Ga0207652_10000003 | |||
| 2077 | Ga0207652_10000489 | |||
| 2078 | Ga0207652_10027113 | |||
| 2079 | Ga0207652_10035093 | |||
| 2080 | Ga0207652_10068878 | |||
| 2081 | Ga0207652_10181942 | |||
| 2082 | Ga0207652_10378410 | |||
| 2083 | Ga0207681_10000061 | |||
| 2084 | Ga0207681_10002744 | |||
| 2085 | Ga0207681_10005152 | |||
| 2086 | Ga0207681_10090692 | |||
| 2087 | Ga0207681_10131345 | |||
| 2088 | Ga0207681_10254450 | |||
| 2089 | Ga0207694_10005386 | |||
| 2090 | Ga0207694_10036581 | |||
| 2091 | Ga0207694_10098020 | |||
| 2092 | Ga0207694_10443780 | |||
| 2093 | Ga0207694_10822103 | |||
| 2094 | Ga0207694_10905958 | |||
| 2095 | Ga0207650_10000056 | |||
| 2096 | Ga0207650_10000645 | |||
| 2097 | Ga0207650_10007357 | |||
| 2098 | Ga0207650_10034652 | |||
| 2099 | Ga0207650_10071175 | |||
| 2100 | Ga0207650_10137220 | |||
| 2101 | Ga0207659_10011390 | |||
| 2102 | Ga0207659_10069623 | |||
| 2103 | Ga0207659_10137601 | |||
| 2104 | Ga0207659_10783826 | |||
| 2105 | Ga0207687_10000252 | |||
| 2106 | Ga0207687_10000892 | |||
| 2107 | Ga0207687_10059042 | |||
| 2108 | Ga0207700_10032777 | |||
| 2109 | Ga0207700_10255321 | |||
| 2110 | Ga0207664_10149793 | |||
| 2111 | Ga0207664_10509315 | |||
| 2112 | Ga0207644_10018835 | |||
| 2113 | Ga0207644_10026256 | |||
| 2114 | Ga0207644_10059655 | |||
| 2115 | Ga0207644_10063814 | |||
| 2116 | Ga0207644_10190814 | |||
| 2117 | Ga0207644_10200922 | |||
| 2118 | Ga0207690_10000245 | |||
| 2119 | Ga0207690_10000630 | |||
| 2120 | Ga0207690_10001503 | |||
| 2121 | Ga0207690_10022521 | |||
| 2122 | Ga0207690_10071040 | |||
| 2123 | Ga0207690_10083137 | |||
| 2124 | Ga0207690_10171137 | |||
| 2125 | Ga0207690_10198124 | |||
| 2126 | Ga0207690_10227900 | |||
| 2127 | Ga0207690_10229078 | |||
| 2128 | Ga0207690_10244142 | |||
| 2129 | Ga0207690_10259225 | |||
| 2130 | Ga0207690_10390236 | |||
| 2131 | Ga0207690_10645490 | |||
| 2132 | Ga0207690_10798539 | |||
| 2133 | Ga0207690_10934350 | |||
| 2134 | Ga0207706_10000041 | |||
| 2135 | Ga0207706_10001361 | |||
| 2136 | Ga0207706_10009320 | |||
| 2137 | Ga0207706_10021878 | |||
| 2138 | Ga0207706_10028567 | |||
| 2139 | Ga0207706_10032833 | |||
| 2140 | Ga0207706_10327574 | |||
| 2141 | Ga0207706_10401387 | |||
| 2142 | Ga0207686_10002334 | |||
| 2143 | Ga0207686_10048837 | |||
| 2144 | Ga0207709_10000066 | |||
| 2145 | Ga0207709_10000116 | |||
| 2146 | Ga0207709_10018879 | |||
| 2147 | Ga0207709_10033589 | |||
| 2148 | Ga0207709_10183311 | |||
| 2149 | Ga0207669_10000022 | |||
| 2150 | Ga0207669_10015833 | |||
| 2151 | Ga0207669_10062042 | |||
| 2152 | Ga0207669_10101776 | |||
| 2153 | Ga0207669_10113323 | |||
| 2154 | Ga0207704_10000002 | |||
| 2155 | Ga0207704_10000007 | |||
| 2156 | Ga0207704_10054761 | |||
| 2157 | Ga0207704_10164991 | |||
| 2158 | Ga0207704_10183549 | |||
| 2159 | Ga0207665_10013175 | |||
| 2160 | Ga0207691_10010000 | |||
| 2161 | Ga0207691_10017215 | |||
| 2162 | Ga0207691_10513215 | |||
| 2163 | Ga0207691_10519937 | |||
| 2164 | Ga0207711_10000254 | |||
| 2165 | Ga0207711_10002858 | |||
| 2166 | Ga0207711_10019188 | |||
| 2167 | Ga0207711_10033796 | |||
| 2168 | Ga0207711_10043144 | |||
| 2169 | Ga0207711_11183716 | |||
| 2170 | Ga0207689_10000060 | |||
| 2171 | Ga0207689_10003854 | |||
| 2172 | Ga0207689_10156309 | |||
| 2173 | Ga0207661_10000953 | |||
| 2174 | Ga0207661_10019161 | |||
| 2175 | Ga0207679_10000243 | |||
| 2176 | Ga0207679_10006441 | |||
| 2177 | Ga0207679_10016805 | |||
| 2178 | Ga0207679_10025671 | |||
| 2179 | Ga0207679_10049249 | |||
| 2180 | Ga0207679_10062972 | |||
| 2181 | Ga0207679_10094259 | |||
| 2182 | Ga0207679_10206807 | |||
| 2183 | Ga0207679_10728949 | |||
| 2184 | Ga0207667_10000001 | |||
| 2185 | Ga0207667_10000017 | |||
| 2186 | Ga0207667_10006092 | |||
| 2187 | Ga0207667_10007578 | |||
| 2188 | Ga0207667_10017260 | |||
| 2189 | Ga0207667_10017604 | |||
| 2190 | Ga0207667_10028549 | |||
| 2191 | Ga0207667_10031849 | |||
| 2192 | Ga0207667_10033839 | |||
| 2193 | Ga0207667_10064139 | |||
| 2194 | Ga0207667_10201249 | |||
| 2195 | Ga0207667_11003548 | |||
| 2196 | Ga0207651_10000004 | |||
| 2197 | Ga0207651_10099174 | |||
| 2198 | Ga0207651_10201365 | |||
| 2199 | Ga0207651_10501208 | |||
| 2200 | Ga0207651_10557147 | |||
| 2201 | Ga0207712_10001154 | |||
| 2202 | Ga0207712_10007169 | |||
| 2203 | Ga0207712_10009916 | |||
| 2204 | Ga0207712_10068412 | |||
| 2205 | Ga0207712_10519690 | |||
| 2206 | Ga0207712_10574041 | |||
| 2207 | Ga0207668_10000050 | |||
| 2208 | Ga0207668_10008350 | |||
| 2209 | Ga0207668_10024423 | |||
| 2210 | Ga0207668_10025165 | |||
| 2211 | Ga0207668_10036914 | |||
| 2212 | Ga0207668_10060121 | |||
| 2213 | Ga0207668_10096392 | |||
| 2214 | Ga0207668_10100343 | |||
| 2215 | Ga0207668_10136193 | |||
| 2216 | Ga0207668_10196533 | |||
| 2217 | Ga0207640_10000695 | |||
| 2218 | Ga0207640_10003242 | |||
| 2219 | Ga0207640_10009695 | |||
| 2220 | Ga0207640_10010412 | |||
| 2221 | Ga0207640_10022324 | |||
| 2222 | Ga0207640_10022842 | |||
| 2223 | Ga0207640_10050304 | |||
| 2224 | Ga0207640_10057393 | |||
| 2225 | Ga0207640_10254719 | |||
| 2226 | Ga0207640_10848116 | |||
| 2227 | Ga0207658_10000109 | |||
| 2228 | Ga0207658_10000243 | |||
| 2229 | Ga0207658_10000831 | |||
| 2230 | Ga0207658_10001229 | |||
| 2231 | Ga0207658_10007072 | |||
| 2232 | Ga0207658_10019968 | |||
| 2233 | Ga0207658_10333312 | |||
| 2234 | Ga0207658_10469643 | |||
| 2235 | Ga0207658_10482858 | |||
| 2236 | Ga0207677_10000231 | |||
| 2237 | Ga0207677_10105098 | |||
| 2238 | Ga0207677_10150276 | |||
| 2239 | Ga0207703_10000167 | |||
| 2240 | Ga0207703_10000302 | |||
| 2241 | Ga0207703_10001218 | |||
| 2242 | Ga0207703_10022812 | |||
| 2243 | Ga0207703_10165021 | |||
| 2244 | Ga0207703_11233867 | |||
| 2245 | Ga0207639_10000222 | |||
| 2246 | Ga0207639_10001618 | |||
| 2247 | Ga0207639_10002807 | |||
| 2248 | Ga0207639_10004222 | |||
| 2249 | Ga0207639_10044491 | |||
| 2250 | Ga0207639_10119275 | |||
| 2251 | Ga0207639_10192428 | |||
| 2252 | Ga0207639_10372545 | |||
| 2253 | Ga0207678_10000427 | |||
| 2254 | Ga0207678_10002526 | |||
| 2255 | Ga0207678_10009305 | |||
| 2256 | Ga0207678_10009690 | |||
| 2257 | Ga0207678_10025204 | |||
| 2258 | Ga0207678_10029423 | |||
| 2259 | Ga0207678_10033366 | |||
| 2260 | Ga0207678_10130264 | |||
| 2261 | Ga0207678_10349584 | |||
| 2262 | Ga0207702_10000074 | |||
| 2263 | Ga0207702_10004354 | |||
| 2264 | Ga0207702_10067615 | |||
| 2265 | Ga0207702_10142238 | |||
| 2266 | Ga0207702_10245637 | |||
| 2267 | Ga0207702_10931312 | |||
| 2268 | Ga0207702_10954380 | |||
| 2269 | Ga0207641_10000018 | |||
| 2270 | Ga0207641_10000241 | |||
| 2271 | Ga0207641_10000755 | |||
| 2272 | Ga0207641_10001790 | |||
| 2273 | Ga0207641_10033823 | |||
| 2274 | Ga0207641_10232662 | |||
| 2275 | Ga0207641_10306438 | |||
| 2276 | Ga0207641_10331658 | |||
| 2277 | Ga0207648_10000003 | |||
| 2278 | Ga0207648_10004533 | |||
| 2279 | Ga0207648_10008748 | |||
| 2280 | Ga0207648_10043805 | |||
| 2281 | Ga0207648_10059901 | |||
| 2282 | Ga0207676_10000021 | |||
| 2283 | Ga0207676_10000027 | |||
| 2284 | Ga0207676_10000344 | |||
| 2285 | Ga0207676_10007462 | |||
| 2286 | Ga0207676_10036224 | |||
| 2287 | Ga0207676_10698306 | |||
| 2288 | Ga0207674_10004106 | |||
| 2289 | Ga0207674_10006823 | |||
| 2290 | Ga0207674_10012801 | |||
| 2291 | Ga0207674_10038792 | |||
| 2292 | Ga0207674_10154090 | |||
| 2293 | Ga0207674_10155404 | |||
| 2294 | Ga0207674_10372997 | |||
| 2295 | Ga0207675_100001147 | |||
| 2296 | Ga0207675_100440544 | |||
| 2297 | Ga0207683_10015482 | |||
| 2298 | Ga0207683_10015611 | |||
| 2299 | Ga0207683_10058649 | |||
| 2300 | Ga0207683_10320182 | |||
| 2301 | Ga0207683_10335183 | |||
| 2302 | Ga0207698_10000892 | |||
| 2303 | Ga0207698_10001072 | |||
| 2304 | Ga0207698_10006957 | |||
| 2305 | Ga0207698_10033576 | |||
| 2306 | Ga0207698_10034897 | |||
| 2307 | Ga0207698_10080661 | |||
| 2308 | Ga0207698_10173871 | |||
| 2309 | Ga0207698_10397770 | |||
| 2310 | Ga0207698_11204589 | |||
| 2311 | Ga0209973_1085743 | |||
| 2312 | Ga0209983_1013449 | |||
| 2313 | Ga0209971_1038769 | |||
| 2314 | Ga0209813_10000007 | |||
| 2315 | Ga0209813_10000279 | |||
| 2316 | Ga0209974_10003536 | |||
| 2317 | Ga0268266_10000002 | |||
| 2318 | Ga0268266_10000175 | |||
| 2319 | Ga0268266_10001810 | |||
| 2320 | Ga0268266_10005157 | |||
| 2321 | Ga0268266_10013052 | |||
| 2322 | Ga0268266_10025965 | |||
| 2323 | Ga0268266_10258148 | |||
| 2324 | Ga0268266_10502646 | |||
| 2325 | Ga0268266_10623025 | |||
| 2326 | Ga0268265_10000042 | |||
| 2327 | Ga0268265_10000052 | |||
| 2328 | Ga0268265_10003957 | |||
| 2329 | Ga0268265_10014248 | |||
| 2330 | Ga0268265_10080018 | |||
| 2331 | Ga0268265_10167444 | |||
| 2332 | Ga0268265_10320645 | |||
| 2333 | Ga0268265_10651549 | |||
| 2334 | Ga0268264_10000144 | |||
| 2335 | Ga0268264_10000268 | |||
| 2336 | Ga0268264_10001327 | |||
| 2337 | Ga0268264_10013849 | |||
| 2338 | Ga0268264_10016760 | |||
| 2339 | Ga0268264_10045605 | |||
| 2340 | Ga0268264_10065024 | |||
| 2341 | Ga0268264_10095824 | |||
| 2342 | Ga0268264_10565079 | |||
| 2343 | Ga0307517_10020643 | |||
| 2344 | Ga0307517_10295058 | |||
| 2345 | Ga0316183_1203243 | |||
| 2346 | Ga0265327_10116288 | |||
| 2347 | Ga0307509_10476517 | |||
| 2348 | Ga0307408_100004452 | |||
| 2349 | Ga0307408_100006152 | |||
| 2350 | Ga0307408_100013781 | |||
| 2351 | Ga0307408_100045019 | |||
| 2352 | Ga0307408_100047429 | |||
| 2353 | Ga0307408_100115622 | |||
| 2354 | Ga0307408_100219274 | |||
| 2355 | Ga0307408_100454895 | |||
| 2356 | Ga0307408_100490889 | |||
| 2357 | Ga0307408_100499911 | |||
| 2358 | Ga0307508_10013978 | |||
| 2359 | Ga0307508_10100659 | |||
| 2360 | Ga0307405_10002843 | |||
| 2361 | Ga0307405_10004479 | |||
| 2362 | Ga0307405_10021552 | |||
| 2363 | Ga0307413_10002654 | |||
| 2364 | Ga0307413_10011213 | |||
| 2365 | Ga0307413_10017328 | |||
| 2366 | Ga0307413_10023177 | |||
| 2367 | Ga0307413_10135136 | |||
| 2368 | Ga0307413_10301424 | |||
| 2369 | Ga0307413_10822024 | |||
| 2370 | Ga0307410_10012132 | |||
| 2371 | Ga0307410_10045244 | |||
| 2372 | Ga0307410_10074163 | |||
| 2373 | Ga0307410_10075902 | |||
| 2374 | Ga0307410_10118726 | |||
| 2375 | Ga0307410_10243550 | |||
| 2376 | Ga0307410_10303694 | |||
| 2377 | Ga0307410_10425944 | |||
| 2378 | Ga0307410_10746693 | |||
| 2379 | Ga0307410_10842397 | |||
| 2380 | Ga0307406_10010388 | |||
| 2381 | Ga0307406_10032616 | |||
| 2382 | Ga0307406_10049849 | |||
| 2383 | Ga0307406_10293774 | |||
| 2384 | Ga0307406_10354532 | |||
| 2385 | Ga0307406_10355532 | |||
| 2386 | Ga0307406_10430414 | |||
| 2387 | Ga0307406_10463989 | |||
| 2388 | Ga0307407_10000642 | |||
| 2389 | Ga0307407_10001660 | |||
| 2390 | Ga0307407_10018963 | |||
| 2391 | Ga0307407_10064069 | |||
| 2392 | Ga0307407_10215283 | |||
| 2393 | Ga0307412_10003000 | |||
| 2394 | Ga0307412_10011723 | |||
| 2395 | Ga0307412_10023555 | |||
| 2396 | Ga0307412_10031872 | |||
| 2397 | Ga0307412_10068448 | |||
| 2398 | Ga0307412_10133370 | |||
| 2399 | Ga0307412_10147821 | |||
| 2400 | Ga0307412_10504704 | |||
| 2401 | Ga0307412_10550438 | |||
| 2402 | Ga0307412_10673933 | |||
| 2403 | Ga0307412_11301028 | |||
| 2404 | Ga0307409_100001134 | |||
| 2405 | Ga0307409_100014600 | |||
| 2406 | Ga0307409_100042286 | |||
| 2407 | Ga0307409_100097867 | |||
| 2408 | Ga0307409_100107575 | |||
| 2409 | Ga0307409_100375613 | |||
| 2410 | Ga0307409_100462246 | |||
| 2411 | Ga0307409_100574396 | |||
| 2412 | Ga0307409_100609696 | |||
| 2413 | Ga0307416_100021275 | |||
| 2414 | Ga0307416_100024603 | |||
| 2415 | Ga0307416_100025294 | |||
| 2416 | Ga0307416_100026146 | |||
| 2417 | Ga0307416_100039060 | |||
| 2418 | Ga0307416_100117251 | |||
| 2419 | Ga0307416_100660589 | |||
| 2420 | Ga0307414_10000073 | |||
| 2421 | Ga0307414_10004382 | |||
| 2422 | Ga0307414_10004615 | |||
| 2423 | Ga0307414_10004943 | |||
| 2424 | Ga0307414_10049760 | |||
| 2425 | Ga0307414_10085299 | |||
| 2426 | Ga0307414_10096376 | |||
| 2427 | Ga0307414_10129051 | |||
| 2428 | Ga0307414_10154175 | |||
| 2429 | Ga0307414_10181450 | |||
| 2430 | Ga0307414_10292136 | |||
| 2431 | Ga0307414_10323515 | |||
| 2432 | Ga0307414_10340417 | |||
| 2433 | Ga0307414_10410604 | |||
| 2434 | Ga0307414_10647308 | |||
| 2435 | Ga0307414_10764060 | |||
| 2436 | Ga0307414_10992884 | |||
| 2437 | Ga0307411_10005275 | |||
| 2438 | Ga0307411_10016683 | |||
| 2439 | Ga0307411_10028900 | |||
| 2440 | Ga0307411_10041569 | |||
| 2441 | Ga0307411_10041899 | |||
| 2442 | Ga0307411_10208079 | |||
| 2443 | Ga0307411_10220221 | |||
| 2444 | Ga0307411_10257744 | |||
| 2445 | Ga0307411_10301566 | |||
| 2446 | Ga0307411_10303104 | |||
| 2447 | Ga0307411_10311678 | |||
| 2448 | Ga0307415_100009294 | |||
| 2449 | Ga0307415_100288064 | |||
| 2450 | Ga0307415_100321955 | |||
| 2451 | Ga0307415_100335672 | |||
| 2452 | Ga0307415_100439992 | |||
| 2453 | Ga0307510_10066259 | |||
| 2454 | Ga0373951_0046907 | |||
| 2455 | Ga0373923_0004223 | |||
| 2456 | Ga0373923_0127740 | |||
| 2457 | Ga0373943_0005666 | |||
| 2458 | Ga0373946_0061644 | |||
| 2459 | Ga0373935_0002322 | |||
| 2460 | Ga0373933_0031583 | |||
| 2461 | Ga0373947_0022791 | |||
| 2462 | Ga0373947_0129808 | |||
| 2463 | Ga0373937_0045789 | |||
| 2464 | Ga0373925_0277898 | |||
| 2465 | Ga0395899_0010252 | |||
| 2466 | Ga0395899_0036681 | |||
| 2467 | Ga0395899_0044714 | |||
| 2468 | Ga0395899_0053580 | |||
| 2469 | Ga0395899_0134149 | |||
| 2470 | Ga0395899_0162236 | |||
| 2471 | Ga0395900_0027388 | |||
| 2472 | Ga0395900_0028928 | |||
| 2473 | Ga0395900_0092721 | |||
| 2474 | Ga0395900_0120079 | |||
| 2475 | Ga0395900_0164384 | |||
| 2476 | Ga0395900_0335785 | |||
| 2477 | Ga0395898_0054496 | |||
| 2478 | Ga0395898_0085987 | |||
| 2479 | Ga0395905_0025080 | |||
| 2480 | Ga0395905_0030632 | |||
| 2481 | Ga0395905_0047368 | |||
| 2482 | Ga0395905_0133408 | |||
| 2483 | Ga0395905_0160398 | |||
| 2484 | Ga0395905_0292187 | |||
| 2485 | Ga0395905_0315237 | |||
| 2486 | Ga0395905_0370430 | |||
| 2487 | Ga0395905_0377023 | |||
| 2488 | Ga0436364_0804686 | |||
| 2489 | Ga0395901_0041174 | |||
| 2490 | Ga0395901_0048282 | |||
| 2491 | Ga0395901_0099018 | |||
| 2492 | Ga0395901_0647004 | |||
| 2493 | Ga0237819_02628 | |||
| 2494 | Ga0237816_03757 | |||
| 2495 | Ga0436365_1638035 | |||
| 2496 | Ga0439466_0065068 | |||
| 2497 | Ga0451791_1549013 | |||
| 2498 | Ga0451853_4106881 | |||
| 2499 | Ga0439432_002749 | |||
| 2500 | Ga0439449_0061824 | |||
| 2501 | Ga0439462_0000274 | |||
| 2502 | Ga0439458_0000616 | |||
| 2503 | Ga0439460_0265782 | |||
| 2504 | Ga0451577_0219644 | |||
| 2505 | Ga0466972_0001135 | |||
| 2506 | Ga0466972_0040609 | |||
| 2507 | Ga0466973_0033687 | |||
| 2508 | Ga0466965_0074211 | |||
| 2509 | Ga0466966_0001152 | |||
| 2510 | Ga0466966_0229375 | |||
| 2511 | Ga0466961_0017645 | |||
| 2512 | Ga0466961_0039301 | |||
| 2513 | Ga0466963_0050836 | |||
| 2514 | Ga0466963_0321751 | |||
| 2515 | Ga0466964_0023350 | |||
| 2516 | Ga0466971_0001276 | |||
| 2517 | Ga0466971_0371524 | |||
| 2518 | Ga0466968_0043206 | |||
| 2519 | Ga0466968_0054968 | |||
| 2520 | Ga0466970_0114927 | |||
| 2521 | Ga0466970_0116316 | |||
| 2522 | Ga0466970_0161930 | |||
| 2523 | Ga0466970_0492336 | |||
| 2524 | Ga0466957_0008816 | |||
| 2525 | Ga0466960_0001716 | |||
| 2526 | Ga0466959_0084865 | |||
| 2527 | Ga0466959_0160252 | |||
| 2528 | Ga0466959_0213418 | |||
| 2529 | Ga0466958_0010021 | |||
| 2530 | Ga0466958_0025024 | |||
| 2531 | Ga0466967_0083449 | |||
| 2532 | Ga0466967_0373387 | |||
| 2533 | Ga0466967_0433627 | |||
| 2534 | Ga0495617_008380 | |||
| 2535 | Ga0495627_000024 | |||
| 2536 | Ga0495627_000582 | |||
| 2537 | Ga0495627_020847 | |||
| 2538 | Ga0495627_036429 | |||
| 2539 | Ga0495638_0000051 | |||
| 2540 | Ga0495638_0015201 | |||
| 2541 | Ga0495638_0127999 | |||
| 2542 | Ga0495650_0000967 | |||
| 2543 | Ga0495650_0001090 | |||
| 2544 | Ga0495650_0003223 | |||
| 2545 | Ga0495605_0024857 | |||
| 2546 | Ga0495584_0483584 | |||
| 2547 | Ga0495585_0040991 | |||
| 2548 | Ga0495585_0061915 | |||
| 2549 | Ga0495585_0062413 | |||
| 2550 | Ga0495585_0081005 | |||
| 2551 | Ga0495585_0094743 | |||
| 2552 | Ga0495596_0000008 | |||
| 2553 | Ga0495596_0002823 | |||
| 2554 | Ga0495607_0006279 | |||
| 2555 | Ga0495607_0013977 | |||
| 2556 | Ga0495607_0037379 | |||
| 2557 | Ga0495583_0000582 | |||
| 2558 | Ga0495583_0001392 | |||
| 2559 | Ga0495583_0005396 | |||
| 2560 | Ga0495583_0030469 | |||
| 2561 | Ga0495583_0074163 | |||
| 2562 | Ga0495583_0077084 | |||
| 2563 | Ga0495583_0085684 | |||
| 2564 | Ga0495606_0000178 | |||
| 2565 | Ga0495606_0010737 | |||
| 2566 | Ga0495606_0013877 | |||
| 2567 | Ga0495606_0027882 | |||
| 2568 | Ga0495606_0163301 | |||
| 2569 | Ga0495606_0173376 | |||
| 2570 | Ga0495610_0000053 | |||
| 2571 | Ga0495610_0000081 | |||
| 2572 | Ga0495610_0001175 | |||
| 2573 | Ga0495610_0004173 | |||
| 2574 | Ga0495610_0093412 | |||
| 2575 | Ga0495610_0151897 | |||
| 2576 | Ga0495616_0223663 | |||
| 2577 | Ga0495620_0024916 | |||
| 2578 | Ga0495631_0026871 | |||
| 2579 | Ga0495631_0045866 | |||
| 2580 | Ga0495631_0252731 | |||
| 2581 | Ga0495632_0000006 | |||
| 2582 | Ga0495632_0000306 | |||
| 2583 | Ga0495632_0000356 | |||
| 2584 | Ga0495632_0014842 | |||
| 2585 | Ga0495632_0185855 | |||
| 2586 | Ga0495637_0000784 | |||
| 2587 | Ga0495637_0023493 | |||
| 2588 | Ga0495643_0000021 | |||
| 2589 | Ga0495643_0000042 | |||
| 2590 | Ga0495643_0001768 | |||
| 2591 | Ga0495643_0002744 | |||
| 2592 | Ga0495643_0002897 | |||
| 2593 | Ga0495643_0012066 | |||
| 2594 | Ga0495643_0018146 | |||
| 2595 | Ga0495643_0018970 | |||
| 2596 | Ga0495643_0045444 | |||
| 2597 | Ga0495643_0055387 | |||
| 2598 | Ga0495643_0064246 | |||
| 2599 | Ga0495643_0108432 | |||
| 2600 | Ga0495643_0183112 | |||
| 2601 | Ga0495643_0232909 | |||
| 2602 | Ga0495643_0406652 | |||
| 2603 | Ga0495648_0000032 | |||
| 2604 | Ga0495648_0004587 | |||
| 2605 | Ga0495648_0026511 | |||
| 2606 | Ga0495648_0038726 | |||
| 2607 | Ga0495648_0148282 | |||
| 2608 | Ga0495648_0215116 | |||
| 2609 | Ga0495663_0000008 | |||
| 2610 | Ga0495663_0000758 | |||
| 2611 | Ga0495663_0021992 | |||
| 2612 | Ga0495663_0054540 | |||
| 2613 | Ga0495663_0128851 | |||
| 2614 | Ga0495652_0539811 | |||
| 2615 | Ga0495609_0003619 | |||
| 2616 | Ga0495609_0161424 | |||
| 2617 | Ga0495597_0021634 | |||
| 2618 | Ga0495622_0002170 | |||
| 2619 | Ga0495633_0000247 | |||
| 2620 | Ga0495633_0000308 | |||
| 2621 | Ga0495633_0001265 | |||
| 2622 | Ga0495633_0009196 | |||
| 2623 | Ga0495633_0015315 | |||
| 2624 | Ga0495633_0043814 | |||
| 2625 | Ga0495633_0100529 | |||
| 2626 | Ga0495633_0188828 | |||
| 2627 | Ga0495668_0000004 | |||
| 2628 | Ga0495668_0000013 | |||
| 2629 | Ga0495668_0015322 | |||
| 2630 | Ga0495668_0021352 | |||
| 2631 | Ga0495668_0216745 | |||
| 2632 | Ga0495668_0434163 | |||
| 2633 | Ga0495611_0014367 | |||
| 2634 | Ga0495611_0066649 | |||
| 2635 | Ga0495625_0000321 | |||
| 2636 | Ga0495625_0000914 | |||
| 2637 | Ga0495625_0003636 | |||
| 2638 | Ga0495625_0042735 | |||
| 2639 | Ga0495625_0043217 | |||
| 2640 | Ga0495625_0071562 | |||
| 2641 | Ga0495625_0119010 | |||
| 2642 | Ga0495625_0226451 | |||
| 2643 | Ga0495661_0072319 | |||
| 2644 | Ga0495661_0194740 | |||
| 2645 | Ga0495623_0070991 | |||
| 2646 | Ga0495669_0002087 | |||
| 2647 | Ga0495669_0009712 | |||
| 2648 | Ga0495669_0014347 | |||
| 2649 | Ga0495669_0062574 | |||
| 2650 | Ga0495671_0000017 | |||
| 2651 | Ga0495671_0000020 | |||
| 2652 | Ga0495671_0005841 | |||
| 2653 | Ga0495671_0006324 | |||
| 2654 | Ga0495671_0022403 | |||
| 2655 | Ga0495649_0031039 | |||
| 2656 | Ga0495649_0038474 | |||
| 2657 | Ga0495600_0001554 | |||
| 2658 | Ga0495660_0047286 | |||
| 2659 | Ga0495660_0087149 | |||
| 2660 | Ga0495672_0117903 | |||
| 2661 | Ga0495683_0006805 | |||
| 2662 | Ga0495687_000250 | |||
| 2663 | Ga0495687_000614 | |||
| 2664 | Ga0495677_0001865 | |||
| 2665 | Ga0495673_0000076 | |||
| 2666 | Ga0495673_0020724 | |||
| 2667 | Ga0495673_0030495 | |||
| 2668 | Ga0495673_0034699 | |||
| 2669 | Ga0495673_0041073 | |||
| 2670 | Ga0495681_0000099 | |||
| 2671 | Ga0495681_0000517 | |||
| 2672 | Ga0495681_0032888 | |||
| 2673 | Ga0495686_0000262 | |||
| 2674 | Ga0495686_0000273 | |||
| 2675 | Ga0495686_0000669 | |||
| 2676 | Ga0495686_0000680 | |||
| 2677 | Ga0495686_0103361 | |||
| 2678 | Ga0495686_0154042 | |||
| 2679 | Ga0495686_0201852 | |||
| 2680 | Ga0495602_0046500 | |||
| 2681 | Ga0495615_0000135 | |||
| 2682 | Ga0495626_0000139 | |||
| 2683 | Ga0496100_0427862 | |||
| 2684 | Ga0496101_0353643 | |||
| 2685 | Ga0496102_0001391 | |||
| 2686 | Ga0496102_0009613 | |||
| 2687 | Ga0496102_0030551 | |||
| 2688 | Ga0496102_0517366 | |||
| 2689 | Ga0496102_0557811 | |||
| 2690 | Ga0496102_0851955 | |||
| 2691 | Ga0496103_0000055 | |||
| 2692 | Ga0496103_0007593 | |||
| 2693 | Ga0496103_0041420 | |||
| 2694 | Ga0496103_0477353 | |||
| 2695 | Ga0496104_0026298 | |||
| 2696 | Ga0496104_1127604 | |||
| 2697 | Ga0496104_1166181 | |||
| 2698 | Ga0496105_0000358 | |||
| 2699 | Ga0496105_0740658 | |||
| 2700 | Ga0496106_0019385 | |||
| 2701 | Ga0496107_0020666 | |||
| 2702 | Ga0496108_0054733 | |||
| 2703 | Ga0496108_0296198 | |||
| 2704 | Ga0496109_0022187 | |||
| 2705 | Ga0496109_0098706 | |||
| 2706 | Ga0496109_0215343 | |||
| 2707 | Ga0496109_0284074 | |||
| 2708 | Ga0496110_0009627 | |||
| 2709 | Ga0496110_0026654 | |||
| 2710 | Ga0496110_0062006 | |||
| 2711 | Ga0496111_0021635 | |||
| 2712 | Ga0496111_0103898 | |||
| 2713 | Ga0496112_0041602 | |||
| 2714 | Ga0496112_0274805 | |||
| 2715 | Ga0496113_0009411 | |||
| 2716 | Ga0496113_0103450 | |||
| 2717 | Ga0496113_0145461 | |||
| 2718 | Ga0496113_1273601 | |||
| 2719 | Ga0496114_0000016 | |||
| 2720 | Ga0496114_0010092 | |||
| 2721 | Ga0496114_0118522 | |||
| 2722 | Ga0496115_0000267 | |||
| 2723 | Ga0496116_0000045 | |||
| 2724 | Ga0496116_0023536 | |||
| 2725 | Ga0496116_0028810 | |||
| 2726 | Ga0496116_0064603 | |||
| 2727 | Ga0496117_0000549 | |||
| 2728 | Ga0496117_0002463 | |||
| 2729 | Ga0496117_0004882 | |||
| 2730 | Ga0496117_0017345 | |||
| 2731 | Ga0496117_0070619 | |||
| 2732 | Ga0496117_0166788 | |||
| 2733 | Ga0496117_0232443 | |||
| 2734 | Ga0496118_0000552 | |||
| 2735 | Ga0496118_0000811 | |||
| 2736 | Ga0496118_0003823 | |||
| 2737 | Ga0496118_0007786 | |||
| 2738 | Ga0496118_0017208 | |||
| 2739 | Ga0496118_0017950 | |||
| 2740 | Ga0496118_0034239 | |||
| 2741 | Ga0496118_0347199 | |||
| 2742 | Ga0496119_0031108 | |||
| 2743 | Ga0496119_0077162 | |||
| 2744 | Ga0496119_0089316 | |||
| 2745 | Ga0496119_0248753 | |||
| 2746 | Ga0496120_0013820 | |||
| 2747 | Ga0496120_0151706 | |||
| 2748 | Ga0496121_0000652 | |||
| 2749 | Ga0496121_0000930 | |||
| 2750 | Ga0496121_0001191 | |||
| 2751 | Ga0496121_0003000 | |||
| 2752 | Ga0496121_0005432 | |||
| 2753 | Ga0496121_0024091 | |||
| 2754 | Ga0496121_0031341 | |||
| 2755 | Ga0496121_0031916 | |||
| 2756 | Ga0496121_0068404 | |||
| 2757 | Ga0496121_0078566 | |||
| 2758 | Ga0496121_0192677 | |||
| 2759 | Ga0496122_0003938 | |||
| 2760 | Ga0496122_0005345 | |||
| 2761 | Ga0496122_0011792 | |||
| 2762 | Ga0496122_0017572 | |||
| 2763 | Ga0496122_0036518 | |||
| 2764 | Ga0496122_0081358 | |||
| 2765 | Ga0496122_0147769 | |||
| 2766 | Ga0496123_0001272 | |||
| 2767 | Ga0496123_0001952 | |||
| 2768 | Ga0496123_0011382 | |||
| 2769 | Ga0496123_0011531 | |||
| 2770 | Ga0496123_0037600 | |||
| 2771 | Ga0496123_0067977 | |||
| 2772 | Ga0496123_0079556 | |||
| 2773 | Ga0496123_0106909 | |||
| 2774 | Ga0496123_0233381 | |||
| 2775 | Ga0496124_0000585 | |||
| 2776 | Ga0496124_0003632 | |||
| 2777 | Ga0496124_0008726 | |||
| 2778 | Ga0496124_0013710 | |||
| 2779 | Ga0496124_0019318 | |||
| 2780 | Ga0496124_0026758 | |||
| 2781 | Ga0496124_0030502 | |||
| 2782 | Ga0496124_0099254 | |||
| 2783 | Ga0496124_0132861 | |||
| 2784 | Ga0496124_0134357 | |||
| 2785 | Ga0496124_0166346 | |||
| 2786 | Ga0496125_0001142 | |||
| 2787 | Ga0496125_0010180 | |||
| 2788 | Ga0496125_0010701 | |||
| 2789 | Ga0496125_0032339 | |||
| 2790 | Ga0496125_0035059 | |||
| 2791 | Ga0496125_0036806 | |||
| 2792 | Ga0496125_0041123 | |||
| 2793 | Ga0496125_0042756 | |||
| 2794 | Ga0496125_0059204 | |||
| 2795 | Ga0496125_0085882 | |||
| 2796 | Ga0496125_0099292 | |||
| 2797 | Ga0496125_0107311 | |||
| 2798 | Ga0496125_0155799 | |||
| 2799 | Ga0496126_0000519 | |||
| 2800 | Ga0496126_0001094 | |||
| 2801 | Ga0496126_0004852 | |||
| 2802 | Ga0496126_0014259 | |||
| 2803 | Ga0496126_0064441 | |||
| 2804 | Ga0496126_0093822 | |||
| 2805 | Ga0496126_0271213 | |||
| 2806 | Ga0496126_0501897 | |||
| 2807 | Ga0496126_0536572 | |||
| 2808 | Ga0495678_201105 | |||
| 2809 | Ga0501335_005898 | |||
| 2810 | Ga0501032_0019920 | |||
| 2811 | Ga0501032_0022006 | |||
| 2812 | Ga0501033_0058368 | |||
| 2813 | Ga0501033_0127471 | |||
| 2814 | Ga0501034_0108545 | |||
| 2815 | Ga0501034_0880013 | |||
| 2816 | Ga0501036_0189107 | |||
| 2817 | Ga0501036_0718870 | |||
| 2818 | Ga0501037_0046165 | |||
| 2819 | Ga0501038_0253946 | |||
| 2820 | Ga0501039_0717338 | |||
| 2821 | Ga0501043_0007449 | |||
| 2822 | Ga0501043_0011321 | |||
| 2823 | Ga0501043_0059629 | |||
| 2824 | Ga0501043_0813160 | |||
| 2825 | Ga0501046_0030557 | |||
| 2826 | Ga0501046_0269958 | |||
| 2827 | Ga0501047_0000795 | |||
| 2828 | Ga0501047_0277926 | |||
| 2829 | Ga0501047_0472231 | |||
| 2830 | Ga0501047_0701199 | |||
| 2831 | Ga0501048_0086339 | |||
| 2832 | Ga0501067_0016919 | |||
| 2833 | Ga0501067_0060171 | |||
| 2834 | Ga0501070_0297898 | |||
| 2835 | Ga0501208_042684 | |||
| 2836 | Ga0501223_000092 | |||
| 2837 | Ga0501224_010003 | |||
| 2838 | Ga0501235_014004 | |||
| 2839 | Ga0501235_034142 | |||
| 2840 | Ga0501249_001325 | |||
| 2841 | Ga0501257_087543 | |||
| 2842 | Ga0501225_0009956 | |||
| 2843 | Ga0501225_0118260 | |||
| 2844 | Ga0501245_127857 | |||
| 2845 | Ga0501267_012879 | |||
| 2846 | Ga0501035_0289634 | |||
| 2847 | Ga0501044_0013098 | |||
| 2848 | Ga0501044_0035147 | |||
| 2849 | Ga0501044_0044292 | |||
| 2850 | Ga0501044_0376795 | |||
| 2851 | Ga0501044_0401751 | |||
| 2852 | Ga0501044_0582299 | |||
| 2853 | nmdc:mga03683_126171_c1 | |||
| 2854 | nmdc:mga03683_276_c1 | |||
| 2855 | nmdc:mga03n38_89329_c1 | |||
| 2856 | nmdc:mga00v17_68256_c1 | |||
| 2857 | nmdc:mga00v17_81142_c1 | |||
| 2858 | nmdc:mga0k408_63396_c1 | |||
| 2859 | nmdc:mga06z11_134_c1 | |||
| 2860 | nmdc:mga06z11_85_c1 | |||
| 2861 | nmdc:mga07m45_12_c1 | |||
| 2862 | nmdc:mga05p37_324492_c1 | |||
| 2863 | nmdc:mga0n895_1010399_c1 | |||
| 2864 | nmdc:mga0n895_1523631_c1 | |||
| 2865 | nmdc:mga0rr50_135562_c1 | |||
| 2866 | nmdc:mga0rr50_141418_c1 | |||
| 2867 | nmdc:mga0sz30_10812_c2 | |||
| 2868 | nmdc:mga0sz30_11490_c1 | |||
| 2869 | Ga0500610_0000092 | |||
| 2870 | Ga0500643_000001 | |||
| 2871 | Ga0500643_001742 | |||
| 2872 | Ga0500643_004433 | |||
| 2873 | Ga0500643_006129 | |||
| 2874 | Ga0500647_0042393 | |||
| 2875 | Ga0500651_0009774 | |||
| 2876 | Ga0500566_0005455 | |||
| 2877 | Ga0500562_003322 | |||
| 2878 | Ga0500592_005424 | |||
| 2879 | Ga0500592_019794 | |||
| 2880 | Ga0500594_0009825 | |||
| 2881 | Ga0500595_007737 | |||
| 2882 | Ga0500607_001489 | |||
| 2883 | Ga0500642_0000187 | |||
| 2884 | Ga0500642_0002784 | |||
| 2885 | Ga0500655_000107 | |||
| 2886 | Ga0500658_0034924 | |||
| 2887 | Ga0500559_0022339 | |||
| 2888 | Ga0500559_0046716 | |||
| 2889 | Ga0500564_027808 | |||
| 2890 | Ga0500568_0003230 | |||
| 2891 | Ga0500573_0000065 | |||
| 2892 | Ga0500616_0002096 | |||
| 2893 | Ga0500616_0051227 | |||
| 2894 | Ga0500619_024218 | |||
| 2895 | Ga0500622_0003412 | |||
| 2896 | Ga0500624_000002 | |||
| 2897 | Ga0500627_0000089 | |||
| 2898 | Ga0500636_0005106 | |||
| 2899 | Ga0500567_002040 | |||
| 2900 | Ga0500570_000192 | |||
| 2901 | Ga0500625_000026 | |||
| 2902 | Ga0500645_000024 | |||
| 2903 | Ga0500596_000659 | |||
| 2904 | Ga0466962_0013450 | |||
| 2905 | 2511130872 | |||
| 2906 | 2512644588 | |||
| 2907 | 2585261427 | |||
| 2908 | 2643730797 | |||
| 2909 | 2643819380 | |||
| 2910 | 2643836094 | |||
| 2911 | 2643951674 | |||
| 2912 | 2644040797 | |||
| 2913 | 2644044550 | |||
| 2914 | 2644052571 | |||
| 2915 | 2644391525 | |||
| 2916 | 2739651109 | |||
| 2917 | 2740029582 | |||
| 2918 | 2778126675 | |||
| 2919 | 2809062608 | |||
| 2920 | 2809078708 | |||
| 2921 | 2809082997 | |||
| 2922 | 2819551416 | |||
| 2923 | 2848298713 | |||
| 2924 | 2852656068 | |||
| 2925 | 2852683203 | |||
| 2926 | 2880521586 | |||
| 2927 | 2885432554 | |||
| 2928 | 2895881321 | |||
| 2929 | 2896253805 | |||
| 2930 | 2919709521 | |||
| 2931 | 2928029412 | |||
| 2932 | 2946790184 | |||
| 2933 | 2984556609 | |||
| 2934 | 2984565218 | |||
| 2935 | 2990265954 | |||
| 2936 | 2993356294 | |||
| 2937 | 2993696255 | |||
| 2938 | 3000867203 | |||
| 2939 | 8054305113 | |||
| 2940 | 8057101585 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8sc2-assembly1.cif.gz_A | human oct1 bound to diltiazem in inward-open conformation | 0.5222 | 5 | 187 |
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.5049 | 1 | 193 |
| 6gv1-assembly1.cif.gz_A | crystal structure of e.coli multidrug/h+ antiporter mdfa in outward open conformation with bound fab fragment | 0.4982 | 3 | 189 |
| 8sc1-assembly1.cif.gz_A | human oct1 (apo) in inward-open conformation | 0.4807 | 5 | 187 |
| 6vs2-assembly1.cif.gz_A | protein d | 0.4667 | 4 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XUL2_18_199_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5236 | 3 | 197 | 1.20.1250.20 |
| af_A0A4V0IJT1_312_502_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.52 | 4 | 189 | 1.20.1250.20 |
| af_A0A0P0X7B4_1_270_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5177 | 4 | 191 | 1.20.1250.20 |
| af_E7FF19_1_301_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5115 | 2 | 187 | 1.20.1250.20 |
| af_P9WGE5_1_282_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5097 | 4 | 194 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3LTE6-F1-model_v4 | UPF0056 membrane protein | 0.7734 | 2 | 197 |
GO:0005886
|
| AF-A0A839J1R9-F1-model_v4 | UPF0056 membrane protein | 0.7669 | 41 | 198 |
GO:0005886
|
| AF-A0A7Y2G823-F1-model_v4 | UPF0056 membrane protein | 0.7645 | 4 | 198 |
GO:0005886
|
| AF-A0A3D3Q9Z2-F1-model_v4 | UPF0056 membrane protein | 0.7594 | 13 | 197 |
GO:0005886
|
| AF-A0A1C3DT85-F1-model_v4 | UPF0056 membrane protein | 0.7593 | 5 | 197 |
GO:0005886
|