F494209

General Info

Members Datasets Scaffolds Average Seq Length
1471 483 1457 283

Family's Representative Sequence

Representative Sequence 3300035090|Ga0373949_0002749|Ga0373949_0002749_1201_2208
Length 323
Sequence MEPHAARLRAFLQKTLLFRQADSSAQLSKAATASTVPRRRSLNKDQQAMSLKGKTLFITGGSRGIGLAIALKATVEPHPKLEGTIHTAAAEVAKAGGRALPLAVDVRDEAGVQAAIDEAAEKFGGIDIVVNNASAIQLTSVAATEMRRYDLMQQINARGTFMVSKFAIPYLTRAANPHILMLSPPLDMSEKWFAPHTAYSMAKFGMSLVVLGLAGELRGKVAVNALWPRTTIATAAIRNLLGGETMIRRSRKPEILAEAACRIFEKPKSFTGNFLIDDTFLASEGVTDFDQYRVDPSQPLQIDFFVPDSSRPPNGVSLDAKSR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
5 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
6 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
7 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
8 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
9 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
10 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
11 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
12 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
13 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
14 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
15 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
16 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
17 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
22 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
23 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
24 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
27 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
28 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
62 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
63 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
64 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
65 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
68 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
79 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
125 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
164 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
245 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
251 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
252 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
253 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
254 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
257 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
258 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
259 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
260 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
261 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
262 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
263 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
264 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
268 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
269 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
270 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
271 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
272 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
273 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
274 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
275 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
276 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
277 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
278 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
279 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
280 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
281 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
282 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
283 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
284 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
285 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
286 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
287 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
288 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
289 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
290 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
291 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
292 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
293 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
294 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
295 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
296 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
297 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
298 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
299 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
300 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
301 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
302 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
303 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
304 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
305 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
311 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
312 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
315 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
318 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
319 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
320 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
321 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
322 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
323 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
324 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
325 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
326 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
327 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
328 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
329 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
334 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
335 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
336 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
337 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
338 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
339 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
340 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
341 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
342 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
343 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
344 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
345 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
346 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
349 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
350 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
351 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
352 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
353 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
354 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
355 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
358 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
359 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
360 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
361 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
362 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
363 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
364 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
365 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
366 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
367 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
368 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
369 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
370 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
371 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
372 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
373 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
374 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
375 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
376 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
377 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
378 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
381 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
382 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
383 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
384 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
385 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
386 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
389 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
390 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
391 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
392 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
396 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
397 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
398 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
404 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
405 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
406 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
407 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
408 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
409 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
410 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
411 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
412 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
413 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
414 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
415 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
416 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
417 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
418 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
419 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
420 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
421 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
422 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
425 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
435 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
436 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
437 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
438 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
439 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
440 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
441 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
442 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
443 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
444 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
445 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
446 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
447 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
448 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
455 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
456 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
457 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
458 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
459 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
460 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
461 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
462 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
463 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
464 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
465 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
466 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
467 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
468 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
469 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
470 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
471 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
472 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
473 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
474 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
475 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
476 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
477 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
478 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
479 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
480 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
481 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0.68
Rhizoplane 6.87
Rhizosphere 87.49
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772992 2209111006 Bacteria 11790
2 ARSoilOldRDRAFT_c000054 3300000044 Bacteria 23692
3 JGI24746J21847_1001225 3300001977 Bacteria 4080
4 JGI24746J21847_1004166 3300001977 Bacteria 2284
5 JGI24739J22299_10003110 3300001989 Bacteria 6332
6 JGI24739J22299_10070181 3300001989 Bacteria 1091
7 JGI24737J22298_10001185 3300001990 Bacteria 9195
8 JGI24737J22298_10003047 3300001990 Bacteria 5939
9 JGI24750J21931_1000231 3300002070 Bacteria 9469
10 JGI24750J21931_1005084 3300002070 Bacteria 1610
11 JGI24745J21846_1000755 3300002073 Bacteria 2946
12 JGI24748J21848_1000261 3300002074 Bacteria 6289
13 JGI24748J21848_1003508 3300002074 Bacteria 1791
14 JGI24738J21930_10002196 3300002075 Bacteria 5199
15 JGI24749J21850_1000804 3300002076 Bacteria 4509
16 JGI24744J21845_10000435 3300002077 Bacteria 7351
17 JGI24035J26624_1000373 3300002126 Bacteria 4227
18 JGI24742J22300_10000181 3300002244 Bacteria 9346
19 JGI25405J52794_10009851 3300003911 Bacteria 1811
20 Ga0065704_10001572 3300005289 Bacteria 8725
21 Ga0065712_10100661 3300005290 Bacteria 2051
22 Ga0065715_10089280 3300005293 Bacteria 11642
23 Ga0065715_10108672 3300005293 Bacteria 2692
24 Ga0065715_10175305 3300005293 Bacteria 1516
25 Ga0070658_10000687 3300005327 Bacteria 29282
26 Ga0070658_10315050 3300005327 Bacteria 1335
27 Ga0070676_10000128 3300005328 Bacteria 28446
28 Ga0070676_10001378 3300005328 Bacteria 12256
29 Ga0070676_10005042 3300005328 Bacteria 6996
30 Ga0070676_10061681 3300005328 Bacteria 2229
31 Ga0070676_10089191 3300005328 Bacteria 1886
32 Ga0070683_100000289 3300005329 Bacteria 34698
33 Ga0070683_100020587 3300005329 Bacteria 5871
34 Ga0070683_100057113 3300005329 Bacteria 3625
35 Ga0070683_100087875 3300005329 Bacteria 2915
36 Ga0070690_100000493 3300005330 Bacteria 19783
37 Ga0070690_100000935 3300005330 Bacteria 14900
38 Ga0070690_100028449 3300005330 Bacteria 3462
39 Ga0070690_100247869 3300005330 Bacteria 1259
40 Ga0070670_100000101 3300005331 Bacteria 79628
41 Ga0070670_100003173 3300005331 Bacteria 13581
42 Ga0070670_100008041 3300005331 Bacteria 8971
43 Ga0070670_100019008 3300005331 Bacteria 5893
44 Ga0070670_100070158 3300005331 Bacteria 3009
45 Ga0070670_100078972 3300005331 Bacteria 2827
46 Ga0070670_100094935 3300005331 Bacteria 2565
47 Ga0070670_100110791 3300005331 Bacteria 2365
48 Ga0070670_100149495 3300005331 Bacteria 2021
49 Ga0070677_10000043 3300005333 Bacteria 39363
50 Ga0070677_10001450 3300005333 Bacteria 7510
51 Ga0070677_10025082 3300005333 Bacteria 2223
52 Ga0068869_100000289 3300005334 Bacteria 26851
53 Ga0068869_100000380 3300005334 Bacteria 24111
54 Ga0068869_100288858 3300005334 Bacteria 1321
55 Ga0070666_10001787 3300005335 Bacteria 13097
56 Ga0070666_10006364 3300005335 Bacteria 7262
57 Ga0070666_10010239 3300005335 Bacteria 5859
58 Ga0070666_10030072 3300005335 Bacteria 3576
59 Ga0070680_100002347 3300005336 Bacteria 13977
60 Ga0070680_100019727 3300005336 Bacteria 5346
61 Ga0070680_100022158 3300005336 Bacteria 5054
62 Ga0070680_100029756 3300005336 Bacteria 4384
63 Ga0070680_100054897 3300005336 Bacteria 3254
64 Ga0070680_100099128 3300005336 Bacteria 2418
65 Ga0070680_100121027 3300005336 Bacteria 2185
66 Ga0070680_100171696 3300005336 Bacteria 1825
67 Ga0070680_100247994 3300005336 Bacteria 1505
68 Ga0070680_100524060 3300005336 Bacteria 1015
69 Ga0070682_100004343 3300005337 Bacteria 7868
70 Ga0070682_100015610 3300005337 Bacteria 4403
71 Ga0070682_100036935 3300005337 Bacteria 2988
72 Ga0070682_100089223 3300005337 Bacteria 2014
73 Ga0070682_100195742 3300005337 Bacteria 1422
74 Ga0068868_100000408 3300005338 Bacteria 29034
75 Ga0068868_100005016 3300005338 Bacteria 9300
76 Ga0068868_100184809 3300005338 Bacteria 1731
77 Ga0070660_100000182 3300005339 Bacteria 41532
78 Ga0070660_100000866 3300005339 Bacteria 20176
79 Ga0070660_100199791 3300005339 Bacteria 1622
80 Ga0070689_100000819 3300005340 Bacteria 19235
81 Ga0070689_100009342 3300005340 Bacteria 6950
82 Ga0070689_100115556 3300005340 Bacteria 2139
83 Ga0070689_100148283 3300005340 Bacteria 1891
84 Ga0070691_10005195 3300005341 Bacteria 5916
85 Ga0070691_10023085 3300005341 Bacteria 2888
86 Ga0070687_100000157 3300005343 Bacteria 23598
87 Ga0070687_100000689 3300005343 Bacteria 11282
88 Ga0070661_100000314 3300005344 Bacteria 39090
89 Ga0070661_100000706 3300005344 Bacteria 24464
90 Ga0070661_100052505 3300005344 Bacteria 2984
91 Ga0070661_100126771 3300005344 Bacteria 1915
92 Ga0070692_10005753 3300005345 Bacteria 5325
93 Ga0070692_10015999 3300005345 Bacteria 3560
94 Ga0070668_100000138 3300005347 Bacteria 45978
95 Ga0070668_100000726 3300005347 Bacteria 22600
96 Ga0070668_100000857 3300005347 Bacteria 21127
97 Ga0070668_100001850 3300005347 Bacteria 15431
98 Ga0070668_100032755 3300005347 Bacteria 3954
99 Ga0070669_100001744 3300005353 Bacteria 15679
100 Ga0070669_100002719 3300005353 Bacteria 12760
101 Ga0070669_100007256 3300005353 Bacteria 7954
102 Ga0070669_100051933 3300005353 Bacteria 2998
103 Ga0070669_100121015 3300005353 Bacteria 1997
104 Ga0070675_100002240 3300005354 Bacteria 14349
105 Ga0070675_100007109 3300005354 Bacteria 8617
106 Ga0070675_100050219 3300005354 Bacteria 3425
107 Ga0070671_100000598 3300005355 Bacteria 25820
108 Ga0070671_100004442 3300005355 Bacteria 11100
109 Ga0070671_100022998 3300005355 Bacteria 5093
110 Ga0070671_100048578 3300005355 Bacteria 3529
111 Ga0070674_100000480 3300005356 Bacteria 20131
112 Ga0070674_100002210 3300005356 Bacteria 10703
113 Ga0070674_100018371 3300005356 Bacteria 4419
114 Ga0070674_100224557 3300005356 Bacteria 1463
115 Ga0070673_100000289 3300005364 Bacteria 26187
116 Ga0070673_100000309 3300005364 Bacteria 25621
117 Ga0070673_100014793 3300005364 Bacteria 5454
118 Ga0070673_100027399 3300005364 Bacteria 4224
119 Ga0070688_100000189 3300005365 Bacteria 32631
120 Ga0070688_100002233 3300005365 Bacteria 9773
121 Ga0070688_100004722 3300005365 Bacteria 7119
122 Ga0070688_100025788 3300005365 Bacteria 3485
123 Ga0070688_100062535 3300005365 Bacteria 2357
124 Ga0070659_100000172 3300005366 Bacteria 49995
125 Ga0070659_100003195 3300005366 Bacteria 11664
126 Ga0070659_100054864 3300005366 Bacteria 3140
127 Ga0070659_100084611 3300005366 Bacteria 2536
128 Ga0070659_100217757 3300005366 Bacteria 1575
129 Ga0070667_100000146 3300005367 Bacteria 88847
130 Ga0070667_100000436 3300005367 Bacteria 43897
131 Ga0070667_100005276 3300005367 Bacteria 10807
132 Ga0070667_100079710 3300005367 Bacteria 2800
133 Ga0070667_100259342 3300005367 Bacteria 1556
134 Ga0070703_10004383 3300005406 Bacteria 3975
135 Ga0070709_10026460 3300005434 Bacteria 3439
136 Ga0070709_10035521 3300005434 Bacteria 3029
137 Ga0070714_100004331 3300005435 Bacteria 10704
138 Ga0070714_100252513 3300005435 Bacteria 1631
139 Ga0070713_100018876 3300005436 Bacteria 5250
140 Ga0070713_100074537 3300005436 Bacteria 2875
141 Ga0070713_100188408 3300005436 Bacteria 1858
142 Ga0070713_100199171 3300005436 Bacteria 1808
143 Ga0070713_100268437 3300005436 Bacteria 1562
144 Ga0070713_100398601 3300005436 Bacteria 1285
145 Ga0070710_10012616 3300005437 Bacteria 4202
146 Ga0070710_10026693 3300005437 Bacteria 3072
147 Ga0070710_10101146 3300005437 Bacteria 1717
148 Ga0070701_10000608 3300005438 Bacteria 12508
149 Ga0070701_10013330 3300005438 Bacteria 3737
150 Ga0070701_10015849 3300005438 Bacteria 3492
151 Ga0070711_100071369 3300005439 Bacteria 2447
152 Ga0070711_100245176 3300005439 Bacteria 1403
153 Ga0070705_100000781 3300005440 Bacteria 17954
154 Ga0070705_100000789 3300005440 Bacteria 17855
155 Ga0070705_100030632 3300005440 Bacteria 2972
156 Ga0070705_100076382 3300005440 Bacteria 2043
157 Ga0070705_100134776 3300005440 Bacteria 1616
158 Ga0070700_100002740 3300005441 Bacteria 9011
159 Ga0070700_100027531 3300005441 Bacteria 3371
160 Ga0070700_100095163 3300005441 Bacteria 1952
161 Ga0070694_100001837 3300005444 Bacteria 12570
162 Ga0070694_100013917 3300005444 Bacteria 5030
163 Ga0070694_100107520 3300005444 Bacteria 1982
164 Ga0070694_100184961 3300005444 Bacteria 1543
165 Ga0070708_100023828 3300005445 Bacteria 5209
166 Ga0070663_100000297 3300005455 Bacteria 25442
167 Ga0070663_100006081 3300005455 Bacteria 7223
168 Ga0070663_100010034 3300005455 Bacteria 5889
169 Ga0070663_100049800 3300005455 Bacteria 2977
170 Ga0070663_100050119 3300005455 Bacteria 2968
171 Ga0070678_100001856 3300005456 Bacteria 11388
172 Ga0070678_100010744 3300005456 Bacteria 5608
173 Ga0070678_100020795 3300005456 Bacteria 4312
174 Ga0070678_100089072 3300005456 Bacteria 2361
175 Ga0070662_100003948 3300005457 Bacteria 9300
176 Ga0070662_100029921 3300005457 Bacteria 3805
177 Ga0070662_100068723 3300005457 Bacteria 2605
178 Ga0070681_10005077 3300005458 Bacteria 12699
179 Ga0070681_10008886 3300005458 Bacteria 9875
180 Ga0070681_10073491 3300005458 Bacteria 3381
181 Ga0070681_10076325 3300005458 Bacteria 3310
182 Ga0070681_10117554 3300005458 Bacteria 2595
183 Ga0070681_10166852 3300005458 Bacteria 2124
184 Ga0068867_100008821 3300005459 Bacteria 7119
185 Ga0068867_100008914 3300005459 Bacteria 7079
186 Ga0068867_100032291 3300005459 Bacteria 3785
187 Ga0068867_100216946 3300005459 Bacteria 1539
188 Ga0070685_10000473 3300005466 Bacteria 23501
189 Ga0070685_10001152 3300005466 Bacteria 14147
190 Ga0070685_10086788 3300005466 Bacteria 1887
191 Ga0070707_100522266 3300005468 Bacteria 1149
192 Ga0070699_100251589 3300005518 Bacteria 1579
193 Ga0070679_100003016 3300005530 Bacteria 15378
194 Ga0070679_100158678 3300005530 Bacteria 2236
195 Ga0070679_100168245 3300005530 Bacteria 2165
196 Ga0070679_100251260 3300005530 Bacteria 1724
197 Ga0070684_100002293 3300005535 Bacteria 14101
198 Ga0070684_100050300 3300005535 Bacteria 3620
199 Ga0070684_100151409 3300005535 Bacteria 2101
200 Ga0070697_100072052 3300005536 Bacteria 2835
201 Ga0068853_100000417 3300005539 Bacteria 29141
202 Ga0068853_100014676 3300005539 Bacteria 6425
203 Ga0068853_100122809 3300005539 Bacteria 2318
204 Ga0068853_100176144 3300005539 Bacteria 1937
205 Ga0070672_100000106 3300005543 Bacteria 41858
206 Ga0070672_100004680 3300005543 Bacteria 8971
207 Ga0070672_100007721 3300005543 Bacteria 7326
208 Ga0070672_100033734 3300005543 Bacteria 3879
209 Ga0070672_100136883 3300005543 Bacteria 2017
210 Ga0070686_100000615 3300005544 Bacteria 20904
211 Ga0070686_100006028 3300005544 Bacteria 6727
212 Ga0070686_100027546 3300005544 Bacteria 3440
213 Ga0070686_100203071 3300005544 Bacteria 1422
214 Ga0070695_100003412 3300005545 Bacteria 9286
215 Ga0070695_100007200 3300005545 Bacteria 6596
216 Ga0070695_100086699 3300005545 Bacteria 2081
217 Ga0070695_100199957 3300005545 Bacteria 1428
218 Ga0070696_100001368 3300005546 Bacteria 15912
219 Ga0070696_100005592 3300005546 Bacteria 8391
220 Ga0070696_100021433 3300005546 Bacteria 4381
221 Ga0070696_100051449 3300005546 Bacteria 2865
222 Ga0070696_100196219 3300005546 Bacteria 1505
223 Ga0070696_100222497 3300005546 Bacteria 1417
224 Ga0070696_100260957 3300005546 Bacteria 1314
225 Ga0070693_100005170 3300005547 Bacteria 6239
226 Ga0070693_100005911 3300005547 Bacteria 5916
227 Ga0070693_100037116 3300005547 Bacteria 2715
228 Ga0070693_100065352 3300005547 Bacteria 2126
229 Ga0070665_100000915 3300005548 Bacteria 37838
230 Ga0070665_100016010 3300005548 Bacteria 7528
231 Ga0070665_100052367 3300005548 Bacteria 4094
232 Ga0070665_100078312 3300005548 Bacteria 3312
233 Ga0070665_100335144 3300005548 Bacteria 1517
234 Ga0070665_100606418 3300005548 Bacteria 1108
235 Ga0070704_100001277 3300005549 Bacteria 13292
236 Ga0070704_100048761 3300005549 Bacteria 2966
237 Ga0068855_100001441 3300005563 Bacteria 29631
238 Ga0068855_100029828 3300005563 Bacteria 6522
239 Ga0068855_100032389 3300005563 Bacteria 6242
240 Ga0068855_100113642 3300005563 Bacteria 3106
241 Ga0068855_100170922 3300005563 Bacteria 2462
242 Ga0068855_100201789 3300005563 Bacteria 2238
243 Ga0068855_100256216 3300005563 Bacteria 1951
244 Ga0070664_100003578 3300005564 Bacteria 12545
245 Ga0070664_100016295 3300005564 Bacteria 6092
246 Ga0070664_100083724 3300005564 Bacteria 2752
247 Ga0070664_100250710 3300005564 Bacteria 1591
248 Ga0068857_100000047 3300005577 Bacteria 67784
249 Ga0068857_100000691 3300005577 Bacteria 25060
250 Ga0068854_100001617 3300005578 Bacteria 13701
251 Ga0068854_100015430 3300005578 Bacteria 5060
252 Ga0068854_100181359 3300005578 Bacteria 1645
253 Ga0068856_100001905 3300005614 Bacteria 21761
254 Ga0068856_100006971 3300005614 Bacteria 11041
255 Ga0068856_100076986 3300005614 Bacteria 3305
256 Ga0068856_100198629 3300005614 Bacteria 2020
257 Ga0068856_100476600 3300005614 Bacteria 1269
258 Ga0068856_100643733 3300005614 Bacteria 1081
259 Ga0070702_100001524 3300005615 Bacteria 9532
260 Ga0070702_100011924 3300005615 Bacteria 4337
261 Ga0070702_100041489 3300005615 Bacteria 2581
262 Ga0068852_100002060 3300005616 Bacteria 13713
263 Ga0068852_100003513 3300005616 Bacteria 10963
264 Ga0068852_100545044 3300005616 Bacteria 1160
265 Ga0068859_100007372 3300005617 Bacteria 11158
266 Ga0068859_100011991 3300005617 Bacteria 8705
267 Ga0068859_100013161 3300005617 Bacteria 8311
268 Ga0068859_100029103 3300005617 Bacteria 5543
269 Ga0068864_100000137 3300005618 Bacteria 70702
270 Ga0068864_100000568 3300005618 Bacteria 31384
271 Ga0068864_100000931 3300005618 Bacteria 24535
272 Ga0068864_100001979 3300005618 Bacteria 16865
273 Ga0068864_100171386 3300005618 Bacteria 1979
274 Ga0068866_10000077 3300005718 Bacteria 39340
275 Ga0068866_10000847 3300005718 Bacteria 13547
276 Ga0068866_10006756 3300005718 Bacteria 4784
277 Ga0068866_10060997 3300005718 Bacteria 1957
278 Ga0068861_100003249 3300005719 Bacteria 10760
279 Ga0068861_100004720 3300005719 Bacteria 9159
280 Ga0068861_100006268 3300005719 Bacteria 8091
281 Ga0068851_10002100 3300005834 Bacteria 8762
282 Ga0068870_10000037 3300005840 Bacteria 42069
283 Ga0068870_10001288 3300005840 Bacteria 10089
284 Ga0068870_10083123 3300005840 Bacteria 1774
285 Ga0068863_100000165 3300005841 Bacteria 71079
286 Ga0068863_100000543 3300005841 Bacteria 38366
287 Ga0068863_100006063 3300005841 Bacteria 11861
288 Ga0068863_100054012 3300005841 Bacteria 3807
289 Ga0068863_100386052 3300005841 Bacteria 1368
290 Ga0068858_100002073 3300005842 Bacteria 20401
291 Ga0068858_100002582 3300005842 Bacteria 18238
292 Ga0068858_100002762 3300005842 Bacteria 17640
293 Ga0068858_100010851 3300005842 Bacteria 8613
294 Ga0068858_100127607 3300005842 Bacteria 2383
295 Ga0068860_100000308 3300005843 Bacteria 67784
296 Ga0068860_100006167 3300005843 Bacteria 12056
297 Ga0068860_100011915 3300005843 Bacteria 8570
298 Ga0068862_100000129 3300005844 Bacteria 88141
299 Ga0068862_100000879 3300005844 Bacteria 29265
300 Ga0068862_100003288 3300005844 Bacteria 13981
301 Ga0068862_100004095 3300005844 Bacteria 12362
302 Ga0068862_100042769 3300005844 Bacteria 3860
303 Ga0081455_10000007 3300005937 Bacteria 269394
304 Ga0081540_1000023 3300005983 Bacteria 159665
305 Ga0081539_10051336 3300005985 Bacteria 2325
306 Ga0070717_10000287 3300006028 Bacteria 34051
307 Ga0070717_10037821 3300006028 Bacteria 3920
308 Ga0070717_10149381 3300006028 Bacteria 2020
309 Ga0070717_10186558 3300006028 Bacteria 1810
310 Ga0075365_10092969 3300006038 Bacteria 2057
311 Ga0075365_10176537 3300006038 Bacteria 1492
312 Ga0075365_10273857 3300006038 Bacteria 1187
313 Ga0075368_10071085 3300006042 Bacteria 1405
314 Ga0075432_10023256 3300006058 Bacteria 2122
315 Ga0070715_10024067 3300006163 Bacteria 2394
316 Ga0070712_100057693 3300006175 Bacteria 2728
317 Ga0075367_10179357 3300006178 Bacteria 1320
318 Ga0075427_10001231 3300006194 Bacteria 3258
319 Ga0075366_10073842 3300006195 Bacteria 2033
320 Ga0097621_100000416 3300006237 Bacteria 29698
321 Ga0097621_100027373 3300006237 Bacteria 4482
322 Ga0097621_100100468 3300006237 Bacteria 2433
323 Ga0097621_100150502 3300006237 Bacteria 1996
324 Ga0075370_10069388 3300006353 Bacteria 2014
325 Ga0068871_100001611 3300006358 Bacteria 15188
326 Ga0068871_100014765 3300006358 Bacteria 5830
327 Ga0068871_100041387 3300006358 Bacteria 3694
328 Ga0075428_100067471 3300006844 Bacteria 3915
329 Ga0075428_100232278 3300006844 Bacteria 1990
330 Ga0075430_100003208 3300006846 Bacteria 13694
331 Ga0075430_100087427 3300006846 Bacteria 2608
332 Ga0075431_100010935 3300006847 Bacteria 9131
333 Ga0075433_10056950 3300006852 Bacteria 3416
334 Ga0075429_100039273 3300006880 Bacteria 4120
335 Ga0068865_100000118 3300006881 Bacteria 39940
336 Ga0068865_100000248 3300006881 Bacteria 30110
337 Ga0068865_100012159 3300006881 Bacteria 5412
338 Ga0068865_100065600 3300006881 Bacteria 2558
339 Ga0068865_100077250 3300006881 Bacteria 2379
340 Ga0068865_100188059 3300006881 Bacteria 1595
341 Ga0097620_100007372 3300006931 Bacteria 11158
342 Ga0097620_100011991 3300006931 Bacteria 8705
343 Ga0097620_100013161 3300006931 Bacteria 8311
344 Ga0097620_100029103 3300006931 Bacteria 5543
345 Ga0075435_100004999 3300007076 Bacteria 9203
346 Ga0075435_100025735 3300007076 Bacteria 4583
347 Ga0075435_100330249 3300007076 Bacteria 1306
348 Ga0099794_10016526 3300007265 Bacteria 3274
349 Ga0099794_10088989 3300007265 Bacteria 1531
350 Ga0099795_10008314 3300007788 Bacteria 2953
351 Ga0105251_10015311 3300009011 Bacteria 4199
352 Ga0105251_10025688 3300009011 Bacteria 3009
353 Ga0105240_10011679 3300009093 Bacteria 12203
354 Ga0105240_10057085 3300009093 Bacteria 4881
355 Ga0105240_10145262 3300009093 Bacteria 2831
356 Ga0105240_10154039 3300009093 Bacteria 2735
357 Ga0105240_10429084 3300009093 Bacteria 1483
358 Ga0105240_10688497 3300009093 Bacteria 1117
359 Ga0111539_10002489 3300009094 Bacteria 24423
360 Ga0111539_10005685 3300009094 Bacteria 16136
361 Ga0111539_10081451 3300009094 Bacteria 3807
362 Ga0111539_10101922 3300009094 Bacteria 3370
363 Ga0111539_10174789 3300009094 Bacteria 2509
364 Ga0105245_10004150 3300009098 Bacteria 12870
365 Ga0105245_10004689 3300009098 Bacteria 12086
366 Ga0105245_10014011 3300009098 Bacteria 6982
367 Ga0105247_10000929 3300009101 Bacteria 22043
368 Ga0105247_10003633 3300009101 Bacteria 10018
369 Ga0105247_10005076 3300009101 Bacteria 8342
370 Ga0105247_10049720 3300009101 Bacteria 2578
371 Ga0105247_10116467 3300009101 Bacteria 1726
372 Ga0114129_10076975 3300009147 Bacteria 4642
373 Ga0105243_10001705 3300009148 Bacteria 18936
374 Ga0105243_10075564 3300009148 Bacteria 2735
375 Ga0105243_10149303 3300009148 Bacteria 2003
376 Ga0105243_10438411 3300009148 Bacteria 1222
377 Ga0105243_10601772 3300009148 Bacteria 1058
378 Ga0105241_10017077 3300009174 Bacteria 5329
379 Ga0105241_10023853 3300009174 Bacteria 4539
380 Ga0105241_10051372 3300009174 Bacteria 3144
381 Ga0105242_10003502 3300009176 Bacteria 12201
382 Ga0105242_10015634 3300009176 Bacteria 5895
383 Ga0105242_10040244 3300009176 Bacteria 3766
384 Ga0105242_10473976 3300009176 Bacteria 1185
385 Ga0105242_10583075 3300009176 Bacteria 1077
386 Ga0105248_10005936 3300009177 Bacteria 13420
387 Ga0105248_10008717 3300009177 Bacteria 11140
388 Ga0105248_10019363 3300009177 Bacteria 7532
389 Ga0105248_10045910 3300009177 Bacteria 4898
390 Ga0105248_10069603 3300009177 Bacteria 3951
391 Ga0105248_10080320 3300009177 Bacteria 3665
392 Ga0105248_10154580 3300009177 Bacteria 2589
393 Ga0105248_10173133 3300009177 Bacteria 2433
394 Ga0105248_10228136 3300009177 Bacteria 2096
395 Ga0105237_10002357 3300009545 Bacteria 23450
396 Ga0105237_10032218 3300009545 Bacteria 5308
397 Ga0105237_10067332 3300009545 Bacteria 3575
398 Ga0105238_10051600 3300009551 Bacteria 4137
399 Ga0105238_10067773 3300009551 Bacteria 3569
400 Ga0105238_10072462 3300009551 Bacteria 3440
401 Ga0105238_10129678 3300009551 Bacteria 2500
402 Ga0105238_10176294 3300009551 Bacteria 2114
403 Ga0105238_10206051 3300009551 Bacteria 1942
404 Ga0105249_10000337 3300009553 Bacteria 47466
405 Ga0105249_10000476 3300009553 Bacteria 37263
406 Ga0105249_10002020 3300009553 Bacteria 17621
407 Ga0105249_10004624 3300009553 Bacteria 11890
408 Ga0105249_10028150 3300009553 Bacteria 5073
409 Ga0105249_10581614 3300009553 Bacteria 1173
410 Ga0105148_100006 3300009978 Bacteria 43932
411 Ga0105239_10007529 3300010375 Bacteria 12486
412 Ga0105239_10019578 3300010375 Bacteria 7471
413 Ga0105239_10098475 3300010375 Bacteria 3232
414 Ga0105239_10201460 3300010375 Bacteria 2230
415 Ga0105246_10000057 3300011119 Bacteria 44951
416 Ga0105246_10036594 3300011119 Bacteria 3290
417 Ga0105246_10108887 3300011119 Bacteria 2031
418 Ga0105246_10136654 3300011119 Bacteria 1838
419 Ga0105246_10275849 3300011119 Bacteria 1346
420 Ga0157338_1001612 3300012515 Bacteria 1643
421 Ga0157373_10015723 3300013100 Bacteria 5526
422 Ga0157373_10111768 3300013100 Bacteria 1921
423 Ga0157371_10001039 3300013102 Bacteria 30425
424 Ga0157371_10005939 3300013102 Bacteria 10190
425 Ga0157371_10135555 3300013102 Bacteria 1753
426 Ga0157371_10183164 3300013102 Bacteria 1498
427 Ga0157370_10069032 3300013104 Bacteria 3339
428 Ga0157370_10369686 3300013104 Bacteria 1321
429 Ga0157369_10002301 3300013105 Bacteria 22971
430 Ga0157369_10155854 3300013105 Bacteria 2412
431 Ga0157369_10332533 3300013105 Bacteria 1578
432 Ga0157374_10004809 3300013296 Bacteria 11335
433 Ga0157374_10106518 3300013296 Bacteria 2693
434 Ga0157374_10173881 3300013296 Bacteria 2102
435 Ga0157378_10001109 3300013297 Bacteria 24517
436 Ga0157378_10019819 3300013297 Bacteria 5914
437 Ga0157378_10216901 3300013297 Bacteria 1817
438 Ga0157378_10299254 3300013297 Bacteria 1556
439 Ga0157378_10627220 3300013297 Bacteria 1089
440 Ga0163162_10001328 3300013306 Bacteria 23105
441 Ga0163162_10001937 3300013306 Bacteria 19439
442 Ga0163162_10013041 3300013306 Bacteria 8112
443 Ga0163162_10064361 3300013306 Bacteria 3712
444 Ga0163162_10090498 3300013306 Bacteria 3141
445 Ga0163162_10299508 3300013306 Bacteria 1740
446 Ga0157372_10002547 3300013307 Bacteria 19761
447 Ga0157372_10048072 3300013307 Bacteria 4742
448 Ga0157372_10160956 3300013307 Bacteria 2594
449 Ga0157372_10319130 3300013307 Bacteria 1809
450 Ga0157375_10003994 3300013308 Bacteria 12794
451 Ga0157375_10013229 3300013308 Bacteria 7336
452 Ga0157375_10016002 3300013308 Bacteria 6728
453 Ga0157375_10023337 3300013308 Bacteria 5708
454 Ga0157375_10326985 3300013308 Bacteria 1698
455 Ga0163163_10001849 3300014325 Bacteria 17876
456 Ga0163163_10002371 3300014325 Bacteria 15940
457 Ga0163163_10009747 3300014325 Bacteria 8601
458 Ga0163163_10042318 3300014325 Bacteria 4461
459 Ga0163163_10052770 3300014325 Bacteria 4012
460 Ga0157380_10002362 3300014326 Bacteria 12682
461 Ga0157380_10059431 3300014326 Bacteria 3050
462 Ga0157380_10092131 3300014326 Bacteria 2504
463 Ga0157380_10204997 3300014326 Bacteria 1753
464 Ga0157377_10001240 3300014745 Bacteria 10912
465 Ga0157377_10006656 3300014745 Bacteria 5525
466 Ga0157379_10000293 3300014968 Bacteria 39625
467 Ga0157379_10000782 3300014968 Bacteria 25845
468 Ga0157379_10005209 3300014968 Bacteria 11167
469 Ga0157379_10018280 3300014968 Bacteria 6178
470 Ga0157376_10000531 3300014969 Bacteria 24495
471 Ga0157376_10003340 3300014969 Bacteria 11033
472 Ga0157376_10052615 3300014969 Bacteria 3386
473 Ga0157376_10080988 3300014969 Bacteria 2786
474 Ga0157376_10701371 3300014969 Bacteria 1017
475 Ga0163161_10000209 3300017792 Bacteria 53534
476 Ga0163161_10002426 3300017792 Bacteria 13333
477 Ga0163161_10063027 3300017792 Bacteria 2701
478 Ga0213876_10082027 3300021384 Bacteria 1706
479 Ga0213876_10104952 3300021384 Bacteria 1499
480 Ga0213876_10157141 3300021384 Bacteria 1210
481 Ga0224572_1020919 3300024225 Bacteria 1256
482 Ga0207666_1000011 3300025271 Bacteria 46553
483 Ga0207666_1000574 3300025271 Bacteria 4455
484 Ga0207673_1001238 3300025290 Bacteria 2750
485 Ga0207697_10000044 3300025315 Bacteria 48337
486 Ga0207697_10001213 3300025315 Bacteria 14099
487 Ga0207697_10008532 3300025315 Bacteria 4477
488 Ga0207697_10038033 3300025315 Bacteria 1973
489 Ga0207656_10000807 3300025321 Bacteria 10227
490 Ga0207713_1036012 3300025735 Bacteria 2128
491 Ga0207653_10001246 3300025885 Bacteria 8320
492 Ga0207682_10000260 3300025893 Bacteria 23782
493 Ga0207682_10001373 3300025893 Bacteria 11227
494 Ga0207682_10010268 3300025893 Bacteria 3671
495 Ga0207682_10046758 3300025893 Bacteria 1779
496 Ga0207692_10008612 3300025898 Bacteria 4229
497 Ga0207692_10019563 3300025898 Bacteria 3063
498 Ga0207692_10056391 3300025898 Bacteria 2015
499 Ga0207642_10000773 3300025899 Bacteria 9902
500 Ga0207642_10002298 3300025899 Bacteria 5954
501 Ga0207710_10002058 3300025900 Bacteria 9536
502 Ga0207710_10010446 3300025900 Bacteria 3909
503 Ga0207710_10012503 3300025900 Bacteria 3572
504 Ga0207710_10039920 3300025900 Bacteria 2079
505 Ga0207688_10000723 3300025901 Bacteria 16367
506 Ga0207688_10001743 3300025901 Bacteria 11542
507 Ga0207680_10001184 3300025903 Bacteria 12321
508 Ga0207680_10003528 3300025903 Bacteria 7362
509 Ga0207647_10002057 3300025904 Bacteria 15374
510 Ga0207647_10014545 3300025904 Bacteria 5423
511 Ga0207685_10023686 3300025905 Bacteria 2094
512 Ga0207685_10051937 3300025905 Bacteria 1586
513 Ga0207685_10073266 3300025905 Bacteria 1395
514 Ga0207699_10022496 3300025906 Bacteria 3417
515 Ga0207699_10113889 3300025906 Bacteria 1738
516 Ga0207699_10145414 3300025906 Bacteria 1562
517 Ga0207699_10156974 3300025906 Unclassified 1511
518 Ga0207645_10000281 3300025907 Bacteria 42381
519 Ga0207645_10000508 3300025907 Bacteria 32214
520 Ga0207645_10000844 3300025907 Bacteria 25580
521 Ga0207645_10158575 3300025907 Bacteria 1479
522 Ga0207643_10000011 3300025908 Bacteria 150819
523 Ga0207643_10000012 3300025908 Bacteria 133318
524 Ga0207643_10014023 3300025908 Bacteria 4348
525 Ga0207705_10026317 3300025909 Bacteria 4149
526 Ga0207705_10046556 3300025909 Bacteria 3117
527 Ga0207705_10121930 3300025909 Bacteria 1935
528 Ga0207654_10016109 3300025911 Bacteria 3888
529 Ga0207654_10166605 3300025911 Bacteria 1427
530 Ga0207707_10000551 3300025912 Bacteria 38020
531 Ga0207707_10039675 3300025912 Bacteria 4115
532 Ga0207707_10061187 3300025912 Bacteria 3276
533 Ga0207707_10139890 3300025912 Bacteria 2117
534 Ga0207707_10271659 3300025912 Bacteria 1469
535 Ga0207695_10008979 3300025913 Bacteria 12440
536 Ga0207695_10183995 3300025913 Bacteria 2009
537 Ga0207695_10622322 3300025913 Bacteria 961
538 Ga0207671_10002539 3300025914 Bacteria 19431
539 Ga0207671_10004326 3300025914 Bacteria 13645
540 Ga0207693_10004775 3300025915 Bacteria 11395
541 Ga0207693_10014915 3300025915 Bacteria 6241
542 Ga0207693_10021938 3300025915 Bacteria 5077
543 Ga0207693_10250082 3300025915 Bacteria 1391
544 Ga0207693_10445864 3300025915 Bacteria 1011
545 Ga0207663_10031908 3300025916 Bacteria 3122
546 Ga0207663_10091507 3300025916 Bacteria 2020
547 Ga0207663_10102512 3300025916 Bacteria 1925
548 Ga0207663_10259362 3300025916 Bacteria 1283
549 Ga0207663_10322699 3300025916 Bacteria 1161
550 Ga0207660_10000992 3300025917 Bacteria 18816
551 Ga0207660_10036735 3300025917 Bacteria 3407
552 Ga0207660_10038724 3300025917 Bacteria 3329
553 Ga0207660_10050004 3300025917 Bacteria 2967
554 Ga0207660_10055858 3300025917 Bacteria 2823
555 Ga0207660_10100054 3300025917 Bacteria 2164
556 Ga0207660_10165499 3300025917 Bacteria 1709
557 Ga0207660_10263159 3300025917 Bacteria 1364
558 Ga0207662_10000004 3300025918 Bacteria 128333
559 Ga0207662_10000123 3300025918 Bacteria 37327
560 Ga0207662_10004900 3300025918 Bacteria 7080
561 Ga0207657_10000358 3300025919 Bacteria 48238
562 Ga0207657_10001071 3300025919 Bacteria 28958
563 Ga0207657_10006368 3300025919 Bacteria 12262
564 Ga0207657_10188114 3300025919 Bacteria 1667
565 Ga0207649_10000545 3300025920 Bacteria 26032
566 Ga0207649_10001116 3300025920 Bacteria 16289
567 Ga0207649_10009605 3300025920 Bacteria 5297
568 Ga0207649_10160465 3300025920 Bacteria 1557
569 Ga0207652_10004318 3300025921 Bacteria 11589
570 Ga0207652_10029896 3300025921 Bacteria 4559
571 Ga0207652_10072763 3300025921 Bacteria 2989
572 Ga0207652_10082236 3300025921 Bacteria 2818
573 Ga0207652_10122007 3300025921 Bacteria 2319
574 Ga0207652_10210545 3300025921 Bacteria 1750
575 Ga0207681_10000286 3300025923 Bacteria 37397
576 Ga0207681_10002960 3300025923 Bacteria 10700
577 Ga0207681_10070726 3300025923 Bacteria 2431
578 Ga0207681_10174499 3300025923 Bacteria 1632
579 Ga0207694_10010993 3300025924 Bacteria 6837
580 Ga0207694_10054436 3300025924 Bacteria 3104
581 Ga0207694_10114904 3300025924 Bacteria 2144
582 Ga0207694_10286467 3300025924 Bacteria 1354
583 Ga0207650_10000064 3300025925 Bacteria 142969
584 Ga0207650_10000491 3300025925 Bacteria 32900
585 Ga0207650_10005306 3300025925 Bacteria 8794
586 Ga0207650_10019921 3300025925 Bacteria 4722
587 Ga0207650_10065506 3300025925 Bacteria 2723
588 Ga0207650_10134340 3300025925 Bacteria 1939
589 Ga0207659_10000023 3300025926 Bacteria 142947
590 Ga0207659_10000048 3300025926 Bacteria 83743
591 Ga0207659_10059360 3300025926 Bacteria 2749
592 Ga0207687_10000149 3300025927 Bacteria 46713
593 Ga0207687_10001075 3300025927 Bacteria 18526
594 Ga0207687_10009704 3300025927 Bacteria 6296
595 Ga0207687_10072492 3300025927 Bacteria 2464
596 Ga0207687_10286702 3300025927 Bacteria 1322
597 Ga0207700_10023416 3300025928 Bacteria 4257
598 Ga0207700_10054210 3300025928 Bacteria 3008
599 Ga0207700_10112263 3300025928 Bacteria 2195
600 Ga0207700_10128406 3300025928 Bacteria 2066
601 Ga0207700_10210989 3300025928 Bacteria 1642
602 Ga0207700_10376471 3300025928 Bacteria 1241
603 Ga0207664_10010848 3300025929 Bacteria 6451
604 Ga0207664_10205200 3300025929 Bacteria 1703
605 Ga0207664_10402331 3300025929 Bacteria 1218
606 Ga0207644_10000724 3300025931 Bacteria 20908
607 Ga0207644_10003325 3300025931 Bacteria 10377
608 Ga0207644_10087486 3300025931 Bacteria 2316
609 Ga0207644_10128859 3300025931 Bacteria 1934
610 Ga0207644_10222421 3300025931 Bacteria 1497
611 Ga0207690_10000203 3300025932 Bacteria 46451
612 Ga0207690_10000221 3300025932 Bacteria 43110
613 Ga0207690_10090553 3300025932 Bacteria 2159
614 Ga0207690_10100506 3300025932 Bacteria 2064
615 Ga0207706_10001046 3300025933 Bacteria 28083
616 Ga0207706_10001683 3300025933 Bacteria 21818
617 Ga0207706_10002188 3300025933 Bacteria 19056
618 Ga0207706_10014893 3300025933 Bacteria 7044
619 Ga0207706_10038655 3300025933 Bacteria 4233
620 Ga0207706_10119921 3300025933 Bacteria 2313
621 Ga0207686_10000995 3300025934 Bacteria 16847
622 Ga0207686_10007690 3300025934 Bacteria 5810
623 Ga0207686_10022973 3300025934 Bacteria 3596
624 Ga0207686_10027938 3300025934 Bacteria 3310
625 Ga0207709_10000607 3300025935 Bacteria 29669
626 Ga0207709_10007727 3300025935 Bacteria 5962
627 Ga0207709_10018652 3300025935 Bacteria 3889
628 Ga0207709_10254282 3300025935 Bacteria 1285
629 Ga0207670_10000125 3300025936 Bacteria 50796
630 Ga0207670_10000508 3300025936 Bacteria 21401
631 Ga0207670_10004752 3300025936 Bacteria 7367
632 Ga0207670_10029657 3300025936 Bacteria 3487
633 Ga0207670_10070528 3300025936 Bacteria 2414
634 Ga0207670_10185694 3300025936 Bacteria 1569
635 Ga0207669_10000357 3300025937 Bacteria 20792
636 Ga0207669_10001170 3300025937 Bacteria 11151
637 Ga0207669_10010638 3300025937 Bacteria 4437
638 Ga0207704_10000102 3300025938 Bacteria 47829
639 Ga0207704_10001003 3300025938 Bacteria 12514
640 Ga0207704_10065467 3300025938 Bacteria 2275
641 Ga0207704_10128879 3300025938 Bacteria 1747
642 Ga0207704_10316430 3300025938 Bacteria 1202
643 Ga0207665_10004285 3300025939 Bacteria 9482
644 Ga0207665_10145955 3300025939 Bacteria 1691
645 Ga0207691_10000256 3300025940 Bacteria 52748
646 Ga0207691_10000550 3300025940 Bacteria 37583
647 Ga0207691_10001163 3300025940 Bacteria 26132
648 Ga0207691_10072331 3300025940 Bacteria 3110
649 Ga0207691_10119625 3300025940 Bacteria 2335
650 Ga0207711_10003421 3300025941 Bacteria 13732
651 Ga0207711_10008837 3300025941 Bacteria 8420
652 Ga0207711_10012565 3300025941 Bacteria 7036
653 Ga0207711_10016967 3300025941 Bacteria 6048
654 Ga0207711_10043077 3300025941 Bacteria 3848
655 Ga0207711_10046162 3300025941 Bacteria 3722
656 Ga0207711_10106533 3300025941 Bacteria 2488
657 Ga0207711_10170042 3300025941 Bacteria 1977
658 Ga0207711_10472849 3300025941 Bacteria 1167
659 Ga0207689_10000008 3300025942 Bacteria 127942
660 Ga0207689_10000027 3300025942 Bacteria 100932
661 Ga0207689_10186300 3300025942 Bacteria 1712
662 Ga0207689_10430909 3300025942 Bacteria 1101
663 Ga0207661_10000104 3300025944 Bacteria 53977
664 Ga0207661_10009327 3300025944 Bacteria 7034
665 Ga0207661_10103129 3300025944 Bacteria 2400
666 Ga0207679_10000196 3300025945 Bacteria 48433
667 Ga0207679_10011389 3300025945 Bacteria 5757
668 Ga0207679_10067421 3300025945 Bacteria 2684
669 Ga0207667_10012594 3300025949 Bacteria 9728
670 Ga0207667_10034029 3300025949 Bacteria 5474
671 Ga0207667_10115111 3300025949 Bacteria 2771
672 Ga0207667_10115285 3300025949 Bacteria 2769
673 Ga0207667_10147683 3300025949 Bacteria 2420
674 Ga0207667_10161073 3300025949 Bacteria 2308
675 Ga0207667_10186655 3300025949 Bacteria 2128
676 Ga0207651_10000025 3300025960 Bacteria 72585
677 Ga0207651_10001000 3300025960 Bacteria 12479
678 Ga0207651_10180791 3300025960 Bacteria 1673
679 Ga0207651_10313259 3300025960 Bacteria 1309
680 Ga0207651_10352358 3300025960 Bacteria 1240
681 Ga0207712_10000156 3300025961 Bacteria 70300
682 Ga0207712_10001014 3300025961 Bacteria 19999
683 Ga0207712_10002218 3300025961 Bacteria 12644
684 Ga0207712_10014509 3300025961 Bacteria 5071
685 Ga0207712_10152239 3300025961 Bacteria 1788
686 Ga0207712_10184934 3300025961 Bacteria 1640
687 Ga0207712_10233568 3300025961 Bacteria 1478
688 Ga0207712_10319767 3300025961 Bacteria 1280
689 Ga0207668_10000251 3300025972 Bacteria 35861
690 Ga0207668_10000595 3300025972 Bacteria 22503
691 Ga0207668_10000783 3300025972 Bacteria 19460
692 Ga0207668_10010743 3300025972 Bacteria 5542
693 Ga0207640_10000157 3300025981 Bacteria 49126
694 Ga0207640_10001621 3300025981 Bacteria 12070
695 Ga0207640_10186656 3300025981 Bacteria 1559
696 Ga0207640_10355997 3300025981 Bacteria 1178
697 Ga0207658_10001085 3300025986 Bacteria 22019
698 Ga0207658_10002430 3300025986 Bacteria 13621
699 Ga0207658_10003467 3300025986 Bacteria 11150
700 Ga0207658_10033714 3300025986 Bacteria 3654
701 Ga0207658_10073036 3300025986 Bacteria 2603
702 Ga0207658_10156223 3300025986 Bacteria 1864
703 Ga0207677_10000609 3300026023 Bacteria 22003
704 Ga0207677_10000769 3300026023 Bacteria 18456
705 Ga0207677_10076415 3300026023 Bacteria 2384
706 Ga0207703_10000125 3300026035 Bacteria 92115
707 Ga0207703_10000193 3300026035 Bacteria 70671
708 Ga0207703_10000530 3300026035 Bacteria 39281
709 Ga0207703_10003859 3300026035 Bacteria 12455
710 Ga0207703_10132484 3300026035 Bacteria 2154
711 Ga0207639_10001949 3300026041 Bacteria 13856
712 Ga0207639_10002297 3300026041 Bacteria 12832
713 Ga0207639_10057177 3300026041 Bacteria 2993
714 Ga0207639_10064883 3300026041 Bacteria 2832
715 Ga0207678_10004329 3300026067 Bacteria 12744
716 Ga0207678_10008215 3300026067 Bacteria 9199
717 Ga0207678_10019030 3300026067 Bacteria 6031
718 Ga0207678_10058156 3300026067 Bacteria 3327
719 Ga0207678_10114069 3300026067 Bacteria 2306
720 Ga0207708_10002782 3300026075 Bacteria 12851
721 Ga0207708_10007180 3300026075 Bacteria 8235
722 Ga0207708_10035382 3300026075 Bacteria 3800
723 Ga0207708_10214874 3300026075 Bacteria 1538
724 Ga0207702_10006150 3300026078 Bacteria 10390
725 Ga0207702_10016459 3300026078 Bacteria 6120
726 Ga0207702_10037662 3300026078 Bacteria 4049
727 Ga0207702_10080783 3300026078 Bacteria 2822
728 Ga0207702_10195723 3300026078 Bacteria 1871
729 Ga0207702_10696435 3300026078 Bacteria 1001
730 Ga0207641_10003122 3300026088 Bacteria 14896
731 Ga0207641_10010526 3300026088 Bacteria 7590
732 Ga0207641_10011900 3300026088 Bacteria 7137
733 Ga0207641_10178079 3300026088 Bacteria 1945
734 Ga0207641_10481848 3300026088 Bacteria 1202
735 Ga0207641_10694818 3300026088 Bacteria 1001
736 Ga0207648_10001281 3300026089 Bacteria 28081
737 Ga0207648_10001448 3300026089 Bacteria 26132
738 Ga0207648_10005563 3300026089 Bacteria 12680
739 Ga0207648_10008182 3300026089 Bacteria 10165
740 Ga0207648_10027139 3300026089 Bacteria 5085
741 Ga0207676_10000141 3300026095 Bacteria 62869
742 Ga0207676_10001238 3300026095 Bacteria 19004
743 Ga0207676_10031668 3300026095 Bacteria 3978
744 Ga0207676_10108939 3300026095 Bacteria 2313
745 Ga0207676_10342268 3300026095 Bacteria 1380
746 Ga0207676_10429202 3300026095 Bacteria 1241
747 Ga0207674_10000738 3300026116 Bacteria 42793
748 Ga0207674_10009174 3300026116 Bacteria 11343
749 Ga0207674_10107504 3300026116 Bacteria 2766
750 Ga0207675_100000004 3300026118 Bacteria 210328
751 Ga0207675_100000604 3300026118 Bacteria 35079
752 Ga0207675_100001525 3300026118 Bacteria 23219
753 Ga0207675_100013369 3300026118 Bacteria 7659
754 Ga0207675_100710429 3300026118 Bacteria 1015
755 Ga0207683_10000006 3300026121 Bacteria 181260
756 Ga0207683_10001096 3300026121 Bacteria 24667
757 Ga0207683_10001361 3300026121 Bacteria 22115
758 Ga0207683_10015012 3300026121 Bacteria 6591
759 Ga0207683_10069343 3300026121 Bacteria 3114
760 Ga0207698_10000378 3300026142 Bacteria 25887
761 Ga0207698_10001953 3300026142 Bacteria 12108
762 Ga0207698_10284239 3300026142 Bacteria 1532
763 Ga0207698_10303401 3300026142 Bacteria 1487
764 Ga0209967_1001997 3300027364 Bacteria 2632
765 Ga0209984_1003158 3300027424 Bacteria 1872
766 Ga0209995_1023795 3300027471 Bacteria 1019
767 Ga0209999_1010111 3300027543 Bacteria 1704
768 Ga0209982_1012504 3300027552 Bacteria 1274
769 Ga0209970_1006414 3300027614 Bacteria 1929
770 Ga0210002_1002058 3300027617 Bacteria 2902
771 Ga0210002_1009177 3300027617 Bacteria 1511
772 Ga0209983_1003202 3300027665 Bacteria 3513
773 Ga0209971_1000338 3300027682 Bacteria 12967
774 Ga0209966_1004428 3300027695 Bacteria 2382
775 Ga0209998_10000168 3300027717 Bacteria 24295
776 Ga0209998_10002910 3300027717 Bacteria 3833
777 Ga0209998_10003848 3300027717 Bacteria 3244
778 Ga0209813_10018076 3300027866 Bacteria 1944
779 Ga0209974_10000232 3300027876 Bacteria 18009
780 Ga0207428_10000165 3300027907 Bacteria 91701
781 Ga0207428_10000446 3300027907 Bacteria 50240
782 Ga0207428_10001251 3300027907 Bacteria 27203
783 Ga0268266_10000207 3300028379 Bacteria 102761
784 Ga0268266_10000497 3300028379 Bacteria 56202
785 Ga0268266_10012277 3300028379 Bacteria 7411
786 Ga0268266_10033418 3300028379 Bacteria 4372
787 Ga0268266_10150931 3300028379 Bacteria 2094
788 Ga0268265_10000677 3300028380 Bacteria 33608
789 Ga0268265_10001687 3300028380 Bacteria 18006
790 Ga0268265_10002274 3300028380 Bacteria 14632
791 Ga0268265_10028697 3300028380 Bacteria 3987
792 Ga0268265_10500083 3300028380 Bacteria 1145
793 Ga0268264_10000301 3300028381 Bacteria 80467
794 Ga0268264_10000360 3300028381 Bacteria 67798
795 Ga0268264_10002029 3300028381 Bacteria 18124
796 Ga0268264_10097281 3300028381 Bacteria 2551
797 Ga0265318_10012399 3300028577 Bacteria 3631
798 Ga0307517_10004082 3300028786 Bacteria 22535
799 Ga0307517_10036004 3300028786 Bacteria 5582
800 Ga0307517_10154577 3300028786 Bacteria 1561
801 Ga0265338_10010532 3300028800 Bacteria 10815
802 Ga0265330_10051814 3300031235 Bacteria 1799
803 Ga0265330_10080292 3300031235 Bacteria 1405
804 Ga0265332_10007662 3300031238 Bacteria 4879
805 Ga0265332_10011536 3300031238 Bacteria 3926
806 Ga0265332_10070700 3300031238 Bacteria 1487
807 Ga0265325_10000026 3300031241 Bacteria 109937
808 Ga0265325_10000181 3300031241 Bacteria 44985
809 Ga0265325_10015466 3300031241 Bacteria 4289
810 Ga0265325_10070818 3300031241 Bacteria 1751
811 Ga0265325_10094403 3300031241 Bacteria 1471
812 Ga0265340_10010050 3300031247 Bacteria 5068
813 Ga0265340_10045083 3300031247 Bacteria 2155
814 Ga0265340_10091469 3300031247 Bacteria 1421
815 Ga0265339_10002985 3300031249 Bacteria 11941
816 Ga0265339_10061077 3300031249 Bacteria 2029
817 Ga0265339_10121726 3300031249 Bacteria 1341
818 Ga0265331_10011565 3300031250 Bacteria 4828
819 Ga0265331_10014098 3300031250 Bacteria 4270
820 Ga0265331_10017257 3300031250 Bacteria 3770
821 Ga0265316_10072301 3300031344 Bacteria 2657
822 Ga0307408_100044422 3300031548 Bacteria 3166
823 Ga0307408_100243712 3300031548 Bacteria 1479
824 Ga0265313_10000358 3300031595 Bacteria 49794
825 Ga0265313_10053441 3300031595 Bacteria 1922
826 Ga0265313_10058519 3300031595 Bacteria 1816
827 Ga0265313_10065203 3300031595 Bacteria 1691
828 Ga0265314_10001510 3300031711 Bacteria 25753
829 Ga0265314_10033367 3300031711 Bacteria 3776
830 Ga0265314_10047472 3300031711 Bacteria 3021
831 Ga0265314_10051817 3300031711 Bacteria 2857
832 Ga0265314_10096788 3300031711 Bacteria 1908
833 Ga0265342_10000096 3300031712 Bacteria 97237
834 Ga0265342_10000502 3300031712 Bacteria 41908
835 Ga0265342_10007165 3300031712 Bacteria 8208
836 Ga0265342_10017496 3300031712 Bacteria 4659
837 Ga0265342_10021946 3300031712 Bacteria 4068
838 Ga0307410_10066390 3300031852 Unclassified 2485
839 Ga0307409_100030057 3300031995 Bacteria 3898
840 Ga0307411_10127994 3300032005 Unclassified 1851
841 Ga0307415_100128682 3300032126 Unclassified 1913
842 Ga0307510_10064048 3300033180 Bacteria 3736
843 Ga0307510_10323959 3300033180 Bacteria 997
844 Ga0373930_0000613 3300034816 Bacteria 4947
845 Ga0373930_0000992 3300034816 Bacteria 4078
846 Ga0373948_0000083 3300034817 Bacteria 9733
847 Ga0373950_0007316 3300034818 Bacteria 1710
848 Ga0373958_0002135 3300034819 Bacteria 2740
849 Ga0373959_0006063 3300034820 Bacteria 1996
850 Ga0373938_0001037 3300034957 Bacteria 4468
851 Ga0373926_0057960 3300035083 Bacteria 1407
852 Ga0373928_0013130 3300035084 Bacteria 1660
853 Ga0373929_0000847 3300035085 Bacteria 5955
854 Ga0373934_0006693 3300035086 Bacteria 4283
855 Ga0373940_0000931 3300035088 Bacteria 4952
856 Ga0373949_0002681 3300035090 Bacteria 4468
857 Ga0373949_0002749 3300035090 Bacteria 4392
858 Ga0373951_0000469 3300035091 Bacteria 11565
859 Ga0373951_0001389 3300035091 Bacteria 6360
860 Ga0373952_0001783 3300035092 Bacteria 3918
861 Ga0373952_0002699 3300035092 Bacteria 3202
862 Ga0373932_0000757 3300035112 Bacteria 9626
863 Ga0373932_0005374 3300035112 Bacteria 3014
864 Ga0373932_0017314 3300035112 Bacteria 1849
865 Ga0373932_0018395 3300035112 Bacteria 1806
866 Ga0373936_0000140 3300035113 Bacteria 25032
867 Ga0373936_0032890 3300035113 Bacteria 2053
868 Ga0373936_0042418 3300035113 Bacteria 1826
869 Ga0373939_0000487 3300035114 Bacteria 10018
870 Ga0373939_0002471 3300035114 Bacteria 4360
871 Ga0373939_0028942 3300035114 Bacteria 1581
872 Ga0373941_0000083 3300035115 Bacteria 15466
873 Ga0373941_0007268 3300035115 Bacteria 2705
874 Ga0373941_0024289 3300035115 Bacteria 1740
875 Ga0373945_0013570 3300035116 Bacteria 2720
876 Ga0373945_0024587 3300035116 Bacteria 2088
877 Ga0373945_0046025 3300035116 Bacteria 1591
878 Ga0373953_0000297 3300035117 Bacteria 13618
879 Ga0373953_0008802 3300035117 Bacteria 3443
880 Ga0373953_0025432 3300035117 Bacteria 2262
881 Ga0373954_0003422 3300035118 Bacteria 6726
882 Ga0373954_0013833 3300035118 Bacteria 3596
883 Ga0373954_0039629 3300035118 Bacteria 2193
884 Ga0373956_0003044 3300035119 Bacteria 6786
885 Ga0373956_0023887 3300035119 Bacteria 2628
886 Ga0373956_0028591 3300035119 Bacteria 2427
887 Ga0373956_0029686 3300035119 Bacteria 2386
888 Ga0373957_0000766 3300035120 Bacteria 8338
889 Ga0373957_0002369 3300035120 Bacteria 5362
890 Ga0373960_0000185 3300035121 Bacteria 11147
891 Ga0373943_0004574 3300035170 Bacteria 6251
892 Ga0373943_0012583 3300035170 Bacteria 3814
893 Ga0373943_0013519 3300035170 Bacteria 3687
894 Ga0373943_0020370 3300035170 Bacteria 3056
895 Ga0373943_0052297 3300035170 Bacteria 2014
896 Ga0373946_0003338 3300035171 Bacteria 5697
897 Ga0373946_0009415 3300035171 Bacteria 3597
898 Ga0373946_0029581 3300035171 Bacteria 2181
899 Ga0373955_0000121 3300035172 Bacteria 31151
900 Ga0373955_0002341 3300035172 Bacteria 8255
901 Ga0373955_0025869 3300035172 Bacteria 3018
902 Ga0373942_0004921 3300035207 Bacteria 3098
903 Ga0373961_0000569 3300035241 Bacteria 13935
904 Ga0373961_0028343 3300035241 Bacteria 1544
905 Ga0373962_0001061 3300035242 Bacteria 6395
906 Ga0373962_0001225 3300035242 Bacteria 5999
907 Ga0373962_0036828 3300035242 Bacteria 1364
908 Ga0373924_0003715 3300035410 Bacteria 5272
909 Ga0373924_0020927 3300035410 Bacteria 2547
910 Ga0373924_0027227 3300035410 Bacteria 2272
911 Ga0373924_0197960 3300035410 Bacteria 886
912 Ga0373931_0001480 3300035691 Bacteria 10101
913 Ga0373931_0025503 3300035691 Bacteria 3003
914 Ga0373935_0020984 3300035692 Bacteria 3995
915 Ga0373935_0120300 3300035692 Bacteria 1753
916 Ga0373935_0447121 3300035692 Bacteria 933
917 Ga0373927_0006188 3300035695 Bacteria 8178
918 Ga0373927_0009234 3300035695 Bacteria 6615
919 Ga0373927_0030544 3300035695 Bacteria 3515
920 Ga0373927_0035875 3300035695 Bacteria 3226
921 Ga0373927_0071910 3300035695 Bacteria 2238
922 Ga0373927_0077328 3300035695 Bacteria 2155
923 Ga0373927_0106256 3300035695 Bacteria 1828
924 Ga0373927_0137221 3300035695 Bacteria 1599
925 Ga0373933_0003839 3300035724 Bacteria 8297
926 Ga0373933_0004297 3300035724 Bacteria 7823
927 Ga0373933_0016466 3300035724 Bacteria 4135
928 Ga0373933_0106527 3300035724 Bacteria 1744
929 Ga0373947_0001544 3300035725 Bacteria 14129
930 Ga0373947_0039246 3300035725 Bacteria 2816
931 Ga0373947_0070024 3300035725 Bacteria 2148
932 Ga0373947_0175377 3300035725 Bacteria 1393
933 Ga0373947_0192984 3300035725 Bacteria 1329
934 Ga0373937_0001392 3300036401 Bacteria 20206
935 Ga0373937_0033041 3300036401 Bacteria 4695
936 Ga0373937_0039790 3300036401 Bacteria 4284
937 Ga0373937_0722594 3300036401 Bacteria 943
938 Ga0373925_0000016 3300037068 Bacteria 176830
939 Ga0373925_0024955 3300037068 Bacteria 4366
940 Ga0373925_0125815 3300037068 Bacteria 1994
941 Ga0373925_0183746 3300037068 Bacteria 1656
942 Ga0373925_0201305 3300037068 Bacteria 1583
943 Ga0373925_0418111 3300037068 Bacteria 1095
944 Ga0395899_0127819 3300037312 Bacteria 1817
945 Ga0395900_0025306 3300037418 Bacteria 6077
946 Ga0395900_0184320 3300037418 Bacteria 2119
947 Ga0395900_0550675 3300037418 Bacteria 1098
948 Ga0395898_0016015 3300037466 Bacteria 7679
949 Ga0395898_0054822 3300037466 Bacteria 3889
950 Ga0436364_0036319 3300037853 Bacteria 3843
951 Ga0395901_0178644 3300038443 Bacteria 2226
952 Ga0395901_0203937 3300038443 Bacteria 2072
953 Ga0395901_0216199 3300038443 Bacteria 2005
954 Ga0242420_000941 3300038996 Bacteria 3647
955 Ga0436365_0405014 3300039437 Bacteria 3576
956 Ga0436365_0948695 3300039437 Bacteria 2565
957 Ga0436365_1269494 3300039437 Bacteria 2741
958 Ga0436365_1280755 3300039437 Bacteria 7070
959 Ga0436365_1866778 3300039437 Bacteria 8832
960 Ga0436360_0375466 3300039438 Bacteria 1002
961 Ga0436360_0645527 3300039438 Bacteria 1198
962 Ga0436360_1061551 3300039438 Bacteria 1636
963 Ga0436361_1178821 3300039447 Bacteria 2381
964 Ga0436363_0005935 3300039450 Bacteria 1722
965 Ga0436363_0182318 3300039450 Bacteria 1623
966 Ga0436363_0438395 3300039450 Bacteria 994
967 Ga0436363_0752414 3300039450 Bacteria 6526
968 Ga0439453_0000287 3300041408 Bacteria 5237
969 Ga0451853_1876261 3300041512 Bacteria 1007
970 Ga0439443_000311 3300042003 Bacteria 4023
971 Ga0439448_0020673 3300042005 Bacteria 2039
972 Ga0439448_0045884 3300042005 Bacteria 1423
973 Ga0439458_0016844 3300042157 Bacteria 1664
974 Ga0439435_0002311 3300042436 Bacteria 3756
975 Ga0439460_0011722 3300042461 Bacteria 2265
976 Ga0439460_0058438 3300042461 Bacteria 1172
977 Ga0451577_0142177 3300042876 Bacteria 2157
978 Ga0439440_0029891 3300042993 Bacteria 1281
979 Ga0466963_0051694 3300044694 Bacteria 2724
980 Ga0466963_0228176 3300044694 Bacteria 1305
981 Ga0466963_0382954 3300044694 Bacteria 991
982 Ga0466964_0242495 3300044706 Bacteria 885
983 Ga0453684_0057110 3300044712 Bacteria 5056
984 Ga0466957_0098436 3300044842 Bacteria 1840
985 Ga0466957_0110148 3300044842 Bacteria 1745
986 Ga0466959_0239065 3300045049 Bacteria 1255
987 Ga0451576_0054772 3300045051 Bacteria 4175
988 Ga0466967_0029957 3300045976 Bacteria 4561
989 Ga0466967_0257003 3300045976 Bacteria 1670
990 Ga0466967_0328136 3300045976 Bacteria 1477
991 Ga0495592_0000044 3300046454 Bacteria 118749
992 Ga0495592_0011150 3300046454 Bacteria 6789
993 Ga0495592_0078676 3300046454 Bacteria 2388
994 Ga0495592_0285604 3300046454 Bacteria 1078
995 Ga0495603_0093270 3300046455 Bacteria 1759
996 Ga0495603_0202372 3300046455 Bacteria 1147
997 Ga0495629_0000908 3300046459 Bacteria 23774
998 Ga0495629_0001495 3300046459 Bacteria 18379
999 Ga0495629_0103934 3300046459 Bacteria 1981
1000 Ga0495641_0018252 3300046461 Bacteria 3624
1001 Ga0495641_0071094 3300046461 Bacteria 1562
1002 Ga0495651_0000384 3300046462 Bacteria 34361
1003 Ga0495651_0005140 3300046462 Bacteria 9974
1004 Ga0495651_0011671 3300046462 Bacteria 6753
1005 Ga0495651_0014623 3300046462 Bacteria 6068
1006 Ga0495651_0034295 3300046462 Bacteria 3956
1007 Ga0495651_0052883 3300046462 Bacteria 3127
1008 Ga0495651_0204309 3300046462 Bacteria 1380
1009 Ga0495653_0000022 3300046463 Bacteria 169653
1010 Ga0495653_0001587 3300046463 Bacteria 17855
1011 Ga0495653_0013468 3300046463 Bacteria 6663
1012 Ga0495653_0013657 3300046463 Bacteria 6619
1013 Ga0495653_0046604 3300046463 Bacteria 3356
1014 Ga0495653_0076516 3300046463 Bacteria 2488
1015 Ga0495653_0207086 3300046463 Bacteria 1327
1016 Ga0495580_0049192 3300046472 Bacteria 2983
1017 Ga0495580_0062588 3300046472 Bacteria 2610
1018 Ga0495582_0019944 3300046473 Bacteria 3668
1019 Ga0495582_0030062 3300046473 Bacteria 2981
1020 Ga0495582_0031626 3300046473 Bacteria 2909
1021 Ga0495582_0033109 3300046473 Bacteria 2841
1022 Ga0495582_0057756 3300046473 Bacteria 2140
1023 Ga0495639_0145408 3300046475 Bacteria 1141
1024 Ga0495662_0002060 3300046476 Bacteria 10076
1025 Ga0495662_0006129 3300046476 Bacteria 6009
1026 Ga0495662_0019655 3300046476 Bacteria 3268
1027 Ga0495662_0063836 3300046476 Bacteria 1779
1028 Ga0495664_0000013 3300046477 Bacteria 204282
1029 Ga0495664_0010358 3300046477 Bacteria 5230
1030 Ga0495584_0006013 3300046491 Bacteria 6392
1031 Ga0495584_0052280 3300046491 Bacteria 2056
1032 Ga0495585_0004651 3300046492 Bacteria 8855
1033 Ga0495594_0013695 3300046499 Bacteria 4238
1034 Ga0495594_0087005 3300046499 Bacteria 1748
1035 Ga0495594_0200197 3300046499 Bacteria 1138
1036 Ga0495607_0023913 3300046501 Bacteria 3817
1037 Ga0495608_0000004 3300046511 Bacteria 355027
1038 Ga0495608_0008967 3300046511 Bacteria 6992
1039 Ga0495608_0033665 3300046511 Bacteria 3460
1040 Ga0495608_0041310 3300046511 Bacteria 3087
1041 Ga0495618_0000032 3300046514 Bacteria 104874
1042 Ga0495618_0001734 3300046514 Bacteria 14479
1043 Ga0495618_0013805 3300046514 Bacteria 4914
1044 Ga0495618_0110565 3300046514 Bacteria 1759
1045 Ga0495628_0000014 3300046516 Bacteria 205818
1046 Ga0495628_0000115 3300046516 Bacteria 65159
1047 Ga0495628_0089871 3300046516 Bacteria 2378
1048 Ga0495628_0148581 3300046516 Bacteria 1785
1049 Ga0495630_0004635 3300046517 Bacteria 9643
1050 Ga0495630_0011417 3300046517 Bacteria 6434
1051 Ga0495630_0111347 3300046517 Bacteria 2073
1052 Ga0495630_0114111 3300046517 Bacteria 2047
1053 Ga0495630_0121838 3300046517 Bacteria 1978
1054 Ga0495637_0026655 3300046520 Bacteria 2592
1055 Ga0495644_0002617 3300046523 Bacteria 7162
1056 Ga0495663_0080130 3300046525 Bacteria 1051
1057 Ga0495666_0138689 3300046526 Bacteria 1134
1058 Ga0495652_0000002 3300046529 Bacteria 946606
1059 Ga0495652_0003686 3300046529 Bacteria 14995
1060 Ga0495652_0003875 3300046529 Bacteria 14587
1061 Ga0495652_0022889 3300046529 Bacteria 5543
1062 Ga0495652_0079902 3300046529 Bacteria 2702
1063 Ga0495652_0082877 3300046529 Bacteria 2641
1064 Ga0495652_0098127 3300046529 Bacteria 2382
1065 Ga0495665_0016233 3300046531 Bacteria 4012
1066 Ga0495640_0000001 3300046533 Bacteria 853827
1067 Ga0495640_0002426 3300046533 Bacteria 14966
1068 Ga0495640_0024962 3300046533 Bacteria 4342
1069 Ga0495640_0094869 3300046533 Bacteria 1964
1070 Ga0495586_0046247 3300046535 Bacteria 2346
1071 Ga0495586_0106121 3300046535 Bacteria 1562
1072 Ga0495587_0000004 3300046536 Bacteria 358433
1073 Ga0495587_0002412 3300046536 Bacteria 12454
1074 Ga0495587_0108284 3300046536 Bacteria 1597
1075 Ga0495598_0001141 3300046537 Bacteria 5109
1076 Ga0495645_0000001 3300046543 Bacteria 657910
1077 Ga0495645_0008003 3300046543 Bacteria 7359
1078 Ga0495645_0014956 3300046543 Bacteria 5514
1079 Ga0495645_0152431 3300046543 Bacteria 1604
1080 Ga0495645_0182985 3300046543 Bacteria 1434
1081 Ga0495645_0312370 3300046543 Bacteria 1023
1082 Ga0495622_0017391 3300046557 Bacteria 3346
1083 Ga0495622_0051388 3300046557 Bacteria 1912
1084 Ga0495633_0005351 3300046558 Bacteria 7871
1085 Ga0495667_0000009 3300046559 Bacteria 223329
1086 Ga0495667_0012187 3300046559 Bacteria 5824
1087 Ga0495667_0031459 3300046559 Bacteria 3562
1088 Ga0495667_0035970 3300046559 Bacteria 3307
1089 Ga0495656_0005591 3300046615 Bacteria 4346
1090 Ga0495634_0000033 3300046642 Bacteria 109811
1091 Ga0495634_0014694 3300046642 Bacteria 5636
1092 Ga0495634_0018450 3300046642 Bacteria 4967
1093 Ga0495634_0208305 3300046642 Bacteria 1211
1094 Ga0495634_0221214 3300046642 Bacteria 1168
1095 Ga0495611_0055220 3300046648 Bacteria 1797
1096 Ga0495635_0000003 3300046663 Bacteria 390055
1097 Ga0495635_0001500 3300046663 Bacteria 15653
1098 Ga0495635_0018371 3300046663 Bacteria 4879
1099 Ga0495635_0025464 3300046663 Bacteria 4121
1100 Ga0495635_0025906 3300046663 Bacteria 4084
1101 Ga0495635_0114215 3300046663 Bacteria 1843
1102 Ga0495659_0001874 3300046664 Bacteria 6943
1103 Ga0495661_0055859 3300046665 Bacteria 2365
1104 Ga0495588_0005740 3300046674 Bacteria 5540
1105 Ga0495588_0095502 3300046674 Bacteria 1559
1106 Ga0495657_0000138 3300046675 Bacteria 65458
1107 Ga0495657_0014554 3300046675 Bacteria 5772
1108 Ga0495657_0137699 3300046675 Bacteria 1524
1109 Ga0495599_0000030 3300046678 Bacteria 113715
1110 Ga0495599_0002434 3300046678 Bacteria 10840
1111 Ga0495599_0292576 3300046678 Bacteria 984
1112 Ga0495623_0000059 3300046679 Bacteria 67952
1113 Ga0495623_0004365 3300046679 Bacteria 9307
1114 Ga0495623_0013790 3300046679 Bacteria 5239
1115 Ga0495646_0000031 3300046680 Bacteria 87445
1116 Ga0495646_0001361 3300046680 Bacteria 14457
1117 Ga0495646_0157758 3300046680 Bacteria 1258
1118 Ga0495647_0002299 3300046681 Bacteria 5995
1119 Ga0495658_0002673 3300046683 Bacteria 8972
1120 Ga0495658_0011071 3300046683 Bacteria 4526
1121 Ga0495658_0020975 3300046683 Bacteria 3438
1122 Ga0495658_0070242 3300046683 Bacteria 2031
1123 Ga0495658_0070639 3300046683 Bacteria 2026
1124 Ga0495613_0042220 3300046689 Bacteria 3375
1125 Ga0495613_0078712 3300046689 Bacteria 2398
1126 Ga0495613_0099462 3300046689 Bacteria 2101
1127 Ga0495613_0149353 3300046689 Bacteria 1667
1128 Ga0495624_0022269 3300046690 Bacteria 4192
1129 Ga0495624_0045990 3300046690 Bacteria 2776
1130 Ga0495670_0000479 3300046691 Bacteria 18937
1131 Ga0495589_0064295 3300046794 Bacteria 1799
1132 Ga0495600_0000003 3300046809 Bacteria 180457
1133 Ga0495600_0024479 3300046809 Bacteria 3887
1134 Ga0495600_0035224 3300046809 Bacteria 3250
1135 Ga0495581_0011221 3300047315 Bacteria 5181
1136 Ga0495581_0109524 3300047315 Bacteria 1606
1137 Ga0495604_0000002 3300047317 Bacteria 530904
1138 Ga0495604_0001990 3300047317 Bacteria 16501
1139 Ga0495604_0030332 3300047317 Bacteria 4294
1140 Ga0495604_0033338 3300047317 Bacteria 4078
1141 Ga0495604_0038955 3300047317 Bacteria 3737
1142 Ga0495636_0046007 3300047318 Bacteria 1820
1143 Ga0495674_0000004 3300047319 Bacteria 531855
1144 Ga0495674_0000575 3300047319 Bacteria 34286
1145 Ga0495674_0005198 3300047319 Bacteria 12501
1146 Ga0495674_0017159 3300047319 Bacteria 6742
1147 Ga0495674_0059571 3300047319 Bacteria 3334
1148 Ga0495674_0079574 3300047319 Bacteria 2814
1149 Ga0495674_0082219 3300047319 Bacteria 2761
1150 Ga0495674_0341660 3300047319 Bacteria 1216
1151 Ga0495676_0017161 3300047321 Bacteria 6406
1152 Ga0495676_0153273 3300047321 Bacteria 1637
1153 Ga0495680_0000676 3300047322 Bacteria 38110
1154 Ga0495680_0018591 3300047322 Bacteria 5892
1155 Ga0495680_0019866 3300047322 Bacteria 5663
1156 Ga0495680_0026792 3300047322 Bacteria 4746
1157 Ga0495680_0029533 3300047322 Bacteria 4489
1158 Ga0495675_0000048 3300047444 Bacteria 81486
1159 Ga0495675_0001520 3300047444 Bacteria 14017
1160 Ga0495675_0020343 3300047444 Bacteria 4220
1161 Ga0495675_0051440 3300047444 Bacteria 2616
1162 Ga0495675_0084970 3300047444 Bacteria 1990
1163 Ga0495684_0000019 3300047471 Bacteria 153938
1164 Ga0495684_0017475 3300047471 Bacteria 5522
1165 Ga0495684_0037312 3300047471 Bacteria 3727
1166 Ga0495686_0056001 3300047472 Bacteria 2464
1167 Ga0495593_0006402 3300047673 Bacteria 6906
1168 Ga0495593_0026370 3300047673 Bacteria 3209
1169 Ga0495593_0101637 3300047673 Bacteria 1474
1170 Ga0495593_0115580 3300047673 Bacteria 1368
1171 Ga0495602_0000001 3300048088 Bacteria 510904
1172 Ga0495602_0023818 3300048088 Bacteria 5955
1173 Ga0495602_0034502 3300048088 Bacteria 4732
1174 Ga0495602_0179865 3300048088 Bacteria 1632
1175 Ga0495602_0220184 3300048088 Bacteria 1433
1176 Ga0496100_0001037 3300048903 Bacteria 13421
1177 Ga0496100_0027866 3300048903 Bacteria 3477
1178 Ga0496100_0041163 3300048903 Bacteria 2943
1179 Ga0496100_0046087 3300048903 Bacteria 2801
1180 Ga0496101_0000464 3300048904 Bacteria 25674
1181 Ga0496101_0003701 3300048904 Bacteria 9535
1182 Ga0496101_0033242 3300048904 Bacteria 3636
1183 Ga0496101_0050339 3300048904 Bacteria 2998
1184 Ga0496101_0075982 3300048904 Bacteria 2474
1185 Ga0496101_0245388 3300048904 Bacteria 1394
1186 Ga0496102_0000109 3300048905 Bacteria 117315
1187 Ga0496102_0001120 3300048905 Bacteria 24582
1188 Ga0496102_0006511 3300048905 Bacteria 9963
1189 Ga0496102_0017284 3300048905 Bacteria 6318
1190 Ga0496102_0042908 3300048905 Bacteria 4099
1191 Ga0496102_0069508 3300048905 Bacteria 3232
1192 Ga0496102_0091703 3300048905 Bacteria 2813
1193 Ga0496102_0171787 3300048905 Bacteria 2040
1194 Ga0496103_0000181 3300048906 Bacteria 64065
1195 Ga0496103_0000611 3300048906 Bacteria 27883
1196 Ga0496103_0033257 3300048906 Bacteria 3150
1197 Ga0496103_0033988 3300048906 Bacteria 3117
1198 Ga0496103_0101169 3300048906 Bacteria 1824
1199 Ga0496104_0000299 3300048907 Bacteria 43965
1200 Ga0496104_0016816 3300048907 Bacteria 6648
1201 Ga0496104_0022722 3300048907 Bacteria 5761
1202 Ga0496104_0029701 3300048907 Bacteria 5072
1203 Ga0496104_0052506 3300048907 Bacteria 3851
1204 Ga0496104_0191902 3300048907 Bacteria 1954
1205 Ga0496104_0210560 3300048907 Bacteria 1855
1206 Ga0496104_0220300 3300048907 Bacteria 1810
1207 Ga0496104_0568116 3300048907 Bacteria 1045
1208 Ga0496105_0001270 3300048908 Bacteria 17643
1209 Ga0496105_0001374 3300048908 Bacteria 17129
1210 Ga0496105_0062354 3300048908 Bacteria 3076
1211 Ga0496105_0077085 3300048908 Bacteria 2753
1212 Ga0496105_0088222 3300048908 Bacteria 2562
1213 Ga0496106_0000541 3300048909 Bacteria 26824
1214 Ga0496106_0013112 3300048909 Bacteria 6117
1215 Ga0496106_0029493 3300048909 Bacteria 4088
1216 Ga0496106_0029616 3300048909 Bacteria 4081
1217 Ga0496106_0069918 3300048909 Bacteria 2680
1218 Ga0496106_0283435 3300048909 Bacteria 1327
1219 Ga0496107_0000493 3300048910 Bacteria 21794
1220 Ga0496107_0020737 3300048910 Bacteria 4644
1221 Ga0496107_0025307 3300048910 Bacteria 4202
1222 Ga0496107_0081921 3300048910 Bacteria 2353
1223 Ga0496107_0128915 3300048910 Bacteria 1867
1224 Ga0496107_0312540 3300048910 Bacteria 1169
1225 Ga0496108_0001251 3300048911 Bacteria 19871
1226 Ga0496108_0009140 3300048911 Bacteria 8022
1227 Ga0496108_0021394 3300048911 Bacteria 5316
1228 Ga0496108_0023341 3300048911 Bacteria 5088
1229 Ga0496108_0034850 3300048911 Bacteria 4182
1230 Ga0496108_0057901 3300048911 Bacteria 3255
1231 Ga0496108_0558448 3300048911 Bacteria 998
1232 Ga0496108_0674761 3300048911 Bacteria 897
1233 Ga0496109_0003457 3300048912 Bacteria 13191
1234 Ga0496109_0003885 3300048912 Bacteria 12475
1235 Ga0496109_0011044 3300048912 Bacteria 7744
1236 Ga0496109_0028976 3300048912 Bacteria 4957
1237 Ga0496109_0096922 3300048912 Bacteria 2733
1238 Ga0496109_0106326 3300048912 Bacteria 2606
1239 Ga0496109_0459416 3300048912 Bacteria 1202
1240 Ga0496110_0018558 3300048913 Bacteria 5833
1241 Ga0496110_0018993 3300048913 Bacteria 5777
1242 Ga0496110_0052760 3300048913 Bacteria 3573
1243 Ga0496110_0132905 3300048913 Bacteria 2247
1244 Ga0496110_0144867 3300048913 Bacteria 2148
1245 Ga0496110_0174927 3300048913 Bacteria 1948
1246 Ga0496110_0253593 3300048913 Bacteria 1601
1247 Ga0496111_0002007 3300048914 Bacteria 12109
1248 Ga0496111_0021214 3300048914 Bacteria 4533
1249 Ga0496111_0030829 3300048914 Bacteria 3815
1250 Ga0496111_0036078 3300048914 Bacteria 3535
1251 Ga0496111_0147173 3300048914 Bacteria 1746
1252 Ga0496112_0001013 3300048915 Bacteria 20620
1253 Ga0496112_0007480 3300048915 Bacteria 9695
1254 Ga0496112_0017113 3300048915 Bacteria 6805
1255 Ga0496112_0072404 3300048915 Bacteria 3406
1256 Ga0496112_0092462 3300048915 Bacteria 2994
1257 Ga0496112_0284697 3300048915 Bacteria 1599
1258 Ga0496113_0001926 3300048916 Bacteria 11873
1259 Ga0496113_0050089 3300048916 Bacteria 3112
1260 Ga0496113_0053403 3300048916 Bacteria 3021
1261 Ga0496113_0067556 3300048916 Bacteria 2711
1262 Ga0496113_0079168 3300048916 Bacteria 2515
1263 Ga0496113_0101046 3300048916 Bacteria 2235
1264 Ga0496113_0144370 3300048916 Bacteria 1874
1265 Ga0496113_0255593 3300048916 Bacteria 1399
1266 Ga0496114_0002139 3300048917 Bacteria 15018
1267 Ga0496114_0003043 3300048917 Bacteria 12845
1268 Ga0496114_0009948 3300048917 Bacteria 7559
1269 Ga0496114_0227947 3300048917 Bacteria 1636
1270 Ga0496115_0000042 3300048918 Bacteria 118348
1271 Ga0496115_0003177 3300048918 Bacteria 11804
1272 Ga0496115_0033657 3300048918 Bacteria 4047
1273 Ga0496115_0058773 3300048918 Bacteria 3095
1274 Ga0496115_0125575 3300048918 Bacteria 2113
1275 Ga0496115_0193218 3300048918 Bacteria 1681
1276 Ga0496115_0251025 3300048918 Bacteria 1456
1277 Ga0496116_0001662 3300048919 Bacteria 24440
1278 Ga0496117_0000398 3300048920 Bacteria 74273
1279 Ga0496117_0003997 3300048920 Bacteria 16649
1280 Ga0496118_0000109 3300048921 Bacteria 153067
1281 Ga0496118_0162271 3300048921 Bacteria 1380
1282 Ga0496119_0003011 3300048922 Bacteria 17849
1283 Ga0496120_0135786 3300048923 Bacteria 1254
1284 Ga0496120_0141808 3300048923 Bacteria 1219
1285 Ga0496121_0000292 3300048924 Bacteria 103415
1286 Ga0496121_0000687 3300048924 Bacteria 63021
1287 Ga0496121_0017483 3300048924 Bacteria 7322
1288 Ga0496121_0160697 3300048924 Bacteria 1643
1289 Ga0496122_0082409 3300048925 Bacteria 2234
1290 Ga0496123_0045779 3300048926 Bacteria 2976
1291 Ga0496123_0051274 3300048926 Bacteria 2749
1292 Ga0496124_0000201 3300048927 Bacteria 117658
1293 Ga0496124_0001004 3300048927 Bacteria 44711
1294 Ga0496124_0056227 3300048927 Bacteria 3319
1295 Ga0496125_0251629 3300048928 Unclassified 1114
1296 Ga0496126_0000654 3300048929 Bacteria 64276
1297 Ga0496126_0003401 3300048929 Bacteria 20112
1298 Ga0496126_0136309 3300048929 Bacteria 2117
1299 Ga0501031_0297545 3300049568 Bacteria 1046
1300 Ga0501032_0024422 3300049569 Bacteria 4174
1301 Ga0501032_0047880 3300049569 Bacteria 2886
1302 Ga0501033_0050841 3300049570 Bacteria 3073
1303 Ga0501033_0056964 3300049570 Bacteria 2888
1304 Ga0501034_0000229 3300049571 Bacteria 105030
1305 Ga0501034_0011795 3300049571 Bacteria 9045
1306 Ga0501034_0014761 3300049571 Bacteria 8040
1307 Ga0501034_0042297 3300049571 Bacteria 4612
1308 Ga0501034_0098401 3300049571 Bacteria 2921
1309 Ga0501034_0144626 3300049571 Bacteria 2355
1310 Ga0501036_0015929 3300049572 Bacteria 6278
1311 Ga0501036_0243908 3300049572 Bacteria 1507
1312 Ga0501036_0465999 3300049572 Bacteria 1052
1313 Ga0501037_0026325 3300049573 Bacteria 4298
1314 Ga0501038_0026706 3300049574 Bacteria 5140
1315 Ga0501038_0061506 3300049574 Bacteria 3211
1316 Ga0501038_0109670 3300049574 Bacteria 2287
1317 Ga0501038_0190706 3300049574 Bacteria 1649
1318 Ga0501039_0075578 3300049575 Bacteria 2619
1319 Ga0501039_0131946 3300049575 Bacteria 1960
1320 Ga0501043_0004699 3300049579 Bacteria 11070
1321 Ga0501043_0007918 3300049579 Bacteria 8398
1322 Ga0501043_0013539 3300049579 Bacteria 6382
1323 Ga0501043_0090558 3300049579 Bacteria 2405
1324 Ga0501046_0019671 3300049580 Bacteria 5595
1325 Ga0501047_0018077 3300049581 Bacteria 6756
1326 Ga0501047_0054113 3300049581 Bacteria 3882
1327 Ga0501047_0059048 3300049581 Bacteria 3704
1328 Ga0501047_0087709 3300049581 Bacteria 2989
1329 Ga0501047_0118321 3300049581 Bacteria 2531
1330 Ga0501047_0138151 3300049581 Bacteria 2316
1331 Ga0501047_0191795 3300049581 Bacteria 1906
1332 Ga0501047_0410515 3300049581 Bacteria 1186
1333 Ga0501048_0031437 3300049582 Bacteria 3839
1334 Ga0501067_0018314 3300049583 Bacteria 3880
1335 Ga0501067_0025722 3300049583 Bacteria 3262
1336 Ga0501067_0037634 3300049583 Bacteria 2687
1337 Ga0501068_0008616 3300049584 Bacteria 5682
1338 Ga0501070_0017087 3300049586 Bacteria 6089
1339 Ga0501070_0027804 3300049586 Bacteria 4743
1340 Ga0501070_0044504 3300049586 Bacteria 3693
1341 Ga0501070_0056372 3300049586 Bacteria 3257
1342 Ga0501070_0148709 3300049586 Bacteria 1933
1343 Ga0501070_0340928 3300049586 Bacteria 1217
1344 Ga0501071_0043591 3300049587 Bacteria 3217
1345 Ga0501072_0056479 3300049588 Bacteria 3093
1346 Ga0501072_0072612 3300049588 Bacteria 2720
1347 Ga0501073_0008726 3300049589 Bacteria 7505
1348 Ga0501073_0009055 3300049589 Bacteria 7349
1349 Ga0501073_0077243 3300049589 Bacteria 2317
1350 Ga0501074_0004160 3300049590 Bacteria 10331
1351 Ga0501074_0195305 3300049590 Bacteria 1442
1352 Ga0501075_0043671 3300049591 Bacteria 3362
1353 Ga0501076_0102712 3300049592 Bacteria 2305
1354 Ga0501076_0182301 3300049592 Bacteria 1712
1355 Ga0501077_0008005 3300049593 Bacteria 6532
1356 Ga0501211_000078 3300049658 Bacteria 6823
1357 Ga0501223_000005 3300049663 Bacteria 137995
1358 Ga0501235_005113 3300049669 Bacteria 2850
1359 Ga0501246_000350 3300049676 Bacteria 3252
1360 Ga0501225_0004933 3300049705 Bacteria 3942
1361 Ga0501079_0519446 3300049741 Bacteria 936
1362 Ga0501080_0004770 3300049742 Bacteria 12094
1363 Ga0501080_0024968 3300049742 Bacteria 5543
1364 Ga0501080_0191059 3300049742 Bacteria 1881
1365 Ga0501083_0011693 3300049744 Bacteria 6153
1366 Ga0501083_0055261 3300049744 Bacteria 2663
1367 Ga0501083_0080871 3300049744 Bacteria 2154
1368 Ga0501035_0016880 3300049822 Bacteria 6731
1369 Ga0501035_0025614 3300049822 Bacteria 5406
1370 Ga0501035_0058572 3300049822 Bacteria 3432
1371 Ga0501035_0155601 3300049822 Bacteria 1981
1372 Ga0501044_0005671 3300049823 Bacteria 13838
1373 Ga0501044_0020182 3300049823 Bacteria 7112
1374 Ga0501044_0058669 3300049823 Bacteria 3946
1375 Ga0501044_0060192 3300049823 Bacteria 3889
1376 Ga0501044_0069757 3300049823 Bacteria 3578
1377 Ga0501044_0106377 3300049823 Bacteria 2817
1378 Ga0501044_0359814 3300049823 Bacteria 1373
1379 nmdc:mga03683_109015_c1 3300050489 Bacteria 1223
1380 nmdc:mga03683_119684_c1 3300050489 Bacteria 1170
1381 nmdc:mga03n38_180299_c1 3300050490 Bacteria 1082
1382 nmdc:mga00v17_145541_c1 3300050491 Bacteria 1521
1383 nmdc:mga0yw44_195059_c1 3300050492 Bacteria 1336
1384 nmdc:mga0yw44_79672_c1 3300050492 Bacteria 2050
1385 nmdc:mga0k408_46867_c1 3300050493 Bacteria 2497
1386 nmdc:mga0k408_93897_c1 3300050493 Bacteria 1764
1387 nmdc:mga06z11_46856_c1 3300050494 Bacteria 2193
1388 nmdc:mga07m45_98142_c1 3300050496 Bacteria 1682
1389 nmdc:mga05p37_33600_c1 3300050507 Bacteria 6283
1390 nmdc:mga09592_12517_c1 3300050508 Bacteria 6913
1391 nmdc:mga0qj67_33232_c1 3300050509 Bacteria 4025
1392 nmdc:mga0qj67_693_c1 3300050509 Bacteria 22941
1393 nmdc:mga06r32_1056_c1 3300050510 Bacteria 24895
1394 nmdc:mga06r32_475647_c1 3300050510 Bacteria 1228
1395 nmdc:mga06r32_70450_c1 3300050510 Bacteria 3382
1396 nmdc:mga08y16_160719_c1 3300050511 Bacteria 2334
1397 nmdc:mga08y16_3020_c1 3300050511 Bacteria 17372
1398 nmdc:mga08y16_33369_c1 3300050511 Bacteria 5406
1399 nmdc:mga08y16_3846_c1 3300050511 Bacteria 15611
1400 nmdc:mga08y16_5716_c1 3300050511 Bacteria 13032
1401 nmdc:mga08y16_604368_c1 3300050511 Bacteria 1105
1402 nmdc:mga0n895_118025_c1 3300050512 Bacteria 2673
1403 nmdc:mga0n895_184514_c1 3300050512 Bacteria 2117
1404 nmdc:mga0n895_248280_c1 3300050512 Bacteria 1806
1405 nmdc:mga0n895_291_c1 3300050512 Bacteria 33000
1406 nmdc:mga0rr50_29605_c1 3300050513 Bacteria 3865
1407 nmdc:mga0rr50_344834_c1 3300050513 Bacteria 1252
1408 nmdc:mga0rr50_89309_c1 3300050513 Bacteria 2396
1409 nmdc:mga0a205_10048_c1 3300050515 Bacteria 8685
1410 nmdc:mga0a205_280241_c1 3300050515 Bacteria 1542
1411 nmdc:mga0a205_36116_c1 3300050515 Bacteria 4748
1412 nmdc:mga0a205_4627_c1 3300050515 Bacteria 12336
1413 Ga0495601_0000002 3300053077 Bacteria 528704
1414 Ga0495601_0000305 3300053077 Bacteria 26104
1415 Ga0495601_0001692 3300053077 Bacteria 12181
1416 Ga0495601_0001865 3300053077 Bacteria 11743
1417 Ga0495601_0006428 3300053077 Bacteria 6872
1418 Ga0495601_0086844 3300053077 Bacteria 2010
1419 Ga0495601_0090911 3300053077 Bacteria 1964
1420 Ga0495612_0000012 3300053078 Bacteria 223883
1421 Ga0495612_0000569 3300053078 Bacteria 14847
1422 Ga0495612_0003420 3300053078 Bacteria 6580
1423 Ga0495612_0007881 3300053078 Bacteria 4342
1424 Ga0495612_0012688 3300053078 Bacteria 3396
1425 Ga0495595_0000012 3300053084 Bacteria 174322
1426 Ga0495595_0000258 3300053084 Bacteria 21114
1427 Ga0495595_0006191 3300053084 Bacteria 4868
1428 Ga0495595_0009308 3300053084 Bacteria 4059
1429 Ga0495595_0010174 3300053084 Bacteria 3907
1430 Ga0495595_0186052 3300053084 Bacteria 1031
1431 Ga0495619_0000003 3300053085 Bacteria 515784
1432 Ga0495619_0000159 3300053085 Bacteria 49689
1433 Ga0495619_0000628 3300053085 Bacteria 23297
1434 Ga0495619_0002083 3300053085 Bacteria 13288
1435 Ga0495619_0004989 3300053085 Bacteria 8428
1436 Ga0495619_0013002 3300053085 Bacteria 5243
1437 Ga0495619_0026797 3300053085 Bacteria 3710
1438 Ga0495619_0105693 3300053085 Bacteria 1919
1439 Ga0495619_0162360 3300053085 Bacteria 1543
1440 Ga0495619_0202857 3300053085 Bacteria 1373
1441 Ga0500643_000315 3300053087 Bacteria 39356
1442 Ga0500643_003668 3300053087 Bacteria 7250
1443 Ga0500643_003696 3300053087 Bacteria 7213
1444 Ga0500644_0000375 3300053088 Bacteria 21830
1445 Ga0500651_0013892 3300053093 Bacteria 4917
1446 Ga0500556_0002149 3300053104 Bacteria 6691
1447 Ga0500562_002034 3300053108 Bacteria 5064
1448 Ga0500595_000002 3300053119 Bacteria 1074388
1449 Ga0500616_0000002 3300053153 Bacteria 1611257
1450 Ga0500616_0014363 3300053153 Bacteria 4553
1451 Ga0500645_002132 3300053730 Bacteria 9107
1452 Ga0500645_003502 3300053730 Bacteria 6344
1453 Ga0501084_0119829 3300054114 Bacteria 2212
1454 Ga0501082_0000036 3300060353 Bacteria 95930
1455 Ga0501082_0071462 3300060353 Bacteria 2988
1456 Ga0501082_0288980 3300060353 Bacteria 1427
1457 Ga0530510_0093093 3300061734 Bacteria 2200

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001977 JGI24746J21847_1004166 JGI24746J21847_10041663 238
2 3300041512 Ga0451853_1876261 Ga0451853_1876261_104_919 256
3 3300001989 JGI24739J22299_10070181 JGI24739J22299_100701812 257
4 3300002070 JGI24750J21931_1005084 JGI24750J21931_10050842 257
5 3300002076 JGI24749J21850_1000804 JGI24749J21850_10008042 257
6 3300005293 Ga0065715_10175305 Ga0065715_101753052 257
7 3300005327 Ga0070658_10000687 Ga0070658_1000068718 257
8 3300005328 Ga0070676_10001378 Ga0070676_100013787 257
9 3300005329 Ga0070683_100020587 Ga0070683_1000205872 257
10 3300005330 Ga0070690_100000493 Ga0070690_1000004937 257
11 3300005331 Ga0070670_100008041 Ga0070670_1000080414 257
12 3300005333 Ga0070677_10001450 Ga0070677_100014504 257
13 3300005334 Ga0068869_100000380 Ga0068869_1000003806 257
14 3300005335 Ga0070666_10006364 Ga0070666_100063643 257
15 3300005338 Ga0068868_100005016 Ga0068868_1000050167 257
16 3300005339 Ga0070660_100000866 Ga0070660_10000086613 257
17 3300005340 Ga0070689_100009342 Ga0070689_1000093424 257
18 3300005343 Ga0070687_100000157 Ga0070687_10000015711 257
19 3300005344 Ga0070661_100000706 Ga0070661_10000070616 257
20 3300005347 Ga0070668_100000726 Ga0070668_10000072613 257
21 3300005353 Ga0070669_100001744 Ga0070669_10000174411 257
22 3300005354 Ga0070675_100007109 Ga0070675_1000071097 257
23 3300005355 Ga0070671_100004442 Ga0070671_1000044427 257
24 3300005356 Ga0070674_100000480 Ga0070674_10000048012 257
25 3300005364 Ga0070673_100000309 Ga0070673_10000030914 257
26 3300005365 Ga0070688_100002233 Ga0070688_1000022337 257
27 3300005366 Ga0070659_100000172 Ga0070659_10000017232 257
28 3300005367 Ga0070667_100005276 Ga0070667_1000052767 257
29 3300005438 Ga0070701_10013330 Ga0070701_100133303 257
30 3300005440 Ga0070705_100000789 Ga0070705_1000007895 257
31 3300005441 Ga0070700_100027531 Ga0070700_1000275313 257
32 3300005444 Ga0070694_100107520 Ga0070694_1001075203 257
33 3300005444 Ga0070694_100184961 Ga0070694_1001849612 257
34 3300005455 Ga0070663_100010034 Ga0070663_1000100345 257
35 3300005456 Ga0070678_100010744 Ga0070678_1000107442 257
36 3300005457 Ga0070662_100003948 Ga0070662_1000039487 257
37 3300005459 Ga0068867_100008914 Ga0068867_1000089144 257
38 3300005466 Ga0070685_10000473 Ga0070685_1000047314 257
39 3300005535 Ga0070684_100050300 Ga0070684_1000503002 257
40 3300005539 Ga0068853_100014676 Ga0068853_1000146763 257
41 3300005543 Ga0070672_100004680 Ga0070672_1000046804 257
42 3300005544 Ga0070686_100006028 Ga0070686_1000060282 257
43 3300005545 Ga0070695_100003412 Ga0070695_1000034127 257
44 3300005545 Ga0070695_100199957 Ga0070695_1001999571 257
45 3300005546 Ga0070696_100051449 Ga0070696_1000514492 257
46 3300005546 Ga0070696_100196219 Ga0070696_1001962192 257
47 3300005547 Ga0070693_100005170 Ga0070693_1000051705 257
48 3300005548 Ga0070665_100052367 Ga0070665_1000523672 257
49 3300005563 Ga0068855_100001441 Ga0068855_1000014417 257
50 3300005564 Ga0070664_100003578 Ga0070664_1000035787 257
51 3300005577 Ga0068857_100000691 Ga0068857_10000069114 257
52 3300005578 Ga0068854_100001617 Ga0068854_1000016177 257
53 3300005614 Ga0068856_100006971 Ga0068856_1000069714 257
54 3300005615 Ga0070702_100011924 Ga0070702_1000119243 257
55 3300005616 Ga0068852_100002060 Ga0068852_1000020608 257
56 3300005617 Ga0068859_100007372 Ga0068859_1000073724 257
57 3300005618 Ga0068864_100001979 Ga0068864_1000019797 257
58 3300005718 Ga0068866_10000847 Ga0068866_1000084710 257
59 3300005719 Ga0068861_100006268 Ga0068861_1000062684 257
60 3300005834 Ga0068851_10002100 Ga0068851_100021008 257
61 3300005840 Ga0068870_10001288 Ga0068870_100012887 257
62 3300005841 Ga0068863_100006063 Ga0068863_1000060638 257
63 3300005842 Ga0068858_100010851 Ga0068858_1000108516 257
64 3300005843 Ga0068860_100011915 Ga0068860_1000119154 257
65 3300005844 Ga0068862_100003288 Ga0068862_1000032887 257
66 3300005983 Ga0081540_1000023 Ga0081540_1000023110 257
67 3300006237 Ga0097621_100027373 Ga0097621_1000273733 257
68 3300006358 Ga0068871_100014765 Ga0068871_1000147653 257
69 3300006881 Ga0068865_100000118 Ga0068865_1000001188 257
70 3300006931 Ga0097620_100007372 Ga0097620_1000073729 257
71 3300009093 Ga0105240_10011679 Ga0105240_100116798 257
72 3300009098 Ga0105245_10004689 Ga0105245_100046899 257
73 3300009101 Ga0105247_10000929 Ga0105247_100009295 257
74 3300009174 Ga0105241_10017077 Ga0105241_100170775 257
75 3300009176 Ga0105242_10015634 Ga0105242_100156342 257
76 3300009177 Ga0105248_10045910 Ga0105248_100459103 257
77 3300009545 Ga0105237_10002357 Ga0105237_100023576 257
78 3300009551 Ga0105238_10072462 Ga0105238_100724622 257
79 3300009553 Ga0105249_10002020 Ga0105249_1000202011 257
80 3300010375 Ga0105239_10019578 Ga0105239_100195782 257
81 3300011119 Ga0105246_10036594 Ga0105246_100365943 257
82 3300013102 Ga0157371_10001039 Ga0157371_1000103917 257
83 3300013105 Ga0157369_10002301 Ga0157369_1000230114 257
84 3300013296 Ga0157374_10106518 Ga0157374_101065183 257
85 3300013297 Ga0157378_10001109 Ga0157378_1000110917 257
86 3300013306 Ga0163162_10013041 Ga0163162_100130419 257
87 3300013307 Ga0157372_10002547 Ga0157372_100025472 257
88 3300013308 Ga0157375_10013229 Ga0157375_100132294 257
89 3300014325 Ga0163163_10001849 Ga0163163_1000184911 257
90 3300014745 Ga0157377_10006656 Ga0157377_100066563 257
91 3300014968 Ga0157379_10000782 Ga0157379_100007825 257
92 3300014969 Ga0157376_10003340 Ga0157376_100033407 257
93 3300014969 Ga0157376_10080988 Ga0157376_100809883 257
94 3300017792 Ga0163161_10002426 Ga0163161_1000242613 257
95 3300025315 Ga0207697_10001213 Ga0207697_100012139 257
96 3300025321 Ga0207656_10000807 Ga0207656_100008075 257
97 3300025893 Ga0207682_10001373 Ga0207682_100013735 257
98 3300025899 Ga0207642_10000773 Ga0207642_100007734 257
99 3300025900 Ga0207710_10002058 Ga0207710_100020586 257
100 3300025901 Ga0207688_10001743 Ga0207688_100017437 257
101 3300025903 Ga0207680_10003528 Ga0207680_100035285 257
102 3300025904 Ga0207647_10002057 Ga0207647_1000205711 257
103 3300025907 Ga0207645_10000844 Ga0207645_1000084418 257
104 3300025908 Ga0207643_10000011 Ga0207643_1000001119 257
105 3300025909 Ga0207705_10026317 Ga0207705_100263172 257
106 3300025911 Ga0207654_10016109 Ga0207654_100161094 257
107 3300025913 Ga0207695_10008979 Ga0207695_100089799 257
108 3300025914 Ga0207671_10002539 Ga0207671_100025396 257
109 3300025916 Ga0207663_10091507 Ga0207663_100915071 257
110 3300025918 Ga0207662_10000004 Ga0207662_1000000411 257
111 3300025919 Ga0207657_10001071 Ga0207657_1000107120 257
112 3300025920 Ga0207649_10001116 Ga0207649_1000111612 257
113 3300025921 Ga0207652_10210545 Ga0207652_102105452 257
114 3300025923 Ga0207681_10002960 Ga0207681_100029609 257
115 3300025924 Ga0207694_10010993 Ga0207694_100109932 257
116 3300025925 Ga0207650_10000491 Ga0207650_1000049118 257
117 3300025926 Ga0207659_10000048 Ga0207659_100000488 257
118 3300025927 Ga0207687_10001075 Ga0207687_100010757 257
119 3300025931 Ga0207644_10003325 Ga0207644_100033256 257
120 3300025932 Ga0207690_10000221 Ga0207690_1000022134 257
121 3300025933 Ga0207706_10001046 Ga0207706_100010469 257
122 3300025934 Ga0207686_10007690 Ga0207686_100076902 257
123 3300025935 Ga0207709_10007727 Ga0207709_100077274 257
124 3300025936 Ga0207670_10000508 Ga0207670_100005088 257
125 3300025937 Ga0207669_10001170 Ga0207669_100011706 257
126 3300025938 Ga0207704_10000102 Ga0207704_100001028 257
127 3300025940 Ga0207691_10001163 Ga0207691_1000116319 257
128 3300025941 Ga0207711_10003421 Ga0207711_100034219 257
129 3300025942 Ga0207689_10000027 Ga0207689_1000002714 257
130 3300025944 Ga0207661_10009327 Ga0207661_100093272 257
131 3300025945 Ga0207679_10011389 Ga0207679_100113892 257
132 3300025949 Ga0207667_10012594 Ga0207667_100125948 257
133 3300025960 Ga0207651_10000025 Ga0207651_1000002557 257
134 3300025961 Ga0207712_10002218 Ga0207712_100022189 257
135 3300025972 Ga0207668_10010743 Ga0207668_100107434 257
136 3300025981 Ga0207640_10001621 Ga0207640_100016216 257
137 3300025986 Ga0207658_10002430 Ga0207658_1000243010 257
138 3300026023 Ga0207677_10000769 Ga0207677_100007697 257
139 3300026035 Ga0207703_10000125 Ga0207703_1000012575 257
140 3300026041 Ga0207639_10002297 Ga0207639_100022973 257
141 3300026067 Ga0207678_10008215 Ga0207678_100082155 257
142 3300026075 Ga0207708_10214874 Ga0207708_102148743 257
143 3300026078 Ga0207702_10006150 Ga0207702_100061503 257
144 3300026088 Ga0207641_10010526 Ga0207641_100105263 257
145 3300026089 Ga0207648_10001281 Ga0207648_1000128117 257
146 3300026095 Ga0207676_10001238 Ga0207676_100012389 257
147 3300026116 Ga0207674_10000738 Ga0207674_1000073816 257
148 3300026118 Ga0207675_100000004 Ga0207675_10000000420 257
149 3300026121 Ga0207683_10001361 Ga0207683_1000136114 257
150 3300026142 Ga0207698_10001953 Ga0207698_100019539 257
151 3300028379 Ga0268266_10000207 Ga0268266_1000020717 257
152 3300028380 Ga0268265_10002274 Ga0268265_100022743 257
153 3300028381 Ga0268264_10000301 Ga0268264_100003018 257
154 3300035410 Ga0373924_0197960 Ga0373924_0197960_45_866 257
155 3300035692 Ga0373935_0447121 Ga0373935_0447121_10_831 257
156 3300036401 Ga0373937_0722594 Ga0373937_0722594_86_907 257
157 3300037068 Ga0373925_0024955 Ga0373925_0024955_2202_3023 257
158 3300046472 Ga0495580_0049192 Ga0495580_0049192_985_1806 257
159 3300047472 Ga0495686_0056001 Ga0495686_0056001_495_1313 257
160 3300048903 Ga0496100_0046087 Ga0496100_0046087_231_1049 257
161 3300048904 Ga0496101_0033242 Ga0496101_0033242_248_1066 257
162 3300048905 Ga0496102_0017284 Ga0496102_0017284_3677_4498 257
163 3300048906 Ga0496103_0101169 Ga0496103_0101169_663_1484 257
164 3300048907 Ga0496104_0568116 Ga0496104_0568116_32_853 257
165 3300048909 Ga0496106_0029616 Ga0496106_0029616_761_1582 257
166 3300048910 Ga0496107_0081921 Ga0496107_0081921_1343_2161 257
167 3300048911 Ga0496108_0034850 Ga0496108_0034850_1003_1824 257
168 3300048911 Ga0496108_0674761 Ga0496108_0674761_10_852 257
169 3300048912 Ga0496109_0011044 Ga0496109_0011044_3141_3962 257
170 3300048915 Ga0496112_0001013 Ga0496112_0001013_2126_2947 257
171 3300048916 Ga0496113_0067556 Ga0496113_0067556_1422_2243 257
172 3300048918 Ga0496115_0125575 Ga0496115_0125575_250_1068 257
173 3300049583 Ga0501067_0037634 Ga0501067_0037634_540_1358 257
174 3300049589 Ga0501073_0077243 Ga0501073_0077243_1144_1962 257
175 3300050515 nmdc:mga0a205_280241_c1 nmdc:mga0a205_280241_c1_416_1237 257
176 3300005337 Ga0070682_100015610 Ga0070682_1000156102 258
177 3300005455 Ga0070663_100006081 Ga0070663_1000060812 258
178 3300009176 Ga0105242_10583075 Ga0105242_105830751 258
179 3300039450 Ga0436363_0438395 Ga0436363_0438395_83_904 258
180 3300003911 JGI25405J52794_10009851 JGI25405J52794_100098512 260
181 3300031548 Ga0307408_100044422 Ga0307408_1000444224 260
182 3300031852 Ga0307410_10066390 Ga0307410_100663902 260
183 3300031995 Ga0307409_100030057 Ga0307409_1000300572 260
184 3300032005 Ga0307411_10127994 Ga0307411_101279942 260
185 3300032126 Ga0307415_100128682 Ga0307415_1001286822 260
186 3300048928 Ga0496125_0251629 Ga0496125_0251629_251_1078 260
187 iso_pu_bacteria 2643221605 2644039493 261
188 3300028786 Ga0307517_10004082 Ga0307517_1000408210 262
189 3300005336 Ga0070680_100019727 Ga0070680_1000197273 264
190 3300005337 Ga0070682_100036935 Ga0070682_1000369353 264
191 3300005366 Ga0070659_100054864 Ga0070659_1000548643 264
192 3300005458 Ga0070681_10117554 Ga0070681_101175543 264
193 3300005530 Ga0070679_100251260 Ga0070679_1002512602 264
194 3300005539 Ga0068853_100122809 Ga0068853_1001228092 264
195 3300005547 Ga0070693_100065352 Ga0070693_1000653522 264
196 3300009174 Ga0105241_10051372 Ga0105241_100513722 264
197 3300013307 Ga0157372_10319130 Ga0157372_103191302 264
198 3300025912 Ga0207707_10061187 Ga0207707_100611872 264
199 3300025917 Ga0207660_10036735 Ga0207660_100367353 264
200 3300025921 Ga0207652_10122007 Ga0207652_101220072 264
201 3300025932 Ga0207690_10100506 Ga0207690_101005061 264
202 3300028786 Ga0307517_10036004 Ga0307517_100360043 264
203 3300046517 Ga0495630_0114111 Ga0495630_0114111_461_1309 264
204 3300046535 Ga0495586_0106121 Ga0495586_0106121_443_1291 264
205 3300046794 Ga0495589_0064295 Ga0495589_0064295_681_1520 264
206 iso_pu_bacteria 2508501050 2508725417 264
207 iso_pu_bacteria 2775506901 2776261629 264
208 3300033180 Ga0307510_10323959 Ga0307510_103239591 265
209 3300044694 Ga0466963_0228176 Ga0466963_0228176_138_974 265
210 3300044706 Ga0466964_0242495 Ga0466964_0242495_17_853 265
211 3300045976 Ga0466967_0328136 Ga0466967_0328136_250_1086 265
212 3300048923 Ga0496120_0141808 Ga0496120_0141808_158_1009 265
213 3300048924 Ga0496121_0017483 Ga0496121_0017483_5405_6256 265
214 3300048927 Ga0496124_0001004 Ga0496124_0001004_38775_39626 265
215 3300053087 Ga0500643_000315 Ga0500643_000315_17150_18004 265
216 3300033180 Ga0307510_10064048 Ga0307510_100640483 266
217 3300035083 Ga0373926_0057960 Ga0373926_0057960_218_1063 266
218 3300035170 Ga0373943_0004574 Ga0373943_0004574_3625_4470 266
219 3300035695 Ga0373927_0077328 Ga0373927_0077328_1154_1999 266
220 3300035725 Ga0373947_0070024 Ga0373947_0070024_887_1732 266
221 3300046463 Ga0495653_0076516 Ga0495653_0076516_498_1343 266
222 3300046476 Ga0495662_0002060 Ga0495662_0002060_4510_5355 266
223 3300046477 Ga0495664_0010358 Ga0495664_0010358_3263_4108 266
224 3300046514 Ga0495618_0001734 Ga0495618_0001734_3491_4336 266
225 3300046517 Ga0495630_0011417 Ga0495630_0011417_1131_1976 266
226 3300046533 Ga0495640_0002426 Ga0495640_0002426_12819_13664 266
227 3300046543 Ga0495645_0008003 Ga0495645_0008003_4802_5647 266
228 3300046642 Ga0495634_0014694 Ga0495634_0014694_2230_3075 266
229 3300046663 Ga0495635_0001500 Ga0495635_0001500_11759_12604 266
230 3300047315 Ga0495581_0109524 Ga0495581_0109524_709_1554 266
231 3300047319 Ga0495674_0000575 Ga0495674_0000575_32298_33143 266
232 3300048916 Ga0496113_0101046 Ga0496113_0101046_18_863 266
233 3300049571 Ga0501034_0098401 Ga0501034_0098401_838_1701 266
234 3300049574 Ga0501038_0109670 Ga0501038_0109670_1017_1880 266
235 3300049581 Ga0501047_0087709 Ga0501047_0087709_861_1724 266
236 3300049663 Ga0501223_000005 Ga0501223_000005_37459_38319 266
237 3300049676 Ga0501246_000350 Ga0501246_000350_667_1527 266
238 3300049705 Ga0501225_0004933 Ga0501225_0004933_1898_2758 266
239 3300053077 Ga0495601_0001865 Ga0495601_0001865_335_1180 266
240 3300053078 Ga0495612_0007881 Ga0495612_0007881_290_1135 266
241 3300053085 Ga0495619_0004989 Ga0495619_0004989_6355_7200 266
242 3300053087 Ga0500643_003668 Ga0500643_003668_6180_7055 266
243 3300006028 Ga0070717_10037821 Ga0070717_100378212 267
244 3300028786 Ga0307517_10154577 Ga0307517_101545772 267
245 3300031249 Ga0265339_10061077 Ga0265339_100610772 267
246 3300053153 Ga0500616_0014363 Ga0500616_0014363_1309_2211 267
247 iso_pu_bacteria 2917554339 2917555709 267
248 3300014326 Ga0157380_10092131 Ga0157380_100921312 268
249 3300025905 Ga0207685_10073266 Ga0207685_100732662 268
250 3300028577 Ga0265318_10012399 Ga0265318_100123994 268
251 3300031238 Ga0265332_10011536 Ga0265332_100115362 268
252 3300031241 Ga0265325_10015466 Ga0265325_100154662 268
253 3300031247 Ga0265340_10045083 Ga0265340_100450832 268
254 3300031250 Ga0265331_10017257 Ga0265331_100172575 268
255 3300031595 Ga0265313_10065203 Ga0265313_100652032 268
256 3300031711 Ga0265314_10047472 Ga0265314_100474723 268
257 3300031712 Ga0265342_10021946 Ga0265342_100219462 268
258 3300035116 Ga0373945_0013570 Ga0373945_0013570_1782_2645 268
259 3300035118 Ga0373954_0039629 Ga0373954_0039629_1205_2068 268
260 3300035119 Ga0373956_0029686 Ga0373956_0029686_216_1079 268
261 3300035170 Ga0373943_0020370 Ga0373943_0020370_1978_2841 268
262 3300035692 Ga0373935_0020984 Ga0373935_0020984_1127_1990 268
263 3300035725 Ga0373947_0039246 Ga0373947_0039246_1763_2626 268
264 3300037068 Ga0373925_0201305 Ga0373925_0201305_66_929 268
265 3300046455 Ga0495603_0093270 Ga0495603_0093270_564_1427 268
266 3300046461 Ga0495641_0018252 Ga0495641_0018252_2544_3407 268
267 3300046462 Ga0495651_0034295 Ga0495651_0034295_1327_2190 268
268 3300046463 Ga0495653_0013468 Ga0495653_0013468_4421_5284 268
269 3300046472 Ga0495580_0062588 Ga0495580_0062588_1726_2589 268
270 3300046473 Ga0495582_0057756 Ga0495582_0057756_217_1080 268
271 3300046475 Ga0495639_0145408 Ga0495639_0145408_209_1072 268
272 3300046476 Ga0495662_0006129 Ga0495662_0006129_1250_2113 268
273 3300046491 Ga0495584_0006013 Ga0495584_0006013_2008_2871 268
274 3300046492 Ga0495585_0004651 Ga0495585_0004651_2022_2885 268
275 3300046499 Ga0495594_0087005 Ga0495594_0087005_209_1072 268
276 3300046501 Ga0495607_0023913 Ga0495607_0023913_1594_2457 268
277 3300046514 Ga0495618_0110565 Ga0495618_0110565_333_1196 268
278 3300046517 Ga0495630_0121838 Ga0495630_0121838_944_1807 268
279 3300046520 Ga0495637_0026655 Ga0495637_0026655_133_996 268
280 3300046523 Ga0495644_0002617 Ga0495644_0002617_4619_5482 268
281 3300046526 Ga0495666_0138689 Ga0495666_0138689_55_918 268
282 3300046529 Ga0495652_0079902 Ga0495652_0079902_218_1081 268
283 3300046531 Ga0495665_0016233 Ga0495665_0016233_3123_3986 268
284 3300046533 Ga0495640_0094869 Ga0495640_0094869_217_1080 268
285 3300046537 Ga0495598_0001141 Ga0495598_0001141_376_1239 268
286 3300046543 Ga0495645_0312370 Ga0495645_0312370_142_1005 268
287 3300046557 Ga0495622_0017391 Ga0495622_0017391_809_1672 268
288 3300046558 Ga0495633_0005351 Ga0495633_0005351_1956_2819 268
289 3300046559 Ga0495667_0031459 Ga0495667_0031459_1232_2095 268
290 3300046615 Ga0495656_0005591 Ga0495656_0005591_1987_2850 268
291 3300046642 Ga0495634_0208305 Ga0495634_0208305_217_1080 268
292 3300046663 Ga0495635_0025464 Ga0495635_0025464_2950_3813 268
293 3300046664 Ga0495659_0001874 Ga0495659_0001874_2303_3166 268
294 3300046665 Ga0495661_0055859 Ga0495661_0055859_165_1028 268
295 3300046674 Ga0495588_0005740 Ga0495588_0005740_1787_2650 268
296 3300046678 Ga0495599_0292576 Ga0495599_0292576_55_918 268
297 3300046681 Ga0495647_0002299 Ga0495647_0002299_2635_3498 268
298 3300046683 Ga0495658_0070639 Ga0495658_0070639_946_1809 268
299 3300046690 Ga0495624_0022269 Ga0495624_0022269_1990_2853 268
300 3300046691 Ga0495670_0000479 Ga0495670_0000479_2056_2919 268
301 3300047319 Ga0495674_0341660 Ga0495674_0341660_137_1000 268
302 3300047322 Ga0495680_0026792 Ga0495680_0026792_437_1300 268
303 3300047471 Ga0495684_0017475 Ga0495684_0017475_208_1071 268
304 3300049571 Ga0501034_0014761 Ga0501034_0014761_1059_1919 268
305 3300049744 Ga0501083_0011693 Ga0501083_0011693_1817_2677 268
306 3300053077 Ga0495601_0090911 Ga0495601_0090911_217_1080 268
307 3300053084 Ga0495595_0010174 Ga0495595_0010174_2950_3813 268
308 3300053085 Ga0495619_0013002 Ga0495619_0013002_3151_4014 268
309 iso_pu_bacteria 2861691609 2861694490 268
310 3300037853 Ga0436364_0036319 Ga0436364_0036319_1642_2508 269
311 3300046454 Ga0495592_0078676 Ga0495592_0078676_487_1350 269
312 3300046683 Ga0495658_0020975 Ga0495658_0020975_1885_2748 269
313 3300047317 Ga0495604_0033338 Ga0495604_0033338_2416_3279 269
314 3300047319 Ga0495674_0005198 Ga0495674_0005198_9051_9914 269
315 3300047673 Ga0495593_0101637 Ga0495593_0101637_204_1067 269
316 3300049822 Ga0501035_0155601 Ga0501035_0155601_55_915 269
317 3300053084 Ga0495595_0009308 Ga0495595_0009308_1317_2180 269
318 3300053085 Ga0495619_0000628 Ga0495619_0000628_19819_20682 269
319 3300025915 Ga0207693_10021938 Ga0207693_100219384 270
320 3300025939 Ga0207665_10145955 Ga0207665_101459552 270
321 3300028380 Ga0268265_10500083 Ga0268265_105000831 270
322 3300053104 Ga0500556_0002149 Ga0500556_0002149_5562_6431 270
323 3300053108 Ga0500562_002034 Ga0500562_002034_1190_2059 270
324 3300053730 Ga0500645_003502 Ga0500645_003502_3505_4374 270
325 3300005336 Ga0070680_100121027 Ga0070680_1001210272 271
326 3300005436 Ga0070713_100268437 Ga0070713_1002684371 271
327 3300005985 Ga0081539_10051336 Ga0081539_100513362 271
328 3300025917 Ga0207660_10263159 Ga0207660_102631591 271
329 3300039450 Ga0436363_0752414 Ga0436363_0752414_3257_4126 271
330 3300044842 Ga0466957_0098436 Ga0466957_0098436_677_1579 271
331 3300049586 Ga0501070_0340928 Ga0501070_0340928_82_945 271
332 3300005289 Ga0065704_10001572 Ga0065704_100015726 272
333 3300005329 Ga0070683_100057113 Ga0070683_1000571132 272
334 3300005331 Ga0070670_100094935 Ga0070670_1000949352 272
335 3300005331 Ga0070670_100149495 Ga0070670_1001494952 272
336 3300005336 Ga0070680_100099128 Ga0070680_1000991283 272
337 3300005347 Ga0070668_100001850 Ga0070668_1000018505 272
338 3300005353 Ga0070669_100121015 Ga0070669_1001210151 272
339 3300005436 Ga0070713_100188408 Ga0070713_1001884082 272
340 3300005458 Ga0070681_10073491 Ga0070681_100734913 272
341 3300005530 Ga0070679_100168245 Ga0070679_1001682452 272
342 3300005535 Ga0070684_100151409 Ga0070684_1001514092 272
343 3300005548 Ga0070665_100016010 Ga0070665_1000160108 272
344 3300005563 Ga0068855_100170922 Ga0068855_1001709223 272
345 3300005614 Ga0068856_100076986 Ga0068856_1000769863 272
346 3300005614 Ga0068856_100643733 Ga0068856_1006437331 272
347 3300005616 Ga0068852_100545044 Ga0068852_1005450442 272
348 3300005842 Ga0068858_100002582 Ga0068858_1000025823 272
349 3300009011 Ga0105251_10015311 Ga0105251_100153113 272
350 3300009093 Ga0105240_10154039 Ga0105240_101540392 272
351 3300009093 Ga0105240_10429084 Ga0105240_104290842 272
352 3300009176 Ga0105242_10473976 Ga0105242_104739761 272
353 3300009551 Ga0105238_10129678 Ga0105238_101296783 272
354 3300009551 Ga0105238_10206051 Ga0105238_102060512 272
355 3300013104 Ga0157370_10069032 Ga0157370_100690324 272
356 3300013105 Ga0157369_10155854 Ga0157369_101558542 272
357 3300014968 Ga0157379_10018280 Ga0157379_100182802 272
358 3300025913 Ga0207695_10622322 Ga0207695_106223222 272
359 3300025915 Ga0207693_10250082 Ga0207693_102500822 272
360 3300025921 Ga0207652_10082236 Ga0207652_100822363 272
361 3300025923 Ga0207681_10070726 Ga0207681_100707262 272
362 3300025925 Ga0207650_10134340 Ga0207650_101343402 272
363 3300025928 Ga0207700_10128406 Ga0207700_101284063 272
364 3300025928 Ga0207700_10210989 Ga0207700_102109892 272
365 3300025941 Ga0207711_10106533 Ga0207711_101065332 272
366 3300025944 Ga0207661_10103129 Ga0207661_101031293 272
367 3300025949 Ga0207667_10034029 Ga0207667_100340293 272
368 3300025949 Ga0207667_10115285 Ga0207667_101152853 272
369 3300025972 Ga0207668_10000783 Ga0207668_100007838 272
370 3300026035 Ga0207703_10000193 Ga0207703_1000019348 272
371 3300026041 Ga0207639_10057177 Ga0207639_100571773 272
372 3300026078 Ga0207702_10037662 Ga0207702_100376622 272
373 3300028379 Ga0268266_10000497 Ga0268266_1000049751 272
374 3300028800 Ga0265338_10010532 Ga0265338_100105323 272
375 3300031250 Ga0265331_10014098 Ga0265331_100140982 272
376 3300031711 Ga0265314_10096788 Ga0265314_100967882 272
377 3300037312 Ga0395899_0127819 Ga0395899_0127819_196_1071 272
378 3300037418 Ga0395900_0025306 Ga0395900_0025306_1944_2804 272
379 3300037418 Ga0395900_0184320 Ga0395900_0184320_1181_2056 272
380 3300037466 Ga0395898_0054822 Ga0395898_0054822_1412_2287 272
381 3300038443 Ga0395901_0203937 Ga0395901_0203937_157_1032 272
382 3300039438 Ga0436360_0375466 Ga0436360_0375466_115_981 272
383 3300039450 Ga0436363_0005935 Ga0436363_0005935_768_1679 272
384 3300044694 Ga0466963_0051694 Ga0466963_0051694_855_1712 272
385 3300044842 Ga0466957_0110148 Ga0466957_0110148_355_1212 272
386 3300045976 Ga0466967_0029957 Ga0466967_0029957_77_934 272
387 3300048905 Ga0496102_0000109 Ga0496102_0000109_110504_111367 272
388 3300048906 Ga0496103_0000181 Ga0496103_0000181_5949_6812 272
389 3300048907 Ga0496104_0029701 Ga0496104_0029701_4068_4931 272
390 3300048908 Ga0496105_0001374 Ga0496105_0001374_11202_12065 272
391 3300048910 Ga0496107_0128915 Ga0496107_0128915_389_1252 272
392 3300048913 Ga0496110_0018993 Ga0496110_0018993_3207_4070 272
393 3300048914 Ga0496111_0002007 Ga0496111_0002007_9314_10177 272
394 3300048917 Ga0496114_0002139 Ga0496114_0002139_1584_2447 272
395 3300048918 Ga0496115_0000042 Ga0496115_0000042_110697_111560 272
396 3300048919 Ga0496116_0001662 Ga0496116_0001662_1759_2622 272
397 3300048920 Ga0496117_0000398 Ga0496117_0000398_5059_5922 272
398 3300048920 Ga0496117_0003997 Ga0496117_0003997_6693_7556 272
399 3300048921 Ga0496118_0000109 Ga0496118_0000109_110760_111623 272
400 3300048922 Ga0496119_0003011 Ga0496119_0003011_4802_5665 272
401 3300048923 Ga0496120_0135786 Ga0496120_0135786_340_1203 272
402 3300048924 Ga0496121_0000292 Ga0496121_0000292_74508_75371 272
403 3300048924 Ga0496121_0000687 Ga0496121_0000687_57118_57981 272
404 3300048924 Ga0496121_0160697 Ga0496121_0160697_547_1410 272
405 3300048926 Ga0496123_0051274 Ga0496123_0051274_516_1379 272
406 3300048927 Ga0496124_0000201 Ga0496124_0000201_5079_5942 272
407 3300048929 Ga0496126_0000654 Ga0496126_0000654_6101_6964 272
408 3300048929 Ga0496126_0003401 Ga0496126_0003401_7536_8399 272
409 3300049572 Ga0501036_0465999 Ga0501036_0465999_92_955 272
410 3300049575 Ga0501039_0131946 Ga0501039_0131946_80_943 272
411 3300049588 Ga0501072_0056479 Ga0501072_0056479_1913_2776 272
412 3300049591 Ga0501075_0043671 Ga0501075_0043671_372_1235 272
413 3300049592 Ga0501076_0102712 Ga0501076_0102712_174_1037 272
414 3300060353 Ga0501082_0288980 Ga0501082_0288980_129_992 272
415 3300061734 Ga0530510_0093093 Ga0530510_0093093_1076_1939 272
416 iso_pu_bacteria 2935675223 2935683538 272
417 iso_pu_bacteria 2935684952 2935693414 272
418 iso_pu_bacteria 2935713505 2935721604 272
419 iso_pu_bacteria 2935722832 2935731066 272
420 iso_pu_bacteria 2935732158 2935740743 272
421 iso_pu_bacteria 2935741537 2935750007 272
422 iso_pu_bacteria 2935750917 2935759397 272
423 iso_pu_bacteria 2935760218 2935769183 272
424 iso_pu_bacteria 2940556831 2940565301 272
425 3300002074 JGI24748J21848_1003508 JGI24748J21848_10035081 273
426 3300005327 Ga0070658_10315050 Ga0070658_103150502 273
427 3300005331 Ga0070670_100070158 Ga0070670_1000701582 273
428 3300005336 Ga0070680_100054897 Ga0070680_1000548973 273
429 3300005336 Ga0070680_100247994 Ga0070680_1002479942 273
430 3300005339 Ga0070660_100199791 Ga0070660_1001997913 273
431 3300005344 Ga0070661_100052505 Ga0070661_1000525053 273
432 3300005367 Ga0070667_100259342 Ga0070667_1002593422 273
433 3300005434 Ga0070709_10026460 Ga0070709_100264604 273
434 3300005437 Ga0070710_10101146 Ga0070710_101011462 273
435 3300005458 Ga0070681_10166852 Ga0070681_101668521 273
436 3300005466 Ga0070685_10086788 Ga0070685_100867882 273
437 3300005530 Ga0070679_100158678 Ga0070679_1001586783 273
438 3300005563 Ga0068855_100032389 Ga0068855_1000323894 273
439 3300005563 Ga0068855_100201789 Ga0068855_1002017892 273
440 3300005578 Ga0068854_100181359 Ga0068854_1001813592 273
441 3300005618 Ga0068864_100171386 Ga0068864_1001713863 273
442 3300006028 Ga0070717_10149381 Ga0070717_101493812 273
443 3300006175 Ga0070712_100057693 Ga0070712_1000576933 273
444 3300007265 Ga0099794_10016526 Ga0099794_100165262 273
445 3300007265 Ga0099794_10088989 Ga0099794_100889893 273
446 3300007788 Ga0099795_10008314 Ga0099795_100083142 273
447 3300009011 Ga0105251_10025688 Ga0105251_100256883 273
448 3300009093 Ga0105240_10057085 Ga0105240_100570852 273
449 3300009094 Ga0111539_10101922 Ga0111539_101019224 273
450 3300009098 Ga0105245_10014011 Ga0105245_100140113 273
451 3300009148 Ga0105243_10601772 Ga0105243_106017721 273
452 3300009177 Ga0105248_10080320 Ga0105248_100803202 273
453 3300009177 Ga0105248_10173133 Ga0105248_101731332 273
454 3300009553 Ga0105249_10581614 Ga0105249_105816141 273
455 3300009978 Ga0105148_100006 Ga0105148_10000627 273
456 3300013100 Ga0157373_10111768 Ga0157373_101117682 273
457 3300013102 Ga0157371_10183164 Ga0157371_101831641 273
458 3300013105 Ga0157369_10332533 Ga0157369_103325332 273
459 3300013297 Ga0157378_10299254 Ga0157378_102992542 273
460 3300014326 Ga0157380_10059431 Ga0157380_100594312 273
461 3300021384 Ga0213876_10104952 Ga0213876_101049522 273
462 3300025735 Ga0207713_1036012 Ga0207713_10360122 273
463 3300025898 Ga0207692_10056391 Ga0207692_100563912 273
464 3300025906 Ga0207699_10113889 Ga0207699_101138892 273
465 3300025909 Ga0207705_10046556 Ga0207705_100465561 273
466 3300025909 Ga0207705_10121930 Ga0207705_101219301 273
467 3300025912 Ga0207707_10271659 Ga0207707_102716592 273
468 3300025917 Ga0207660_10038724 Ga0207660_100387243 273
469 3300025917 Ga0207660_10100054 Ga0207660_101000542 273
470 3300025919 Ga0207657_10188114 Ga0207657_101881142 273
471 3300025921 Ga0207652_10072763 Ga0207652_100727633 273
472 3300025927 Ga0207687_10009704 Ga0207687_100097045 273
473 3300025928 Ga0207700_10112263 Ga0207700_101122632 273
474 3300025928 Ga0207700_10376471 Ga0207700_103764712 273
475 3300025936 Ga0207670_10185694 Ga0207670_101856943 273
476 3300025941 Ga0207711_10472849 Ga0207711_104728491 273
477 3300025949 Ga0207667_10186655 Ga0207667_101866552 273
478 3300025961 Ga0207712_10152239 Ga0207712_101522392 273
479 3300025981 Ga0207640_10186656 Ga0207640_101866562 273
480 3300026095 Ga0207676_10429202 Ga0207676_104292021 273
481 3300026116 Ga0207674_10107504 Ga0207674_101075043 273
482 3300031235 Ga0265330_10051814 Ga0265330_100518142 273
483 3300031238 Ga0265332_10007662 Ga0265332_100076625 273
484 3300031238 Ga0265332_10070700 Ga0265332_100707001 273
485 3300031241 Ga0265325_10000181 Ga0265325_100001813 273
486 3300031241 Ga0265325_10070818 Ga0265325_100708182 273
487 3300031247 Ga0265340_10010050 Ga0265340_100100504 273
488 3300031249 Ga0265339_10002985 Ga0265339_100029855 273
489 3300031249 Ga0265339_10121726 Ga0265339_101217262 273
490 3300031250 Ga0265331_10011565 Ga0265331_100115652 273
491 3300031344 Ga0265316_10072301 Ga0265316_100723014 273
492 3300031595 Ga0265313_10000358 Ga0265313_100003584 273
493 3300031711 Ga0265314_10001510 Ga0265314_1000151019 273
494 3300031711 Ga0265314_10033367 Ga0265314_100333674 273
495 3300031711 Ga0265314_10051817 Ga0265314_100518172 273
496 3300031712 Ga0265342_10000096 Ga0265342_1000009642 273
497 3300031712 Ga0265342_10000502 Ga0265342_1000050218 273
498 3300031712 Ga0265342_10007165 Ga0265342_100071652 273
499 3300035115 Ga0373941_0007268 Ga0373941_0007268_907_1767 273
500 3300035117 Ga0373953_0008802 Ga0373953_0008802_1443_2303 273
501 3300035119 Ga0373956_0023887 Ga0373956_0023887_1239_2099 273
502 3300035120 Ga0373957_0002369 Ga0373957_0002369_3600_4460 273
503 3300035172 Ga0373955_0002341 Ga0373955_0002341_4002_4862 273
504 3300035695 Ga0373927_0137221 Ga0373927_0137221_164_1030 273
505 3300035724 Ga0373933_0004297 Ga0373933_0004297_2798_3658 273
506 3300036401 Ga0373937_0033041 Ga0373937_0033041_3508_4368 273
507 3300037068 Ga0373925_0418111 Ga0373925_0418111_17_883 273
508 3300037418 Ga0395900_0550675 Ga0395900_0550675_50_910 273
509 3300037466 Ga0395898_0016015 Ga0395898_0016015_1309_2169 273
510 3300038443 Ga0395901_0178644 Ga0395901_0178644_323_1204 273
511 3300038443 Ga0395901_0216199 Ga0395901_0216199_1081_1941 273
512 3300039437 Ga0436365_0948695 Ga0436365_0948695_446_1312 273
513 3300039437 Ga0436365_1269494 Ga0436365_1269494_67_927 273
514 3300039437 Ga0436365_1866778 Ga0436365_1866778_6610_7470 273
515 3300039438 Ga0436360_0645527 Ga0436360_0645527_65_940 273
516 3300039438 Ga0436360_1061551 Ga0436360_1061551_89_955 273
517 3300039447 Ga0436361_1178821 Ga0436361_1178821_1257_2123 273
518 3300039450 Ga0436363_0182318 Ga0436363_0182318_72_998 273
519 3300041408 Ga0439453_0000287 Ga0439453_0000287_3199_4059 273
520 3300042003 Ga0439443_000311 Ga0439443_000311_1235_2095 273
521 3300042436 Ga0439435_0002311 Ga0439435_0002311_68_928 273
522 3300042461 Ga0439460_0011722 Ga0439460_0011722_147_1007 273
523 3300045049 Ga0466959_0239065 Ga0466959_0239065_336_1196 273
524 3300046462 Ga0495651_0014623 Ga0495651_0014623_2472_3332 273
525 3300046511 Ga0495608_0041310 Ga0495608_0041310_2188_3048 273
526 3300046516 Ga0495628_0089871 Ga0495628_0089871_1302_2162 273
527 3300046529 Ga0495652_0098127 Ga0495652_0098127_1300_2160 273
528 3300046675 Ga0495657_0014554 Ga0495657_0014554_2452_3312 273
529 3300047322 Ga0495680_0029533 Ga0495680_0029533_3115_3975 273
530 3300047444 Ga0495675_0051440 Ga0495675_0051440_179_1039 273
531 3300048088 Ga0495602_0034502 Ga0495602_0034502_2741_3601 273
532 3300048907 Ga0496104_0022722 Ga0496104_0022722_1408_2289 273
533 3300048907 Ga0496104_0052506 Ga0496104_0052506_2246_3112 273
534 3300048911 Ga0496108_0021394 Ga0496108_0021394_825_1706 273
535 3300048912 Ga0496109_0028976 Ga0496109_0028976_3834_4715 273
536 3300048913 Ga0496110_0018558 Ga0496110_0018558_951_1817 273
537 3300048913 Ga0496110_0174927 Ga0496110_0174927_808_1689 273
538 3300048915 Ga0496112_0007480 Ga0496112_0007480_3213_4094 273
539 3300048921 Ga0496118_0162271 Ga0496118_0162271_19_885 273
540 3300048925 Ga0496122_0082409 Ga0496122_0082409_764_1630 273
541 3300048926 Ga0496123_0045779 Ga0496123_0045779_1340_2206 273
542 3300048927 Ga0496124_0056227 Ga0496124_0056227_771_1637 273
543 3300048929 Ga0496126_0136309 Ga0496126_0136309_1011_1877 273
544 3300049568 Ga0501031_0297545 Ga0501031_0297545_28_888 273
545 3300049569 Ga0501032_0024422 Ga0501032_0024422_1973_2833 273
546 3300049569 Ga0501032_0047880 Ga0501032_0047880_1653_2513 273
547 3300049570 Ga0501033_0050841 Ga0501033_0050841_70_936 273
548 3300049570 Ga0501033_0056964 Ga0501033_0056964_632_1504 273
549 3300049571 Ga0501034_0000229 Ga0501034_0000229_37343_38203 273
550 3300049571 Ga0501034_0011795 Ga0501034_0011795_5438_6298 273
551 3300049571 Ga0501034_0042297 Ga0501034_0042297_1622_2563 273
552 3300049571 Ga0501034_0144626 Ga0501034_0144626_1146_2006 273
553 3300049572 Ga0501036_0015929 Ga0501036_0015929_2479_3420 273
554 3300049572 Ga0501036_0243908 Ga0501036_0243908_359_1231 273
555 3300049573 Ga0501037_0026325 Ga0501037_0026325_2918_3859 273
556 3300049574 Ga0501038_0026706 Ga0501038_0026706_1337_2197 273
557 3300049574 Ga0501038_0061506 Ga0501038_0061506_1968_2834 273
558 3300049574 Ga0501038_0190706 Ga0501038_0190706_74_940 273
559 3300049575 Ga0501039_0075578 Ga0501039_0075578_1315_2175 273
560 3300049579 Ga0501043_0004699 Ga0501043_0004699_3939_4799 273
561 3300049579 Ga0501043_0007918 Ga0501043_0007918_7459_8325 273
562 3300049579 Ga0501043_0013539 Ga0501043_0013539_1554_2495 273
563 3300049579 Ga0501043_0090558 Ga0501043_0090558_263_1135 273
564 3300049580 Ga0501046_0019671 Ga0501046_0019671_2976_3917 273
565 3300049581 Ga0501047_0018077 Ga0501047_0018077_4663_5529 273
566 3300049581 Ga0501047_0054113 Ga0501047_0054113_1412_2278 273
567 3300049581 Ga0501047_0118321 Ga0501047_0118321_866_1726 273
568 3300049581 Ga0501047_0138151 Ga0501047_0138151_225_1097 273
569 3300049581 Ga0501047_0191795 Ga0501047_0191795_529_1389 273
570 3300049581 Ga0501047_0410515 Ga0501047_0410515_12_872 273
571 3300049582 Ga0501048_0031437 Ga0501048_0031437_1931_2791 273
572 3300049583 Ga0501067_0018314 Ga0501067_0018314_2262_3128 273
573 3300049584 Ga0501068_0008616 Ga0501068_0008616_2598_3539 273
574 3300049586 Ga0501070_0017087 Ga0501070_0017087_3661_4533 273
575 3300049586 Ga0501070_0027804 Ga0501070_0027804_2995_3861 273
576 3300049586 Ga0501070_0056372 Ga0501070_0056372_1114_2055 273
577 3300049587 Ga0501071_0043591 Ga0501071_0043591_1066_1926 273
578 3300049588 Ga0501072_0072612 Ga0501072_0072612_1166_2026 273
579 3300049589 Ga0501073_0008726 Ga0501073_0008726_3852_4718 273
580 3300049590 Ga0501074_0195305 Ga0501074_0195305_336_1196 273
581 3300049592 Ga0501076_0182301 Ga0501076_0182301_649_1509 273
582 3300049593 Ga0501077_0008005 Ga0501077_0008005_3620_4480 273
583 3300049658 Ga0501211_000078 Ga0501211_000078_644_1525 273
584 3300049669 Ga0501235_005113 Ga0501235_005113_345_1226 273
585 3300049741 Ga0501079_0519446 Ga0501079_0519446_62_922 273
586 3300049742 Ga0501080_0004770 Ga0501080_0004770_8530_9396 273
587 3300049742 Ga0501080_0024968 Ga0501080_0024968_3657_4523 273
588 3300049742 Ga0501080_0191059 Ga0501080_0191059_440_1381 273
589 3300049744 Ga0501083_0055261 Ga0501083_0055261_1697_2563 273
590 3300049744 Ga0501083_0080871 Ga0501083_0080871_703_1563 273
591 3300049822 Ga0501035_0016880 Ga0501035_0016880_540_1481 273
592 3300049822 Ga0501035_0025614 Ga0501035_0025614_3192_4064 273
593 3300049822 Ga0501035_0058572 Ga0501035_0058572_1619_2485 273
594 3300049823 Ga0501044_0005671 Ga0501044_0005671_2294_3160 273
595 3300049823 Ga0501044_0020182 Ga0501044_0020182_1621_2562 273
596 3300049823 Ga0501044_0060192 Ga0501044_0060192_1556_2422 273
597 3300049823 Ga0501044_0069757 Ga0501044_0069757_2527_3387 273
598 3300049823 Ga0501044_0106377 Ga0501044_0106377_1428_2288 273
599 3300049823 Ga0501044_0359814 Ga0501044_0359814_12_872 273
600 3300050511 nmdc:mga08y16_604368_c1 nmdc:mga08y16_604368_c1_186_1067 273
601 3300053078 Ga0495612_0003420 Ga0495612_0003420_3945_4805 273
602 3300053084 Ga0495595_0006191 Ga0495595_0006191_3053_3913 273
603 3300053084 Ga0495595_0186052 Ga0495595_0186052_118_984 273
604 3300053085 Ga0495619_0026797 Ga0495619_0026797_1895_2755 273
605 3300053085 Ga0495619_0202857 Ga0495619_0202857_294_1160 273
606 3300054114 Ga0501084_0119829 Ga0501084_0119829_38_898 273
607 3300060353 Ga0501082_0000036 Ga0501082_0000036_92405_93265 273
608 3300060353 Ga0501082_0071462 Ga0501082_0071462_2082_2942 273
609 2209111006 2214772992 2213793016 274
610 3300000044 ARSoilOldRDRAFT_c000054 ARSoilOldRDRAFT_0000546 274
611 3300001977 JGI24746J21847_1001225 JGI24746J21847_10012252 274
612 3300001989 JGI24739J22299_10003110 JGI24739J22299_100031103 274
613 3300001990 JGI24737J22298_10001185 JGI24737J22298_100011853 274
614 3300001990 JGI24737J22298_10003047 JGI24737J22298_100030474 274
615 3300002070 JGI24750J21931_1000231 JGI24750J21931_10002314 274
616 3300002073 JGI24745J21846_1000755 JGI24745J21846_10007552 274
617 3300002074 JGI24748J21848_1000261 JGI24748J21848_10002612 274
618 3300002075 JGI24738J21930_10002196 JGI24738J21930_100021963 274
619 3300002077 JGI24744J21845_10000435 JGI24744J21845_100004353 274
620 3300002126 JGI24035J26624_1000373 JGI24035J26624_10003734 274
621 3300002244 JGI24742J22300_10000181 JGI24742J22300_100001813 274
622 3300005290 Ga0065712_10100661 Ga0065712_101006612 274
623 3300005293 Ga0065715_10089280 Ga0065715_100892802 274
624 3300005293 Ga0065715_10108672 Ga0065715_101086722 274
625 3300005328 Ga0070676_10000128 Ga0070676_1000012816 274
626 3300005328 Ga0070676_10005042 Ga0070676_100050423 274
627 3300005328 Ga0070676_10061681 Ga0070676_100616812 274
628 3300005328 Ga0070676_10089191 Ga0070676_100891912 274
629 3300005329 Ga0070683_100000289 Ga0070683_1000002893 274
630 3300005329 Ga0070683_100087875 Ga0070683_1000878753 274
631 3300005330 Ga0070690_100000935 Ga0070690_1000009354 274
632 3300005330 Ga0070690_100028449 Ga0070690_1000284493 274
633 3300005330 Ga0070690_100247869 Ga0070690_1002478691 274
634 3300005331 Ga0070670_100000101 Ga0070670_10000010172 274
635 3300005331 Ga0070670_100003173 Ga0070670_10000317313 274
636 3300005331 Ga0070670_100019008 Ga0070670_1000190083 274
637 3300005331 Ga0070670_100078972 Ga0070670_1000789723 274
638 3300005331 Ga0070670_100110791 Ga0070670_1001107912 274
639 3300005333 Ga0070677_10000043 Ga0070677_1000004326 274
640 3300005333 Ga0070677_10025082 Ga0070677_100250822 274
641 3300005334 Ga0068869_100000289 Ga0068869_10000028917 274
642 3300005334 Ga0068869_100288858 Ga0068869_1002888582 274
643 3300005335 Ga0070666_10001787 Ga0070666_100017879 274
644 3300005335 Ga0070666_10010239 Ga0070666_100102395 274
645 3300005335 Ga0070666_10030072 Ga0070666_100300724 274
646 3300005336 Ga0070680_100002347 Ga0070680_10000234714 274
647 3300005336 Ga0070680_100022158 Ga0070680_1000221585 274
648 3300005336 Ga0070680_100029756 Ga0070680_1000297562 274
649 3300005336 Ga0070680_100171696 Ga0070680_1001716962 274
650 3300005336 Ga0070680_100524060 Ga0070680_1005240601 274
651 3300005337 Ga0070682_100004343 Ga0070682_1000043436 274
652 3300005337 Ga0070682_100089223 Ga0070682_1000892231 274
653 3300005337 Ga0070682_100195742 Ga0070682_1001957421 274
654 3300005338 Ga0068868_100000408 Ga0068868_1000004087 274
655 3300005338 Ga0068868_100184809 Ga0068868_1001848092 274
656 3300005339 Ga0070660_100000182 Ga0070660_10000018210 274
657 3300005340 Ga0070689_100000819 Ga0070689_1000008192 274
658 3300005340 Ga0070689_100115556 Ga0070689_1001155563 274
659 3300005340 Ga0070689_100148283 Ga0070689_1001482832 274
660 3300005341 Ga0070691_10005195 Ga0070691_100051954 274
661 3300005341 Ga0070691_10023085 Ga0070691_100230852 274
662 3300005343 Ga0070687_100000689 Ga0070687_1000006892 274
663 3300005344 Ga0070661_100000314 Ga0070661_10000031440 274
664 3300005344 Ga0070661_100126771 Ga0070661_1001267712 274
665 3300005345 Ga0070692_10005753 Ga0070692_100057532 274
666 3300005345 Ga0070692_10015999 Ga0070692_100159992 274
667 3300005347 Ga0070668_100000138 Ga0070668_10000013830 274
668 3300005347 Ga0070668_100000857 Ga0070668_10000085722 274
669 3300005347 Ga0070668_100032755 Ga0070668_1000327552 274
670 3300005353 Ga0070669_100002719 Ga0070669_1000027193 274
671 3300005353 Ga0070669_100007256 Ga0070669_1000072566 274
672 3300005353 Ga0070669_100051933 Ga0070669_1000519332 274
673 3300005354 Ga0070675_100002240 Ga0070675_10000224013 274
674 3300005354 Ga0070675_100050219 Ga0070675_1000502192 274
675 3300005355 Ga0070671_100000598 Ga0070671_10000059811 274
676 3300005355 Ga0070671_100022998 Ga0070671_1000229983 274
677 3300005355 Ga0070671_100048578 Ga0070671_1000485782 274
678 3300005356 Ga0070674_100002210 Ga0070674_1000022103 274
679 3300005356 Ga0070674_100018371 Ga0070674_1000183712 274
680 3300005356 Ga0070674_100224557 Ga0070674_1002245572 274
681 3300005364 Ga0070673_100000289 Ga0070673_10000028930 274
682 3300005364 Ga0070673_100014793 Ga0070673_1000147933 274
683 3300005364 Ga0070673_100027399 Ga0070673_1000273992 274
684 3300005365 Ga0070688_100000189 Ga0070688_10000018921 274
685 3300005365 Ga0070688_100004722 Ga0070688_1000047228 274
686 3300005365 Ga0070688_100025788 Ga0070688_1000257884 274
687 3300005365 Ga0070688_100062535 Ga0070688_1000625352 274
688 3300005366 Ga0070659_100003195 Ga0070659_10000319510 274
689 3300005366 Ga0070659_100084611 Ga0070659_1000846112 274
690 3300005366 Ga0070659_100217757 Ga0070659_1002177571 274
691 3300005367 Ga0070667_100000146 Ga0070667_10000014674 274
692 3300005367 Ga0070667_100000436 Ga0070667_10000043632 274
693 3300005367 Ga0070667_100079710 Ga0070667_1000797102 274
694 3300005406 Ga0070703_10004383 Ga0070703_100043832 274
695 3300005434 Ga0070709_10035521 Ga0070709_100355213 274
696 3300005435 Ga0070714_100004331 Ga0070714_1000043314 274
697 3300005435 Ga0070714_100252513 Ga0070714_1002525132 274
698 3300005436 Ga0070713_100018876 Ga0070713_1000188764 274
699 3300005436 Ga0070713_100074537 Ga0070713_1000745373 274
700 3300005436 Ga0070713_100199171 Ga0070713_1001991712 274
701 3300005436 Ga0070713_100398601 Ga0070713_1003986011 274
702 3300005437 Ga0070710_10012616 Ga0070710_100126162 274
703 3300005437 Ga0070710_10026693 Ga0070710_100266933 274
704 3300005438 Ga0070701_10000608 Ga0070701_100006082 274
705 3300005438 Ga0070701_10015849 Ga0070701_100158492 274
706 3300005439 Ga0070711_100071369 Ga0070711_1000713691 274
707 3300005439 Ga0070711_100245176 Ga0070711_1002451761 274
708 3300005440 Ga0070705_100000781 Ga0070705_10000078119 274
709 3300005440 Ga0070705_100030632 Ga0070705_1000306322 274
710 3300005440 Ga0070705_100076382 Ga0070705_1000763821 274
711 3300005440 Ga0070705_100134776 Ga0070705_1001347762 274
712 3300005441 Ga0070700_100002740 Ga0070700_1000027402 274
713 3300005441 Ga0070700_100095163 Ga0070700_1000951632 274
714 3300005444 Ga0070694_100001837 Ga0070694_1000018373 274
715 3300005444 Ga0070694_100013917 Ga0070694_1000139174 274
716 3300005445 Ga0070708_100023828 Ga0070708_1000238284 274
717 3300005455 Ga0070663_100000297 Ga0070663_10000029728 274
718 3300005455 Ga0070663_100049800 Ga0070663_1000498002 274
719 3300005455 Ga0070663_100050119 Ga0070663_1000501194 274
720 3300005456 Ga0070678_100001856 Ga0070678_1000018562 274
721 3300005456 Ga0070678_100020795 Ga0070678_1000207952 274
722 3300005456 Ga0070678_100089072 Ga0070678_1000890722 274
723 3300005457 Ga0070662_100029921 Ga0070662_1000299214 274
724 3300005457 Ga0070662_100068723 Ga0070662_1000687233 274
725 3300005458 Ga0070681_10005077 Ga0070681_1000507712 274
726 3300005458 Ga0070681_10008886 Ga0070681_100088863 274
727 3300005458 Ga0070681_10076325 Ga0070681_100763252 274
728 3300005459 Ga0068867_100008821 Ga0068867_1000088216 274
729 3300005459 Ga0068867_100032291 Ga0068867_1000322914 274
730 3300005459 Ga0068867_100216946 Ga0068867_1002169462 274
731 3300005466 Ga0070685_10001152 Ga0070685_100011522 274
732 3300005468 Ga0070707_100522266 Ga0070707_1005222661 274
733 3300005518 Ga0070699_100251589 Ga0070699_1002515892 274
734 3300005530 Ga0070679_100003016 Ga0070679_1000030163 274
735 3300005535 Ga0070684_100002293 Ga0070684_10000229313 274
736 3300005536 Ga0070697_100072052 Ga0070697_1000720522 274
737 3300005539 Ga0068853_100000417 Ga0068853_10000041728 274
738 3300005539 Ga0068853_100176144 Ga0068853_1001761442 274
739 3300005543 Ga0070672_100000106 Ga0070672_10000010643 274
740 3300005543 Ga0070672_100007721 Ga0070672_1000077214 274
741 3300005543 Ga0070672_100033734 Ga0070672_1000337345 274
742 3300005543 Ga0070672_100136883 Ga0070672_1001368832 274
743 3300005544 Ga0070686_100000615 Ga0070686_1000006152 274
744 3300005544 Ga0070686_100027546 Ga0070686_1000275462 274
745 3300005544 Ga0070686_100203071 Ga0070686_1002030712 274
746 3300005545 Ga0070695_100007200 Ga0070695_1000072005 274
747 3300005545 Ga0070695_100086699 Ga0070695_1000866992 274
748 3300005546 Ga0070696_100001368 Ga0070696_10000136814 274
749 3300005546 Ga0070696_100005592 Ga0070696_1000055926 274
750 3300005546 Ga0070696_100021433 Ga0070696_1000214332 274
751 3300005546 Ga0070696_100222497 Ga0070696_1002224972 274
752 3300005546 Ga0070696_100260957 Ga0070696_1002609572 274
753 3300005547 Ga0070693_100005911 Ga0070693_1000059114 274
754 3300005547 Ga0070693_100037116 Ga0070693_1000371162 274
755 3300005548 Ga0070665_100000915 Ga0070665_10000091511 274
756 3300005548 Ga0070665_100078312 Ga0070665_1000783122 274
757 3300005548 Ga0070665_100335144 Ga0070665_1003351442 274
758 3300005548 Ga0070665_100606418 Ga0070665_1006064182 274
759 3300005549 Ga0070704_100001277 Ga0070704_10000127712 274
760 3300005549 Ga0070704_100048761 Ga0070704_1000487614 274
761 3300005563 Ga0068855_100029828 Ga0068855_1000298283 274
762 3300005563 Ga0068855_100113642 Ga0068855_1001136422 274
763 3300005563 Ga0068855_100256216 Ga0068855_1002562162 274
764 3300005564 Ga0070664_100016295 Ga0070664_1000162953 274
765 3300005564 Ga0070664_100083724 Ga0070664_1000837243 274
766 3300005564 Ga0070664_100250710 Ga0070664_1002507101 274
767 3300005577 Ga0068857_100000047 Ga0068857_10000004730 274
768 3300005578 Ga0068854_100015430 Ga0068854_1000154304 274
769 3300005614 Ga0068856_100001905 Ga0068856_10000190521 274
770 3300005614 Ga0068856_100198629 Ga0068856_1001986292 274
771 3300005614 Ga0068856_100476600 Ga0068856_1004766002 274
772 3300005615 Ga0070702_100001524 Ga0070702_1000015242 274
773 3300005615 Ga0070702_100041489 Ga0070702_1000414892 274
774 3300005616 Ga0068852_100003513 Ga0068852_10000351310 274
775 3300005617 Ga0068859_100011991 Ga0068859_1000119912 274
776 3300005617 Ga0068859_100013161 Ga0068859_1000131614 274
777 3300005617 Ga0068859_100029103 Ga0068859_1000291036 274
778 3300005618 Ga0068864_100000137 Ga0068864_10000013722 274
779 3300005618 Ga0068864_100000568 Ga0068864_10000056825 274
780 3300005618 Ga0068864_100000931 Ga0068864_1000009313 274
781 3300005718 Ga0068866_10000077 Ga0068866_100000774 274
782 3300005718 Ga0068866_10006756 Ga0068866_100067562 274
783 3300005718 Ga0068866_10060997 Ga0068866_100609972 274
784 3300005719 Ga0068861_100003249 Ga0068861_1000032493 274
785 3300005719 Ga0068861_100004720 Ga0068861_1000047209 274
786 3300005840 Ga0068870_10000037 Ga0068870_1000003711 274
787 3300005840 Ga0068870_10083123 Ga0068870_100831232 274
788 3300005841 Ga0068863_100000165 Ga0068863_10000016557 274
789 3300005841 Ga0068863_100000543 Ga0068863_10000054339 274
790 3300005841 Ga0068863_100054012 Ga0068863_1000540124 274
791 3300005841 Ga0068863_100386052 Ga0068863_1003860522 274
792 3300005842 Ga0068858_100002073 Ga0068858_1000020733 274
793 3300005842 Ga0068858_100002762 Ga0068858_1000027626 274
794 3300005842 Ga0068858_100127607 Ga0068858_1001276072 274
795 3300005843 Ga0068860_100000308 Ga0068860_10000030873 274
796 3300005843 Ga0068860_100006167 Ga0068860_1000061672 274
797 3300005844 Ga0068862_100000129 Ga0068862_10000012924 274
798 3300005844 Ga0068862_100000879 Ga0068862_1000008792 274
799 3300005844 Ga0068862_100004095 Ga0068862_1000040959 274
800 3300005844 Ga0068862_100042769 Ga0068862_1000427692 274
801 3300005937 Ga0081455_10000007 Ga0081455_1000000768 274
802 3300006028 Ga0070717_10000287 Ga0070717_100002876 274
803 3300006028 Ga0070717_10186558 Ga0070717_101865582 274
804 3300006038 Ga0075365_10092969 Ga0075365_100929692 274
805 3300006038 Ga0075365_10176537 Ga0075365_101765372 274
806 3300006038 Ga0075365_10273857 Ga0075365_102738571 274
807 3300006042 Ga0075368_10071085 Ga0075368_100710852 274
808 3300006058 Ga0075432_10023256 Ga0075432_100232562 274
809 3300006163 Ga0070715_10024067 Ga0070715_100240672 274
810 3300006178 Ga0075367_10179357 Ga0075367_101793572 274
811 3300006194 Ga0075427_10001231 Ga0075427_100012311 274
812 3300006195 Ga0075366_10073842 Ga0075366_100738421 274
813 3300006237 Ga0097621_100000416 Ga0097621_1000004168 274
814 3300006237 Ga0097621_100100468 Ga0097621_1001004682 274
815 3300006237 Ga0097621_100150502 Ga0097621_1001505021 274
816 3300006353 Ga0075370_10069388 Ga0075370_100693882 274
817 3300006358 Ga0068871_100001611 Ga0068871_10000161115 274
818 3300006358 Ga0068871_100041387 Ga0068871_1000413872 274
819 3300006844 Ga0075428_100067471 Ga0075428_1000674713 274
820 3300006844 Ga0075428_100232278 Ga0075428_1002322782 274
821 3300006846 Ga0075430_100003208 Ga0075430_1000032084 274
822 3300006846 Ga0075430_100087427 Ga0075430_1000874272 274
823 3300006847 Ga0075431_100010935 Ga0075431_1000109358 274
824 3300006852 Ga0075433_10056950 Ga0075433_100569504 274
825 3300006880 Ga0075429_100039273 Ga0075429_1000392733 274
826 3300006881 Ga0068865_100000248 Ga0068865_1000002482 274
827 3300006881 Ga0068865_100012159 Ga0068865_1000121595 274
828 3300006881 Ga0068865_100065600 Ga0068865_1000656003 274
829 3300006881 Ga0068865_100077250 Ga0068865_1000772502 274
830 3300006881 Ga0068865_100188059 Ga0068865_1001880592 274
831 3300006931 Ga0097620_100011991 Ga0097620_1000119918 274
832 3300006931 Ga0097620_100013161 Ga0097620_1000131614 274
833 3300006931 Ga0097620_100029103 Ga0097620_1000291032 274
834 3300007076 Ga0075435_100004999 Ga0075435_1000049993 274
835 3300007076 Ga0075435_100025735 Ga0075435_1000257353 274
836 3300007076 Ga0075435_100330249 Ga0075435_1003302492 274
837 3300009093 Ga0105240_10145262 Ga0105240_101452622 274
838 3300009093 Ga0105240_10688497 Ga0105240_106884971 274
839 3300009094 Ga0111539_10002489 Ga0111539_100024899 274
840 3300009094 Ga0111539_10005685 Ga0111539_100056853 274
841 3300009094 Ga0111539_10081451 Ga0111539_100814512 274
842 3300009094 Ga0111539_10174789 Ga0111539_101747892 274
843 3300009098 Ga0105245_10004150 Ga0105245_100041503 274
844 3300009101 Ga0105247_10003633 Ga0105247_100036333 274
845 3300009101 Ga0105247_10005076 Ga0105247_100050764 274
846 3300009101 Ga0105247_10049720 Ga0105247_100497202 274
847 3300009101 Ga0105247_10116467 Ga0105247_101164672 274
848 3300009147 Ga0114129_10076975 Ga0114129_100769752 274
849 3300009148 Ga0105243_10001705 Ga0105243_100017056 274
850 3300009148 Ga0105243_10075564 Ga0105243_100755642 274
851 3300009148 Ga0105243_10149303 Ga0105243_101493031 274
852 3300009148 Ga0105243_10438411 Ga0105243_104384112 274
853 3300009174 Ga0105241_10023853 Ga0105241_100238532 274
854 3300009176 Ga0105242_10003502 Ga0105242_100035023 274
855 3300009176 Ga0105242_10040244 Ga0105242_100402442 274
856 3300009177 Ga0105248_10005936 Ga0105248_100059363 274
857 3300009177 Ga0105248_10008717 Ga0105248_1000871710 274
858 3300009177 Ga0105248_10019363 Ga0105248_100193633 274
859 3300009177 Ga0105248_10069603 Ga0105248_100696032 274
860 3300009177 Ga0105248_10154580 Ga0105248_101545802 274
861 3300009177 Ga0105248_10228136 Ga0105248_102281362 274
862 3300009545 Ga0105237_10032218 Ga0105237_100322184 274
863 3300009545 Ga0105237_10067332 Ga0105237_100673324 274
864 3300009551 Ga0105238_10051600 Ga0105238_100516004 274
865 3300009551 Ga0105238_10067773 Ga0105238_100677734 274
866 3300009551 Ga0105238_10176294 Ga0105238_101762942 274
867 3300009553 Ga0105249_10000337 Ga0105249_1000033716 274
868 3300009553 Ga0105249_10000476 Ga0105249_1000047637 274
869 3300009553 Ga0105249_10004624 Ga0105249_100046244 274
870 3300009553 Ga0105249_10028150 Ga0105249_100281503 274
871 3300010375 Ga0105239_10007529 Ga0105239_100075293 274
872 3300010375 Ga0105239_10098475 Ga0105239_100984752 274
873 3300010375 Ga0105239_10201460 Ga0105239_102014602 274
874 3300011119 Ga0105246_10000057 Ga0105246_1000005722 274
875 3300011119 Ga0105246_10108887 Ga0105246_101088872 274
876 3300011119 Ga0105246_10136654 Ga0105246_101366542 274
877 3300011119 Ga0105246_10275849 Ga0105246_102758492 274
878 3300012515 Ga0157338_1001612 Ga0157338_10016122 274
879 3300013100 Ga0157373_10015723 Ga0157373_100157233 274
880 3300013102 Ga0157371_10005939 Ga0157371_100059392 274
881 3300013102 Ga0157371_10135555 Ga0157371_101355552 274
882 3300013104 Ga0157370_10369686 Ga0157370_103696861 274
883 3300013296 Ga0157374_10004809 Ga0157374_100048093 274
884 3300013296 Ga0157374_10173881 Ga0157374_101738812 274
885 3300013297 Ga0157378_10019819 Ga0157378_100198192 274
886 3300013297 Ga0157378_10216901 Ga0157378_102169012 274
887 3300013297 Ga0157378_10627220 Ga0157378_106272201 274
888 3300013306 Ga0163162_10001328 Ga0163162_100013284 274
889 3300013306 Ga0163162_10001937 Ga0163162_1000193721 274
890 3300013306 Ga0163162_10064361 Ga0163162_100643612 274
891 3300013306 Ga0163162_10090498 Ga0163162_100904982 274
892 3300013306 Ga0163162_10299508 Ga0163162_102995082 274
893 3300013307 Ga0157372_10048072 Ga0157372_100480722 274
894 3300013307 Ga0157372_10160956 Ga0157372_101609562 274
895 3300013308 Ga0157375_10003994 Ga0157375_100039943 274
896 3300013308 Ga0157375_10016002 Ga0157375_100160027 274
897 3300013308 Ga0157375_10023337 Ga0157375_100233373 274
898 3300013308 Ga0157375_10326985 Ga0157375_103269852 274
899 3300014325 Ga0163163_10002371 Ga0163163_100023714 274
900 3300014325 Ga0163163_10009747 Ga0163163_100097473 274
901 3300014325 Ga0163163_10042318 Ga0163163_100423182 274
902 3300014325 Ga0163163_10052770 Ga0163163_100527704 274
903 3300014326 Ga0157380_10002362 Ga0157380_100023623 274
904 3300014326 Ga0157380_10204997 Ga0157380_102049972 274
905 3300014745 Ga0157377_10001240 Ga0157377_100012403 274
906 3300014968 Ga0157379_10000293 Ga0157379_100002934 274
907 3300014968 Ga0157379_10005209 Ga0157379_100052099 274
908 3300014969 Ga0157376_10000531 Ga0157376_100005313 274
909 3300014969 Ga0157376_10052615 Ga0157376_100526152 274
910 3300014969 Ga0157376_10701371 Ga0157376_107013711 274
911 3300017792 Ga0163161_10000209 Ga0163161_1000020919 274
912 3300017792 Ga0163161_10063027 Ga0163161_100630272 274
913 3300021384 Ga0213876_10082027 Ga0213876_100820271 274
914 3300021384 Ga0213876_10157141 Ga0213876_101571412 274
915 3300024225 Ga0224572_1020919 Ga0224572_10209192 274
916 3300025271 Ga0207666_1000011 Ga0207666_100001112 274
917 3300025271 Ga0207666_1000574 Ga0207666_10005742 274
918 3300025290 Ga0207673_1001238 Ga0207673_10012382 274
919 3300025315 Ga0207697_10000044 Ga0207697_100000443 274
920 3300025315 Ga0207697_10008532 Ga0207697_100085324 274
921 3300025315 Ga0207697_10038033 Ga0207697_100380332 274
922 3300025885 Ga0207653_10001246 Ga0207653_100012462 274
923 3300025893 Ga0207682_10000260 Ga0207682_1000026026 274
924 3300025893 Ga0207682_10010268 Ga0207682_100102684 274
925 3300025893 Ga0207682_10046758 Ga0207682_100467582 274
926 3300025898 Ga0207692_10008612 Ga0207692_100086122 274
927 3300025898 Ga0207692_10019563 Ga0207692_100195633 274
928 3300025899 Ga0207642_10002298 Ga0207642_100022986 274
929 3300025900 Ga0207710_10010446 Ga0207710_100104462 274
930 3300025900 Ga0207710_10012503 Ga0207710_100125032 274
931 3300025900 Ga0207710_10039920 Ga0207710_100399202 274
932 3300025901 Ga0207688_10000723 Ga0207688_1000072316 274
933 3300025903 Ga0207680_10001184 Ga0207680_100011845 274
934 3300025904 Ga0207647_10014545 Ga0207647_100145452 274
935 3300025905 Ga0207685_10023686 Ga0207685_100236862 274
936 3300025905 Ga0207685_10051937 Ga0207685_100519372 274
937 3300025906 Ga0207699_10022496 Ga0207699_100224963 274
938 3300025906 Ga0207699_10145414 Ga0207699_101454142 274
939 3300025906 Ga0207699_10156974 Ga0207699_101569742 274
940 3300025907 Ga0207645_10000281 Ga0207645_1000028112 274
941 3300025907 Ga0207645_10000508 Ga0207645_1000050820 274
942 3300025907 Ga0207645_10158575 Ga0207645_101585752 274
943 3300025908 Ga0207643_10000012 Ga0207643_1000001226 274
944 3300025908 Ga0207643_10014023 Ga0207643_100140232 274
945 3300025911 Ga0207654_10166605 Ga0207654_101666052 274
946 3300025912 Ga0207707_10000551 Ga0207707_1000055114 274
947 3300025912 Ga0207707_10039675 Ga0207707_100396753 274
948 3300025912 Ga0207707_10139890 Ga0207707_101398902 274
949 3300025913 Ga0207695_10183995 Ga0207695_101839952 274
950 3300025914 Ga0207671_10004326 Ga0207671_1000432611 274
951 3300025915 Ga0207693_10004775 Ga0207693_100047754 274
952 3300025915 Ga0207693_10014915 Ga0207693_100149156 274
953 3300025915 Ga0207693_10445864 Ga0207693_104458641 274
954 3300025916 Ga0207663_10031908 Ga0207663_100319082 274
955 3300025916 Ga0207663_10102512 Ga0207663_101025122 274
956 3300025916 Ga0207663_10259362 Ga0207663_102593621 274
957 3300025916 Ga0207663_10322699 Ga0207663_103226992 274
958 3300025917 Ga0207660_10000992 Ga0207660_100009923 274
959 3300025917 Ga0207660_10050004 Ga0207660_100500041 274
960 3300025917 Ga0207660_10055858 Ga0207660_100558582 274
961 3300025917 Ga0207660_10165499 Ga0207660_101654992 274
962 3300025918 Ga0207662_10000123 Ga0207662_1000012312 274
963 3300025918 Ga0207662_10004900 Ga0207662_100049005 274
964 3300025919 Ga0207657_10000358 Ga0207657_1000035826 274
965 3300025919 Ga0207657_10006368 Ga0207657_1000636812 274
966 3300025920 Ga0207649_10000545 Ga0207649_100005458 274
967 3300025920 Ga0207649_10009605 Ga0207649_100096056 274
968 3300025920 Ga0207649_10160465 Ga0207649_101604652 274
969 3300025921 Ga0207652_10004318 Ga0207652_100043183 274
970 3300025921 Ga0207652_10029896 Ga0207652_100298962 274
971 3300025923 Ga0207681_10000286 Ga0207681_1000028612 274
972 3300025923 Ga0207681_10174499 Ga0207681_101744992 274
973 3300025924 Ga0207694_10054436 Ga0207694_100544363 274
974 3300025924 Ga0207694_10114904 Ga0207694_101149041 274
975 3300025924 Ga0207694_10286467 Ga0207694_102864672 274
976 3300025925 Ga0207650_10000064 Ga0207650_1000006470 274
977 3300025925 Ga0207650_10005306 Ga0207650_100053066 274
978 3300025925 Ga0207650_10019921 Ga0207650_100199213 274
979 3300025925 Ga0207650_10065506 Ga0207650_100655062 274
980 3300025926 Ga0207659_10000023 Ga0207659_1000002394 274
981 3300025926 Ga0207659_10059360 Ga0207659_100593602 274
982 3300025927 Ga0207687_10000149 Ga0207687_1000014910 274
983 3300025927 Ga0207687_10072492 Ga0207687_100724922 274
984 3300025927 Ga0207687_10286702 Ga0207687_102867022 274
985 3300025928 Ga0207700_10023416 Ga0207700_100234163 274
986 3300025928 Ga0207700_10054210 Ga0207700_100542102 274
987 3300025929 Ga0207664_10010848 Ga0207664_100108485 274
988 3300025929 Ga0207664_10205200 Ga0207664_102052002 274
989 3300025929 Ga0207664_10402331 Ga0207664_104023312 274
990 3300025931 Ga0207644_10000724 Ga0207644_1000072411 274
991 3300025931 Ga0207644_10087486 Ga0207644_100874862 274
992 3300025931 Ga0207644_10128859 Ga0207644_101288592 274
993 3300025931 Ga0207644_10222421 Ga0207644_102224212 274
994 3300025932 Ga0207690_10000203 Ga0207690_1000020328 274
995 3300025932 Ga0207690_10090553 Ga0207690_100905532 274
996 3300025933 Ga0207706_10001683 Ga0207706_1000168311 274
997 3300025933 Ga0207706_10002188 Ga0207706_1000218821 274
998 3300025933 Ga0207706_10014893 Ga0207706_100148934 274
999 3300025933 Ga0207706_10038655 Ga0207706_100386553 274
1000 3300025933 Ga0207706_10119921 Ga0207706_101199213 274
1001 3300025934 Ga0207686_10000995 Ga0207686_100009954 274
1002 3300025934 Ga0207686_10022973 Ga0207686_100229732 274
1003 3300025934 Ga0207686_10027938 Ga0207686_100279382 274
1004 3300025935 Ga0207709_10000607 Ga0207709_1000060710 274
1005 3300025935 Ga0207709_10018652 Ga0207709_100186524 274
1006 3300025935 Ga0207709_10254282 Ga0207709_102542821 274
1007 3300025936 Ga0207670_10000125 Ga0207670_1000012511 274
1008 3300025936 Ga0207670_10004752 Ga0207670_100047523 274
1009 3300025936 Ga0207670_10029657 Ga0207670_100296573 274
1010 3300025936 Ga0207670_10070528 Ga0207670_100705282 274
1011 3300025937 Ga0207669_10000357 Ga0207669_100003573 274
1012 3300025937 Ga0207669_10010638 Ga0207669_100106384 274
1013 3300025938 Ga0207704_10001003 Ga0207704_100010033 274
1014 3300025938 Ga0207704_10065467 Ga0207704_100654672 274
1015 3300025938 Ga0207704_10128879 Ga0207704_101288792 274
1016 3300025938 Ga0207704_10316430 Ga0207704_103164301 274
1017 3300025939 Ga0207665_10004285 Ga0207665_100042854 274
1018 3300025940 Ga0207691_10000256 Ga0207691_1000025654 274
1019 3300025940 Ga0207691_10000550 Ga0207691_1000055019 274
1020 3300025940 Ga0207691_10072331 Ga0207691_100723312 274
1021 3300025940 Ga0207691_10119625 Ga0207691_101196252 274
1022 3300025941 Ga0207711_10008837 Ga0207711_100088377 274
1023 3300025941 Ga0207711_10012565 Ga0207711_100125655 274
1024 3300025941 Ga0207711_10016967 Ga0207711_100169672 274
1025 3300025941 Ga0207711_10043077 Ga0207711_100430771 274
1026 3300025941 Ga0207711_10046162 Ga0207711_100461624 274
1027 3300025941 Ga0207711_10170042 Ga0207711_101700421 274
1028 3300025942 Ga0207689_10000008 Ga0207689_1000000812 274
1029 3300025942 Ga0207689_10186300 Ga0207689_101863002 274
1030 3300025942 Ga0207689_10430909 Ga0207689_104309092 274
1031 3300025944 Ga0207661_10000104 Ga0207661_1000010442 274
1032 3300025945 Ga0207679_10000196 Ga0207679_100001963 274
1033 3300025945 Ga0207679_10067421 Ga0207679_100674212 274
1034 3300025949 Ga0207667_10115111 Ga0207667_101151112 274
1035 3300025949 Ga0207667_10147683 Ga0207667_101476832 274
1036 3300025949 Ga0207667_10161073 Ga0207667_101610732 274
1037 3300025960 Ga0207651_10001000 Ga0207651_1000100011 274
1038 3300025960 Ga0207651_10180791 Ga0207651_101807912 274
1039 3300025960 Ga0207651_10313259 Ga0207651_103132592 274
1040 3300025960 Ga0207651_10352358 Ga0207651_103523582 274
1041 3300025961 Ga0207712_10000156 Ga0207712_100001568 274
1042 3300025961 Ga0207712_10001014 Ga0207712_100010144 274
1043 3300025961 Ga0207712_10014509 Ga0207712_100145093 274
1044 3300025961 Ga0207712_10184934 Ga0207712_101849342 274
1045 3300025961 Ga0207712_10233568 Ga0207712_102335682 274
1046 3300025961 Ga0207712_10319767 Ga0207712_103197672 274
1047 3300025972 Ga0207668_10000251 Ga0207668_1000025122 274
1048 3300025972 Ga0207668_10000595 Ga0207668_100005959 274
1049 3300025981 Ga0207640_10000157 Ga0207640_1000015719 274
1050 3300025981 Ga0207640_10355997 Ga0207640_103559972 274
1051 3300025986 Ga0207658_10001085 Ga0207658_100010859 274
1052 3300025986 Ga0207658_10003467 Ga0207658_100034679 274
1053 3300025986 Ga0207658_10033714 Ga0207658_100337144 274
1054 3300025986 Ga0207658_10073036 Ga0207658_100730363 274
1055 3300025986 Ga0207658_10156223 Ga0207658_101562232 274
1056 3300026023 Ga0207677_10000609 Ga0207677_100006096 274
1057 3300026023 Ga0207677_10076415 Ga0207677_100764151 274
1058 3300026035 Ga0207703_10000530 Ga0207703_1000053017 274
1059 3300026035 Ga0207703_10003859 Ga0207703_100038593 274
1060 3300026035 Ga0207703_10132484 Ga0207703_101324842 274
1061 3300026041 Ga0207639_10001949 Ga0207639_100019499 274
1062 3300026041 Ga0207639_10064883 Ga0207639_100648832 274
1063 3300026067 Ga0207678_10004329 Ga0207678_1000432912 274
1064 3300026067 Ga0207678_10019030 Ga0207678_100190307 274
1065 3300026067 Ga0207678_10058156 Ga0207678_100581562 274
1066 3300026067 Ga0207678_10114069 Ga0207678_101140692 274
1067 3300026075 Ga0207708_10002782 Ga0207708_100027823 274
1068 3300026075 Ga0207708_10007180 Ga0207708_100071807 274
1069 3300026075 Ga0207708_10035382 Ga0207708_100353823 274
1070 3300026078 Ga0207702_10016459 Ga0207702_100164594 274
1071 3300026078 Ga0207702_10080783 Ga0207702_100807832 274
1072 3300026078 Ga0207702_10195723 Ga0207702_101957232 274
1073 3300026078 Ga0207702_10696435 Ga0207702_106964351 274
1074 3300026088 Ga0207641_10003122 Ga0207641_1000312215 274
1075 3300026088 Ga0207641_10011900 Ga0207641_100119003 274
1076 3300026088 Ga0207641_10178079 Ga0207641_101780792 274
1077 3300026088 Ga0207641_10481848 Ga0207641_104818481 274
1078 3300026088 Ga0207641_10694818 Ga0207641_106948182 274
1079 3300026089 Ga0207648_10001448 Ga0207648_1000144822 274
1080 3300026089 Ga0207648_10005563 Ga0207648_100055632 274
1081 3300026089 Ga0207648_10008182 Ga0207648_100081824 274
1082 3300026089 Ga0207648_10027139 Ga0207648_100271393 274
1083 3300026095 Ga0207676_10000141 Ga0207676_1000014146 274
1084 3300026095 Ga0207676_10031668 Ga0207676_100316682 274
1085 3300026095 Ga0207676_10108939 Ga0207676_101089392 274
1086 3300026095 Ga0207676_10342268 Ga0207676_103422682 274
1087 3300026116 Ga0207674_10009174 Ga0207674_1000917410 274
1088 3300026118 Ga0207675_100000604 Ga0207675_10000060428 274
1089 3300026118 Ga0207675_100001525 Ga0207675_10000152511 274
1090 3300026118 Ga0207675_100013369 Ga0207675_1000133692 274
1091 3300026118 Ga0207675_100710429 Ga0207675_1007104291 274
1092 3300026121 Ga0207683_10000006 Ga0207683_1000000697 274
1093 3300026121 Ga0207683_10001096 Ga0207683_1000109627 274
1094 3300026121 Ga0207683_10015012 Ga0207683_100150125 274
1095 3300026121 Ga0207683_10069343 Ga0207683_100693432 274
1096 3300026142 Ga0207698_10000378 Ga0207698_1000037810 274
1097 3300026142 Ga0207698_10284239 Ga0207698_102842392 274
1098 3300026142 Ga0207698_10303401 Ga0207698_103034012 274
1099 3300027364 Ga0209967_1001997 Ga0209967_10019973 274
1100 3300027424 Ga0209984_1003158 Ga0209984_10031582 274
1101 3300027471 Ga0209995_1023795 Ga0209995_10237951 274
1102 3300027543 Ga0209999_1010111 Ga0209999_10101112 274
1103 3300027552 Ga0209982_1012504 Ga0209982_10125042 274
1104 3300027614 Ga0209970_1006414 Ga0209970_10064142 274
1105 3300027617 Ga0210002_1002058 Ga0210002_10020582 274
1106 3300027617 Ga0210002_1009177 Ga0210002_10091772 274
1107 3300027665 Ga0209983_1003202 Ga0209983_10032022 274
1108 3300027682 Ga0209971_1000338 Ga0209971_10003382 274
1109 3300027695 Ga0209966_1004428 Ga0209966_10044282 274
1110 3300027717 Ga0209998_10000168 Ga0209998_1000016816 274
1111 3300027717 Ga0209998_10002910 Ga0209998_100029104 274
1112 3300027717 Ga0209998_10003848 Ga0209998_100038484 274
1113 3300027866 Ga0209813_10018076 Ga0209813_100180762 274
1114 3300027876 Ga0209974_10000232 Ga0209974_1000023213 274
1115 3300027907 Ga0207428_10000165 Ga0207428_1000016591 274
1116 3300027907 Ga0207428_10000446 Ga0207428_100004466 274
1117 3300027907 Ga0207428_10001251 Ga0207428_1000125128 274
1118 3300028379 Ga0268266_10012277 Ga0268266_100122776 274
1119 3300028379 Ga0268266_10033418 Ga0268266_100334182 274
1120 3300028379 Ga0268266_10150931 Ga0268266_101509312 274
1121 3300028380 Ga0268265_10000677 Ga0268265_1000067722 274
1122 3300028380 Ga0268265_10001687 Ga0268265_100016873 274
1123 3300028380 Ga0268265_10028697 Ga0268265_100286972 274
1124 3300028381 Ga0268264_10000360 Ga0268264_1000036072 274
1125 3300028381 Ga0268264_10002029 Ga0268264_100020294 274
1126 3300028381 Ga0268264_10097281 Ga0268264_100972813 274
1127 3300031235 Ga0265330_10080292 Ga0265330_100802922 274
1128 3300031241 Ga0265325_10000026 Ga0265325_1000002668 274
1129 3300031241 Ga0265325_10094403 Ga0265325_100944031 274
1130 3300031247 Ga0265340_10091469 Ga0265340_100914692 274
1131 3300031548 Ga0307408_100243712 Ga0307408_1002437122 274
1132 3300031595 Ga0265313_10053441 Ga0265313_100534412 274
1133 3300031595 Ga0265313_10058519 Ga0265313_100585191 274
1134 3300031712 Ga0265342_10017496 Ga0265342_100174962 274
1135 3300034816 Ga0373930_0000613 Ga0373930_0000613_2653_3516 274
1136 3300034816 Ga0373930_0000992 Ga0373930_0000992_1793_2656 274
1137 3300034817 Ga0373948_0000083 Ga0373948_0000083_6585_7448 274
1138 3300034818 Ga0373950_0007316 Ga0373950_0007316_306_1169 274
1139 3300034819 Ga0373958_0002135 Ga0373958_0002135_1386_2249 274
1140 3300034820 Ga0373959_0006063 Ga0373959_0006063_907_1770 274
1141 3300034957 Ga0373938_0001037 Ga0373938_0001037_2489_3352 274
1142 3300035084 Ga0373928_0013130 Ga0373928_0013130_492_1355 274
1143 3300035085 Ga0373929_0000847 Ga0373929_0000847_2691_3554 274
1144 3300035086 Ga0373934_0006693 Ga0373934_0006693_3244_4107 274
1145 3300035088 Ga0373940_0000931 Ga0373940_0000931_1650_2513 274
1146 3300035090 Ga0373949_0002681 Ga0373949_0002681_219_1082 274
1147 3300035090 Ga0373949_0002749 Ga0373949_0002749_1201_2208 274
1148 3300035091 Ga0373951_0000469 Ga0373951_0000469_2025_2888 274
1149 3300035091 Ga0373951_0001389 Ga0373951_0001389_1588_2451 274
1150 3300035092 Ga0373952_0001783 Ga0373952_0001783_1574_2437 274
1151 3300035092 Ga0373952_0002699 Ga0373952_0002699_1512_2375 274
1152 3300035112 Ga0373932_0000757 Ga0373932_0000757_492_1355 274
1153 3300035112 Ga0373932_0005374 Ga0373932_0005374_2033_2896 274
1154 3300035112 Ga0373932_0017314 Ga0373932_0017314_269_1132 274
1155 3300035112 Ga0373932_0018395 Ga0373932_0018395_715_1626 274
1156 3300035113 Ga0373936_0000140 Ga0373936_0000140_21981_22853 274
1157 3300035113 Ga0373936_0032890 Ga0373936_0032890_940_1803 274
1158 3300035113 Ga0373936_0042418 Ga0373936_0042418_325_1188 274
1159 3300035114 Ga0373939_0000487 Ga0373939_0000487_2161_3024 274
1160 3300035114 Ga0373939_0002471 Ga0373939_0002471_1363_2226 274
1161 3300035114 Ga0373939_0028942 Ga0373939_0028942_450_1313 274
1162 3300035115 Ga0373941_0000083 Ga0373941_0000083_4666_5529 274
1163 3300035115 Ga0373941_0024289 Ga0373941_0024289_162_1025 274
1164 3300035116 Ga0373945_0024587 Ga0373945_0024587_422_1294 274
1165 3300035116 Ga0373945_0046025 Ga0373945_0046025_199_1071 274
1166 3300035117 Ga0373953_0000297 Ga0373953_0000297_5217_6089 274
1167 3300035117 Ga0373953_0025432 Ga0373953_0025432_720_1598 274
1168 3300035118 Ga0373954_0003422 Ga0373954_0003422_1339_2211 274
1169 3300035118 Ga0373954_0013833 Ga0373954_0013833_494_1405 274
1170 3300035119 Ga0373956_0003044 Ga0373956_0003044_5477_6340 274
1171 3300035119 Ga0373956_0028591 Ga0373956_0028591_534_1412 274
1172 3300035120 Ga0373957_0000766 Ga0373957_0000766_6413_7324 274
1173 3300035121 Ga0373960_0000185 Ga0373960_0000185_360_1223 274
1174 3300035170 Ga0373943_0012583 Ga0373943_0012583_1598_2470 274
1175 3300035170 Ga0373943_0013519 Ga0373943_0013519_2044_2916 274
1176 3300035170 Ga0373943_0052297 Ga0373943_0052297_64_927 274
1177 3300035171 Ga0373946_0003338 Ga0373946_0003338_982_1854 274
1178 3300035171 Ga0373946_0009415 Ga0373946_0009415_2247_3110 274
1179 3300035171 Ga0373946_0029581 Ga0373946_0029581_77_949 274
1180 3300035172 Ga0373955_0000121 Ga0373955_0000121_26062_26934 274
1181 3300035172 Ga0373955_0025869 Ga0373955_0025869_793_1671 274
1182 3300035207 Ga0373942_0004921 Ga0373942_0004921_306_1169 274
1183 3300035241 Ga0373961_0000569 Ga0373961_0000569_1829_2692 274
1184 3300035241 Ga0373961_0028343 Ga0373961_0028343_556_1419 274
1185 3300035242 Ga0373962_0001061 Ga0373962_0001061_1322_2329 274
1186 3300035242 Ga0373962_0001225 Ga0373962_0001225_2978_3841 274
1187 3300035242 Ga0373962_0036828 Ga0373962_0036828_373_1236 274
1188 3300035410 Ga0373924_0003715 Ga0373924_0003715_568_1431 274
1189 3300035410 Ga0373924_0020927 Ga0373924_0020927_913_1791 274
1190 3300035410 Ga0373924_0027227 Ga0373924_0027227_1094_1957 274
1191 3300035691 Ga0373931_0001480 Ga0373931_0001480_4543_5406 274
1192 3300035691 Ga0373931_0025503 Ga0373931_0025503_1919_2830 274
1193 3300035692 Ga0373935_0120300 Ga0373935_0120300_391_1254 274
1194 3300035695 Ga0373927_0006188 Ga0373927_0006188_7067_7939 274
1195 3300035695 Ga0373927_0009234 Ga0373927_0009234_4872_5744 274
1196 3300035695 Ga0373927_0030544 Ga0373927_0030544_2194_3057 274
1197 3300035695 Ga0373927_0035875 Ga0373927_0035875_1815_2678 274
1198 3300035695 Ga0373927_0071910 Ga0373927_0071910_729_1592 274
1199 3300035695 Ga0373927_0106256 Ga0373927_0106256_340_1218 274
1200 3300035724 Ga0373933_0003839 Ga0373933_0003839_5284_6195 274
1201 3300035724 Ga0373933_0016466 Ga0373933_0016466_2435_3298 274
1202 3300035724 Ga0373933_0106527 Ga0373933_0106527_350_1228 274
1203 3300035725 Ga0373947_0001544 Ga0373947_0001544_1985_2848 274
1204 3300035725 Ga0373947_0175377 Ga0373947_0175377_392_1264 274
1205 3300035725 Ga0373947_0192984 Ga0373947_0192984_206_1078 274
1206 3300036401 Ga0373937_0001392 Ga0373937_0001392_3762_4634 274
1207 3300036401 Ga0373937_0039790 Ga0373937_0039790_2130_2993 274
1208 3300037068 Ga0373925_0000016 Ga0373925_0000016_93244_94116 274
1209 3300037068 Ga0373925_0125815 Ga0373925_0125815_639_1502 274
1210 3300037068 Ga0373925_0183746 Ga0373925_0183746_360_1232 274
1211 3300038996 Ga0242420_000941 Ga0242420_000941_644_1507 274
1212 3300039437 Ga0436365_0405014 Ga0436365_0405014_1031_1906 274
1213 3300039437 Ga0436365_1280755 Ga0436365_1280755_185_1048 274
1214 3300042005 Ga0439448_0020673 Ga0439448_0020673_489_1352 274
1215 3300042005 Ga0439448_0045884 Ga0439448_0045884_458_1321 274
1216 3300042157 Ga0439458_0016844 Ga0439458_0016844_356_1219 274
1217 3300042461 Ga0439460_0058438 Ga0439460_0058438_143_1006 274
1218 3300042876 Ga0451577_0142177 Ga0451577_0142177_192_1055 274
1219 3300042993 Ga0439440_0029891 Ga0439440_0029891_133_996 274
1220 3300044694 Ga0466963_0382954 Ga0466963_0382954_53_928 274
1221 3300044712 Ga0453684_0057110 Ga0453684_0057110_2627_3490 274
1222 3300045051 Ga0451576_0054772 Ga0451576_0054772_1938_2801 274
1223 3300045976 Ga0466967_0257003 Ga0466967_0257003_587_1462 274
1224 3300046454 Ga0495592_0000044 Ga0495592_0000044_61729_62601 274
1225 3300046454 Ga0495592_0011150 Ga0495592_0011150_2808_3671 274
1226 3300046454 Ga0495592_0285604 Ga0495592_0285604_122_1000 274
1227 3300046455 Ga0495603_0202372 Ga0495603_0202372_45_917 274
1228 3300046459 Ga0495629_0000908 Ga0495629_0000908_20114_20977 274
1229 3300046459 Ga0495629_0001495 Ga0495629_0001495_1023_1895 274
1230 3300046459 Ga0495629_0103934 Ga0495629_0103934_148_1026 274
1231 3300046461 Ga0495641_0071094 Ga0495641_0071094_345_1217 274
1232 3300046462 Ga0495651_0000384 Ga0495651_0000384_22006_22878 274
1233 3300046462 Ga0495651_0005140 Ga0495651_0005140_2403_3314 274
1234 3300046462 Ga0495651_0011671 Ga0495651_0011671_3702_4565 274
1235 3300046462 Ga0495651_0052883 Ga0495651_0052883_1879_2757 274
1236 3300046462 Ga0495651_0204309 Ga0495651_0204309_465_1328 274
1237 3300046463 Ga0495653_0000022 Ga0495653_0000022_43611_44483 274
1238 3300046463 Ga0495653_0001587 Ga0495653_0001587_489_1400 274
1239 3300046463 Ga0495653_0013657 Ga0495653_0013657_547_1410 274
1240 3300046463 Ga0495653_0046604 Ga0495653_0046604_530_1393 274
1241 3300046463 Ga0495653_0207086 Ga0495653_0207086_217_1095 274
1242 3300046473 Ga0495582_0019944 Ga0495582_0019944_828_1691 274
1243 3300046473 Ga0495582_0030062 Ga0495582_0030062_1178_2050 274
1244 3300046473 Ga0495582_0031626 Ga0495582_0031626_1974_2837 274
1245 3300046473 Ga0495582_0033109 Ga0495582_0033109_1149_2027 274
1246 3300046476 Ga0495662_0019655 Ga0495662_0019655_2087_2959 274
1247 3300046476 Ga0495662_0063836 Ga0495662_0063836_546_1409 274
1248 3300046477 Ga0495664_0000013 Ga0495664_0000013_146773_147645 274
1249 3300046491 Ga0495584_0052280 Ga0495584_0052280_709_1572 274
1250 3300046499 Ga0495594_0013695 Ga0495594_0013695_1401_2264 274
1251 3300046499 Ga0495594_0200197 Ga0495594_0200197_101_973 274
1252 3300046511 Ga0495608_0000004 Ga0495608_0000004_297503_298375 274
1253 3300046511 Ga0495608_0008967 Ga0495608_0008967_4754_5632 274
1254 3300046511 Ga0495608_0033665 Ga0495608_0033665_2047_2910 274
1255 3300046514 Ga0495618_0000032 Ga0495618_0000032_30040_30912 274
1256 3300046514 Ga0495618_0013805 Ga0495618_0013805_472_1335 274
1257 3300046516 Ga0495628_0000014 Ga0495628_0000014_58181_59053 274
1258 3300046516 Ga0495628_0000115 Ga0495628_0000115_28717_29580 274
1259 3300046516 Ga0495628_0148581 Ga0495628_0148581_204_1082 274
1260 3300046517 Ga0495630_0004635 Ga0495630_0004635_3456_4328 274
1261 3300046517 Ga0495630_0111347 Ga0495630_0111347_474_1337 274
1262 3300046525 Ga0495663_0080130 Ga0495663_0080130_20_883 274
1263 3300046529 Ga0495652_0000002 Ga0495652_0000002_151887_152759 274
1264 3300046529 Ga0495652_0003686 Ga0495652_0003686_2607_3470 274
1265 3300046529 Ga0495652_0003875 Ga0495652_0003875_551_1462 274
1266 3300046529 Ga0495652_0022889 Ga0495652_0022889_551_1414 274
1267 3300046529 Ga0495652_0082877 Ga0495652_0082877_1578_2456 274
1268 3300046533 Ga0495640_0000001 Ga0495640_0000001_245891_246763 274
1269 3300046533 Ga0495640_0024962 Ga0495640_0024962_3180_4043 274
1270 3300046535 Ga0495586_0046247 Ga0495586_0046247_1058_1921 274
1271 3300046536 Ga0495587_0000004 Ga0495587_0000004_300987_301859 274
1272 3300046536 Ga0495587_0002412 Ga0495587_0002412_9648_10559 274
1273 3300046536 Ga0495587_0108284 Ga0495587_0108284_412_1275 274
1274 3300046543 Ga0495645_0000001 Ga0495645_0000001_56731_57603 274
1275 3300046543 Ga0495645_0014956 Ga0495645_0014956_1127_1990 274
1276 3300046543 Ga0495645_0152431 Ga0495645_0152431_116_994 274
1277 3300046543 Ga0495645_0182985 Ga0495645_0182985_549_1412 274
1278 3300046557 Ga0495622_0051388 Ga0495622_0051388_486_1349 274
1279 3300046559 Ga0495667_0000009 Ga0495667_0000009_61780_62652 274
1280 3300046559 Ga0495667_0012187 Ga0495667_0012187_2787_3698 274
1281 3300046559 Ga0495667_0035970 Ga0495667_0035970_583_1461 274
1282 3300046642 Ga0495634_0000033 Ga0495634_0000033_33299_34171 274
1283 3300046642 Ga0495634_0018450 Ga0495634_0018450_3443_4306 274
1284 3300046642 Ga0495634_0221214 Ga0495634_0221214_47_910 274
1285 3300046648 Ga0495611_0055220 Ga0495611_0055220_810_1676 274
1286 3300046663 Ga0495635_0000003 Ga0495635_0000003_56588_57460 274
1287 3300046663 Ga0495635_0018371 Ga0495635_0018371_317_1228 274
1288 3300046663 Ga0495635_0025906 Ga0495635_0025906_582_1445 274
1289 3300046663 Ga0495635_0114215 Ga0495635_0114215_576_1439 274
1290 3300046674 Ga0495588_0095502 Ga0495588_0095502_153_1016 274
1291 3300046675 Ga0495657_0000138 Ga0495657_0000138_8413_9285 274
1292 3300046675 Ga0495657_0137699 Ga0495657_0137699_121_999 274
1293 3300046678 Ga0495599_0000030 Ga0495599_0000030_56160_57032 274
1294 3300046678 Ga0495599_0002434 Ga0495599_0002434_1509_2372 274
1295 3300046679 Ga0495623_0000059 Ga0495623_0000059_56629_57501 274
1296 3300046679 Ga0495623_0004365 Ga0495623_0004365_3734_4597 274
1297 3300046679 Ga0495623_0013790 Ga0495623_0013790_1345_2208 274
1298 3300046680 Ga0495646_0000031 Ga0495646_0000031_56647_57519 274
1299 3300046680 Ga0495646_0001361 Ga0495646_0001361_550_1461 274
1300 3300046680 Ga0495646_0157758 Ga0495646_0157758_237_1100 274
1301 3300046683 Ga0495658_0002673 Ga0495658_0002673_2815_3678 274
1302 3300046683 Ga0495658_0011071 Ga0495658_0011071_358_1221 274
1303 3300046683 Ga0495658_0070242 Ga0495658_0070242_597_1469 274
1304 3300046689 Ga0495613_0042220 Ga0495613_0042220_439_1302 274
1305 3300046689 Ga0495613_0078712 Ga0495613_0078712_1330_2202 274
1306 3300046689 Ga0495613_0099462 Ga0495613_0099462_303_1166 274
1307 3300046689 Ga0495613_0149353 Ga0495613_0149353_14_886 274
1308 3300046690 Ga0495624_0045990 Ga0495624_0045990_1867_2730 274
1309 3300046809 Ga0495600_0000003 Ga0495600_0000003_164289_165161 274
1310 3300046809 Ga0495600_0024479 Ga0495600_0024479_1934_2797 274
1311 3300046809 Ga0495600_0035224 Ga0495600_0035224_316_1227 274
1312 3300047315 Ga0495581_0011221 Ga0495581_0011221_3485_4348 274
1313 3300047317 Ga0495604_0000002 Ga0495604_0000002_473405_474277 274
1314 3300047317 Ga0495604_0001990 Ga0495604_0001990_529_1392 274
1315 3300047317 Ga0495604_0030332 Ga0495604_0030332_1465_2376 274
1316 3300047317 Ga0495604_0038955 Ga0495604_0038955_333_1211 274
1317 3300047318 Ga0495636_0046007 Ga0495636_0046007_844_1707 274
1318 3300047319 Ga0495674_0000004 Ga0495674_0000004_472738_473610 274
1319 3300047319 Ga0495674_0017159 Ga0495674_0017159_1073_1936 274
1320 3300047319 Ga0495674_0059571 Ga0495674_0059571_505_1416 274
1321 3300047319 Ga0495674_0079574 Ga0495674_0079574_1523_2401 274
1322 3300047319 Ga0495674_0082219 Ga0495674_0082219_630_1493 274
1323 3300047321 Ga0495676_0017161 Ga0495676_0017161_1889_2752 274
1324 3300047321 Ga0495676_0153273 Ga0495676_0153273_254_1126 274
1325 3300047322 Ga0495680_0000676 Ga0495680_0000676_25456_26328 274
1326 3300047322 Ga0495680_0018591 Ga0495680_0018591_3207_4085 274
1327 3300047322 Ga0495680_0019866 Ga0495680_0019866_1610_2473 274
1328 3300047444 Ga0495675_0000048 Ga0495675_0000048_24095_24967 274
1329 3300047444 Ga0495675_0001520 Ga0495675_0001520_7870_8733 274
1330 3300047444 Ga0495675_0020343 Ga0495675_0020343_1299_2177 274
1331 3300047444 Ga0495675_0084970 Ga0495675_0084970_414_1277 274
1332 3300047471 Ga0495684_0000019 Ga0495684_0000019_96435_97307 274
1333 3300047471 Ga0495684_0037312 Ga0495684_0037312_2709_3572 274
1334 3300047673 Ga0495593_0006402 Ga0495593_0006402_4092_4955 274
1335 3300047673 Ga0495593_0026370 Ga0495593_0026370_1708_2571 274
1336 3300047673 Ga0495593_0115580 Ga0495593_0115580_74_952 274
1337 3300048088 Ga0495602_0000001 Ga0495602_0000001_56630_57502 274
1338 3300048088 Ga0495602_0023818 Ga0495602_0023818_3467_4330 274
1339 3300048088 Ga0495602_0179865 Ga0495602_0179865_379_1257 274
1340 3300048088 Ga0495602_0220184 Ga0495602_0220184_317_1180 274
1341 3300048903 Ga0496100_0001037 Ga0496100_0001037_2672_3679 274
1342 3300048903 Ga0496100_0027866 Ga0496100_0027866_498_1361 274
1343 3300048903 Ga0496100_0041163 Ga0496100_0041163_918_1781 274
1344 3300048904 Ga0496101_0000464 Ga0496101_0000464_22511_23518 274
1345 3300048904 Ga0496101_0003701 Ga0496101_0003701_4291_5154 274
1346 3300048904 Ga0496101_0050339 Ga0496101_0050339_147_1010 274
1347 3300048904 Ga0496101_0075982 Ga0496101_0075982_716_1594 274
1348 3300048904 Ga0496101_0245388 Ga0496101_0245388_211_1074 274
1349 3300048905 Ga0496102_0001120 Ga0496102_0001120_9871_10734 274
1350 3300048905 Ga0496102_0006511 Ga0496102_0006511_7142_8005 274
1351 3300048905 Ga0496102_0042908 Ga0496102_0042908_1249_2112 274
1352 3300048905 Ga0496102_0069508 Ga0496102_0069508_359_1270 274
1353 3300048905 Ga0496102_0091703 Ga0496102_0091703_1590_2453 274
1354 3300048905 Ga0496102_0171787 Ga0496102_0171787_560_1423 274
1355 3300048906 Ga0496103_0000611 Ga0496103_0000611_10997_11860 274
1356 3300048906 Ga0496103_0033257 Ga0496103_0033257_1090_1953 274
1357 3300048906 Ga0496103_0033988 Ga0496103_0033988_463_1326 274
1358 3300048907 Ga0496104_0000299 Ga0496104_0000299_34993_35856 274
1359 3300048907 Ga0496104_0016816 Ga0496104_0016816_3075_3938 274
1360 3300048907 Ga0496104_0191902 Ga0496104_0191902_874_1737 274
1361 3300048907 Ga0496104_0210560 Ga0496104_0210560_870_1733 274
1362 3300048907 Ga0496104_0220300 Ga0496104_0220300_698_1576 274
1363 3300048908 Ga0496105_0001270 Ga0496105_0001270_3313_4176 274
1364 3300048908 Ga0496105_0062354 Ga0496105_0062354_992_1855 274
1365 3300048908 Ga0496105_0077085 Ga0496105_0077085_1231_2094 274
1366 3300048908 Ga0496105_0088222 Ga0496105_0088222_1535_2398 274
1367 3300048909 Ga0496106_0000541 Ga0496106_0000541_16091_17098 274
1368 3300048909 Ga0496106_0013112 Ga0496106_0013112_4480_5343 274
1369 3300048909 Ga0496106_0029493 Ga0496106_0029493_2004_2867 274
1370 3300048909 Ga0496106_0069918 Ga0496106_0069918_465_1328 274
1371 3300048909 Ga0496106_0283435 Ga0496106_0283435_36_899 274
1372 3300048910 Ga0496107_0000493 Ga0496107_0000493_7304_8311 274
1373 3300048910 Ga0496107_0020737 Ga0496107_0020737_2502_3365 274
1374 3300048910 Ga0496107_0025307 Ga0496107_0025307_2580_3443 274
1375 3300048910 Ga0496107_0312540 Ga0496107_0312540_107_970 274
1376 3300048911 Ga0496108_0001251 Ga0496108_0001251_9062_9925 274
1377 3300048911 Ga0496108_0009140 Ga0496108_0009140_3269_4132 274
1378 3300048911 Ga0496108_0023341 Ga0496108_0023341_1434_2297 274
1379 3300048911 Ga0496108_0057901 Ga0496108_0057901_1040_1903 274
1380 3300048911 Ga0496108_0558448 Ga0496108_0558448_38_901 274
1381 3300048912 Ga0496109_0003457 Ga0496109_0003457_8892_9755 274
1382 3300048912 Ga0496109_0003885 Ga0496109_0003885_9583_10590 274
1383 3300048912 Ga0496109_0096922 Ga0496109_0096922_733_1611 274
1384 3300048912 Ga0496109_0106326 Ga0496109_0106326_1526_2389 274
1385 3300048912 Ga0496109_0459416 Ga0496109_0459416_218_1081 274
1386 3300048913 Ga0496110_0052760 Ga0496110_0052760_2082_2945 274
1387 3300048913 Ga0496110_0132905 Ga0496110_0132905_644_1507 274
1388 3300048913 Ga0496110_0144867 Ga0496110_0144867_362_1225 274
1389 3300048913 Ga0496110_0253593 Ga0496110_0253593_309_1172 274
1390 3300048914 Ga0496111_0021214 Ga0496111_0021214_2464_3471 274
1391 3300048914 Ga0496111_0030829 Ga0496111_0030829_1632_2495 274
1392 3300048914 Ga0496111_0036078 Ga0496111_0036078_2472_3335 274
1393 3300048914 Ga0496111_0147173 Ga0496111_0147173_693_1556 274
1394 3300048915 Ga0496112_0017113 Ga0496112_0017113_661_1524 274
1395 3300048915 Ga0496112_0072404 Ga0496112_0072404_549_1412 274
1396 3300048915 Ga0496112_0092462 Ga0496112_0092462_1222_2085 274
1397 3300048915 Ga0496112_0284697 Ga0496112_0284697_190_1053 274
1398 3300048916 Ga0496113_0001926 Ga0496113_0001926_3132_3995 274
1399 3300048916 Ga0496113_0050089 Ga0496113_0050089_938_1801 274
1400 3300048916 Ga0496113_0053403 Ga0496113_0053403_2129_2992 274
1401 3300048916 Ga0496113_0079168 Ga0496113_0079168_356_1363 274
1402 3300048916 Ga0496113_0144370 Ga0496113_0144370_566_1429 274
1403 3300048916 Ga0496113_0255593 Ga0496113_0255593_289_1152 274
1404 3300048917 Ga0496114_0003043 Ga0496114_0003043_7568_8431 274
1405 3300048917 Ga0496114_0009948 Ga0496114_0009948_2329_3192 274
1406 3300048917 Ga0496114_0227947 Ga0496114_0227947_195_1058 274
1407 3300048918 Ga0496115_0003177 Ga0496115_0003177_9890_10753 274
1408 3300048918 Ga0496115_0033657 Ga0496115_0033657_752_1663 274
1409 3300048918 Ga0496115_0058773 Ga0496115_0058773_602_1513 274
1410 3300048918 Ga0496115_0193218 Ga0496115_0193218_475_1338 274
1411 3300048918 Ga0496115_0251025 Ga0496115_0251025_116_979 274
1412 3300049581 Ga0501047_0059048 Ga0501047_0059048_432_1298 274
1413 3300049583 Ga0501067_0025722 Ga0501067_0025722_260_1126 274
1414 3300049586 Ga0501070_0044504 Ga0501070_0044504_673_1539 274
1415 3300049586 Ga0501070_0148709 Ga0501070_0148709_1006_1875 274
1416 3300049589 Ga0501073_0009055 Ga0501073_0009055_1549_2415 274
1417 3300049590 Ga0501074_0004160 Ga0501074_0004160_3882_4748 274
1418 3300049823 Ga0501044_0058669 Ga0501044_0058669_1539_2405 274
1419 3300050489 nmdc:mga03683_109015_c1 nmdc:mga03683_109015_c1_111_983 274
1420 3300050489 nmdc:mga03683_119684_c1 nmdc:mga03683_119684_c1_32_904 274
1421 3300050490 nmdc:mga03n38_180299_c1 nmdc:mga03n38_180299_c1_200_1072 274
1422 3300050491 nmdc:mga00v17_145541_c1 nmdc:mga00v17_145541_c1_31_903 274
1423 3300050492 nmdc:mga0yw44_195059_c1 nmdc:mga0yw44_195059_c1_191_1060 274
1424 3300050492 nmdc:mga0yw44_79672_c1 nmdc:mga0yw44_79672_c1_1023_1895 274
1425 3300050493 nmdc:mga0k408_46867_c1 nmdc:mga0k408_46867_c1_1498_2370 274
1426 3300050493 nmdc:mga0k408_93897_c1 nmdc:mga0k408_93897_c1_813_1685 274
1427 3300050494 nmdc:mga06z11_46856_c1 nmdc:mga06z11_46856_c1_589_1461 274
1428 3300050496 nmdc:mga07m45_98142_c1 nmdc:mga07m45_98142_c1_324_1196 274
1429 3300050507 nmdc:mga05p37_33600_c1 nmdc:mga05p37_33600_c1_3480_4343 274
1430 3300050508 nmdc:mga09592_12517_c1 nmdc:mga09592_12517_c1_535_1398 274
1431 3300050509 nmdc:mga0qj67_33232_c1 nmdc:mga0qj67_33232_c1_1011_1919 274
1432 3300050509 nmdc:mga0qj67_693_c1 nmdc:mga0qj67_693_c1_19016_19879 274
1433 3300050510 nmdc:mga06r32_1056_c1 nmdc:mga06r32_1056_c1_22581_23444 274
1434 3300050510 nmdc:mga06r32_475647_c1 nmdc:mga06r32_475647_c1_199_1107 274
1435 3300050510 nmdc:mga06r32_70450_c1 nmdc:mga06r32_70450_c1_1226_2134 274
1436 3300050511 nmdc:mga08y16_160719_c1 nmdc:mga08y16_160719_c1_683_1546 274
1437 3300050511 nmdc:mga08y16_3020_c1 nmdc:mga08y16_3020_c1_13243_14106 274
1438 3300050511 nmdc:mga08y16_33369_c1 nmdc:mga08y16_33369_c1_2986_3894 274
1439 3300050511 nmdc:mga08y16_3846_c1 nmdc:mga08y16_3846_c1_2789_3652 274
1440 3300050511 nmdc:mga08y16_5716_c1 nmdc:mga08y16_5716_c1_10121_10984 274
1441 3300050512 nmdc:mga0n895_118025_c1 nmdc:mga0n895_118025_c1_1091_1954 274
1442 3300050512 nmdc:mga0n895_184514_c1 nmdc:mga0n895_184514_c1_423_1286 274
1443 3300050512 nmdc:mga0n895_248280_c1 nmdc:mga0n895_248280_c1_91_1002 274
1444 3300050512 nmdc:mga0n895_291_c1 nmdc:mga0n895_291_c1_20893_21756 274
1445 3300050513 nmdc:mga0rr50_29605_c1 nmdc:mga0rr50_29605_c1_337_1200 274
1446 3300050513 nmdc:mga0rr50_344834_c1 nmdc:mga0rr50_344834_c1_197_1060 274
1447 3300050513 nmdc:mga0rr50_89309_c1 nmdc:mga0rr50_89309_c1_156_1019 274
1448 3300050515 nmdc:mga0a205_10048_c1 nmdc:mga0a205_10048_c1_6811_7674 274
1449 3300050515 nmdc:mga0a205_36116_c1 nmdc:mga0a205_36116_c1_2030_2893 274
1450 3300050515 nmdc:mga0a205_4627_c1 nmdc:mga0a205_4627_c1_2975_3838 274
1451 3300053077 Ga0495601_0000002 Ga0495601_0000002_373236_374108 274
1452 3300053077 Ga0495601_0000305 Ga0495601_0000305_17067_17930 274
1453 3300053077 Ga0495601_0001692 Ga0495601_0001692_8748_9611 274
1454 3300053077 Ga0495601_0006428 Ga0495601_0006428_3885_4796 274
1455 3300053077 Ga0495601_0086844 Ga0495601_0086844_720_1598 274
1456 3300053078 Ga0495612_0000012 Ga0495612_0000012_166433_167305 274
1457 3300053078 Ga0495612_0000569 Ga0495612_0000569_2152_3015 274
1458 3300053078 Ga0495612_0012688 Ga0495612_0012688_2035_2898 274
1459 3300053084 Ga0495595_0000012 Ga0495595_0000012_125020_125892 274
1460 3300053084 Ga0495595_0000258 Ga0495595_0000258_3394_4257 274
1461 3300053085 Ga0495619_0000003 Ga0495619_0000003_61752_62624 274
1462 3300053085 Ga0495619_0000159 Ga0495619_0000159_33057_33920 274
1463 3300053085 Ga0495619_0002083 Ga0495619_0002083_5888_6751 274
1464 3300053085 Ga0495619_0105693 Ga0495619_0105693_856_1734 274
1465 3300053085 Ga0495619_0162360 Ga0495619_0162360_174_1037 274
1466 3300053087 Ga0500643_003696 Ga0500643_003696_3145_4020 274
1467 3300053088 Ga0500644_0000375 Ga0500644_0000375_2109_2984 274
1468 3300053093 Ga0500651_0013892 Ga0500651_0013892_403_1278 274
1469 3300053119 Ga0500595_000002 Ga0500595_000002_849462_850337 274
1470 3300053153 Ga0500616_0000002 Ga0500616_0000002_954708_955583 274
1471 3300053730 Ga0500645_002132 Ga0500645_002132_4545_5420 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

54

241

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

60

265

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kvo-assembly3.cif.gz_B crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2) 0.9571 5 259
3kvo-assembly3.cif.gz_A crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2) 0.9492 3 258
3e03-assembly1.cif.gz_C-2 crystal structure of a putative dehydrogenase from xanthomonas campestris 0.938 1 259
3sc4-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase (a0qtm2 homolog) mycobacterium thermoresistibile 0.913 2 268
3e03-assembly3.cif.gz_A-4 crystal structure of a putative dehydrogenase from xanthomonas campestris 0.911 1 260
ID Description Score Start End Superfamily
af_Q6P5L8_1_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9569 3 258 3.40.50.720
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9049 47 179 3.40.50.720
af_Q6P5L8_1_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8914 3 258 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8783 42 182 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8696 85 179 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3S1RY73-F1-model_v4 SDR family oxidoreductase 0.9936 65 243
AF-A0A820P344-F1-model_v4 Short chain dehydrogenase 0.9928 56 181 GO:0005739
AF-A0A4Q5YVM8-F1-model_v4 SDR family oxidoreductase 0.9908 48 257 GO:0016491
AF-U6DM51-F1-model_v4 Hydroxysteroid dehydrogenase-like protein 2 0.9905 45 259 GO:0005739
GO:0005777
GO:0016491
AF-A0A4Q6F2S2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9903 52 168

Feature Viewer

pLDDT pTM Quality
91.54 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map