F494243
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1476 | 543 | 2952 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100016422|Ga0070694_1000164227 |
| Length | 266 |
| Sequence | MALNLIMLGPPGAGKGTQAERFARTRGIPRISTGDILRDAVHEGTEIGKRAKAIMDRGELVGDDVMIGIVQERLDRPDAAGGFVLEGFPRTVAQATALDRIMTGRDPLIVVDIAVPETELVRRLAWRLICEVCGANAAMEDLGDGAPGVDGADRVVLPGANANAPETIAAVRAIAEPHRCRRCGGRLVQRSDDNDAIVRERLKVYQRQSEPLVEFYRERPTFRSISGAQPPDRVAADLTAAVEAAVARPPVGTRVVPGKARSGAQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 110 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 148 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 149 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 150 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 225 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 226 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 227 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 230 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 234 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300029283 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 | Metatranscriptome | Rhizosphere |
| 238 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 239 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 240 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 241 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 244 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 245 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 247 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 248 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 253 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 254 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 255 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 257 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 258 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 259 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 260 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 262 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 263 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 264 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 265 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 267 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 269 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 270 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 274 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 279 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 282 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 284 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 285 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 286 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 287 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 289 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 290 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 291 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 292 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 294 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 297 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 298 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 299 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 300 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 301 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 302 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 303 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 304 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 305 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 306 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 307 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 308 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 309 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 310 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 311 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 312 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 313 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 314 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 315 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 316 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 317 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 318 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 319 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 320 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 390 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 391 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 392 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 393 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 394 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 395 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 398 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 399 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 400 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 401 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 402 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 403 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 404 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 405 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 406 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 407 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 408 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 409 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 410 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 411 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 412 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 413 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 414 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 460 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 464 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 467 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 469 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 470 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 483 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 487 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 488 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 489 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 490 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 491 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 492 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 493 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 494 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 496 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 497 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 498 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 499 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 500 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 501 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 502 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 503 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 504 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 505 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 506 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 507 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 508 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 510 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 511 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 512 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 513 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 514 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 517 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 518 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 519 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 520 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 521 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 522 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 523 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 524 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 525 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 526 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 527 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 528 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 529 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 530 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 531 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 532 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 533 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 534 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 535 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 536 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 537 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 538 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 539 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 540 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 541 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 542 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 543 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96 |
| Metatranscriptomes | 2.24 |
| Isolates | 1.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.35 |
| Nodule | 0.81 |
| Rhizoplane | 5.22 |
| Rhizosphere | 85.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070694_100016422 | 3300005444 | Bacteria | 4660 |
| 2 | JGI25162J39368_1009314 | 3300002737 | Bacteria | 1323 |
| 3 | JGI25151J46595_10028272 | 3300003187 | Bacteria | 2235 |
| 4 | JGI25407J50210_10043710 | 3300003373 | Bacteria | 1144 |
| 5 | Ga0055538_1000286 | 3300003751 | Bacteria | 25743 |
| 6 | Ga0055531_10022595 | 3300003794 | Bacteria | 2391 |
| 7 | Ga0065712_10010472 | 3300005290 | Bacteria | 2496 |
| 8 | Ga0065715_10004682 | 3300005293 | Bacteria | 3980 |
| 9 | Ga0065715_10138461 | 3300005293 | Bacteria | 1880 |
| 10 | Ga0065707_10004657 | 3300005295 | Bacteria | 4532 |
| 11 | Ga0065707_10305482 | 3300005295 | Bacteria | 983 |
| 12 | Ga0070658_10000172 | 3300005327 | Bacteria | 56478 |
| 13 | Ga0070658_10118295 | 3300005327 | Bacteria | 2200 |
| 14 | Ga0070676_10010331 | 3300005328 | Bacteria | 5064 |
| 15 | Ga0070676_10017267 | 3300005328 | Bacteria | 3994 |
| 16 | Ga0070676_10064218 | 3300005328 | Bacteria | 2188 |
| 17 | Ga0070676_10303732 | 3300005328 | Bacteria | 1083 |
| 18 | Ga0070683_100334615 | 3300005329 | Bacteria | 1442 |
| 19 | Ga0070683_100377411 | 3300005329 | Bacteria | 1351 |
| 20 | Ga0070683_100828082 | 3300005329 | Bacteria | 887 |
| 21 | Ga0070690_100006534 | 3300005330 | Bacteria | 6617 |
| 22 | Ga0070690_100196991 | 3300005330 | Bacteria | 1400 |
| 23 | Ga0070670_100082822 | 3300005331 | Bacteria | 2757 |
| 24 | Ga0070677_10098834 | 3300005333 | Bacteria | 1283 |
| 25 | Ga0070677_10151331 | 3300005333 | Bacteria | 1080 |
| 26 | Ga0068869_100162850 | 3300005334 | Bacteria | 1737 |
| 27 | Ga0068869_100163409 | 3300005334 | Bacteria | 1735 |
| 28 | Ga0068869_100169508 | 3300005334 | Bacteria | 1705 |
| 29 | Ga0068869_100188225 | 3300005334 | Bacteria | 1622 |
| 30 | Ga0068869_100310801 | 3300005334 | Bacteria | 1275 |
| 31 | Ga0068869_100414370 | 3300005334 | Bacteria | 1110 |
| 32 | Ga0070666_10007809 | 3300005335 | Bacteria | 6607 |
| 33 | Ga0070666_10356367 | 3300005335 | Bacteria | 1047 |
| 34 | Ga0070680_100073734 | 3300005336 | Bacteria | 2808 |
| 35 | Ga0070680_100136701 | 3300005336 | Bacteria | 2053 |
| 36 | Ga0070680_100154450 | 3300005336 | Bacteria | 1927 |
| 37 | Ga0070680_100233985 | 3300005336 | Bacteria | 1552 |
| 38 | Ga0068868_100081704 | 3300005338 | Bacteria | 2591 |
| 39 | Ga0068868_100221694 | 3300005338 | Bacteria | 1583 |
| 40 | Ga0068868_100599576 | 3300005338 | Bacteria | 976 |
| 41 | Ga0070660_100002987 | 3300005339 | Bacteria | 11642 |
| 42 | Ga0070660_100007791 | 3300005339 | Bacteria | 7468 |
| 43 | Ga0070660_100230165 | 3300005339 | Bacteria | 1508 |
| 44 | Ga0070660_100267782 | 3300005339 | Bacteria | 1396 |
| 45 | Ga0070660_100312906 | 3300005339 | Bacteria | 1289 |
| 46 | Ga0070689_100064561 | 3300005340 | Bacteria | 2850 |
| 47 | Ga0070689_100111866 | 3300005340 | Bacteria | 2173 |
| 48 | Ga0070689_100118410 | 3300005340 | Bacteria | 2113 |
| 49 | Ga0070691_10421015 | 3300005341 | Bacteria | 757 |
| 50 | Ga0070687_100012998 | 3300005343 | Bacteria | 3696 |
| 51 | Ga0070687_100030822 | 3300005343 | Bacteria | 2625 |
| 52 | Ga0070687_100076243 | 3300005343 | Bacteria | 1816 |
| 53 | Ga0070661_100195221 | 3300005344 | Bacteria | 1545 |
| 54 | Ga0070661_100343556 | 3300005344 | Bacteria | 1170 |
| 55 | Ga0070668_100000831 | 3300005347 | Bacteria | 21324 |
| 56 | Ga0070668_100098740 | 3300005347 | Bacteria | 2311 |
| 57 | Ga0070668_100108161 | 3300005347 | Bacteria | 2211 |
| 58 | Ga0070668_100161136 | 3300005347 | Bacteria | 1820 |
| 59 | Ga0070668_100206942 | 3300005347 | Bacteria | 1612 |
| 60 | Ga0070668_100603160 | 3300005347 | Bacteria | 961 |
| 61 | Ga0070669_100035389 | 3300005353 | Bacteria | 3617 |
| 62 | Ga0070675_100000056 | 3300005354 | Bacteria | 66985 |
| 63 | Ga0070675_100004703 | 3300005354 | Bacteria | 10420 |
| 64 | Ga0070675_100401556 | 3300005354 | Bacteria | 1223 |
| 65 | Ga0070675_100442461 | 3300005354 | Bacteria | 1165 |
| 66 | Ga0070671_100024169 | 3300005355 | Bacteria | 4973 |
| 67 | Ga0070671_100096780 | 3300005355 | Bacteria | 2475 |
| 68 | Ga0070671_100260964 | 3300005355 | Bacteria | 1472 |
| 69 | Ga0070671_100395569 | 3300005355 | Bacteria | 1182 |
| 70 | Ga0070671_100453285 | 3300005355 | Bacteria | 1101 |
| 71 | Ga0070671_100893792 | 3300005355 | Bacteria | 776 |
| 72 | Ga0070674_100050917 | 3300005356 | Bacteria | 2852 |
| 73 | Ga0070674_100118101 | 3300005356 | Bacteria | 1959 |
| 74 | Ga0070674_100192087 | 3300005356 | Bacteria | 1571 |
| 75 | Ga0070674_100208681 | 3300005356 | Bacteria | 1512 |
| 76 | Ga0070674_100371545 | 3300005356 | Bacteria | 1161 |
| 77 | Ga0070673_100003427 | 3300005364 | Bacteria | 9877 |
| 78 | Ga0070673_100173677 | 3300005364 | Bacteria | 1841 |
| 79 | Ga0070673_100324956 | 3300005364 | Bacteria | 1360 |
| 80 | Ga0070673_100387519 | 3300005364 | Bacteria | 1247 |
| 81 | Ga0070673_100966862 | 3300005364 | Unclassified | 792 |
| 82 | Ga0070688_100070904 | 3300005365 | Bacteria | 2229 |
| 83 | Ga0070688_100225636 | 3300005365 | Bacteria | 1323 |
| 84 | Ga0070688_100239703 | 3300005365 | Bacteria | 1286 |
| 85 | Ga0070659_100059884 | 3300005366 | Bacteria | 3007 |
| 86 | Ga0070659_100300889 | 3300005366 | Bacteria | 1338 |
| 87 | Ga0070667_100172226 | 3300005367 | Bacteria | 1911 |
| 88 | Ga0070703_10227179 | 3300005406 | Bacteria | 746 |
| 89 | Ga0070709_10004324 | 3300005434 | Bacteria | 7659 |
| 90 | Ga0070709_10143061 | 3300005434 | Bacteria | 1645 |
| 91 | Ga0070709_10694899 | 3300005434 | Bacteria | 791 |
| 92 | Ga0070714_100282011 | 3300005435 | Bacteria | 1544 |
| 93 | Ga0070714_100389823 | 3300005435 | Bacteria | 1315 |
| 94 | Ga0070714_100505011 | 3300005435 | Bacteria | 1153 |
| 95 | Ga0070714_100651634 | 3300005435 | Bacteria | 1014 |
| 96 | Ga0070713_100000161 | 3300005436 | Bacteria | 45444 |
| 97 | Ga0070713_100025501 | 3300005436 | Bacteria | 4622 |
| 98 | Ga0070713_100025646 | 3300005436 | Bacteria | 4613 |
| 99 | Ga0070713_100138736 | 3300005436 | Bacteria | 2151 |
| 100 | Ga0070713_100176408 | 3300005436 | Bacteria | 1918 |
| 101 | Ga0070710_10001033 | 3300005437 | Bacteria | 13226 |
| 102 | Ga0070710_10009605 | 3300005437 | Bacteria | 4737 |
| 103 | Ga0070701_10094219 | 3300005438 | Bacteria | 1647 |
| 104 | Ga0070711_100297575 | 3300005439 | Bacteria | 1282 |
| 105 | Ga0070711_100511941 | 3300005439 | Bacteria | 991 |
| 106 | Ga0070705_100008402 | 3300005440 | Bacteria | 5115 |
| 107 | Ga0070705_100492435 | 3300005440 | Bacteria | 929 |
| 108 | Ga0070705_100732606 | 3300005440 | Bacteria | 780 |
| 109 | Ga0070700_100040018 | 3300005441 | Bacteria | 2867 |
| 110 | Ga0070700_100041014 | 3300005441 | Bacteria | 2836 |
| 111 | Ga0070700_100223853 | 3300005441 | Bacteria | 1335 |
| 112 | Ga0070708_100010139 | 3300005445 | Bacteria | 7624 |
| 113 | Ga0070708_100028126 | 3300005445 | Bacteria | 4834 |
| 114 | Ga0070708_100259760 | 3300005445 | Bacteria | 1633 |
| 115 | Ga0070708_100725669 | 3300005445 | Bacteria | 935 |
| 116 | Ga0070663_100239507 | 3300005455 | Bacteria | 1431 |
| 117 | Ga0070678_100027149 | 3300005456 | Bacteria | 3883 |
| 118 | Ga0070678_100120735 | 3300005456 | Bacteria | 2066 |
| 119 | Ga0070678_100379642 | 3300005456 | Bacteria | 1222 |
| 120 | Ga0070678_100483707 | 3300005456 | Bacteria | 1090 |
| 121 | Ga0070662_100170816 | 3300005457 | Bacteria | 1707 |
| 122 | Ga0070662_100224409 | 3300005457 | Bacteria | 1500 |
| 123 | Ga0070662_100283201 | 3300005457 | Bacteria | 1342 |
| 124 | Ga0070662_100336558 | 3300005457 | Bacteria | 1234 |
| 125 | Ga0070662_100514343 | 3300005457 | Bacteria | 1000 |
| 126 | Ga0070681_10018722 | 3300005458 | Bacteria | 6929 |
| 127 | Ga0070681_10042357 | 3300005458 | Bacteria | 4563 |
| 128 | Ga0070681_10047185 | 3300005458 | Bacteria | 4306 |
| 129 | Ga0070681_10122730 | 3300005458 | Bacteria | 2531 |
| 130 | Ga0070681_10579647 | 3300005458 | Bacteria | 1036 |
| 131 | Ga0068867_100223195 | 3300005459 | Bacteria | 1519 |
| 132 | Ga0068867_100420557 | 3300005459 | Bacteria | 1132 |
| 133 | Ga0068867_100505350 | 3300005459 | Bacteria | 1040 |
| 134 | Ga0070685_10071840 | 3300005466 | Bacteria | 2052 |
| 135 | Ga0070706_100052012 | 3300005467 | Bacteria | 3782 |
| 136 | Ga0070706_100994669 | 3300005467 | Unclassified | 773 |
| 137 | Ga0070707_100119560 | 3300005468 | Bacteria | 2558 |
| 138 | Ga0070707_100174339 | 3300005468 | Bacteria | 2096 |
| 139 | Ga0070707_100463032 | 3300005468 | Bacteria | 1229 |
| 140 | Ga0070707_100579001 | 3300005468 | Bacteria | 1085 |
| 141 | Ga0070698_100042981 | 3300005471 | Bacteria | 4634 |
| 142 | Ga0070698_100063884 | 3300005471 | Bacteria | 3711 |
| 143 | Ga0070698_100114045 | 3300005471 | Bacteria | 2667 |
| 144 | Ga0070698_100247677 | 3300005471 | Bacteria | 1715 |
| 145 | Ga0070699_100006991 | 3300005518 | Bacteria | 9807 |
| 146 | Ga0070699_100042746 | 3300005518 | Bacteria | 3922 |
| 147 | Ga0070699_100182694 | 3300005518 | Bacteria | 1862 |
| 148 | Ga0070699_100198658 | 3300005518 | Bacteria | 1783 |
| 149 | Ga0070699_100522629 | 3300005518 | Bacteria | 1079 |
| 150 | Ga0070679_100044653 | 3300005530 | Bacteria | 4415 |
| 151 | Ga0070679_100087883 | 3300005530 | Bacteria | 3096 |
| 152 | Ga0070679_100124874 | 3300005530 | Bacteria | 2557 |
| 153 | Ga0070679_100325809 | 3300005530 | Bacteria | 1485 |
| 154 | Ga0070679_100443557 | 3300005530 | Bacteria | 1243 |
| 155 | Ga0070684_100100706 | 3300005535 | Bacteria | 2580 |
| 156 | Ga0070684_100148186 | 3300005535 | Bacteria | 2125 |
| 157 | Ga0070684_100716926 | 3300005535 | Bacteria | 933 |
| 158 | Ga0070697_100022127 | 3300005536 | Bacteria | 5044 |
| 159 | Ga0070697_100327097 | 3300005536 | Bacteria | 1321 |
| 160 | Ga0068853_100030559 | 3300005539 | Bacteria | 4551 |
| 161 | Ga0068853_100370174 | 3300005539 | Bacteria | 1336 |
| 162 | Ga0068853_100848526 | 3300005539 | Bacteria | 876 |
| 163 | Ga0068853_101093302 | 3300005539 | Bacteria | 769 |
| 164 | Ga0070672_100139503 | 3300005543 | Bacteria | 1998 |
| 165 | Ga0070672_100366412 | 3300005543 | Bacteria | 1230 |
| 166 | Ga0070686_100002243 | 3300005544 | Bacteria | 10661 |
| 167 | Ga0070686_100103111 | 3300005544 | Bacteria | 1930 |
| 168 | Ga0070686_100147971 | 3300005544 | Bacteria | 1642 |
| 169 | Ga0070686_100170290 | 3300005544 | Bacteria | 1540 |
| 170 | Ga0070686_100588637 | 3300005544 | Bacteria | 875 |
| 171 | Ga0070695_100003541 | 3300005545 | Bacteria | 9119 |
| 172 | Ga0070695_100062147 | 3300005545 | Bacteria | 2425 |
| 173 | Ga0070695_100114416 | 3300005545 | Bacteria | 1836 |
| 174 | Ga0070695_100173196 | 3300005545 | Bacteria | 1524 |
| 175 | Ga0070695_100395332 | 3300005545 | Bacteria | 1047 |
| 176 | Ga0070696_100004194 | 3300005546 | Bacteria | 9602 |
| 177 | Ga0070696_100182976 | 3300005546 | Bacteria | 1555 |
| 178 | Ga0070693_100155270 | 3300005547 | Bacteria | 1453 |
| 179 | Ga0070665_100000109 | 3300005548 | Bacteria | 155026 |
| 180 | Ga0070665_100010437 | 3300005548 | Bacteria | 9398 |
| 181 | Ga0070665_100188766 | 3300005548 | Bacteria | 2062 |
| 182 | Ga0070665_100769035 | 3300005548 | Bacteria | 976 |
| 183 | Ga0070704_100011568 | 3300005549 | Bacteria | 5415 |
| 184 | Ga0070704_100019087 | 3300005549 | Bacteria | 4400 |
| 185 | Ga0070704_100138326 | 3300005549 | Bacteria | 1898 |
| 186 | Ga0068855_100017220 | 3300005563 | Bacteria | 8696 |
| 187 | Ga0068855_100019504 | 3300005563 | Bacteria | 8149 |
| 188 | Ga0068855_100191323 | 3300005563 | Bacteria | 2308 |
| 189 | Ga0068855_100825222 | 3300005563 | Bacteria | 984 |
| 190 | Ga0070664_100169782 | 3300005564 | Bacteria | 1934 |
| 191 | Ga0070664_100390429 | 3300005564 | Bacteria | 1272 |
| 192 | Ga0070664_100543812 | 3300005564 | Bacteria | 1073 |
| 193 | Ga0068857_100063077 | 3300005577 | Bacteria | 3294 |
| 194 | Ga0068857_100894793 | 3300005577 | Bacteria | 851 |
| 195 | Ga0068854_100213124 | 3300005578 | Bacteria | 1524 |
| 196 | Ga0068854_100277683 | 3300005578 | Bacteria | 1347 |
| 197 | Ga0068854_100669936 | 3300005578 | Bacteria | 892 |
| 198 | Ga0068856_100018557 | 3300005614 | Bacteria | 6740 |
| 199 | Ga0068856_100254817 | 3300005614 | Unclassified | 1770 |
| 200 | Ga0068856_100937987 | 3300005614 | Bacteria | 884 |
| 201 | Ga0068852_100032860 | 3300005616 | Bacteria | 4301 |
| 202 | Ga0068852_100305253 | 3300005616 | Bacteria | 1542 |
| 203 | Ga0068852_100645832 | 3300005616 | Unclassified | 1065 |
| 204 | Ga0068859_100021003 | 3300005617 | Bacteria | 6554 |
| 205 | Ga0068859_100065113 | 3300005617 | Bacteria | 3679 |
| 206 | Ga0068859_100219454 | 3300005617 | Bacteria | 1989 |
| 207 | Ga0068859_100427652 | 3300005617 | Bacteria | 1421 |
| 208 | Ga0068859_100650905 | 3300005617 | Bacteria | 1146 |
| 209 | Ga0068859_100664279 | 3300005617 | Bacteria | 1134 |
| 210 | Ga0068859_100869196 | 3300005617 | Bacteria | 987 |
| 211 | Ga0068864_100023234 | 3300005618 | Bacteria | 5204 |
| 212 | Ga0068864_100063762 | 3300005618 | Bacteria | 3194 |
| 213 | Ga0068864_100830112 | 3300005618 | Bacteria | 910 |
| 214 | Ga0068866_10013064 | 3300005718 | Bacteria | 3632 |
| 215 | Ga0068866_10240660 | 3300005718 | Bacteria | 1102 |
| 216 | Ga0068861_100067590 | 3300005719 | Bacteria | 2759 |
| 217 | Ga0068861_100073792 | 3300005719 | Bacteria | 2651 |
| 218 | Ga0068861_100095518 | 3300005719 | Bacteria | 2354 |
| 219 | Ga0068861_100138254 | 3300005719 | Bacteria | 1985 |
| 220 | Ga0068861_100200552 | 3300005719 | Bacteria | 1674 |
| 221 | Ga0068861_100362892 | 3300005719 | Bacteria | 1274 |
| 222 | Ga0068861_100436014 | 3300005719 | Bacteria | 1171 |
| 223 | Ga0068861_100553653 | 3300005719 | Bacteria | 1048 |
| 224 | Ga0068851_10465475 | 3300005834 | Unclassified | 753 |
| 225 | Ga0068870_10017565 | 3300005840 | Bacteria | 3438 |
| 226 | Ga0068870_10104977 | 3300005840 | Bacteria | 1604 |
| 227 | Ga0068863_100000017 | 3300005841 | Bacteria | 207950 |
| 228 | Ga0068863_100017228 | 3300005841 | Bacteria | 6929 |
| 229 | Ga0068863_100091547 | 3300005841 | Bacteria | 2884 |
| 230 | Ga0068863_100098324 | 3300005841 | Bacteria | 2779 |
| 231 | Ga0068863_100177459 | 3300005841 | Bacteria | 2044 |
| 232 | Ga0068863_100221469 | 3300005841 | Bacteria | 1823 |
| 233 | Ga0068863_100269671 | 3300005841 | Bacteria | 1647 |
| 234 | Ga0068863_100395752 | 3300005841 | Bacteria | 1350 |
| 235 | Ga0068863_100682508 | 3300005841 | Unclassified | 1020 |
| 236 | Ga0068858_100001254 | 3300005842 | Bacteria | 26256 |
| 237 | Ga0068858_100036297 | 3300005842 | Bacteria | 4570 |
| 238 | Ga0068858_100213833 | 3300005842 | Bacteria | 1825 |
| 239 | Ga0068858_100304218 | 3300005842 | Bacteria | 1522 |
| 240 | Ga0068858_100325108 | 3300005842 | Bacteria | 1470 |
| 241 | Ga0068858_100341758 | 3300005842 | Bacteria | 1432 |
| 242 | Ga0068858_100443973 | 3300005842 | Bacteria | 1250 |
| 243 | Ga0068860_100196477 | 3300005843 | Bacteria | 1954 |
| 244 | Ga0068860_100204933 | 3300005843 | Bacteria | 1912 |
| 245 | Ga0068860_100222812 | 3300005843 | Bacteria | 1832 |
| 246 | Ga0068862_100021021 | 3300005844 | Bacteria | 5453 |
| 247 | Ga0068862_100243979 | 3300005844 | Bacteria | 1634 |
| 248 | Ga0068862_100256173 | 3300005844 | Bacteria | 1596 |
| 249 | Ga0068862_100388290 | 3300005844 | Bacteria | 1303 |
| 250 | Ga0068862_100477468 | 3300005844 | Bacteria | 1180 |
| 251 | Ga0068862_100654087 | 3300005844 | Bacteria | 1014 |
| 252 | Ga0081455_10020035 | 3300005937 | Bacteria | 6313 |
| 253 | Ga0081455_10062986 | 3300005937 | Bacteria | 3114 |
| 254 | Ga0081455_10094886 | 3300005937 | Bacteria | 2409 |
| 255 | Ga0081455_10196227 | 3300005937 | Bacteria | 1516 |
| 256 | Ga0081538_10028271 | 3300005981 | Bacteria | 3861 |
| 257 | Ga0081538_10159526 | 3300005981 | Bacteria | 1005 |
| 258 | Ga0081540_1029909 | 3300005983 | Bacteria | 3026 |
| 259 | Ga0081540_1060207 | 3300005983 | Bacteria | 1818 |
| 260 | Ga0081539_10028512 | 3300005985 | Bacteria | 3509 |
| 261 | Ga0070717_10058494 | 3300006028 | Bacteria | 3188 |
| 262 | Ga0070717_10078925 | 3300006028 | Bacteria | 2759 |
| 263 | Ga0070717_10083134 | 3300006028 | Bacteria | 2691 |
| 264 | Ga0070717_10210245 | 3300006028 | Bacteria | 1707 |
| 265 | Ga0070717_10242212 | 3300006028 | Bacteria | 1591 |
| 266 | Ga0075365_10064596 | 3300006038 | Bacteria | 2452 |
| 267 | Ga0075365_10150506 | 3300006038 | Bacteria | 1619 |
| 268 | Ga0075365_10183350 | 3300006038 | Bacteria | 1464 |
| 269 | Ga0075368_10029905 | 3300006042 | Bacteria | 2107 |
| 270 | Ga0075364_10034870 | 3300006051 | Bacteria | 3250 |
| 271 | Ga0070715_10001976 | 3300006163 | Bacteria | 6174 |
| 272 | Ga0070716_100009024 | 3300006173 | Bacteria | 4962 |
| 273 | Ga0070716_100087778 | 3300006173 | Bacteria | 1875 |
| 274 | Ga0070716_100149702 | 3300006173 | Bacteria | 1499 |
| 275 | Ga0070716_100545086 | 3300006173 | Bacteria | 864 |
| 276 | Ga0070712_100013564 | 3300006175 | Bacteria | 5211 |
| 277 | Ga0070712_100059771 | 3300006175 | Bacteria | 2685 |
| 278 | Ga0075362_10019673 | 3300006177 | Bacteria | 2811 |
| 279 | Ga0075362_10074422 | 3300006177 | Bacteria | 1556 |
| 280 | Ga0075367_10011148 | 3300006178 | Bacteria | 4743 |
| 281 | Ga0075367_10096682 | 3300006178 | Bacteria | 1801 |
| 282 | Ga0075367_10138559 | 3300006178 | Bacteria | 1506 |
| 283 | Ga0075369_10052067 | 3300006186 | Bacteria | 1774 |
| 284 | Ga0075369_10056907 | 3300006186 | Bacteria | 1700 |
| 285 | Ga0075369_10256154 | 3300006186 | Bacteria | 813 |
| 286 | Ga0075366_10003380 | 3300006195 | Bacteria | 8406 |
| 287 | Ga0075366_10077818 | 3300006195 | Bacteria | 1979 |
| 288 | Ga0075366_10301324 | 3300006195 | Bacteria | 980 |
| 289 | Ga0097621_100006061 | 3300006237 | Bacteria | 8549 |
| 290 | Ga0097621_100015176 | 3300006237 | Bacteria | 5787 |
| 291 | Ga0097621_100139647 | 3300006237 | Bacteria | 2070 |
| 292 | Ga0097621_100193670 | 3300006237 | Bacteria | 1761 |
| 293 | Ga0068871_100001728 | 3300006358 | Bacteria | 14706 |
| 294 | Ga0068871_100088164 | 3300006358 | Bacteria | 2581 |
| 295 | Ga0068871_100113852 | 3300006358 | Bacteria | 2278 |
| 296 | Ga0068871_100270635 | 3300006358 | Bacteria | 1484 |
| 297 | Ga0068871_100318050 | 3300006358 | Bacteria | 1370 |
| 298 | Ga0068871_100360462 | 3300006358 | Bacteria | 1288 |
| 299 | Ga0075428_100002425 | 3300006844 | Bacteria | 20258 |
| 300 | Ga0075428_100040963 | 3300006844 | Bacteria | 5093 |
| 301 | Ga0075428_100055934 | 3300006844 | Bacteria | 4322 |
| 302 | Ga0075428_100070820 | 3300006844 | Bacteria | 3811 |
| 303 | Ga0075428_100238517 | 3300006844 | Bacteria | 1962 |
| 304 | Ga0075428_100835067 | 3300006844 | Bacteria | 979 |
| 305 | Ga0075430_100063762 | 3300006846 | Bacteria | 3095 |
| 306 | Ga0075430_100237034 | 3300006846 | Bacteria | 1512 |
| 307 | Ga0075430_100409994 | 3300006846 | Bacteria | 1118 |
| 308 | Ga0075431_100003805 | 3300006847 | Bacteria | 14672 |
| 309 | Ga0075431_100006978 | 3300006847 | Bacteria | 11229 |
| 310 | Ga0075431_100052518 | 3300006847 | Bacteria | 4203 |
| 311 | Ga0075431_100342636 | 3300006847 | Bacteria | 1504 |
| 312 | Ga0075433_10095035 | 3300006852 | Bacteria | 2638 |
| 313 | Ga0075433_10096964 | 3300006852 | Bacteria | 2610 |
| 314 | Ga0075433_10114798 | 3300006852 | Bacteria | 2389 |
| 315 | Ga0075433_10142642 | 3300006852 | Bacteria | 2129 |
| 316 | Ga0075433_10206637 | 3300006852 | Bacteria | 1746 |
| 317 | Ga0075433_10373859 | 3300006852 | Unclassified | 1258 |
| 318 | Ga0075434_100123476 | 3300006871 | Bacteria | 2605 |
| 319 | Ga0075434_100146743 | 3300006871 | Bacteria | 2379 |
| 320 | Ga0075434_100208694 | 3300006871 | Bacteria | 1974 |
| 321 | Ga0075434_100224809 | 3300006871 | Bacteria | 1897 |
| 322 | Ga0075434_100240424 | 3300006871 | Bacteria | 1830 |
| 323 | Ga0075434_100543569 | 3300006871 | Bacteria | 1182 |
| 324 | Ga0075434_100777727 | 3300006871 | Bacteria | 974 |
| 325 | Ga0075429_100004225 | 3300006880 | Bacteria | 12307 |
| 326 | Ga0075429_100010320 | 3300006880 | Bacteria | 8081 |
| 327 | Ga0075429_100067833 | 3300006880 | Bacteria | 3105 |
| 328 | Ga0075429_100078704 | 3300006880 | Bacteria | 2873 |
| 329 | Ga0068865_100468691 | 3300006881 | Bacteria | 1044 |
| 330 | Ga0075436_100028497 | 3300006914 | Bacteria | 3842 |
| 331 | Ga0075436_100031296 | 3300006914 | Bacteria | 3663 |
| 332 | Ga0075436_100049304 | 3300006914 | Bacteria | 2905 |
| 333 | Ga0075436_100057089 | 3300006914 | Bacteria | 2696 |
| 334 | Ga0075436_100058745 | 3300006914 | Bacteria | 2656 |
| 335 | Ga0075436_100100249 | 3300006914 | Bacteria | 2017 |
| 336 | Ga0075436_100109094 | 3300006914 | Bacteria | 1931 |
| 337 | Ga0097620_100021003 | 3300006931 | Bacteria | 6554 |
| 338 | Ga0097620_100065113 | 3300006931 | Bacteria | 3679 |
| 339 | Ga0097620_100219454 | 3300006931 | Bacteria | 1989 |
| 340 | Ga0097620_100427650 | 3300006931 | Bacteria | 1421 |
| 341 | Ga0097620_100650838 | 3300006931 | Bacteria | 1146 |
| 342 | Ga0097620_100664276 | 3300006931 | Bacteria | 1134 |
| 343 | Ga0097620_100869340 | 3300006931 | Bacteria | 987 |
| 344 | Ga0079104_1024112 | 3300006946 | Bacteria | 1607 |
| 345 | Ga0075435_100001542 | 3300007076 | Bacteria | 14846 |
| 346 | Ga0075435_100001694 | 3300007076 | Bacteria | 14328 |
| 347 | Ga0075435_100039831 | 3300007076 | Bacteria | 3751 |
| 348 | Ga0075435_100070719 | 3300007076 | Bacteria | 2848 |
| 349 | Ga0075435_100083105 | 3300007076 | Bacteria | 2632 |
| 350 | Ga0075435_100283065 | 3300007076 | Bacteria | 1416 |
| 351 | Ga0075435_100343739 | 3300007076 | Bacteria | 1278 |
| 352 | Ga0099794_10012544 | 3300007265 | Bacteria | 3661 |
| 353 | Ga0099794_10028448 | 3300007265 | Bacteria | 2600 |
| 354 | Ga0099794_10064512 | 3300007265 | Bacteria | 1785 |
| 355 | Ga0099794_10077253 | 3300007265 | Bacteria | 1638 |
| 356 | Ga0099794_10119509 | 3300007265 | Bacteria | 1325 |
| 357 | Ga0099794_10152346 | 3300007265 | Bacteria | 1174 |
| 358 | Ga0099795_10044771 | 3300007788 | Bacteria | 1589 |
| 359 | Ga0105251_10038598 | 3300009011 | Bacteria | 2339 |
| 360 | Ga0105244_10017034 | 3300009036 | Bacteria | 4119 |
| 361 | Ga0105244_10032973 | 3300009036 | Bacteria | 2735 |
| 362 | Ga0105240_10045226 | 3300009093 | Bacteria | 5587 |
| 363 | Ga0105240_10077161 | 3300009093 | Bacteria | 4106 |
| 364 | Ga0105240_10287205 | 3300009093 | Bacteria | 1887 |
| 365 | Ga0105240_10363484 | 3300009093 | Bacteria | 1638 |
| 366 | Ga0111539_10000566 | 3300009094 | Bacteria | 47366 |
| 367 | Ga0111539_10007255 | 3300009094 | Bacteria | 14196 |
| 368 | Ga0111539_10170273 | 3300009094 | Bacteria | 2545 |
| 369 | Ga0111539_10286952 | 3300009094 | Bacteria | 1915 |
| 370 | Ga0111539_10514804 | 3300009094 | Bacteria | 1394 |
| 371 | Ga0111539_10520909 | 3300009094 | Bacteria | 1385 |
| 372 | Ga0111539_10903261 | 3300009094 | Bacteria | 1027 |
| 373 | Ga0111539_11122142 | 3300009094 | Bacteria | 914 |
| 374 | Ga0105245_10026276 | 3300009098 | Bacteria | 5123 |
| 375 | Ga0105245_10068939 | 3300009098 | Bacteria | 3206 |
| 376 | Ga0105245_10144359 | 3300009098 | Bacteria | 2245 |
| 377 | Ga0105245_10238041 | 3300009098 | Bacteria | 1763 |
| 378 | Ga0105245_10276752 | 3300009098 | Bacteria | 1639 |
| 379 | Ga0105245_10395640 | 3300009098 | Bacteria | 1379 |
| 380 | Ga0105245_10586056 | 3300009098 | Bacteria | 1140 |
| 381 | Ga0105245_11385278 | 3300009098 | Bacteria | 753 |
| 382 | Ga0105247_10000016 | 3300009101 | Bacteria | 263389 |
| 383 | Ga0105247_10004209 | 3300009101 | Bacteria | 9230 |
| 384 | Ga0105247_10009289 | 3300009101 | Bacteria | 5972 |
| 385 | Ga0105247_10024345 | 3300009101 | Bacteria | 3648 |
| 386 | Ga0105247_10056718 | 3300009101 | Bacteria | 2420 |
| 387 | Ga0105247_10127988 | 3300009101 | Bacteria | 1652 |
| 388 | Ga0105247_10391050 | 3300009101 | Bacteria | 988 |
| 389 | Ga0114129_10000431 | 3300009147 | Bacteria | 49869 |
| 390 | Ga0114129_10001150 | 3300009147 | Bacteria | 35034 |
| 391 | Ga0114129_10002840 | 3300009147 | Bacteria | 24196 |
| 392 | Ga0114129_10004861 | 3300009147 | Bacteria | 18961 |
| 393 | Ga0114129_10060820 | 3300009147 | Bacteria | 5280 |
| 394 | Ga0114129_10078194 | 3300009147 | Bacteria | 4602 |
| 395 | Ga0114129_10106586 | 3300009147 | Bacteria | 3871 |
| 396 | Ga0114129_10122991 | 3300009147 | Bacteria | 3570 |
| 397 | Ga0114129_10201915 | 3300009147 | Bacteria | 2692 |
| 398 | Ga0114129_10220032 | 3300009147 | Bacteria | 2562 |
| 399 | Ga0114129_10359401 | 3300009147 | Bacteria | 1927 |
| 400 | Ga0114129_10381813 | 3300009147 | Bacteria | 1860 |
| 401 | Ga0114129_10546194 | 3300009147 | Bacteria | 1507 |
| 402 | Ga0114129_10788848 | 3300009147 | Bacteria | 1213 |
| 403 | Ga0114129_11063128 | 3300009147 | Bacteria | 1015 |
| 404 | Ga0114129_11118264 | 3300009147 | Unclassified | 985 |
| 405 | Ga0114129_11245379 | 3300009147 | Bacteria | 925 |
| 406 | Ga0105243_10301519 | 3300009148 | Bacteria | 1452 |
| 407 | Ga0105243_10611995 | 3300009148 | Bacteria | 1050 |
| 408 | Ga0105241_10087967 | 3300009174 | Bacteria | 2446 |
| 409 | Ga0105242_10184408 | 3300009176 | Bacteria | 1843 |
| 410 | Ga0105242_10223480 | 3300009176 | Bacteria | 1684 |
| 411 | Ga0105242_10228102 | 3300009176 | Bacteria | 1668 |
| 412 | Ga0105242_10386775 | 3300009176 | Bacteria | 1302 |
| 413 | Ga0105242_10607423 | 3300009176 | Bacteria | 1057 |
| 414 | Ga0105248_10002899 | 3300009177 | Bacteria | 19028 |
| 415 | Ga0105248_10019507 | 3300009177 | Bacteria | 7503 |
| 416 | Ga0105248_10088320 | 3300009177 | Bacteria | 3489 |
| 417 | Ga0105248_10088554 | 3300009177 | Bacteria | 3484 |
| 418 | Ga0105248_10094826 | 3300009177 | Bacteria | 3360 |
| 419 | Ga0105248_10110426 | 3300009177 | Bacteria | 3100 |
| 420 | Ga0105248_10125984 | 3300009177 | Bacteria | 2889 |
| 421 | Ga0105248_10135047 | 3300009177 | Bacteria | 2783 |
| 422 | Ga0105248_10169500 | 3300009177 | Bacteria | 2461 |
| 423 | Ga0105248_10280794 | 3300009177 | Bacteria | 1875 |
| 424 | Ga0105248_10371694 | 3300009177 | Bacteria | 1609 |
| 425 | Ga0105248_10910328 | 3300009177 | Bacteria | 993 |
| 426 | Ga0105248_11118400 | 3300009177 | Bacteria | 890 |
| 427 | Ga0105248_11158940 | 3300009177 | Bacteria | 874 |
| 428 | Ga0105237_10210301 | 3300009545 | Bacteria | 1945 |
| 429 | Ga0105237_10354917 | 3300009545 | Bacteria | 1471 |
| 430 | Ga0105237_10408686 | 3300009545 | Bacteria | 1362 |
| 431 | Ga0105238_10658969 | 3300009551 | Bacteria | 1057 |
| 432 | Ga0105249_10020004 | 3300009553 | Bacteria | 5978 |
| 433 | Ga0105249_10048671 | 3300009553 | Bacteria | 3864 |
| 434 | Ga0105249_10184437 | 3300009553 | Bacteria | 2032 |
| 435 | Ga0105249_10508957 | 3300009553 | Bacteria | 1250 |
| 436 | Ga0105249_10546879 | 3300009553 | Bacteria | 1208 |
| 437 | Ga0099796_10011242 | 3300010159 | Bacteria | 2491 |
| 438 | Ga0099796_10040627 | 3300010159 | Bacteria | 1571 |
| 439 | Ga0105239_10386387 | 3300010375 | Bacteria | 1583 |
| 440 | Ga0105239_10561888 | 3300010375 | Bacteria | 1300 |
| 441 | Ga0105239_10950756 | 3300010375 | Bacteria | 987 |
| 442 | Ga0105246_10000488 | 3300011119 | Bacteria | 21462 |
| 443 | Ga0105246_10002877 | 3300011119 | Bacteria | 10417 |
| 444 | Ga0105246_10048926 | 3300011119 | Bacteria | 2892 |
| 445 | Ga0105246_10345968 | 3300011119 | Bacteria | 1217 |
| 446 | Ga0105246_10609482 | 3300011119 | Bacteria | 945 |
| 447 | Ga0157370_10256810 | 3300013104 | Bacteria | 1615 |
| 448 | Ga0157369_10316730 | 3300013105 | Bacteria | 1622 |
| 449 | Ga0157374_10216462 | 3300013296 | Bacteria | 1879 |
| 450 | Ga0157374_10224096 | 3300013296 | Bacteria | 1846 |
| 451 | Ga0157374_10338628 | 3300013296 | Bacteria | 1493 |
| 452 | Ga0157374_10353337 | 3300013296 | Bacteria | 1461 |
| 453 | Ga0157378_10052663 | 3300013297 | Bacteria | 3621 |
| 454 | Ga0157378_10145914 | 3300013297 | Bacteria | 2201 |
| 455 | Ga0157378_10391315 | 3300013297 | Bacteria | 1367 |
| 456 | Ga0163162_10115851 | 3300013306 | Bacteria | 2780 |
| 457 | Ga0163162_10229606 | 3300013306 | Bacteria | 1986 |
| 458 | Ga0163162_10330796 | 3300013306 | Bacteria | 1656 |
| 459 | Ga0163162_10392743 | 3300013306 | Bacteria | 1520 |
| 460 | Ga0163162_11158825 | 3300013306 | Bacteria | 877 |
| 461 | Ga0157372_10964963 | 3300013307 | Bacteria | 988 |
| 462 | Ga0157375_10139830 | 3300013308 | Bacteria | 2547 |
| 463 | Ga0157375_10173554 | 3300013308 | Bacteria | 2304 |
| 464 | Ga0157375_10435333 | 3300013308 | Bacteria | 1477 |
| 465 | Ga0157375_10519216 | 3300013308 | Unclassified | 1354 |
| 466 | Ga0157375_10662569 | 3300013308 | Bacteria | 1199 |
| 467 | Ga0157375_10871853 | 3300013308 | Bacteria | 1046 |
| 468 | Ga0157375_10926635 | 3300013308 | Bacteria | 1014 |
| 469 | Ga0163163_10024877 | 3300014325 | Bacteria | 5701 |
| 470 | Ga0163163_10064535 | 3300014325 | Bacteria | 3633 |
| 471 | Ga0163163_10257855 | 3300014325 | Bacteria | 1794 |
| 472 | Ga0163163_10559923 | 3300014325 | Bacteria | 1206 |
| 473 | Ga0163163_11345461 | 3300014325 | Bacteria | 776 |
| 474 | Ga0157380_10223651 | 3300014326 | Bacteria | 1686 |
| 475 | Ga0157380_10245428 | 3300014326 | Bacteria | 1617 |
| 476 | Ga0157380_10347519 | 3300014326 | Bacteria | 1386 |
| 477 | Ga0157380_10390373 | 3300014326 | Bacteria | 1317 |
| 478 | Ga0157380_10391620 | 3300014326 | Bacteria | 1315 |
| 479 | Ga0157380_11292685 | 3300014326 | Bacteria | 776 |
| 480 | Ga0182008_10004904 | 3300014497 | Bacteria | 7714 |
| 481 | Ga0157377_10001603 | 3300014745 | Bacteria | 9842 |
| 482 | Ga0157377_10078424 | 3300014745 | Bacteria | 1925 |
| 483 | Ga0157377_10158199 | 3300014745 | Bacteria | 1406 |
| 484 | Ga0157377_10270263 | 3300014745 | Bacteria | 1110 |
| 485 | Ga0157377_10377577 | 3300014745 | Bacteria | 959 |
| 486 | Ga0157377_10467160 | 3300014745 | Bacteria | 875 |
| 487 | Ga0157379_10011242 | 3300014968 | Bacteria | 7798 |
| 488 | Ga0157379_10079775 | 3300014968 | Bacteria | 2932 |
| 489 | Ga0157379_10082081 | 3300014968 | Bacteria | 2888 |
| 490 | Ga0157379_10144530 | 3300014968 | Bacteria | 2145 |
| 491 | Ga0157379_10886060 | 3300014968 | Bacteria | 846 |
| 492 | Ga0157376_10247505 | 3300014969 | Bacteria | 1663 |
| 493 | Ga0157376_10278620 | 3300014969 | Bacteria | 1574 |
| 494 | Ga0157376_10401297 | 3300014969 | Bacteria | 1326 |
| 495 | Ga0157376_10508397 | 3300014969 | Bacteria | 1185 |
| 496 | Ga0182007_10006522 | 3300015262 | Bacteria | 5005 |
| 497 | Ga0163161_10259062 | 3300017792 | Bacteria | 1358 |
| 498 | Ga0163161_10285545 | 3300017792 | Bacteria | 1296 |
| 499 | Ga0163161_10388868 | 3300017792 | Bacteria | 1116 |
| 500 | Ga0197907_10958534 | 3300020069 | Eukaryota | 813 |
| 501 | Ga0206352_10045669 | 3300020078 | Eukaryota | 843 |
| 502 | Ga0206350_10423989 | 3300020080 | Unclassified | 851 |
| 503 | Ga0206354_10580180 | 3300020081 | Eukaryota | 815 |
| 504 | Ga0213872_10091145 | 3300021361 | Bacteria | 1364 |
| 505 | Ga0213874_10076065 | 3300021377 | Bacteria | 1080 |
| 506 | Ga0213876_10003406 | 3300021384 | Bacteria | 9099 |
| 507 | Ga0213876_10023171 | 3300021384 | Bacteria | 3280 |
| 508 | Ga0213871_10052803 | 3300021441 | Bacteria | 1117 |
| 509 | Ga0224712_10220596 | 3300022467 | Eukaryota | 868 |
| 510 | Ga0209784_100141 | 3300025224 | Bacteria | 67045 |
| 511 | Ga0209437_100331 | 3300025233 | Bacteria | 58796 |
| 512 | Ga0209130_1043281 | 3300025284 | Bacteria | 857 |
| 513 | Ga0209675_1015955 | 3300025291 | Bacteria | 2207 |
| 514 | Ga0209025_1000976 | 3300025294 | Bacteria | 42839 |
| 515 | Ga0209758_1000216 | 3300025297 | Bacteria | 125352 |
| 516 | Ga0209758_1027215 | 3300025297 | Bacteria | 2449 |
| 517 | Ga0209256_1010676 | 3300025299 | Bacteria | 3804 |
| 518 | Ga0209257_1020704 | 3300025304 | Bacteria | 2417 |
| 519 | Ga0207697_10074714 | 3300025315 | Bacteria | 1424 |
| 520 | Ga0207655_1016982 | 3300025728 | Bacteria | 3949 |
| 521 | Ga0207655_1053672 | 3300025728 | Bacteria | 1609 |
| 522 | Ga0207713_1029603 | 3300025735 | Bacteria | 2450 |
| 523 | Ga0207653_10042327 | 3300025885 | Bacteria | 1498 |
| 524 | Ga0207653_10250200 | 3300025885 | Bacteria | 679 |
| 525 | Ga0207692_10011948 | 3300025898 | Bacteria | 3716 |
| 526 | Ga0207692_10034935 | 3300025898 | Bacteria | 2438 |
| 527 | Ga0207710_10000017 | 3300025900 | Bacteria | 370962 |
| 528 | Ga0207710_10015930 | 3300025900 | Bacteria | 3179 |
| 529 | Ga0207710_10028646 | 3300025900 | Bacteria | 2418 |
| 530 | Ga0207710_10040258 | 3300025900 | Bacteria | 2071 |
| 531 | Ga0207710_10091273 | 3300025900 | Bacteria | 1426 |
| 532 | Ga0207688_10010927 | 3300025901 | Bacteria | 4941 |
| 533 | Ga0207688_10065624 | 3300025901 | Bacteria | 2052 |
| 534 | Ga0207688_10156735 | 3300025901 | Bacteria | 1348 |
| 535 | Ga0207680_10006153 | 3300025903 | Bacteria | 5788 |
| 536 | Ga0207685_10050135 | 3300025905 | Bacteria | 1607 |
| 537 | Ga0207685_10057475 | 3300025905 | Bacteria | 1526 |
| 538 | Ga0207699_10028394 | 3300025906 | Bacteria | 3109 |
| 539 | Ga0207699_10141559 | 3300025906 | Bacteria | 1581 |
| 540 | Ga0207699_10364227 | 3300025906 | Bacteria | 1023 |
| 541 | Ga0207699_10469485 | 3300025906 | Bacteria | 905 |
| 542 | Ga0207699_10614083 | 3300025906 | Bacteria | 792 |
| 543 | Ga0207645_10120859 | 3300025907 | Bacteria | 1700 |
| 544 | Ga0207645_10220500 | 3300025907 | Bacteria | 1250 |
| 545 | Ga0207643_10002622 | 3300025908 | Bacteria | 9735 |
| 546 | Ga0207643_10058965 | 3300025908 | Bacteria | 2189 |
| 547 | Ga0207643_10139071 | 3300025908 | Bacteria | 1449 |
| 548 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 549 | Ga0207705_10246651 | 3300025909 | Bacteria | 1361 |
| 550 | Ga0207705_10574388 | 3300025909 | Bacteria | 876 |
| 551 | Ga0207684_10284308 | 3300025910 | Bacteria | 1426 |
| 552 | Ga0207654_10040688 | 3300025911 | Bacteria | 2620 |
| 553 | Ga0207707_10016379 | 3300025912 | Bacteria | 6465 |
| 554 | Ga0207707_10358042 | 3300025912 | Bacteria | 1257 |
| 555 | Ga0207695_10247709 | 3300025913 | Bacteria | 1682 |
| 556 | Ga0207671_10122202 | 3300025914 | Bacteria | 1991 |
| 557 | Ga0207693_10001926 | 3300025915 | Bacteria | 18180 |
| 558 | Ga0207693_10021188 | 3300025915 | Bacteria | 5167 |
| 559 | Ga0207693_10129942 | 3300025915 | Bacteria | 1980 |
| 560 | Ga0207693_10162845 | 3300025915 | Bacteria | 1755 |
| 561 | Ga0207663_10000218 | 3300025916 | Bacteria | 25518 |
| 562 | Ga0207663_10028223 | 3300025916 | Bacteria | 3282 |
| 563 | Ga0207663_10123632 | 3300025916 | Bacteria | 1776 |
| 564 | Ga0207663_10151603 | 3300025916 | Bacteria | 1627 |
| 565 | Ga0207660_10014904 | 3300025917 | Bacteria | 5124 |
| 566 | Ga0207660_10359614 | 3300025917 | Bacteria | 1168 |
| 567 | Ga0207662_10000683 | 3300025918 | Bacteria | 15427 |
| 568 | Ga0207662_10061436 | 3300025918 | Bacteria | 2256 |
| 569 | Ga0207662_10147552 | 3300025918 | Bacteria | 1494 |
| 570 | Ga0207657_10007500 | 3300025919 | Bacteria | 11182 |
| 571 | Ga0207657_10013143 | 3300025919 | Bacteria | 8130 |
| 572 | Ga0207657_10044526 | 3300025919 | Bacteria | 3901 |
| 573 | Ga0207657_10171327 | 3300025919 | Bacteria | 1758 |
| 574 | Ga0207657_10523273 | 3300025919 | Bacteria | 928 |
| 575 | Ga0207649_10036860 | 3300025920 | Bacteria | 2949 |
| 576 | Ga0207649_10276746 | 3300025920 | Bacteria | 1219 |
| 577 | Ga0207649_10280726 | 3300025920 | Bacteria | 1211 |
| 578 | Ga0207649_10497928 | 3300025920 | Bacteria | 926 |
| 579 | Ga0207652_10014975 | 3300025921 | Bacteria | 6291 |
| 580 | Ga0207652_10016976 | 3300025921 | Bacteria | 5954 |
| 581 | Ga0207652_10077073 | 3300025921 | Bacteria | 2908 |
| 582 | Ga0207652_10243407 | 3300025921 | Bacteria | 1622 |
| 583 | Ga0207652_10259532 | 3300025921 | Bacteria | 1567 |
| 584 | Ga0207652_10281349 | 3300025921 | Bacteria | 1501 |
| 585 | Ga0207646_10221868 | 3300025922 | Bacteria | 1708 |
| 586 | Ga0207681_10031902 | 3300025923 | Bacteria | 3444 |
| 587 | Ga0207681_10260818 | 3300025923 | Bacteria | 1357 |
| 588 | Ga0207650_10138625 | 3300025925 | Bacteria | 1910 |
| 589 | Ga0207650_10438518 | 3300025925 | Bacteria | 1086 |
| 590 | Ga0207659_10001213 | 3300025926 | Bacteria | 15413 |
| 591 | Ga0207659_10028998 | 3300025926 | Bacteria | 3766 |
| 592 | Ga0207659_10113563 | 3300025926 | Bacteria | 2063 |
| 593 | Ga0207687_10015651 | 3300025927 | Bacteria | 4977 |
| 594 | Ga0207687_10108277 | 3300025927 | Bacteria | 2058 |
| 595 | Ga0207687_10191387 | 3300025927 | Bacteria | 1593 |
| 596 | Ga0207687_10384467 | 3300025927 | Bacteria | 1151 |
| 597 | Ga0207687_10906365 | 3300025927 | Bacteria | 754 |
| 598 | Ga0207700_10021547 | 3300025928 | Bacteria | 4403 |
| 599 | Ga0207700_10130792 | 3300025928 | Bacteria | 2049 |
| 600 | Ga0207700_10450251 | 3300025928 | Bacteria | 1135 |
| 601 | Ga0207664_10008551 | 3300025929 | Bacteria | 7147 |
| 602 | Ga0207664_10045656 | 3300025929 | Bacteria | 3436 |
| 603 | Ga0207664_10079107 | 3300025929 | Bacteria | 2668 |
| 604 | Ga0207664_10527278 | 3300025929 | Bacteria | 1059 |
| 605 | Ga0207664_10693924 | 3300025929 | Bacteria | 915 |
| 606 | Ga0207644_10000145 | 3300025931 | Bacteria | 50586 |
| 607 | Ga0207644_10138035 | 3300025931 | Bacteria | 1874 |
| 608 | Ga0207644_10203491 | 3300025931 | Bacteria | 1562 |
| 609 | Ga0207644_10205130 | 3300025931 | Bacteria | 1556 |
| 610 | Ga0207690_10126838 | 3300025932 | Bacteria | 1862 |
| 611 | Ga0207690_10574478 | 3300025932 | Bacteria | 918 |
| 612 | Ga0207706_10002966 | 3300025933 | Bacteria | 16372 |
| 613 | Ga0207706_10120457 | 3300025933 | Bacteria | 2307 |
| 614 | Ga0207706_10207924 | 3300025933 | Bacteria | 1716 |
| 615 | Ga0207706_10329771 | 3300025933 | Bacteria | 1328 |
| 616 | Ga0207706_10345338 | 3300025933 | Bacteria | 1294 |
| 617 | Ga0207706_10418351 | 3300025933 | Bacteria | 1161 |
| 618 | Ga0207706_10424115 | 3300025933 | Bacteria | 1152 |
| 619 | Ga0207686_10072906 | 3300025934 | Bacteria | 2214 |
| 620 | Ga0207709_10056127 | 3300025935 | Bacteria | 2436 |
| 621 | Ga0207709_10102289 | 3300025935 | Bacteria | 1897 |
| 622 | Ga0207709_10255332 | 3300025935 | Bacteria | 1282 |
| 623 | Ga0207670_10023176 | 3300025936 | Bacteria | 3860 |
| 624 | Ga0207670_10046448 | 3300025936 | Bacteria | 2885 |
| 625 | Ga0207670_10109566 | 3300025936 | Bacteria | 1987 |
| 626 | Ga0207670_10168401 | 3300025936 | Bacteria | 1641 |
| 627 | Ga0207669_10040380 | 3300025937 | Bacteria | 2706 |
| 628 | Ga0207669_10387170 | 3300025937 | Bacteria | 1091 |
| 629 | Ga0207704_10108603 | 3300025938 | Bacteria | 1869 |
| 630 | Ga0207704_10214793 | 3300025938 | Bacteria | 1418 |
| 631 | Ga0207704_10240334 | 3300025938 | Bacteria | 1353 |
| 632 | Ga0207665_10005572 | 3300025939 | Bacteria | 8396 |
| 633 | Ga0207665_10006881 | 3300025939 | Bacteria | 7529 |
| 634 | Ga0207665_10046790 | 3300025939 | Bacteria | 2899 |
| 635 | Ga0207665_10058141 | 3300025939 | Bacteria | 2613 |
| 636 | Ga0207665_10095992 | 3300025939 | Bacteria | 2061 |
| 637 | Ga0207665_10627843 | 3300025939 | Bacteria | 841 |
| 638 | Ga0207691_10033820 | 3300025940 | Bacteria | 4759 |
| 639 | Ga0207691_10142665 | 3300025940 | Bacteria | 2110 |
| 640 | Ga0207691_10328703 | 3300025940 | Bacteria | 1310 |
| 641 | Ga0207691_10365725 | 3300025940 | Bacteria | 1233 |
| 642 | Ga0207691_10407998 | 3300025940 | Bacteria | 1158 |
| 643 | Ga0207691_10463962 | 3300025940 | Bacteria | 1077 |
| 644 | Ga0207711_10002995 | 3300025941 | Bacteria | 14760 |
| 645 | Ga0207711_10007764 | 3300025941 | Bacteria | 8964 |
| 646 | Ga0207711_10053527 | 3300025941 | Bacteria | 3461 |
| 647 | Ga0207711_10077530 | 3300025941 | Bacteria | 2897 |
| 648 | Ga0207711_10087655 | 3300025941 | Bacteria | 2731 |
| 649 | Ga0207711_10980799 | 3300025941 | Bacteria | 784 |
| 650 | Ga0207711_11016856 | 3300025941 | Bacteria | 769 |
| 651 | Ga0207689_10008393 | 3300025942 | Bacteria | 8995 |
| 652 | Ga0207689_10198876 | 3300025942 | Bacteria | 1654 |
| 653 | Ga0207689_10262806 | 3300025942 | Bacteria | 1428 |
| 654 | Ga0207689_10288884 | 3300025942 | Bacteria | 1358 |
| 655 | Ga0207689_10306829 | 3300025942 | Bacteria | 1316 |
| 656 | Ga0207689_10383677 | 3300025942 | Bacteria | 1170 |
| 657 | Ga0207661_10423854 | 3300025944 | Bacteria | 1209 |
| 658 | Ga0207661_10700780 | 3300025944 | Bacteria | 931 |
| 659 | Ga0207661_10894155 | 3300025944 | Bacteria | 818 |
| 660 | Ga0207679_10130543 | 3300025945 | Bacteria | 2015 |
| 661 | Ga0207679_10231023 | 3300025945 | Bacteria | 1562 |
| 662 | Ga0207667_10012912 | 3300025949 | Bacteria | 9594 |
| 663 | Ga0207667_10023790 | 3300025949 | Bacteria | 6741 |
| 664 | Ga0207667_10227475 | 3300025949 | Bacteria | 1910 |
| 665 | Ga0207667_10876575 | 3300025949 | Bacteria | 891 |
| 666 | Ga0207651_10109469 | 3300025960 | Bacteria | 2070 |
| 667 | Ga0207651_10336789 | 3300025960 | Bacteria | 1266 |
| 668 | Ga0207712_10024731 | 3300025961 | Bacteria | 3982 |
| 669 | Ga0207712_10379238 | 3300025961 | Bacteria | 1183 |
| 670 | Ga0207668_10008013 | 3300025972 | Bacteria | 6287 |
| 671 | Ga0207668_10036515 | 3300025972 | Bacteria | 3279 |
| 672 | Ga0207668_10094916 | 3300025972 | Bacteria | 2200 |
| 673 | Ga0207668_10111996 | 3300025972 | Bacteria | 2049 |
| 674 | Ga0207640_10022062 | 3300025981 | Bacteria | 3805 |
| 675 | Ga0207640_10327560 | 3300025981 | Bacteria | 1222 |
| 676 | Ga0207677_10076376 | 3300026023 | Bacteria | 2385 |
| 677 | Ga0207677_10217805 | 3300026023 | Bacteria | 1529 |
| 678 | Ga0207677_10347872 | 3300026023 | Bacteria | 1241 |
| 679 | Ga0207703_10012018 | 3300026035 | Bacteria | 6743 |
| 680 | Ga0207703_10048528 | 3300026035 | Bacteria | 3428 |
| 681 | Ga0207703_10094107 | 3300026035 | Bacteria | 2525 |
| 682 | Ga0207703_10184440 | 3300026035 | Bacteria | 1843 |
| 683 | Ga0207703_10213190 | 3300026035 | Bacteria | 1723 |
| 684 | Ga0207703_10269770 | 3300026035 | Bacteria | 1541 |
| 685 | Ga0207703_10318319 | 3300026035 | Bacteria | 1424 |
| 686 | Ga0207703_10322304 | 3300026035 | Bacteria | 1415 |
| 687 | Ga0207639_10113371 | 3300026041 | Bacteria | 2214 |
| 688 | Ga0207639_10140499 | 3300026041 | Bacteria | 2011 |
| 689 | Ga0207639_10251013 | 3300026041 | Bacteria | 1543 |
| 690 | Ga0207639_10338062 | 3300026041 | Bacteria | 1342 |
| 691 | Ga0207678_10045312 | 3300026067 | Bacteria | 3804 |
| 692 | Ga0207678_10095940 | 3300026067 | Bacteria | 2534 |
| 693 | Ga0207678_10139610 | 3300026067 | Bacteria | 2068 |
| 694 | Ga0207708_10022090 | 3300026075 | Bacteria | 4805 |
| 695 | Ga0207708_10165085 | 3300026075 | Bacteria | 1750 |
| 696 | Ga0207708_10461978 | 3300026075 | Bacteria | 1059 |
| 697 | Ga0207708_10511065 | 3300026075 | Bacteria | 1008 |
| 698 | Ga0207702_10248289 | 3300026078 | Bacteria | 1670 |
| 699 | Ga0207702_10290442 | 3300026078 | Bacteria | 1549 |
| 700 | Ga0207641_10000036 | 3300026088 | Bacteria | 213165 |
| 701 | Ga0207641_10001674 | 3300026088 | Bacteria | 21561 |
| 702 | Ga0207641_10006011 | 3300026088 | Bacteria | 10288 |
| 703 | Ga0207641_10125366 | 3300026088 | Bacteria | 2298 |
| 704 | Ga0207641_10424049 | 3300026088 | Bacteria | 1281 |
| 705 | Ga0207641_10445859 | 3300026088 | Bacteria | 1250 |
| 706 | Ga0207641_10986217 | 3300026088 | Bacteria | 839 |
| 707 | Ga0207648_10005612 | 3300026089 | Bacteria | 12612 |
| 708 | Ga0207648_10038262 | 3300026089 | Bacteria | 4222 |
| 709 | Ga0207648_10143468 | 3300026089 | Bacteria | 2106 |
| 710 | Ga0207648_10708539 | 3300026089 | Bacteria | 933 |
| 711 | Ga0207676_10118955 | 3300026095 | Bacteria | 2224 |
| 712 | Ga0207676_10342233 | 3300026095 | Bacteria | 1380 |
| 713 | Ga0207676_10716459 | 3300026095 | Bacteria | 971 |
| 714 | Ga0207674_10084505 | 3300026116 | Bacteria | 3172 |
| 715 | Ga0207674_10089883 | 3300026116 | Bacteria | 3063 |
| 716 | Ga0207674_10190001 | 3300026116 | Bacteria | 2003 |
| 717 | Ga0207674_10396355 | 3300026116 | Bacteria | 1334 |
| 718 | Ga0207675_100003007 | 3300026118 | Bacteria | 16534 |
| 719 | Ga0207675_100036086 | 3300026118 | Bacteria | 4611 |
| 720 | Ga0207675_100082556 | 3300026118 | Bacteria | 3014 |
| 721 | Ga0207675_100182641 | 3300026118 | Bacteria | 2009 |
| 722 | Ga0207675_100405621 | 3300026118 | Bacteria | 1344 |
| 723 | Ga0207675_100627022 | 3300026118 | Bacteria | 1080 |
| 724 | Ga0207675_100951657 | 3300026118 | Bacteria | 876 |
| 725 | Ga0207675_101416959 | 3300026118 | Bacteria | 716 |
| 726 | Ga0207683_10015654 | 3300026121 | Bacteria | 6455 |
| 727 | Ga0207683_10032201 | 3300026121 | Bacteria | 4554 |
| 728 | Ga0207683_10207216 | 3300026121 | Bacteria | 1784 |
| 729 | Ga0207683_10254803 | 3300026121 | Bacteria | 1602 |
| 730 | Ga0207683_10282128 | 3300026121 | Bacteria | 1518 |
| 731 | Ga0207683_10454525 | 3300026121 | Bacteria | 1181 |
| 732 | Ga0207698_10092615 | 3300026142 | Bacteria | 2478 |
| 733 | Ga0207698_10173647 | 3300026142 | Bacteria | 1901 |
| 734 | Ga0207698_10335106 | 3300026142 | Bacteria | 1423 |
| 735 | Ga0207698_10375678 | 3300026142 | Bacteria | 1351 |
| 736 | Ga0207698_10388390 | 3300026142 | Bacteria | 1330 |
| 737 | Ga0207698_10529446 | 3300026142 | Bacteria | 1151 |
| 738 | Ga0207698_11032515 | 3300026142 | Bacteria | 833 |
| 739 | Ga0209281_1029026 | 3300027111 | Bacteria | 1001 |
| 740 | Ga0209489_109706 | 3300027361 | Bacteria | 11675 |
| 741 | Ga0209700_100031 | 3300027363 | Bacteria | 207349 |
| 742 | Ga0209588_1015432 | 3300027671 | Bacteria | 2349 |
| 743 | Ga0209588_1043115 | 3300027671 | Bacteria | 1457 |
| 744 | Ga0209588_1063219 | 3300027671 | Bacteria | 1196 |
| 745 | Ga0209813_10028535 | 3300027866 | Bacteria | 1628 |
| 746 | Ga0207428_10000032 | 3300027907 | Bacteria | 232162 |
| 747 | Ga0207428_10070330 | 3300027907 | Bacteria | 2751 |
| 748 | Ga0207428_10111063 | 3300027907 | Bacteria | 2110 |
| 749 | Ga0207428_10230665 | 3300027907 | Bacteria | 1386 |
| 750 | Ga0207428_10250355 | 3300027907 | Bacteria | 1321 |
| 751 | Ga0268266_10000560 | 3300028379 | Bacteria | 51866 |
| 752 | Ga0268266_10029767 | 3300028379 | Bacteria | 4639 |
| 753 | Ga0268266_10240360 | 3300028379 | Bacteria | 1671 |
| 754 | Ga0268266_10624126 | 3300028379 | Bacteria | 1036 |
| 755 | Ga0268266_11305718 | 3300028379 | Bacteria | 701 |
| 756 | Ga0268265_10043571 | 3300028380 | Bacteria | 3337 |
| 757 | Ga0268265_10201099 | 3300028380 | Bacteria | 1728 |
| 758 | Ga0268265_10203711 | 3300028380 | Bacteria | 1718 |
| 759 | Ga0268265_10223592 | 3300028380 | Bacteria | 1649 |
| 760 | Ga0268265_10232679 | 3300028380 | Bacteria | 1620 |
| 761 | Ga0268265_10255954 | 3300028380 | Bacteria | 1553 |
| 762 | Ga0268265_10392731 | 3300028380 | Bacteria | 1280 |
| 763 | Ga0268265_10642495 | 3300028380 | Bacteria | 1019 |
| 764 | Ga0268264_10014193 | 3300028381 | Bacteria | 6550 |
| 765 | Ga0268264_10111054 | 3300028381 | Bacteria | 2401 |
| 766 | Ga0268264_10155027 | 3300028381 | Bacteria | 2058 |
| 767 | Ga0268264_10177234 | 3300028381 | Bacteria | 1933 |
| 768 | Ga0268264_10255397 | 3300028381 | Bacteria | 1630 |
| 769 | Ga0265334_10083058 | 3300028573 | Unclassified | 1178 |
| 770 | Ga0307517_10000125 | 3300028786 | Bacteria | 115466 |
| 771 | Ga0307515_10158343 | 3300028794 | Bacteria | 2324 |
| 772 | Ga0265338_10008624 | 3300028800 | Bacteria | 12331 |
| 773 | Ga0265338_10090007 | 3300028800 | Bacteria | 2541 |
| 774 | Ga0310982_100320 | 3300029283 | Bacteria | 1188 |
| 775 | Ga0310981_1038706 | 3300029285 | Bacteria | 878 |
| 776 | Ga0307512_10142319 | 3300030522 | Bacteria | 1464 |
| 777 | Ga0316182_1082465 | 3300030745 | Bacteria | 1272 |
| 778 | Ga0265762_1001772 | 3300030760 | Bacteria | 3918 |
| 779 | Ga0265777_103137 | 3300030877 | Bacteria | 1001 |
| 780 | Ga0265328_10000041 | 3300031239 | Bacteria | 89398 |
| 781 | Ga0265340_10107718 | 3300031247 | Bacteria | 1291 |
| 782 | Ga0265316_10004234 | 3300031344 | Bacteria | 14337 |
| 783 | Ga0307408_100158543 | 3300031548 | Bacteria | 1795 |
| 784 | Ga0307408_100320780 | 3300031548 | Bacteria | 1305 |
| 785 | Ga0307508_10165302 | 3300031616 | Bacteria | 1816 |
| 786 | Ga0307508_10233855 | 3300031616 | Bacteria | 1436 |
| 787 | Ga0265314_10110622 | 3300031711 | Bacteria | 1746 |
| 788 | Ga0307516_10167169 | 3300031730 | Bacteria | 1943 |
| 789 | Ga0307405_10187330 | 3300031731 | Bacteria | 1491 |
| 790 | Ga0307405_10386933 | 3300031731 | Bacteria | 1091 |
| 791 | Ga0307413_10070007 | 3300031824 | Bacteria | 2204 |
| 792 | Ga0307413_10139134 | 3300031824 | Bacteria | 1675 |
| 793 | Ga0307413_10314277 | 3300031824 | Bacteria | 1194 |
| 794 | Ga0307410_10017505 | 3300031852 | Bacteria | 4306 |
| 795 | Ga0307410_10063305 | 3300031852 | Bacteria | 2537 |
| 796 | Ga0307410_10077593 | 3300031852 | Bacteria | 2323 |
| 797 | Ga0307406_10029602 | 3300031901 | Bacteria | 3317 |
| 798 | Ga0307406_10302389 | 3300031901 | Bacteria | 1230 |
| 799 | Ga0307406_10470332 | 3300031901 | Bacteria | 1013 |
| 800 | Ga0307407_10175875 | 3300031903 | Bacteria | 1414 |
| 801 | Ga0307407_10195688 | 3300031903 | Bacteria | 1351 |
| 802 | Ga0307412_10804726 | 3300031911 | Bacteria | 816 |
| 803 | Ga0307409_100008475 | 3300031995 | Bacteria | 6244 |
| 804 | Ga0307409_100071714 | 3300031995 | Bacteria | 2755 |
| 805 | Ga0307409_100743896 | 3300031995 | Bacteria | 984 |
| 806 | Ga0307409_100850841 | 3300031995 | Bacteria | 923 |
| 807 | Ga0307416_100015910 | 3300032002 | Bacteria | 5211 |
| 808 | Ga0307416_100092003 | 3300032002 | Bacteria | 2607 |
| 809 | Ga0307416_100651752 | 3300032002 | Bacteria | 1138 |
| 810 | Ga0307416_101106873 | 3300032002 | Bacteria | 897 |
| 811 | Ga0307414_10628150 | 3300032004 | Bacteria | 966 |
| 812 | Ga0307415_100025248 | 3300032126 | Bacteria | 3725 |
| 813 | Ga0307415_100206957 | 3300032126 | Bacteria | 1562 |
| 814 | Ga0307415_100270244 | 3300032126 | Bacteria | 1392 |
| 815 | Ga0307415_100427721 | 3300032126 | Bacteria | 1138 |
| 816 | Ga0316596_1048376 | 3300033541 | Bacteria | 1123 |
| 817 | Ga0373930_0019395 | 3300034816 | Bacteria | 1316 |
| 818 | Ga0373950_0037319 | 3300034818 | Bacteria | 919 |
| 819 | Ga0373958_0011453 | 3300034819 | Bacteria | 1499 |
| 820 | Ga0373959_0000924 | 3300034820 | Bacteria | 4951 |
| 821 | Ga0373928_0003435 | 3300035084 | Bacteria | 3015 |
| 822 | Ga0373929_0000116 | 3300035085 | Bacteria | 13311 |
| 823 | Ga0373934_0002966 | 3300035086 | Bacteria | 6200 |
| 824 | Ga0373934_0051027 | 3300035086 | Bacteria | 1640 |
| 825 | Ga0373934_0113515 | 3300035086 | Bacteria | 1100 |
| 826 | Ga0373940_0000084 | 3300035088 | Bacteria | 11367 |
| 827 | Ga0373940_0064960 | 3300035088 | Bacteria | 1051 |
| 828 | Ga0373949_0048079 | 3300035090 | Bacteria | 1068 |
| 829 | Ga0373923_0000429 | 3300035111 | Bacteria | 9865 |
| 830 | Ga0373923_0036628 | 3300035111 | Bacteria | 2004 |
| 831 | Ga0373932_0000807 | 3300035112 | Bacteria | 9293 |
| 832 | Ga0373932_0009460 | 3300035112 | Bacteria | 2344 |
| 833 | Ga0373936_0010448 | 3300035113 | Bacteria | 3502 |
| 834 | Ga0373939_0035172 | 3300035114 | Bacteria | 1474 |
| 835 | Ga0373939_0048662 | 3300035114 | Bacteria | 1307 |
| 836 | Ga0373941_0000161 | 3300035115 | Bacteria | 12224 |
| 837 | Ga0373941_0015637 | 3300035115 | Bacteria | 2051 |
| 838 | Ga0373941_0026257 | 3300035115 | Bacteria | 1690 |
| 839 | Ga0373953_0000451 | 3300035117 | Bacteria | 11279 |
| 840 | Ga0373953_0007154 | 3300035117 | Bacteria | 3723 |
| 841 | Ga0373953_0071837 | 3300035117 | Bacteria | 1428 |
| 842 | Ga0373954_0000482 | 3300035118 | Bacteria | 14947 |
| 843 | Ga0373954_0003811 | 3300035118 | Bacteria | 6442 |
| 844 | Ga0373954_0010828 | 3300035118 | Bacteria | 4031 |
| 845 | Ga0373954_0090393 | 3300035118 | Bacteria | 1470 |
| 846 | Ga0373956_0111852 | 3300035119 | Bacteria | 1271 |
| 847 | Ga0373956_0186202 | 3300035119 | Bacteria | 982 |
| 848 | Ga0373957_0000922 | 3300035120 | Bacteria | 7704 |
| 849 | Ga0373957_0101640 | 3300035120 | Bacteria | 1152 |
| 850 | Ga0373960_0000753 | 3300035121 | Bacteria | 6755 |
| 851 | Ga0373960_0040375 | 3300035121 | Bacteria | 1347 |
| 852 | Ga0373946_0007337 | 3300035171 | Bacteria | 4026 |
| 853 | Ga0373946_0014782 | 3300035171 | Bacteria | 2949 |
| 854 | Ga0373955_0036421 | 3300035172 | Bacteria | 2610 |
| 855 | Ga0373955_0145249 | 3300035172 | Bacteria | 1393 |
| 856 | Ga0373955_0175916 | 3300035172 | Bacteria | 1268 |
| 857 | Ga0373942_0001757 | 3300035207 | Bacteria | 5486 |
| 858 | Ga0373961_0001371 | 3300035241 | Bacteria | 7313 |
| 859 | Ga0373962_0000245 | 3300035242 | Bacteria | 11519 |
| 860 | Ga0373962_0030916 | 3300035242 | Bacteria | 1467 |
| 861 | Ga0373962_0105373 | 3300035242 | Bacteria | 884 |
| 862 | Ga0373924_0002270 | 3300035410 | Bacteria | 6451 |
| 863 | Ga0373931_0009494 | 3300035691 | Bacteria | 4653 |
| 864 | Ga0373931_0021342 | 3300035691 | Bacteria | 3248 |
| 865 | Ga0373931_0180614 | 3300035691 | Bacteria | 1249 |
| 866 | Ga0373935_0008830 | 3300035692 | Bacteria | 6033 |
| 867 | Ga0373935_0053767 | 3300035692 | Bacteria | 2562 |
| 868 | Ga0373935_0198302 | 3300035692 | Bacteria | 1386 |
| 869 | Ga0373935_0777880 | 3300035692 | Bacteria | 706 |
| 870 | Ga0373927_0028727 | 3300035695 | Bacteria | 3628 |
| 871 | Ga0373927_0059060 | 3300035695 | Bacteria | 2481 |
| 872 | Ga0373927_0096376 | 3300035695 | Bacteria | 1923 |
| 873 | Ga0373927_0132003 | 3300035695 | Bacteria | 1632 |
| 874 | Ga0373927_0383836 | 3300035695 | Bacteria | 926 |
| 875 | Ga0373933_0003737 | 3300035724 | Bacteria | 8413 |
| 876 | Ga0373947_0040913 | 3300035725 | Bacteria | 2762 |
| 877 | Ga0373947_0043635 | 3300035725 | Bacteria | 2679 |
| 878 | Ga0373937_0172438 | 3300036401 | Bacteria | 2030 |
| 879 | Ga0373937_0210181 | 3300036401 | Bacteria | 1831 |
| 880 | Ga0373937_0304832 | 3300036401 | Bacteria | 1506 |
| 881 | Ga0373937_0373074 | 3300036401 | Bacteria | 1353 |
| 882 | Ga0373937_0451068 | 3300036401 | Bacteria | 1221 |
| 883 | Ga0373925_0005941 | 3300037068 | Bacteria | 9044 |
| 884 | Ga0373925_0013826 | 3300037068 | Bacteria | 5843 |
| 885 | Ga0373925_0174928 | 3300037068 | Bacteria | 1696 |
| 886 | Ga0395900_0087991 | 3300037418 | Bacteria | 3193 |
| 887 | Ga0395900_0141424 | 3300037418 | Bacteria | 2464 |
| 888 | Ga0395900_0609373 | 3300037418 | Unclassified | 1032 |
| 889 | Ga0395898_0156518 | 3300037466 | Bacteria | 2180 |
| 890 | Ga0395898_0372873 | 3300037466 | Bacteria | 1361 |
| 891 | Ga0395898_0620454 | 3300037466 | Bacteria | 1024 |
| 892 | Ga0395905_0007428 | 3300037471 | Bacteria | 10895 |
| 893 | Ga0395905_0012237 | 3300037471 | Bacteria | 8263 |
| 894 | Ga0395905_0089423 | 3300037471 | Bacteria | 2886 |
| 895 | Ga0395901_0032493 | 3300038443 | Bacteria | 5384 |
| 896 | Ga0395901_0082956 | 3300038443 | Bacteria | 3350 |
| 897 | Ga0395901_0877081 | 3300038443 | Bacteria | 881 |
| 898 | Ga0436365_0450041 | 3300039437 | Bacteria | 910 |
| 899 | Ga0436365_0697746 | 3300039437 | Bacteria | 24050 |
| 900 | Ga0436365_1470057 | 3300039437 | Bacteria | 969 |
| 901 | Ga0436365_1620453 | 3300039437 | Bacteria | 934 |
| 902 | Ga0436365_1701482 | 3300039437 | Bacteria | 3380 |
| 903 | Ga0436365_1935460 | 3300039437 | Bacteria | 13309 |
| 904 | Ga0436360_0298195 | 3300039438 | Bacteria | 2647 |
| 905 | Ga0436361_0730859 | 3300039447 | Bacteria | 1628 |
| 906 | Ga0436363_0579133 | 3300039450 | Bacteria | 3940 |
| 907 | Ga0436362_0946909 | 3300039453 | Bacteria | 1298 |
| 908 | Ga0436362_1110265 | 3300039453 | Bacteria | 2448 |
| 909 | Ga0439465_0050727 | 3300041413 | Bacteria | 1358 |
| 910 | Ga0451841_0950211 | 3300041498 | Bacteria | 1723 |
| 911 | Ga0451853_0777966 | 3300041512 | Bacteria | 1286 |
| 912 | Ga0439455_0019852 | 3300042012 | Bacteria | 1588 |
| 913 | Ga0450914_003561 | 3300042118 | Bacteria | 1207 |
| 914 | Ga0450890_009528 | 3300042127 | Bacteria | 1245 |
| 915 | Ga0439434_0167228 | 3300042435 | Bacteria | 733 |
| 916 | Ga0451577_0043475 | 3300042876 | Bacteria | 4024 |
| 917 | Ga0466966_0014585 | 3300044684 | Bacteria | 5202 |
| 918 | Ga0466966_0014913 | 3300044684 | Bacteria | 5143 |
| 919 | Ga0466966_0093533 | 3300044684 | Bacteria | 1864 |
| 920 | Ga0466961_0043541 | 3300044693 | Bacteria | 2875 |
| 921 | Ga0466961_0115997 | 3300044693 | Bacteria | 1683 |
| 922 | Ga0466961_0126535 | 3300044693 | Bacteria | 1603 |
| 923 | Ga0466961_0311672 | 3300044693 | Bacteria | 960 |
| 924 | Ga0466963_0075586 | 3300044694 | Bacteria | 2274 |
| 925 | Ga0466963_0437133 | 3300044694 | Bacteria | 923 |
| 926 | Ga0466963_0467393 | 3300044694 | Bacteria | 890 |
| 927 | Ga0466971_0119745 | 3300044719 | Bacteria | 1218 |
| 928 | Ga0466957_0028757 | 3300044842 | Bacteria | 3311 |
| 929 | Ga0466957_0227246 | 3300044842 | Bacteria | 1234 |
| 930 | Ga0466960_0023207 | 3300044901 | Bacteria | 2783 |
| 931 | Ga0466960_0035450 | 3300044901 | Bacteria | 2332 |
| 932 | Ga0466959_0004261 | 3300045049 | Bacteria | 9543 |
| 933 | Ga0466959_0151285 | 3300045049 | Bacteria | 1636 |
| 934 | Ga0466959_0154099 | 3300045049 | Bacteria | 1618 |
| 935 | Ga0451576_0055322 | 3300045051 | Bacteria | 4152 |
| 936 | Ga0451576_0607998 | 3300045051 | Bacteria | 1149 |
| 937 | Ga0466958_0002151 | 3300045836 | Bacteria | 9809 |
| 938 | Ga0466958_0106918 | 3300045836 | Bacteria | 1745 |
| 939 | Ga0466958_0121180 | 3300045836 | Bacteria | 1638 |
| 940 | Ga0466958_0286919 | 3300045836 | Bacteria | 1055 |
| 941 | Ga0466967_0068175 | 3300045976 | Bacteria | 3176 |
| 942 | Ga0466967_0173578 | 3300045976 | Bacteria | 2030 |
| 943 | Ga0466967_0226821 | 3300045976 | Bacteria | 1777 |
| 944 | Ga0495592_0005638 | 3300046454 | Bacteria | 9255 |
| 945 | Ga0495592_0028405 | 3300046454 | Bacteria | 4237 |
| 946 | Ga0495592_0057907 | 3300046454 | Bacteria | 2859 |
| 947 | Ga0495603_0039205 | 3300046455 | Bacteria | 2839 |
| 948 | Ga0495629_0056581 | 3300046459 | Bacteria | 2742 |
| 949 | Ga0495629_0159455 | 3300046459 | Bacteria | 1567 |
| 950 | Ga0495638_0007730 | 3300046460 | Bacteria | 7682 |
| 951 | Ga0495638_0133888 | 3300046460 | Bacteria | 1453 |
| 952 | Ga0495641_0011057 | 3300046461 | Bacteria | 5170 |
| 953 | Ga0495651_0004143 | 3300046462 | Bacteria | 11106 |
| 954 | Ga0495651_0275165 | 3300046462 | Bacteria | 1140 |
| 955 | Ga0495651_0442956 | 3300046462 | Bacteria | 841 |
| 956 | Ga0495653_0022129 | 3300046463 | Bacteria | 5144 |
| 957 | Ga0495653_0294093 | 3300046463 | Bacteria | 1061 |
| 958 | Ga0495580_0056214 | 3300046472 | Bacteria | 2772 |
| 959 | Ga0495580_0133111 | 3300046472 | Bacteria | 1724 |
| 960 | Ga0495580_0144381 | 3300046472 | Bacteria | 1649 |
| 961 | Ga0495580_0198094 | 3300046472 | Bacteria | 1384 |
| 962 | Ga0495582_0012275 | 3300046473 | Bacteria | 4720 |
| 963 | Ga0495639_0001960 | 3300046475 | Bacteria | 9132 |
| 964 | Ga0495639_0064911 | 3300046475 | Bacteria | 1679 |
| 965 | Ga0495639_0093691 | 3300046475 | Bacteria | 1412 |
| 966 | Ga0495662_0005450 | 3300046476 | Bacteria | 6370 |
| 967 | Ga0495664_0003933 | 3300046477 | Bacteria | 8107 |
| 968 | Ga0495584_0006905 | 3300046491 | Bacteria | 5932 |
| 969 | Ga0495584_0099387 | 3300046491 | Bacteria | 1470 |
| 970 | Ga0495584_0117331 | 3300046491 | Bacteria | 1347 |
| 971 | Ga0495584_0153742 | 3300046491 | Bacteria | 1169 |
| 972 | Ga0495596_0066806 | 3300046500 | Bacteria | 1398 |
| 973 | Ga0495606_0199980 | 3300046507 | Bacteria | 1139 |
| 974 | Ga0495608_0004188 | 3300046511 | Bacteria | 10337 |
| 975 | Ga0495608_0007931 | 3300046511 | Bacteria | 7461 |
| 976 | Ga0495608_0165211 | 3300046511 | Bacteria | 1406 |
| 977 | Ga0495608_0193755 | 3300046511 | Bacteria | 1282 |
| 978 | Ga0495610_0002336 | 3300046512 | Bacteria | 16035 |
| 979 | Ga0495610_0106718 | 3300046512 | Bacteria | 1246 |
| 980 | Ga0495616_0152174 | 3300046513 | Bacteria | 1046 |
| 981 | Ga0495616_0154130 | 3300046513 | Bacteria | 1037 |
| 982 | Ga0495618_0129668 | 3300046514 | Bacteria | 1613 |
| 983 | Ga0495618_0145861 | 3300046514 | Bacteria | 1513 |
| 984 | Ga0495620_0112262 | 3300046515 | Bacteria | 1079 |
| 985 | Ga0495628_0036325 | 3300046516 | Bacteria | 3955 |
| 986 | Ga0495628_0055686 | 3300046516 | Bacteria | 3114 |
| 987 | Ga0495628_0203839 | 3300046516 | Bacteria | 1489 |
| 988 | Ga0495630_0010900 | 3300046517 | Bacteria | 6565 |
| 989 | Ga0495630_0057928 | 3300046517 | Bacteria | 2904 |
| 990 | Ga0495631_0025969 | 3300046518 | Bacteria | 2693 |
| 991 | Ga0495637_0075167 | 3300046520 | Bacteria | 1356 |
| 992 | Ga0495644_0034036 | 3300046523 | Bacteria | 1923 |
| 993 | Ga0495663_0006675 | 3300046525 | Bacteria | 3184 |
| 994 | Ga0495642_0003089 | 3300046528 | Bacteria | 6619 |
| 995 | Ga0495642_0146980 | 3300046528 | Bacteria | 1019 |
| 996 | Ga0495652_0005494 | 3300046529 | Bacteria | 11936 |
| 997 | Ga0495652_0050149 | 3300046529 | Bacteria | 3570 |
| 998 | Ga0495652_0069819 | 3300046529 | Bacteria | 2939 |
| 999 | Ga0495652_0081707 | 3300046529 | Bacteria | 2665 |
| 1000 | Ga0495665_0016354 | 3300046531 | Bacteria | 3998 |
| 1001 | Ga0495665_0103663 | 3300046531 | Bacteria | 1492 |
| 1002 | Ga0495640_0001806 | 3300046533 | Bacteria | 16965 |
| 1003 | Ga0495640_0014075 | 3300046533 | Bacteria | 6066 |
| 1004 | Ga0495640_0381402 | 3300046533 | Bacteria | 867 |
| 1005 | Ga0495586_0003635 | 3300046535 | Bacteria | 8263 |
| 1006 | Ga0495586_0526242 | 3300046535 | Bacteria | 682 |
| 1007 | Ga0495587_0002077 | 3300046536 | Bacteria | 13382 |
| 1008 | Ga0495587_0080839 | 3300046536 | Bacteria | 1883 |
| 1009 | Ga0495587_0091248 | 3300046536 | Bacteria | 1760 |
| 1010 | Ga0495587_0143446 | 3300046536 | Bacteria | 1362 |
| 1011 | Ga0495598_0063529 | 3300046537 | Bacteria | 1145 |
| 1012 | Ga0495621_0088457 | 3300046539 | Bacteria | 1165 |
| 1013 | Ga0495597_0135444 | 3300046542 | Bacteria | 1019 |
| 1014 | Ga0495645_0009908 | 3300046543 | Bacteria | 6669 |
| 1015 | Ga0495645_0027506 | 3300046543 | Bacteria | 4132 |
| 1016 | Ga0495645_0161506 | 3300046543 | Bacteria | 1549 |
| 1017 | Ga0495633_0073145 | 3300046558 | Bacteria | 1598 |
| 1018 | Ga0495667_0008752 | 3300046559 | Bacteria | 6878 |
| 1019 | Ga0495667_0023465 | 3300046559 | Bacteria | 4157 |
| 1020 | Ga0495667_0086457 | 3300046559 | Bacteria | 2033 |
| 1021 | Ga0495656_0030020 | 3300046615 | Bacteria | 2194 |
| 1022 | Ga0495656_0054523 | 3300046615 | Bacteria | 1720 |
| 1023 | Ga0495656_0355547 | 3300046615 | Unclassified | 760 |
| 1024 | Ga0495668_0158961 | 3300046616 | Bacteria | 1238 |
| 1025 | Ga0495668_0217988 | 3300046616 | Bacteria | 1045 |
| 1026 | Ga0495668_0226306 | 3300046616 | Bacteria | 1024 |
| 1027 | Ga0495634_0227969 | 3300046642 | Bacteria | 1147 |
| 1028 | Ga0495611_0122721 | 3300046648 | Bacteria | 1211 |
| 1029 | Ga0495611_0159904 | 3300046648 | Bacteria | 1052 |
| 1030 | Ga0495588_0012687 | 3300046674 | Bacteria | 3991 |
| 1031 | Ga0495588_0233903 | 3300046674 | Bacteria | 969 |
| 1032 | Ga0495657_0012725 | 3300046675 | Bacteria | 6240 |
| 1033 | Ga0495657_0103606 | 3300046675 | Bacteria | 1810 |
| 1034 | Ga0495599_0005317 | 3300046678 | Bacteria | 7682 |
| 1035 | Ga0495599_0032803 | 3300046678 | Bacteria | 3260 |
| 1036 | Ga0495599_0076546 | 3300046678 | Bacteria | 2089 |
| 1037 | Ga0495599_0087336 | 3300046678 | Bacteria | 1947 |
| 1038 | Ga0495599_0327801 | 3300046678 | Bacteria | 921 |
| 1039 | Ga0495623_0175936 | 3300046679 | Bacteria | 1247 |
| 1040 | Ga0495623_0197658 | 3300046679 | Bacteria | 1158 |
| 1041 | Ga0495647_0058460 | 3300046681 | Bacteria | 1515 |
| 1042 | Ga0495647_0069026 | 3300046681 | Bacteria | 1411 |
| 1043 | Ga0495647_0095748 | 3300046681 | Bacteria | 1223 |
| 1044 | Ga0495647_0098992 | 3300046681 | Bacteria | 1205 |
| 1045 | Ga0495658_0124747 | 3300046683 | Bacteria | 1561 |
| 1046 | Ga0495658_0185194 | 3300046683 | Bacteria | 1293 |
| 1047 | Ga0495669_0000560 | 3300046684 | Bacteria | 16456 |
| 1048 | Ga0495669_0061694 | 3300046684 | Bacteria | 1697 |
| 1049 | Ga0495669_0073388 | 3300046684 | Bacteria | 1562 |
| 1050 | Ga0495669_0112861 | 3300046684 | Bacteria | 1270 |
| 1051 | Ga0495669_0122884 | 3300046684 | Bacteria | 1218 |
| 1052 | Ga0495669_0191115 | 3300046684 | Bacteria | 977 |
| 1053 | Ga0495613_0013985 | 3300046689 | Bacteria | 5957 |
| 1054 | Ga0495613_0100399 | 3300046689 | Bacteria | 2090 |
| 1055 | Ga0495613_0150801 | 3300046689 | Bacteria | 1658 |
| 1056 | Ga0495613_0249178 | 3300046689 | Bacteria | 1240 |
| 1057 | Ga0495670_0164303 | 3300046691 | Bacteria | 1167 |
| 1058 | Ga0495649_0073198 | 3300046694 | Bacteria | 1836 |
| 1059 | Ga0495600_0002947 | 3300046809 | Bacteria | 9920 |
| 1060 | Ga0495581_0091051 | 3300047315 | Bacteria | 1769 |
| 1061 | Ga0495604_0006828 | 3300047317 | Bacteria | 9045 |
| 1062 | Ga0495604_0133762 | 3300047317 | Bacteria | 1779 |
| 1063 | Ga0495636_0001627 | 3300047318 | Bacteria | 8550 |
| 1064 | Ga0495636_0108087 | 3300047318 | Bacteria | 1222 |
| 1065 | Ga0495674_0005220 | 3300047319 | Bacteria | 12468 |
| 1066 | Ga0495674_0044746 | 3300047319 | Bacteria | 3934 |
| 1067 | Ga0495674_0099319 | 3300047319 | Bacteria | 2478 |
| 1068 | Ga0495672_0012941 | 3300047320 | Bacteria | 5784 |
| 1069 | Ga0495672_0068280 | 3300047320 | Bacteria | 2021 |
| 1070 | Ga0495676_0075687 | 3300047321 | Bacteria | 2573 |
| 1071 | Ga0495676_0198730 | 3300047321 | Bacteria | 1394 |
| 1072 | Ga0495680_0011364 | 3300047322 | Bacteria | 7884 |
| 1073 | Ga0495680_0084304 | 3300047322 | Bacteria | 2395 |
| 1074 | Ga0495680_0218492 | 3300047322 | Bacteria | 1362 |
| 1075 | Ga0495683_0128288 | 3300047323 | Bacteria | 1198 |
| 1076 | Ga0495675_0018560 | 3300047444 | Bacteria | 4416 |
| 1077 | Ga0495685_039324 | 3300047447 | Bacteria | 1619 |
| 1078 | Ga0495673_0072452 | 3300047469 | Bacteria | 1446 |
| 1079 | Ga0495673_0163128 | 3300047469 | Bacteria | 854 |
| 1080 | Ga0495684_0009393 | 3300047471 | Bacteria | 7549 |
| 1081 | Ga0495684_0012445 | 3300047471 | Bacteria | 6558 |
| 1082 | Ga0495686_0091685 | 3300047472 | Bacteria | 1844 |
| 1083 | Ga0495602_0215107 | 3300048088 | Bacteria | 1455 |
| 1084 | Ga0495602_0295325 | 3300048088 | Bacteria | 1188 |
| 1085 | Ga0496100_0004796 | 3300048903 | Bacteria | 7222 |
| 1086 | Ga0496100_0006135 | 3300048903 | Bacteria | 6537 |
| 1087 | Ga0496100_0057191 | 3300048903 | Bacteria | 2554 |
| 1088 | Ga0496100_0291498 | 3300048903 | Bacteria | 1219 |
| 1089 | Ga0496101_0000396 | 3300048904 | Bacteria | 28444 |
| 1090 | Ga0496101_0091436 | 3300048904 | Bacteria | 2265 |
| 1091 | Ga0496101_0145159 | 3300048904 | Bacteria | 1811 |
| 1092 | Ga0496101_0257300 | 3300048904 | Bacteria | 1361 |
| 1093 | Ga0496101_0306051 | 3300048904 | Bacteria | 1245 |
| 1094 | Ga0496101_0327649 | 3300048904 | Bacteria | 1202 |
| 1095 | Ga0496101_0611376 | 3300048904 | Bacteria | 862 |
| 1096 | Ga0496102_0008904 | 3300048905 | Bacteria | 8613 |
| 1097 | Ga0496102_0023775 | 3300048905 | Bacteria | 5445 |
| 1098 | Ga0496102_0186737 | 3300048905 | Bacteria | 1953 |
| 1099 | Ga0496102_0421928 | 3300048905 | Bacteria | 1253 |
| 1100 | Ga0496102_0749962 | 3300048905 | Bacteria | 899 |
| 1101 | Ga0496103_0047199 | 3300048906 | Bacteria | 2660 |
| 1102 | Ga0496103_0078931 | 3300048906 | Bacteria | 2068 |
| 1103 | Ga0496103_0103504 | 3300048906 | Bacteria | 1804 |
| 1104 | Ga0496103_0164392 | 3300048906 | Bacteria | 1424 |
| 1105 | Ga0496103_0324263 | 3300048906 | Bacteria | 991 |
| 1106 | Ga0496104_0017385 | 3300048907 | Bacteria | 6549 |
| 1107 | Ga0496104_0022306 | 3300048907 | Bacteria | 5815 |
| 1108 | Ga0496104_0051414 | 3300048907 | Bacteria | 3890 |
| 1109 | Ga0496104_0076019 | 3300048907 | Bacteria | 3198 |
| 1110 | Ga0496104_0096967 | 3300048907 | Bacteria | 2821 |
| 1111 | Ga0496104_0351678 | 3300048907 | Bacteria | 1386 |
| 1112 | Ga0496104_0691205 | 3300048907 | Bacteria | 928 |
| 1113 | Ga0496105_0005725 | 3300048908 | Bacteria | 9460 |
| 1114 | Ga0496105_0114894 | 3300048908 | Bacteria | 2220 |
| 1115 | Ga0496105_0117251 | 3300048908 | Bacteria | 2196 |
| 1116 | Ga0496105_0268131 | 3300048908 | Bacteria | 1379 |
| 1117 | Ga0496105_0410374 | 3300048908 | Bacteria | 1074 |
| 1118 | Ga0496105_0437957 | 3300048908 | Bacteria | 1033 |
| 1119 | Ga0496106_0050105 | 3300048909 | Bacteria | 3146 |
| 1120 | Ga0496106_0318361 | 3300048909 | Bacteria | 1248 |
| 1121 | Ga0496106_0363627 | 3300048909 | Bacteria | 1162 |
| 1122 | Ga0496106_0483966 | 3300048909 | Bacteria | 994 |
| 1123 | Ga0496107_0010686 | 3300048910 | Bacteria | 6384 |
| 1124 | Ga0496107_0028952 | 3300048910 | Bacteria | 3939 |
| 1125 | Ga0496107_0113730 | 3300048910 | Bacteria | 1991 |
| 1126 | Ga0496107_0650031 | 3300048910 | Bacteria | 777 |
| 1127 | Ga0496108_0036186 | 3300048911 | Bacteria | 4106 |
| 1128 | Ga0496108_0401150 | 3300048911 | Bacteria | 1198 |
| 1129 | Ga0496109_0024415 | 3300048912 | Bacteria | 5374 |
| 1130 | Ga0496109_0171156 | 3300048912 | Bacteria | 2038 |
| 1131 | Ga0496109_0561392 | 3300048912 | Bacteria | 1077 |
| 1132 | Ga0496109_0708872 | 3300048912 | Bacteria | 944 |
| 1133 | Ga0496110_0082246 | 3300048913 | Bacteria | 2872 |
| 1134 | Ga0496110_0088473 | 3300048913 | Bacteria | 2766 |
| 1135 | Ga0496110_0168247 | 3300048913 | Bacteria | 1988 |
| 1136 | Ga0496111_0024319 | 3300048914 | Bacteria | 4263 |
| 1137 | Ga0496111_0055372 | 3300048914 | Bacteria | 2868 |
| 1138 | Ga0496111_0123300 | 3300048914 | Bacteria | 1915 |
| 1139 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 1140 | Ga0496112_0016237 | 3300048915 | Bacteria | 6967 |
| 1141 | Ga0496112_0029065 | 3300048915 | Bacteria | 5344 |
| 1142 | Ga0496112_0162779 | 3300048915 | Bacteria | 2197 |
| 1143 | Ga0496112_0255816 | 3300048915 | Bacteria | 1701 |
| 1144 | Ga0496112_0295914 | 3300048915 | Bacteria | 1564 |
| 1145 | Ga0496112_0388942 | 3300048915 | Bacteria | 1335 |
| 1146 | Ga0496112_0417381 | 3300048915 | Bacteria | 1281 |
| 1147 | Ga0496113_0032056 | 3300048916 | Bacteria | 3817 |
| 1148 | Ga0496113_0231267 | 3300048916 | Bacteria | 1474 |
| 1149 | Ga0496114_0000246 | 3300048917 | Bacteria | 39480 |
| 1150 | Ga0496114_0059095 | 3300048917 | Bacteria | 3202 |
| 1151 | Ga0496114_0111094 | 3300048917 | Bacteria | 2348 |
| 1152 | Ga0496114_0148509 | 3300048917 | Bacteria | 2033 |
| 1153 | Ga0496114_0168207 | 3300048917 | Bacteria | 1909 |
| 1154 | Ga0496114_0288243 | 3300048917 | Bacteria | 1448 |
| 1155 | Ga0496114_0623350 | 3300048917 | Bacteria | 950 |
| 1156 | Ga0496114_0837761 | 3300048917 | Bacteria | 799 |
| 1157 | Ga0496115_0025980 | 3300048918 | Bacteria | 4565 |
| 1158 | Ga0496115_0038310 | 3300048918 | Bacteria | 3803 |
| 1159 | Ga0496115_0076504 | 3300048918 | Bacteria | 2720 |
| 1160 | Ga0496115_0132538 | 3300048918 | Bacteria | 2054 |
| 1161 | Ga0496116_0003008 | 3300048919 | Bacteria | 17086 |
| 1162 | Ga0496116_0150275 | 3300048919 | Bacteria | 1295 |
| 1163 | Ga0496117_0076188 | 3300048920 | Bacteria | 2225 |
| 1164 | Ga0496117_0214415 | 3300048920 | Bacteria | 1077 |
| 1165 | Ga0496118_0075512 | 3300048921 | Bacteria | 2403 |
| 1166 | Ga0496118_0179456 | 3300048921 | Bacteria | 1281 |
| 1167 | Ga0496119_0000469 | 3300048922 | Bacteria | 54992 |
| 1168 | Ga0496119_0000855 | 3300048922 | Bacteria | 40135 |
| 1169 | Ga0496119_0119768 | 3300048922 | Bacteria | 1449 |
| 1170 | Ga0496120_0000372 | 3300048923 | Bacteria | 72951 |
| 1171 | Ga0496120_0001942 | 3300048923 | Bacteria | 22686 |
| 1172 | Ga0496121_0066731 | 3300048924 | Bacteria | 2920 |
| 1173 | Ga0496122_0025808 | 3300048925 | Bacteria | 5088 |
| 1174 | Ga0496122_0147325 | 3300048925 | Bacteria | 1460 |
| 1175 | Ga0496123_0145460 | 3300048926 | Bacteria | 1288 |
| 1176 | Ga0496123_0196005 | 3300048926 | Bacteria | 1040 |
| 1177 | Ga0496123_0269995 | 3300048926 | Bacteria | 828 |
| 1178 | Ga0496124_0000697 | 3300048927 | Bacteria | 55040 |
| 1179 | Ga0496124_0023250 | 3300048927 | Bacteria | 5663 |
| 1180 | Ga0496125_0050981 | 3300048928 | Bacteria | 3419 |
| 1181 | Ga0496125_0075979 | 3300048928 | Bacteria | 2596 |
| 1182 | Ga0496125_0084741 | 3300048928 | Bacteria | 2405 |
| 1183 | Ga0496125_0175500 | 3300048928 | Bacteria | 1434 |
| 1184 | Ga0496126_0024730 | 3300048929 | Bacteria | 5793 |
| 1185 | Ga0496126_0039091 | 3300048929 | Bacteria | 4406 |
| 1186 | Ga0496126_0131756 | 3300048929 | Bacteria | 2160 |
| 1187 | Ga0496126_0221452 | 3300048929 | Bacteria | 1589 |
| 1188 | Ga0501306_000191 | 3300049127 | Bacteria | 4081 |
| 1189 | Ga0501309_005550 | 3300049129 | Bacteria | 1508 |
| 1190 | Ga0501343_001886 | 3300049132 | Bacteria | 1458 |
| 1191 | Ga0501305_001225 | 3300049161 | Bacteria | 2459 |
| 1192 | Ga0501312_000027 | 3300049528 | Bacteria | 8927 |
| 1193 | Ga0501313_006374 | 3300049529 | Bacteria | 1277 |
| 1194 | Ga0501315_001573 | 3300049531 | Bacteria | 1990 |
| 1195 | Ga0501316_000050 | 3300049532 | Bacteria | 5210 |
| 1196 | Ga0501317_020591 | 3300049533 | Bacteria | 890 |
| 1197 | Ga0501318_008883 | 3300049534 | Bacteria | 1084 |
| 1198 | Ga0501321_000062 | 3300049537 | Bacteria | 4755 |
| 1199 | Ga0501323_006864 | 3300049539 | Bacteria | 1283 |
| 1200 | Ga0501323_009825 | 3300049539 | Bacteria | 1132 |
| 1201 | Ga0501324_000425 | 3300049540 | Bacteria | 2250 |
| 1202 | Ga0501330_001473 | 3300049546 | Bacteria | 1223 |
| 1203 | Ga0501331_00589 | 3300049547 | Bacteria | 1538 |
| 1204 | Ga0501334_00263 | 3300049550 | Bacteria | 2190 |
| 1205 | Ga0501335_002359 | 3300049551 | Bacteria | 1527 |
| 1206 | Ga0501337_000411 | 3300049553 | Bacteria | 2076 |
| 1207 | Ga0501031_0026834 | 3300049568 | Bacteria | 3755 |
| 1208 | Ga0501032_0157219 | 3300049569 | Bacteria | 1493 |
| 1209 | Ga0501033_0020411 | 3300049570 | Bacteria | 5004 |
| 1210 | Ga0501036_0000860 | 3300049572 | Bacteria | 22572 |
| 1211 | Ga0501036_0002708 | 3300049572 | Bacteria | 13991 |
| 1212 | Ga0501036_0812469 | 3300049572 | Bacteria | 770 |
| 1213 | Ga0501037_0140123 | 3300049573 | Bacteria | 1731 |
| 1214 | Ga0501037_0159544 | 3300049573 | Bacteria | 1608 |
| 1215 | Ga0501038_0001811 | 3300049574 | Bacteria | 19789 |
| 1216 | Ga0501038_0136222 | 3300049574 | Bacteria | 2012 |
| 1217 | Ga0501038_0140860 | 3300049574 | Bacteria | 1973 |
| 1218 | Ga0501038_0471655 | 3300049574 | Bacteria | 963 |
| 1219 | Ga0501039_0001335 | 3300049575 | Bacteria | 18046 |
| 1220 | Ga0501039_0099511 | 3300049575 | Bacteria | 2269 |
| 1221 | Ga0501040_0011405 | 3300049576 | Bacteria | 5819 |
| 1222 | Ga0501040_0209109 | 3300049576 | Bacteria | 1387 |
| 1223 | Ga0501040_0217457 | 3300049576 | Bacteria | 1359 |
| 1224 | Ga0501042_0000788 | 3300049578 | Bacteria | 17357 |
| 1225 | Ga0501042_0000948 | 3300049578 | Bacteria | 16341 |
| 1226 | Ga0501042_0030263 | 3300049578 | Bacteria | 3822 |
| 1227 | Ga0501042_0309490 | 3300049578 | Bacteria | 1141 |
| 1228 | Ga0501046_0013103 | 3300049580 | Bacteria | 7039 |
| 1229 | Ga0501046_0072436 | 3300049580 | Bacteria | 2675 |
| 1230 | Ga0501046_0081548 | 3300049580 | Bacteria | 2498 |
| 1231 | Ga0501046_0254330 | 3300049580 | Bacteria | 1292 |
| 1232 | Ga0501047_0495817 | 3300049581 | Bacteria | 1048 |
| 1233 | Ga0501048_0010899 | 3300049582 | Bacteria | 6779 |
| 1234 | Ga0501048_0126860 | 3300049582 | Bacteria | 1804 |
| 1235 | Ga0501067_0316826 | 3300049583 | Bacteria | 869 |
| 1236 | Ga0501068_0008573 | 3300049584 | Bacteria | 5695 |
| 1237 | Ga0501068_0285823 | 3300049584 | Bacteria | 1054 |
| 1238 | Ga0501068_0356357 | 3300049584 | Bacteria | 941 |
| 1239 | Ga0501069_0120845 | 3300049585 | Bacteria | 1496 |
| 1240 | Ga0501069_0250475 | 3300049585 | Bacteria | 1033 |
| 1241 | Ga0501069_0394380 | 3300049585 | Bacteria | 819 |
| 1242 | Ga0501070_0046253 | 3300049586 | Bacteria | 3619 |
| 1243 | Ga0501070_0176515 | 3300049586 | Bacteria | 1759 |
| 1244 | Ga0501071_0000849 | 3300049587 | Bacteria | 16382 |
| 1245 | Ga0501071_0017192 | 3300049587 | Bacteria | 4985 |
| 1246 | Ga0501071_0267403 | 3300049587 | Bacteria | 1292 |
| 1247 | Ga0501071_0327320 | 3300049587 | Bacteria | 1164 |
| 1248 | Ga0501072_0003324 | 3300049588 | Bacteria | 12098 |
| 1249 | Ga0501072_0005776 | 3300049588 | Bacteria | 9420 |
| 1250 | Ga0501072_0015507 | 3300049588 | Bacteria | 5840 |
| 1251 | Ga0501072_0104806 | 3300049588 | Bacteria | 2248 |
| 1252 | Ga0501072_0390925 | 3300049588 | Bacteria | 1103 |
| 1253 | Ga0501073_0030743 | 3300049589 | Bacteria | 3833 |
| 1254 | Ga0501073_0123746 | 3300049589 | Bacteria | 1793 |
| 1255 | Ga0501073_0217775 | 3300049589 | Bacteria | 1319 |
| 1256 | Ga0501074_0003006 | 3300049590 | Bacteria | 11867 |
| 1257 | Ga0501074_0030693 | 3300049590 | Bacteria | 3895 |
| 1258 | Ga0501074_0121731 | 3300049590 | Bacteria | 1866 |
| 1259 | Ga0501075_0001033 | 3300049591 | Bacteria | 17853 |
| 1260 | Ga0501075_0001990 | 3300049591 | Bacteria | 13490 |
| 1261 | Ga0501075_0062695 | 3300049591 | Bacteria | 2802 |
| 1262 | Ga0501075_0127092 | 3300049591 | Bacteria | 1941 |
| 1263 | Ga0501075_0193300 | 3300049591 | Bacteria | 1552 |
| 1264 | Ga0501075_0296467 | 3300049591 | Bacteria | 1232 |
| 1265 | Ga0501075_0471046 | 3300049591 | Bacteria | 958 |
| 1266 | Ga0501076_0000979 | 3300049592 | Bacteria | 18705 |
| 1267 | Ga0501076_0007813 | 3300049592 | Bacteria | 7796 |
| 1268 | Ga0501076_0083902 | 3300049592 | Bacteria | 2559 |
| 1269 | Ga0501076_0167771 | 3300049592 | Bacteria | 1789 |
| 1270 | Ga0501076_0300849 | 3300049592 | Bacteria | 1315 |
| 1271 | Ga0501076_0837691 | 3300049592 | Bacteria | 759 |
| 1272 | Ga0501077_0047329 | 3300049593 | Bacteria | 2732 |
| 1273 | Ga0501077_0116299 | 3300049593 | Bacteria | 1695 |
| 1274 | Ga0501077_0183440 | 3300049593 | Bacteria | 1330 |
| 1275 | Ga0501077_0211487 | 3300049593 | Bacteria | 1232 |
| 1276 | Ga0501079_0001475 | 3300049741 | Bacteria | 16640 |
| 1277 | Ga0501079_0006844 | 3300049741 | Bacteria | 8584 |
| 1278 | Ga0501079_0029406 | 3300049741 | Bacteria | 4218 |
| 1279 | Ga0501079_0155940 | 3300049741 | Bacteria | 1780 |
| 1280 | Ga0501079_0185343 | 3300049741 | Bacteria | 1625 |
| 1281 | Ga0501079_0208772 | 3300049741 | Bacteria | 1525 |
| 1282 | Ga0501080_0001334 | 3300049742 | Bacteria | 20578 |
| 1283 | Ga0501080_0056648 | 3300049742 | Bacteria | 3649 |
| 1284 | Ga0501081_0001239 | 3300049743 | Bacteria | 15520 |
| 1285 | Ga0501081_0002378 | 3300049743 | Bacteria | 11848 |
| 1286 | Ga0501081_0038071 | 3300049743 | Bacteria | 3284 |
| 1287 | Ga0501081_0167681 | 3300049743 | Bacteria | 1584 |
| 1288 | Ga0501083_0023121 | 3300049744 | Bacteria | 4312 |
| 1289 | Ga0501083_0055182 | 3300049744 | Bacteria | 2665 |
| 1290 | Ga0501083_0101198 | 3300049744 | Bacteria | 1900 |
| 1291 | Ga0501083_0145723 | 3300049744 | Bacteria | 1550 |
| 1292 | Ga0501279_004537 | 3300049775 | Bacteria | 1825 |
| 1293 | Ga0501035_0029667 | 3300049822 | Bacteria | 4988 |
| 1294 | Ga0501044_0479138 | 3300049823 | Bacteria | 1148 |
| 1295 | Ga0501044_0660016 | 3300049823 | Archaea | 934 |
| 1296 | Ga0501045_0000682 | 3300049824 | Bacteria | 21537 |
| 1297 | Ga0501045_0046088 | 3300049824 | Bacteria | 3175 |
| 1298 | Ga0501045_0054025 | 3300049824 | Bacteria | 2936 |
| 1299 | Ga0501045_0084069 | 3300049824 | Bacteria | 2348 |
| 1300 | Ga0501045_0201880 | 3300049824 | Bacteria | 1481 |
| 1301 | nmdc:mga03n38_108690_c1 | 3300050490 | Bacteria | 1347 |
| 1302 | nmdc:mga03n38_60592_c1 | 3300050490 | Bacteria | 1721 |
| 1303 | nmdc:mga00v17_105905_c1 | 3300050491 | Bacteria | 1780 |
| 1304 | nmdc:mga00v17_371009_c1 | 3300050491 | Bacteria | 930 |
| 1305 | nmdc:mga00v17_94313_c1 | 3300050491 | Bacteria | 1883 |
| 1306 | nmdc:mga0yw44_270499_c1 | 3300050492 | Bacteria | 1134 |
| 1307 | nmdc:mga0yw44_36883_c1 | 3300050492 | Bacteria | 2883 |
| 1308 | nmdc:mga0yw44_70411_c1 | 3300050492 | Bacteria | 2168 |
| 1309 | nmdc:mga0k408_1106_c1 | 3300050493 | Bacteria | 14761 |
| 1310 | nmdc:mga0k408_259294_c1 | 3300050493 | Bacteria | 1038 |
| 1311 | nmdc:mga06z11_24896_c1 | 3300050494 | Bacteria | 2830 |
| 1312 | nmdc:mga06z11_60721_c1 | 3300050494 | Bacteria | 1969 |
| 1313 | nmdc:mga04h51_35660_c1 | 3300050495 | Bacteria | 1596 |
| 1314 | nmdc:mga07m45_201586_c1 | 3300050496 | Bacteria | 1157 |
| 1315 | nmdc:mga07m45_63339_c1 | 3300050496 | Bacteria | 2097 |
| 1316 | nmdc:mga05p37_13622_c1 | 3300050507 | Bacteria | 9746 |
| 1317 | nmdc:mga05p37_16973_c1 | 3300050507 | Bacteria | 8780 |
| 1318 | nmdc:mga05p37_202056_c1 | 3300050507 | Bacteria | 2406 |
| 1319 | nmdc:mga05p37_20610_c1 | 3300050507 | Bacteria | 7977 |
| 1320 | nmdc:mga05p37_246472_c1 | 3300050507 | Bacteria | 2145 |
| 1321 | nmdc:mga05p37_25099_c1 | 3300050507 | Bacteria | 7247 |
| 1322 | nmdc:mga05p37_3048_c1 | 3300050507 | Bacteria | 19460 |
| 1323 | nmdc:mga05p37_306353_c1 | 3300050507 | Bacteria | 1885 |
| 1324 | nmdc:mga05p37_3121_c1 | 3300050507 | Bacteria | 19253 |
| 1325 | nmdc:mga05p37_46662_c1 | 3300050507 | Bacteria | 5326 |
| 1326 | nmdc:mga05p37_595_c1 | 3300050507 | Bacteria | 25325 |
| 1327 | nmdc:mga05p37_613385_c1 | 3300050507 | Bacteria | 1226 |
| 1328 | nmdc:mga05p37_75038_c1 | 3300050507 | Bacteria | 4163 |
| 1329 | nmdc:mga05p37_84346_c1 | 3300050507 | Bacteria | 3914 |
| 1330 | nmdc:mga05p37_88852_c1 | 3300050507 | Bacteria | 3808 |
| 1331 | nmdc:mga09592_110445_c1 | 3300050508 | Bacteria | 2359 |
| 1332 | nmdc:mga09592_13724_c1 | 3300050508 | Bacteria | 6620 |
| 1333 | nmdc:mga09592_255574_c1 | 3300050508 | Bacteria | 1519 |
| 1334 | nmdc:mga09592_388521_c1 | 3300050508 | Bacteria | 1206 |
| 1335 | nmdc:mga09592_462264_c1 | 3300050508 | Bacteria | 1094 |
| 1336 | nmdc:mga09592_7943_c1 | 3300050508 | Bacteria | 8620 |
| 1337 | nmdc:mga0qj67_24449_c1 | 3300050509 | Bacteria | 4656 |
| 1338 | nmdc:mga0qj67_420840_c1 | 3300050509 | Bacteria | 1077 |
| 1339 | nmdc:mga0qj67_5121_c1 | 3300050509 | Bacteria | 9545 |
| 1340 | nmdc:mga0qj67_610644_c1 | 3300050509 | Bacteria | 872 |
| 1341 | nmdc:mga06r32_350562_c1 | 3300050510 | Bacteria | 1460 |
| 1342 | nmdc:mga06r32_51901_c1 | 3300050510 | Bacteria | 3926 |
| 1343 | nmdc:mga06r32_545174_c1 | 3300050510 | Bacteria | 1134 |
| 1344 | nmdc:mga06r32_649826_c1 | 3300050510 | Bacteria | 1023 |
| 1345 | nmdc:mga06r32_86458_c1 | 3300050510 | Bacteria | 3058 |
| 1346 | nmdc:mga08y16_169354_c1 | 3300050511 | Bacteria | 2269 |
| 1347 | nmdc:mga08y16_17177_c1 | 3300050511 | Bacteria | 7617 |
| 1348 | nmdc:mga08y16_236383_c1 | 3300050511 | Bacteria | 1889 |
| 1349 | nmdc:mga08y16_371187_c1 | 3300050511 | Bacteria | 1468 |
| 1350 | nmdc:mga08y16_399570_c1 | 3300050511 | Bacteria | 1407 |
| 1351 | nmdc:mga08y16_4339_c1 | 3300050511 | Bacteria | 14819 |
| 1352 | nmdc:mga08y16_517196_c1 | 3300050511 | Bacteria | 1211 |
| 1353 | nmdc:mga08y16_927899_c1 | 3300050511 | Bacteria | 855 |
| 1354 | nmdc:mga0n895_1001604_c1 | 3300050512 | Bacteria | 817 |
| 1355 | nmdc:mga0n895_142639_c1 | 3300050512 | Bacteria | 2424 |
| 1356 | nmdc:mga0n895_17757_c1 | 3300050512 | Bacteria | 6566 |
| 1357 | nmdc:mga0n895_27160_c1 | 3300050512 | Bacteria | 5435 |
| 1358 | nmdc:mga0n895_602462_c1 | 3300050512 | Bacteria | 1101 |
| 1359 | nmdc:mga0n895_7101_c1 | 3300050512 | Bacteria | 9574 |
| 1360 | nmdc:mga0rr50_149780_c1 | 3300050513 | Bacteria | 1884 |
| 1361 | nmdc:mga0rr50_21352_c1 | 3300050513 | Bacteria | 4418 |
| 1362 | nmdc:mga0rr50_2205_c1 | 3300050513 | Bacteria | 10927 |
| 1363 | nmdc:mga0rr50_373_c1 | 3300050513 | Bacteria | 24506 |
| 1364 | nmdc:mga0rr50_39611_c1 | 3300050513 | Bacteria | 3420 |
| 1365 | nmdc:mga0rr50_60229_c1 | 3300050513 | Bacteria | 2855 |
| 1366 | nmdc:mga08x19_22597_c1 | 3300050514 | Bacteria | 3896 |
| 1367 | nmdc:mga08x19_34220_c1 | 3300050514 | Bacteria | 3210 |
| 1368 | nmdc:mga08x19_632680_c1 | 3300050514 | Bacteria | 759 |
| 1369 | nmdc:mga08x19_90727_c1 | 3300050514 | Bacteria | 2017 |
| 1370 | nmdc:mga0a205_10346_c1 | 3300050515 | Bacteria | 8575 |
| 1371 | nmdc:mga0a205_106213_c1 | 3300050515 | Bacteria | 2706 |
| 1372 | nmdc:mga0a205_47564_c1 | 3300050515 | Bacteria | 4140 |
| 1373 | nmdc:mga0a205_608134_c1 | 3300050515 | Bacteria | 946 |
| 1374 | nmdc:mga0a205_6655_c1 | 3300050515 | Bacteria | 10458 |
| 1375 | nmdc:mga0a205_72605_c1 | 3300050515 | Bacteria | 3325 |
| 1376 | nmdc:mga0a205_929598_c1 | 3300050515 | Bacteria | 716 |
| 1377 | nmdc:mga0sz30_129744_c1 | 3300050516 | Bacteria | 1110 |
| 1378 | Ga0495601_0002901 | 3300053077 | Bacteria | 9754 |
| 1379 | Ga0495601_0028459 | 3300053077 | Bacteria | 3461 |
| 1380 | Ga0495601_0164829 | 3300053077 | Bacteria | 1448 |
| 1381 | Ga0495612_0202295 | 3300053078 | Bacteria | 876 |
| 1382 | Ga0500610_0104299 | 3300053079 | Bacteria | 1464 |
| 1383 | Ga0500610_0111281 | 3300053079 | Bacteria | 1408 |
| 1384 | Ga0495655_0010860 | 3300053083 | Bacteria | 1812 |
| 1385 | Ga0495655_0026693 | 3300053083 | Bacteria | 1363 |
| 1386 | Ga0495655_0066699 | 3300053083 | Bacteria | 996 |
| 1387 | Ga0495595_0001331 | 3300053084 | Bacteria | 9608 |
| 1388 | Ga0495595_0072896 | 3300053084 | Bacteria | 1626 |
| 1389 | Ga0495619_0004075 | 3300053085 | Bacteria | 9360 |
| 1390 | Ga0495619_0004232 | 3300053085 | Bacteria | 9147 |
| 1391 | Ga0495619_0010190 | 3300053085 | Bacteria | 5920 |
| 1392 | Ga0495619_0144447 | 3300053085 | Bacteria | 1640 |
| 1393 | Ga0495619_0161747 | 3300053085 | Bacteria | 1546 |
| 1394 | Ga0500646_0060290 | 3300053090 | Bacteria | 1115 |
| 1395 | Ga0500651_0004275 | 3300053093 | Bacteria | 7979 |
| 1396 | Ga0500651_0226764 | 3300053093 | Bacteria | 1094 |
| 1397 | Ga0500566_0018854 | 3300053094 | Bacteria | 4051 |
| 1398 | Ga0500641_0007395 | 3300053096 | Bacteria | 3916 |
| 1399 | Ga0500556_0082237 | 3300053104 | Bacteria | 1219 |
| 1400 | Ga0500595_001142 | 3300053119 | Bacteria | 14731 |
| 1401 | Ga0500595_008139 | 3300053119 | Bacteria | 4302 |
| 1402 | Ga0500595_009814 | 3300053119 | Bacteria | 3844 |
| 1403 | Ga0500607_017101 | 3300053121 | Bacteria | 4143 |
| 1404 | Ga0500608_077661 | 3300053122 | Bacteria | 1572 |
| 1405 | Ga0500618_009735 | 3300053125 | Bacteria | 2612 |
| 1406 | Ga0500642_0001169 | 3300053130 | Bacteria | 7523 |
| 1407 | Ga0500642_0097290 | 3300053130 | Bacteria | 1365 |
| 1408 | Ga0500655_000265 | 3300053133 | Bacteria | 12247 |
| 1409 | Ga0500559_0002179 | 3300053136 | Bacteria | 10352 |
| 1410 | Ga0500559_0034952 | 3300053136 | Bacteria | 2168 |
| 1411 | Ga0500559_0077114 | 3300053136 | Bacteria | 1509 |
| 1412 | Ga0500568_0006975 | 3300053139 | Bacteria | 5597 |
| 1413 | Ga0500568_0017398 | 3300053139 | Bacteria | 3175 |
| 1414 | Ga0500588_0014706 | 3300053146 | Bacteria | 1990 |
| 1415 | Ga0500589_108869 | 3300053147 | Bacteria | 1191 |
| 1416 | Ga0500590_004805 | 3300053148 | Bacteria | 6438 |
| 1417 | Ga0500622_0012750 | 3300053156 | Bacteria | 4544 |
| 1418 | Ga0500639_055045 | 3300053163 | Bacteria | 2064 |
| 1419 | Ga0500636_0039323 | 3300053177 | Bacteria | 2797 |
| 1420 | Ga0500636_0045197 | 3300053177 | Bacteria | 2598 |
| 1421 | Ga0500637_0004731 | 3300053178 | Bacteria | 6508 |
| 1422 | Ga0500570_032123 | 3300053724 | Bacteria | 2826 |
| 1423 | Ga0500645_004711 | 3300053730 | Bacteria | 5179 |
| 1424 | Ga0501084_0000677 | 3300054114 | Bacteria | 25964 |
| 1425 | Ga0501084_0004051 | 3300054114 | Bacteria | 11934 |
| 1426 | Ga0501084_0084348 | 3300054114 | Bacteria | 2667 |
| 1427 | Ga0501084_0176773 | 3300054114 | Bacteria | 1802 |
| 1428 | Ga0501084_1136244 | 3300054114 | Bacteria | 656 |
| 1429 | Ga0500661_006321 | 3300055283 | Bacteria | 2204 |
| 1430 | Ga0590071_000185 | 3300059421 | Bacteria | 18146 |
| 1431 | Ga0590071_055211 | 3300059421 | Bacteria | 965 |
| 1432 | Ga0590074_015090 | 3300059423 | Bacteria | 1309 |
| 1433 | Ga0590075_000204 | 3300059424 | Bacteria | 16569 |
| 1434 | Ga0590075_035646 | 3300059424 | Bacteria | 1267 |
| 1435 | Ga0590077_020629 | 3300059426 | Bacteria | 1399 |
| 1436 | Ga0587067_002632 | 3300059640 | Bacteria | 2154 |
| 1437 | Ga0587067_018834 | 3300059640 | Bacteria | 1163 |
| 1438 | Ga0587072_000329 | 3300059643 | Bacteria | 4520 |
| 1439 | Ga0587072_024465 | 3300059643 | Bacteria | 1092 |
| 1440 | Ga0501082_0002099 | 3300060353 | Bacteria | 17551 |
| 1441 | Ga0501082_0002693 | 3300060353 | Bacteria | 15524 |
| 1442 | Ga0501082_0025899 | 3300060353 | Bacteria | 5055 |
| 1443 | Ga0501082_0100518 | 3300060353 | Bacteria | 2502 |
| 1444 | Ga0501082_0200131 | 3300060353 | Bacteria | 1738 |
| 1445 | Ga0501082_0205454 | 3300060353 | Bacteria | 1714 |
| 1446 | Ga0501082_0246512 | 3300060353 | Bacteria | 1555 |
| 1447 | Ga0501082_1048034 | 3300060353 | Bacteria | 713 |
| 1448 | Ga0530510_0001293 | 3300061734 | Bacteria | 16724 |
| 1449 | Ga0530510_0009637 | 3300061734 | Bacteria | 6776 |
| 1450 | Ga0530510_0058439 | 3300061734 | Bacteria | 2788 |
| 1451 | 2528204309 | 2527291627 | Bacteria | 5309833 |
| 1452 | 2528212121 | 2527291629 | Bacteria | 5267418 |
| 1453 | 2546946880 | 2546825537 | Bacteria | 5389291 |
| 1454 | 2563930209 | 2563366752 | Bacteria | 4961801 |
| 1455 | 2579747611 | 2576861822 | Bacteria | 5004595 |
| 1456 | 2643738859 | 2643221543 | Bacteria | 6628015 |
| 1457 | 2673167462 | 2671180531 | Bacteria | 9045424 |
| 1458 | 2686543605 | 2684623036 | Bacteria | 5199090 |
| 1459 | 2710602541 | 2710264753 | Bacteria | 5455564 |
| 1460 | 2774867002 | 2773857924 | Bacteria | 5256821 |
| 1461 | 2774902886 | 2773857933 | Bacteria | 5818019 |
| 1462 | 2821118338 | 2821111986 | Bacteria | 6894338 |
| 1463 | 2864738854 | 2864733723 | Bacteria | 6770668 |
| 1464 | 2876810452 | 2876808645 | Bacteria | 8824342 |
| 1465 | 2885529898 | 2885526491 | Bacteria | 7164189 |
| 1466 | 2889047992 | 2889042446 | Bacteria | 7618936 |
| 1467 | 2902335199 | 2902330777 | Bacteria | 6395352 |
| 1468 | 2904168171 | 2904162308 | Bacteria | 7086713 |
| 1469 | 2904496932 | 2904490793 | Bacteria | 7046938 |
| 1470 | 2907208182 | 2907202186 | Bacteria | 6632024 |
| 1471 | 2919166265 | 2919160200 | Bacteria | 6929020 |
| 1472 | 2931385098 | 2931384279 | Bacteria | 7299545 |
| 1473 | 2939685140 | 2939679117 | Bacteria | 6921672 |
| 1474 | 2945996279 | 2945991243 | Bacteria | 7008369 |
| 1475 | 2946058969 | 2946053406 | Bacteria | 6978655 |
| 1476 | 637877936 | 637000116 | Bacteria | 5433628 |
| 1477 | Ga0070694_100016422 | |||
| 1478 | JGI25162J39368_1009314 | |||
| 1479 | JGI25151J46595_10028272 | |||
| 1480 | JGI25407J50210_10043710 | |||
| 1481 | Ga0055538_1000286 | |||
| 1482 | Ga0055531_10022595 | |||
| 1483 | Ga0065712_10010472 | |||
| 1484 | Ga0065715_10004682 | |||
| 1485 | Ga0065715_10138461 | |||
| 1486 | Ga0065707_10004657 | |||
| 1487 | Ga0065707_10305482 | |||
| 1488 | Ga0070658_10000172 | |||
| 1489 | Ga0070658_10118295 | |||
| 1490 | Ga0070676_10010331 | |||
| 1491 | Ga0070676_10017267 | |||
| 1492 | Ga0070676_10064218 | |||
| 1493 | Ga0070676_10303732 | |||
| 1494 | Ga0070683_100334615 | |||
| 1495 | Ga0070683_100377411 | |||
| 1496 | Ga0070683_100828082 | |||
| 1497 | Ga0070690_100006534 | |||
| 1498 | Ga0070690_100196991 | |||
| 1499 | Ga0070670_100082822 | |||
| 1500 | Ga0070677_10098834 | |||
| 1501 | Ga0070677_10151331 | |||
| 1502 | Ga0068869_100162850 | |||
| 1503 | Ga0068869_100163409 | |||
| 1504 | Ga0068869_100169508 | |||
| 1505 | Ga0068869_100188225 | |||
| 1506 | Ga0068869_100310801 | |||
| 1507 | Ga0068869_100414370 | |||
| 1508 | Ga0070666_10007809 | |||
| 1509 | Ga0070666_10356367 | |||
| 1510 | Ga0070680_100073734 | |||
| 1511 | Ga0070680_100136701 | |||
| 1512 | Ga0070680_100154450 | |||
| 1513 | Ga0070680_100233985 | |||
| 1514 | Ga0068868_100081704 | |||
| 1515 | Ga0068868_100221694 | |||
| 1516 | Ga0068868_100599576 | |||
| 1517 | Ga0070660_100002987 | |||
| 1518 | Ga0070660_100007791 | |||
| 1519 | Ga0070660_100230165 | |||
| 1520 | Ga0070660_100267782 | |||
| 1521 | Ga0070660_100312906 | |||
| 1522 | Ga0070689_100064561 | |||
| 1523 | Ga0070689_100111866 | |||
| 1524 | Ga0070689_100118410 | |||
| 1525 | Ga0070691_10421015 | |||
| 1526 | Ga0070687_100012998 | |||
| 1527 | Ga0070687_100030822 | |||
| 1528 | Ga0070687_100076243 | |||
| 1529 | Ga0070661_100195221 | |||
| 1530 | Ga0070661_100343556 | |||
| 1531 | Ga0070668_100000831 | |||
| 1532 | Ga0070668_100098740 | |||
| 1533 | Ga0070668_100108161 | |||
| 1534 | Ga0070668_100161136 | |||
| 1535 | Ga0070668_100206942 | |||
| 1536 | Ga0070668_100603160 | |||
| 1537 | Ga0070669_100035389 | |||
| 1538 | Ga0070675_100000056 | |||
| 1539 | Ga0070675_100004703 | |||
| 1540 | Ga0070675_100401556 | |||
| 1541 | Ga0070675_100442461 | |||
| 1542 | Ga0070671_100024169 | |||
| 1543 | Ga0070671_100096780 | |||
| 1544 | Ga0070671_100260964 | |||
| 1545 | Ga0070671_100395569 | |||
| 1546 | Ga0070671_100453285 | |||
| 1547 | Ga0070671_100893792 | |||
| 1548 | Ga0070674_100050917 | |||
| 1549 | Ga0070674_100118101 | |||
| 1550 | Ga0070674_100192087 | |||
| 1551 | Ga0070674_100208681 | |||
| 1552 | Ga0070674_100371545 | |||
| 1553 | Ga0070673_100003427 | |||
| 1554 | Ga0070673_100173677 | |||
| 1555 | Ga0070673_100324956 | |||
| 1556 | Ga0070673_100387519 | |||
| 1557 | Ga0070673_100966862 | |||
| 1558 | Ga0070688_100070904 | |||
| 1559 | Ga0070688_100225636 | |||
| 1560 | Ga0070688_100239703 | |||
| 1561 | Ga0070659_100059884 | |||
| 1562 | Ga0070659_100300889 | |||
| 1563 | Ga0070667_100172226 | |||
| 1564 | Ga0070703_10227179 | |||
| 1565 | Ga0070709_10004324 | |||
| 1566 | Ga0070709_10143061 | |||
| 1567 | Ga0070709_10694899 | |||
| 1568 | Ga0070714_100282011 | |||
| 1569 | Ga0070714_100389823 | |||
| 1570 | Ga0070714_100505011 | |||
| 1571 | Ga0070714_100651634 | |||
| 1572 | Ga0070713_100000161 | |||
| 1573 | Ga0070713_100025501 | |||
| 1574 | Ga0070713_100025646 | |||
| 1575 | Ga0070713_100138736 | |||
| 1576 | Ga0070713_100176408 | |||
| 1577 | Ga0070710_10001033 | |||
| 1578 | Ga0070710_10009605 | |||
| 1579 | Ga0070701_10094219 | |||
| 1580 | Ga0070711_100297575 | |||
| 1581 | Ga0070711_100511941 | |||
| 1582 | Ga0070705_100008402 | |||
| 1583 | Ga0070705_100492435 | |||
| 1584 | Ga0070705_100732606 | |||
| 1585 | Ga0070700_100040018 | |||
| 1586 | Ga0070700_100041014 | |||
| 1587 | Ga0070700_100223853 | |||
| 1588 | Ga0070708_100010139 | |||
| 1589 | Ga0070708_100028126 | |||
| 1590 | Ga0070708_100259760 | |||
| 1591 | Ga0070708_100725669 | |||
| 1592 | Ga0070663_100239507 | |||
| 1593 | Ga0070678_100027149 | |||
| 1594 | Ga0070678_100120735 | |||
| 1595 | Ga0070678_100379642 | |||
| 1596 | Ga0070678_100483707 | |||
| 1597 | Ga0070662_100170816 | |||
| 1598 | Ga0070662_100224409 | |||
| 1599 | Ga0070662_100283201 | |||
| 1600 | Ga0070662_100336558 | |||
| 1601 | Ga0070662_100514343 | |||
| 1602 | Ga0070681_10018722 | |||
| 1603 | Ga0070681_10042357 | |||
| 1604 | Ga0070681_10047185 | |||
| 1605 | Ga0070681_10122730 | |||
| 1606 | Ga0070681_10579647 | |||
| 1607 | Ga0068867_100223195 | |||
| 1608 | Ga0068867_100420557 | |||
| 1609 | Ga0068867_100505350 | |||
| 1610 | Ga0070685_10071840 | |||
| 1611 | Ga0070706_100052012 | |||
| 1612 | Ga0070706_100994669 | |||
| 1613 | Ga0070707_100119560 | |||
| 1614 | Ga0070707_100174339 | |||
| 1615 | Ga0070707_100463032 | |||
| 1616 | Ga0070707_100579001 | |||
| 1617 | Ga0070698_100042981 | |||
| 1618 | Ga0070698_100063884 | |||
| 1619 | Ga0070698_100114045 | |||
| 1620 | Ga0070698_100247677 | |||
| 1621 | Ga0070699_100006991 | |||
| 1622 | Ga0070699_100042746 | |||
| 1623 | Ga0070699_100182694 | |||
| 1624 | Ga0070699_100198658 | |||
| 1625 | Ga0070699_100522629 | |||
| 1626 | Ga0070679_100044653 | |||
| 1627 | Ga0070679_100087883 | |||
| 1628 | Ga0070679_100124874 | |||
| 1629 | Ga0070679_100325809 | |||
| 1630 | Ga0070679_100443557 | |||
| 1631 | Ga0070684_100100706 | |||
| 1632 | Ga0070684_100148186 | |||
| 1633 | Ga0070684_100716926 | |||
| 1634 | Ga0070697_100022127 | |||
| 1635 | Ga0070697_100327097 | |||
| 1636 | Ga0068853_100030559 | |||
| 1637 | Ga0068853_100370174 | |||
| 1638 | Ga0068853_100848526 | |||
| 1639 | Ga0068853_101093302 | |||
| 1640 | Ga0070672_100139503 | |||
| 1641 | Ga0070672_100366412 | |||
| 1642 | Ga0070686_100002243 | |||
| 1643 | Ga0070686_100103111 | |||
| 1644 | Ga0070686_100147971 | |||
| 1645 | Ga0070686_100170290 | |||
| 1646 | Ga0070686_100588637 | |||
| 1647 | Ga0070695_100003541 | |||
| 1648 | Ga0070695_100062147 | |||
| 1649 | Ga0070695_100114416 | |||
| 1650 | Ga0070695_100173196 | |||
| 1651 | Ga0070695_100395332 | |||
| 1652 | Ga0070696_100004194 | |||
| 1653 | Ga0070696_100182976 | |||
| 1654 | Ga0070693_100155270 | |||
| 1655 | Ga0070665_100000109 | |||
| 1656 | Ga0070665_100010437 | |||
| 1657 | Ga0070665_100188766 | |||
| 1658 | Ga0070665_100769035 | |||
| 1659 | Ga0070704_100011568 | |||
| 1660 | Ga0070704_100019087 | |||
| 1661 | Ga0070704_100138326 | |||
| 1662 | Ga0068855_100017220 | |||
| 1663 | Ga0068855_100019504 | |||
| 1664 | Ga0068855_100191323 | |||
| 1665 | Ga0068855_100825222 | |||
| 1666 | Ga0070664_100169782 | |||
| 1667 | Ga0070664_100390429 | |||
| 1668 | Ga0070664_100543812 | |||
| 1669 | Ga0068857_100063077 | |||
| 1670 | Ga0068857_100894793 | |||
| 1671 | Ga0068854_100213124 | |||
| 1672 | Ga0068854_100277683 | |||
| 1673 | Ga0068854_100669936 | |||
| 1674 | Ga0068856_100018557 | |||
| 1675 | Ga0068856_100254817 | |||
| 1676 | Ga0068856_100937987 | |||
| 1677 | Ga0068852_100032860 | |||
| 1678 | Ga0068852_100305253 | |||
| 1679 | Ga0068852_100645832 | |||
| 1680 | Ga0068859_100021003 | |||
| 1681 | Ga0068859_100065113 | |||
| 1682 | Ga0068859_100219454 | |||
| 1683 | Ga0068859_100427652 | |||
| 1684 | Ga0068859_100650905 | |||
| 1685 | Ga0068859_100664279 | |||
| 1686 | Ga0068859_100869196 | |||
| 1687 | Ga0068864_100023234 | |||
| 1688 | Ga0068864_100063762 | |||
| 1689 | Ga0068864_100830112 | |||
| 1690 | Ga0068866_10013064 | |||
| 1691 | Ga0068866_10240660 | |||
| 1692 | Ga0068861_100067590 | |||
| 1693 | Ga0068861_100073792 | |||
| 1694 | Ga0068861_100095518 | |||
| 1695 | Ga0068861_100138254 | |||
| 1696 | Ga0068861_100200552 | |||
| 1697 | Ga0068861_100362892 | |||
| 1698 | Ga0068861_100436014 | |||
| 1699 | Ga0068861_100553653 | |||
| 1700 | Ga0068851_10465475 | |||
| 1701 | Ga0068870_10017565 | |||
| 1702 | Ga0068870_10104977 | |||
| 1703 | Ga0068863_100000017 | |||
| 1704 | Ga0068863_100017228 | |||
| 1705 | Ga0068863_100091547 | |||
| 1706 | Ga0068863_100098324 | |||
| 1707 | Ga0068863_100177459 | |||
| 1708 | Ga0068863_100221469 | |||
| 1709 | Ga0068863_100269671 | |||
| 1710 | Ga0068863_100395752 | |||
| 1711 | Ga0068863_100682508 | |||
| 1712 | Ga0068858_100001254 | |||
| 1713 | Ga0068858_100036297 | |||
| 1714 | Ga0068858_100213833 | |||
| 1715 | Ga0068858_100304218 | |||
| 1716 | Ga0068858_100325108 | |||
| 1717 | Ga0068858_100341758 | |||
| 1718 | Ga0068858_100443973 | |||
| 1719 | Ga0068860_100196477 | |||
| 1720 | Ga0068860_100204933 | |||
| 1721 | Ga0068860_100222812 | |||
| 1722 | Ga0068862_100021021 | |||
| 1723 | Ga0068862_100243979 | |||
| 1724 | Ga0068862_100256173 | |||
| 1725 | Ga0068862_100388290 | |||
| 1726 | Ga0068862_100477468 | |||
| 1727 | Ga0068862_100654087 | |||
| 1728 | Ga0081455_10020035 | |||
| 1729 | Ga0081455_10062986 | |||
| 1730 | Ga0081455_10094886 | |||
| 1731 | Ga0081455_10196227 | |||
| 1732 | Ga0081538_10028271 | |||
| 1733 | Ga0081538_10159526 | |||
| 1734 | Ga0081540_1029909 | |||
| 1735 | Ga0081540_1060207 | |||
| 1736 | Ga0081539_10028512 | |||
| 1737 | Ga0070717_10058494 | |||
| 1738 | Ga0070717_10078925 | |||
| 1739 | Ga0070717_10083134 | |||
| 1740 | Ga0070717_10210245 | |||
| 1741 | Ga0070717_10242212 | |||
| 1742 | Ga0075365_10064596 | |||
| 1743 | Ga0075365_10150506 | |||
| 1744 | Ga0075365_10183350 | |||
| 1745 | Ga0075368_10029905 | |||
| 1746 | Ga0075364_10034870 | |||
| 1747 | Ga0070715_10001976 | |||
| 1748 | Ga0070716_100009024 | |||
| 1749 | Ga0070716_100087778 | |||
| 1750 | Ga0070716_100149702 | |||
| 1751 | Ga0070716_100545086 | |||
| 1752 | Ga0070712_100013564 | |||
| 1753 | Ga0070712_100059771 | |||
| 1754 | Ga0075362_10019673 | |||
| 1755 | Ga0075362_10074422 | |||
| 1756 | Ga0075367_10011148 | |||
| 1757 | Ga0075367_10096682 | |||
| 1758 | Ga0075367_10138559 | |||
| 1759 | Ga0075369_10052067 | |||
| 1760 | Ga0075369_10056907 | |||
| 1761 | Ga0075369_10256154 | |||
| 1762 | Ga0075366_10003380 | |||
| 1763 | Ga0075366_10077818 | |||
| 1764 | Ga0075366_10301324 | |||
| 1765 | Ga0097621_100006061 | |||
| 1766 | Ga0097621_100015176 | |||
| 1767 | Ga0097621_100139647 | |||
| 1768 | Ga0097621_100193670 | |||
| 1769 | Ga0068871_100001728 | |||
| 1770 | Ga0068871_100088164 | |||
| 1771 | Ga0068871_100113852 | |||
| 1772 | Ga0068871_100270635 | |||
| 1773 | Ga0068871_100318050 | |||
| 1774 | Ga0068871_100360462 | |||
| 1775 | Ga0075428_100002425 | |||
| 1776 | Ga0075428_100040963 | |||
| 1777 | Ga0075428_100055934 | |||
| 1778 | Ga0075428_100070820 | |||
| 1779 | Ga0075428_100238517 | |||
| 1780 | Ga0075428_100835067 | |||
| 1781 | Ga0075430_100063762 | |||
| 1782 | Ga0075430_100237034 | |||
| 1783 | Ga0075430_100409994 | |||
| 1784 | Ga0075431_100003805 | |||
| 1785 | Ga0075431_100006978 | |||
| 1786 | Ga0075431_100052518 | |||
| 1787 | Ga0075431_100342636 | |||
| 1788 | Ga0075433_10095035 | |||
| 1789 | Ga0075433_10096964 | |||
| 1790 | Ga0075433_10114798 | |||
| 1791 | Ga0075433_10142642 | |||
| 1792 | Ga0075433_10206637 | |||
| 1793 | Ga0075433_10373859 | |||
| 1794 | Ga0075434_100123476 | |||
| 1795 | Ga0075434_100146743 | |||
| 1796 | Ga0075434_100208694 | |||
| 1797 | Ga0075434_100224809 | |||
| 1798 | Ga0075434_100240424 | |||
| 1799 | Ga0075434_100543569 | |||
| 1800 | Ga0075434_100777727 | |||
| 1801 | Ga0075429_100004225 | |||
| 1802 | Ga0075429_100010320 | |||
| 1803 | Ga0075429_100067833 | |||
| 1804 | Ga0075429_100078704 | |||
| 1805 | Ga0068865_100468691 | |||
| 1806 | Ga0075436_100028497 | |||
| 1807 | Ga0075436_100031296 | |||
| 1808 | Ga0075436_100049304 | |||
| 1809 | Ga0075436_100057089 | |||
| 1810 | Ga0075436_100058745 | |||
| 1811 | Ga0075436_100100249 | |||
| 1812 | Ga0075436_100109094 | |||
| 1813 | Ga0097620_100021003 | |||
| 1814 | Ga0097620_100065113 | |||
| 1815 | Ga0097620_100219454 | |||
| 1816 | Ga0097620_100427650 | |||
| 1817 | Ga0097620_100650838 | |||
| 1818 | Ga0097620_100664276 | |||
| 1819 | Ga0097620_100869340 | |||
| 1820 | Ga0079104_1024112 | |||
| 1821 | Ga0075435_100001542 | |||
| 1822 | Ga0075435_100001694 | |||
| 1823 | Ga0075435_100039831 | |||
| 1824 | Ga0075435_100070719 | |||
| 1825 | Ga0075435_100083105 | |||
| 1826 | Ga0075435_100283065 | |||
| 1827 | Ga0075435_100343739 | |||
| 1828 | Ga0099794_10012544 | |||
| 1829 | Ga0099794_10028448 | |||
| 1830 | Ga0099794_10064512 | |||
| 1831 | Ga0099794_10077253 | |||
| 1832 | Ga0099794_10119509 | |||
| 1833 | Ga0099794_10152346 | |||
| 1834 | Ga0099795_10044771 | |||
| 1835 | Ga0105251_10038598 | |||
| 1836 | Ga0105244_10017034 | |||
| 1837 | Ga0105244_10032973 | |||
| 1838 | Ga0105240_10045226 | |||
| 1839 | Ga0105240_10077161 | |||
| 1840 | Ga0105240_10287205 | |||
| 1841 | Ga0105240_10363484 | |||
| 1842 | Ga0111539_10000566 | |||
| 1843 | Ga0111539_10007255 | |||
| 1844 | Ga0111539_10170273 | |||
| 1845 | Ga0111539_10286952 | |||
| 1846 | Ga0111539_10514804 | |||
| 1847 | Ga0111539_10520909 | |||
| 1848 | Ga0111539_10903261 | |||
| 1849 | Ga0111539_11122142 | |||
| 1850 | Ga0105245_10026276 | |||
| 1851 | Ga0105245_10068939 | |||
| 1852 | Ga0105245_10144359 | |||
| 1853 | Ga0105245_10238041 | |||
| 1854 | Ga0105245_10276752 | |||
| 1855 | Ga0105245_10395640 | |||
| 1856 | Ga0105245_10586056 | |||
| 1857 | Ga0105245_11385278 | |||
| 1858 | Ga0105247_10000016 | |||
| 1859 | Ga0105247_10004209 | |||
| 1860 | Ga0105247_10009289 | |||
| 1861 | Ga0105247_10024345 | |||
| 1862 | Ga0105247_10056718 | |||
| 1863 | Ga0105247_10127988 | |||
| 1864 | Ga0105247_10391050 | |||
| 1865 | Ga0114129_10000431 | |||
| 1866 | Ga0114129_10001150 | |||
| 1867 | Ga0114129_10002840 | |||
| 1868 | Ga0114129_10004861 | |||
| 1869 | Ga0114129_10060820 | |||
| 1870 | Ga0114129_10078194 | |||
| 1871 | Ga0114129_10106586 | |||
| 1872 | Ga0114129_10122991 | |||
| 1873 | Ga0114129_10201915 | |||
| 1874 | Ga0114129_10220032 | |||
| 1875 | Ga0114129_10359401 | |||
| 1876 | Ga0114129_10381813 | |||
| 1877 | Ga0114129_10546194 | |||
| 1878 | Ga0114129_10788848 | |||
| 1879 | Ga0114129_11063128 | |||
| 1880 | Ga0114129_11118264 | |||
| 1881 | Ga0114129_11245379 | |||
| 1882 | Ga0105243_10301519 | |||
| 1883 | Ga0105243_10611995 | |||
| 1884 | Ga0105241_10087967 | |||
| 1885 | Ga0105242_10184408 | |||
| 1886 | Ga0105242_10223480 | |||
| 1887 | Ga0105242_10228102 | |||
| 1888 | Ga0105242_10386775 | |||
| 1889 | Ga0105242_10607423 | |||
| 1890 | Ga0105248_10002899 | |||
| 1891 | Ga0105248_10019507 | |||
| 1892 | Ga0105248_10088320 | |||
| 1893 | Ga0105248_10088554 | |||
| 1894 | Ga0105248_10094826 | |||
| 1895 | Ga0105248_10110426 | |||
| 1896 | Ga0105248_10125984 | |||
| 1897 | Ga0105248_10135047 | |||
| 1898 | Ga0105248_10169500 | |||
| 1899 | Ga0105248_10280794 | |||
| 1900 | Ga0105248_10371694 | |||
| 1901 | Ga0105248_10910328 | |||
| 1902 | Ga0105248_11118400 | |||
| 1903 | Ga0105248_11158940 | |||
| 1904 | Ga0105237_10210301 | |||
| 1905 | Ga0105237_10354917 | |||
| 1906 | Ga0105237_10408686 | |||
| 1907 | Ga0105238_10658969 | |||
| 1908 | Ga0105249_10020004 | |||
| 1909 | Ga0105249_10048671 | |||
| 1910 | Ga0105249_10184437 | |||
| 1911 | Ga0105249_10508957 | |||
| 1912 | Ga0105249_10546879 | |||
| 1913 | Ga0099796_10011242 | |||
| 1914 | Ga0099796_10040627 | |||
| 1915 | Ga0105239_10386387 | |||
| 1916 | Ga0105239_10561888 | |||
| 1917 | Ga0105239_10950756 | |||
| 1918 | Ga0105246_10000488 | |||
| 1919 | Ga0105246_10002877 | |||
| 1920 | Ga0105246_10048926 | |||
| 1921 | Ga0105246_10345968 | |||
| 1922 | Ga0105246_10609482 | |||
| 1923 | Ga0157370_10256810 | |||
| 1924 | Ga0157369_10316730 | |||
| 1925 | Ga0157374_10216462 | |||
| 1926 | Ga0157374_10224096 | |||
| 1927 | Ga0157374_10338628 | |||
| 1928 | Ga0157374_10353337 | |||
| 1929 | Ga0157378_10052663 | |||
| 1930 | Ga0157378_10145914 | |||
| 1931 | Ga0157378_10391315 | |||
| 1932 | Ga0163162_10115851 | |||
| 1933 | Ga0163162_10229606 | |||
| 1934 | Ga0163162_10330796 | |||
| 1935 | Ga0163162_10392743 | |||
| 1936 | Ga0163162_11158825 | |||
| 1937 | Ga0157372_10964963 | |||
| 1938 | Ga0157375_10139830 | |||
| 1939 | Ga0157375_10173554 | |||
| 1940 | Ga0157375_10435333 | |||
| 1941 | Ga0157375_10519216 | |||
| 1942 | Ga0157375_10662569 | |||
| 1943 | Ga0157375_10871853 | |||
| 1944 | Ga0157375_10926635 | |||
| 1945 | Ga0163163_10024877 | |||
| 1946 | Ga0163163_10064535 | |||
| 1947 | Ga0163163_10257855 | |||
| 1948 | Ga0163163_10559923 | |||
| 1949 | Ga0163163_11345461 | |||
| 1950 | Ga0157380_10223651 | |||
| 1951 | Ga0157380_10245428 | |||
| 1952 | Ga0157380_10347519 | |||
| 1953 | Ga0157380_10390373 | |||
| 1954 | Ga0157380_10391620 | |||
| 1955 | Ga0157380_11292685 | |||
| 1956 | Ga0182008_10004904 | |||
| 1957 | Ga0157377_10001603 | |||
| 1958 | Ga0157377_10078424 | |||
| 1959 | Ga0157377_10158199 | |||
| 1960 | Ga0157377_10270263 | |||
| 1961 | Ga0157377_10377577 | |||
| 1962 | Ga0157377_10467160 | |||
| 1963 | Ga0157379_10011242 | |||
| 1964 | Ga0157379_10079775 | |||
| 1965 | Ga0157379_10082081 | |||
| 1966 | Ga0157379_10144530 | |||
| 1967 | Ga0157379_10886060 | |||
| 1968 | Ga0157376_10247505 | |||
| 1969 | Ga0157376_10278620 | |||
| 1970 | Ga0157376_10401297 | |||
| 1971 | Ga0157376_10508397 | |||
| 1972 | Ga0182007_10006522 | |||
| 1973 | Ga0163161_10259062 | |||
| 1974 | Ga0163161_10285545 | |||
| 1975 | Ga0163161_10388868 | |||
| 1976 | Ga0197907_10958534 | |||
| 1977 | Ga0206352_10045669 | |||
| 1978 | Ga0206350_10423989 | |||
| 1979 | Ga0206354_10580180 | |||
| 1980 | Ga0213872_10091145 | |||
| 1981 | Ga0213874_10076065 | |||
| 1982 | Ga0213876_10003406 | |||
| 1983 | Ga0213876_10023171 | |||
| 1984 | Ga0213871_10052803 | |||
| 1985 | Ga0224712_10220596 | |||
| 1986 | Ga0209784_100141 | |||
| 1987 | Ga0209437_100331 | |||
| 1988 | Ga0209130_1043281 | |||
| 1989 | Ga0209675_1015955 | |||
| 1990 | Ga0209025_1000976 | |||
| 1991 | Ga0209758_1000216 | |||
| 1992 | Ga0209758_1027215 | |||
| 1993 | Ga0209256_1010676 | |||
| 1994 | Ga0209257_1020704 | |||
| 1995 | Ga0207697_10074714 | |||
| 1996 | Ga0207655_1016982 | |||
| 1997 | Ga0207655_1053672 | |||
| 1998 | Ga0207713_1029603 | |||
| 1999 | Ga0207653_10042327 | |||
| 2000 | Ga0207653_10250200 | |||
| 2001 | Ga0207692_10011948 | |||
| 2002 | Ga0207692_10034935 | |||
| 2003 | Ga0207710_10000017 | |||
| 2004 | Ga0207710_10015930 | |||
| 2005 | Ga0207710_10028646 | |||
| 2006 | Ga0207710_10040258 | |||
| 2007 | Ga0207710_10091273 | |||
| 2008 | Ga0207688_10010927 | |||
| 2009 | Ga0207688_10065624 | |||
| 2010 | Ga0207688_10156735 | |||
| 2011 | Ga0207680_10006153 | |||
| 2012 | Ga0207685_10050135 | |||
| 2013 | Ga0207685_10057475 | |||
| 2014 | Ga0207699_10028394 | |||
| 2015 | Ga0207699_10141559 | |||
| 2016 | Ga0207699_10364227 | |||
| 2017 | Ga0207699_10469485 | |||
| 2018 | Ga0207699_10614083 | |||
| 2019 | Ga0207645_10120859 | |||
| 2020 | Ga0207645_10220500 | |||
| 2021 | Ga0207643_10002622 | |||
| 2022 | Ga0207643_10058965 | |||
| 2023 | Ga0207643_10139071 | |||
| 2024 | Ga0207705_10000002 | |||
| 2025 | Ga0207705_10246651 | |||
| 2026 | Ga0207705_10574388 | |||
| 2027 | Ga0207684_10284308 | |||
| 2028 | Ga0207654_10040688 | |||
| 2029 | Ga0207707_10016379 | |||
| 2030 | Ga0207707_10358042 | |||
| 2031 | Ga0207695_10247709 | |||
| 2032 | Ga0207671_10122202 | |||
| 2033 | Ga0207693_10001926 | |||
| 2034 | Ga0207693_10021188 | |||
| 2035 | Ga0207693_10129942 | |||
| 2036 | Ga0207693_10162845 | |||
| 2037 | Ga0207663_10000218 | |||
| 2038 | Ga0207663_10028223 | |||
| 2039 | Ga0207663_10123632 | |||
| 2040 | Ga0207663_10151603 | |||
| 2041 | Ga0207660_10014904 | |||
| 2042 | Ga0207660_10359614 | |||
| 2043 | Ga0207662_10000683 | |||
| 2044 | Ga0207662_10061436 | |||
| 2045 | Ga0207662_10147552 | |||
| 2046 | Ga0207657_10007500 | |||
| 2047 | Ga0207657_10013143 | |||
| 2048 | Ga0207657_10044526 | |||
| 2049 | Ga0207657_10171327 | |||
| 2050 | Ga0207657_10523273 | |||
| 2051 | Ga0207649_10036860 | |||
| 2052 | Ga0207649_10276746 | |||
| 2053 | Ga0207649_10280726 | |||
| 2054 | Ga0207649_10497928 | |||
| 2055 | Ga0207652_10014975 | |||
| 2056 | Ga0207652_10016976 | |||
| 2057 | Ga0207652_10077073 | |||
| 2058 | Ga0207652_10243407 | |||
| 2059 | Ga0207652_10259532 | |||
| 2060 | Ga0207652_10281349 | |||
| 2061 | Ga0207646_10221868 | |||
| 2062 | Ga0207681_10031902 | |||
| 2063 | Ga0207681_10260818 | |||
| 2064 | Ga0207650_10138625 | |||
| 2065 | Ga0207650_10438518 | |||
| 2066 | Ga0207659_10001213 | |||
| 2067 | Ga0207659_10028998 | |||
| 2068 | Ga0207659_10113563 | |||
| 2069 | Ga0207687_10015651 | |||
| 2070 | Ga0207687_10108277 | |||
| 2071 | Ga0207687_10191387 | |||
| 2072 | Ga0207687_10384467 | |||
| 2073 | Ga0207687_10906365 | |||
| 2074 | Ga0207700_10021547 | |||
| 2075 | Ga0207700_10130792 | |||
| 2076 | Ga0207700_10450251 | |||
| 2077 | Ga0207664_10008551 | |||
| 2078 | Ga0207664_10045656 | |||
| 2079 | Ga0207664_10079107 | |||
| 2080 | Ga0207664_10527278 | |||
| 2081 | Ga0207664_10693924 | |||
| 2082 | Ga0207644_10000145 | |||
| 2083 | Ga0207644_10138035 | |||
| 2084 | Ga0207644_10203491 | |||
| 2085 | Ga0207644_10205130 | |||
| 2086 | Ga0207690_10126838 | |||
| 2087 | Ga0207690_10574478 | |||
| 2088 | Ga0207706_10002966 | |||
| 2089 | Ga0207706_10120457 | |||
| 2090 | Ga0207706_10207924 | |||
| 2091 | Ga0207706_10329771 | |||
| 2092 | Ga0207706_10345338 | |||
| 2093 | Ga0207706_10418351 | |||
| 2094 | Ga0207706_10424115 | |||
| 2095 | Ga0207686_10072906 | |||
| 2096 | Ga0207709_10056127 | |||
| 2097 | Ga0207709_10102289 | |||
| 2098 | Ga0207709_10255332 | |||
| 2099 | Ga0207670_10023176 | |||
| 2100 | Ga0207670_10046448 | |||
| 2101 | Ga0207670_10109566 | |||
| 2102 | Ga0207670_10168401 | |||
| 2103 | Ga0207669_10040380 | |||
| 2104 | Ga0207669_10387170 | |||
| 2105 | Ga0207704_10108603 | |||
| 2106 | Ga0207704_10214793 | |||
| 2107 | Ga0207704_10240334 | |||
| 2108 | Ga0207665_10005572 | |||
| 2109 | Ga0207665_10006881 | |||
| 2110 | Ga0207665_10046790 | |||
| 2111 | Ga0207665_10058141 | |||
| 2112 | Ga0207665_10095992 | |||
| 2113 | Ga0207665_10627843 | |||
| 2114 | Ga0207691_10033820 | |||
| 2115 | Ga0207691_10142665 | |||
| 2116 | Ga0207691_10328703 | |||
| 2117 | Ga0207691_10365725 | |||
| 2118 | Ga0207691_10407998 | |||
| 2119 | Ga0207691_10463962 | |||
| 2120 | Ga0207711_10002995 | |||
| 2121 | Ga0207711_10007764 | |||
| 2122 | Ga0207711_10053527 | |||
| 2123 | Ga0207711_10077530 | |||
| 2124 | Ga0207711_10087655 | |||
| 2125 | Ga0207711_10980799 | |||
| 2126 | Ga0207711_11016856 | |||
| 2127 | Ga0207689_10008393 | |||
| 2128 | Ga0207689_10198876 | |||
| 2129 | Ga0207689_10262806 | |||
| 2130 | Ga0207689_10288884 | |||
| 2131 | Ga0207689_10306829 | |||
| 2132 | Ga0207689_10383677 | |||
| 2133 | Ga0207661_10423854 | |||
| 2134 | Ga0207661_10700780 | |||
| 2135 | Ga0207661_10894155 | |||
| 2136 | Ga0207679_10130543 | |||
| 2137 | Ga0207679_10231023 | |||
| 2138 | Ga0207667_10012912 | |||
| 2139 | Ga0207667_10023790 | |||
| 2140 | Ga0207667_10227475 | |||
| 2141 | Ga0207667_10876575 | |||
| 2142 | Ga0207651_10109469 | |||
| 2143 | Ga0207651_10336789 | |||
| 2144 | Ga0207712_10024731 | |||
| 2145 | Ga0207712_10379238 | |||
| 2146 | Ga0207668_10008013 | |||
| 2147 | Ga0207668_10036515 | |||
| 2148 | Ga0207668_10094916 | |||
| 2149 | Ga0207668_10111996 | |||
| 2150 | Ga0207640_10022062 | |||
| 2151 | Ga0207640_10327560 | |||
| 2152 | Ga0207677_10076376 | |||
| 2153 | Ga0207677_10217805 | |||
| 2154 | Ga0207677_10347872 | |||
| 2155 | Ga0207703_10012018 | |||
| 2156 | Ga0207703_10048528 | |||
| 2157 | Ga0207703_10094107 | |||
| 2158 | Ga0207703_10184440 | |||
| 2159 | Ga0207703_10213190 | |||
| 2160 | Ga0207703_10269770 | |||
| 2161 | Ga0207703_10318319 | |||
| 2162 | Ga0207703_10322304 | |||
| 2163 | Ga0207639_10113371 | |||
| 2164 | Ga0207639_10140499 | |||
| 2165 | Ga0207639_10251013 | |||
| 2166 | Ga0207639_10338062 | |||
| 2167 | Ga0207678_10045312 | |||
| 2168 | Ga0207678_10095940 | |||
| 2169 | Ga0207678_10139610 | |||
| 2170 | Ga0207708_10022090 | |||
| 2171 | Ga0207708_10165085 | |||
| 2172 | Ga0207708_10461978 | |||
| 2173 | Ga0207708_10511065 | |||
| 2174 | Ga0207702_10248289 | |||
| 2175 | Ga0207702_10290442 | |||
| 2176 | Ga0207641_10000036 | |||
| 2177 | Ga0207641_10001674 | |||
| 2178 | Ga0207641_10006011 | |||
| 2179 | Ga0207641_10125366 | |||
| 2180 | Ga0207641_10424049 | |||
| 2181 | Ga0207641_10445859 | |||
| 2182 | Ga0207641_10986217 | |||
| 2183 | Ga0207648_10005612 | |||
| 2184 | Ga0207648_10038262 | |||
| 2185 | Ga0207648_10143468 | |||
| 2186 | Ga0207648_10708539 | |||
| 2187 | Ga0207676_10118955 | |||
| 2188 | Ga0207676_10342233 | |||
| 2189 | Ga0207676_10716459 | |||
| 2190 | Ga0207674_10084505 | |||
| 2191 | Ga0207674_10089883 | |||
| 2192 | Ga0207674_10190001 | |||
| 2193 | Ga0207674_10396355 | |||
| 2194 | Ga0207675_100003007 | |||
| 2195 | Ga0207675_100036086 | |||
| 2196 | Ga0207675_100082556 | |||
| 2197 | Ga0207675_100182641 | |||
| 2198 | Ga0207675_100405621 | |||
| 2199 | Ga0207675_100627022 | |||
| 2200 | Ga0207675_100951657 | |||
| 2201 | Ga0207675_101416959 | |||
| 2202 | Ga0207683_10015654 | |||
| 2203 | Ga0207683_10032201 | |||
| 2204 | Ga0207683_10207216 | |||
| 2205 | Ga0207683_10254803 | |||
| 2206 | Ga0207683_10282128 | |||
| 2207 | Ga0207683_10454525 | |||
| 2208 | Ga0207698_10092615 | |||
| 2209 | Ga0207698_10173647 | |||
| 2210 | Ga0207698_10335106 | |||
| 2211 | Ga0207698_10375678 | |||
| 2212 | Ga0207698_10388390 | |||
| 2213 | Ga0207698_10529446 | |||
| 2214 | Ga0207698_11032515 | |||
| 2215 | Ga0209281_1029026 | |||
| 2216 | Ga0209489_109706 | |||
| 2217 | Ga0209700_100031 | |||
| 2218 | Ga0209588_1015432 | |||
| 2219 | Ga0209588_1043115 | |||
| 2220 | Ga0209588_1063219 | |||
| 2221 | Ga0209813_10028535 | |||
| 2222 | Ga0207428_10000032 | |||
| 2223 | Ga0207428_10070330 | |||
| 2224 | Ga0207428_10111063 | |||
| 2225 | Ga0207428_10230665 | |||
| 2226 | Ga0207428_10250355 | |||
| 2227 | Ga0268266_10000560 | |||
| 2228 | Ga0268266_10029767 | |||
| 2229 | Ga0268266_10240360 | |||
| 2230 | Ga0268266_10624126 | |||
| 2231 | Ga0268266_11305718 | |||
| 2232 | Ga0268265_10043571 | |||
| 2233 | Ga0268265_10201099 | |||
| 2234 | Ga0268265_10203711 | |||
| 2235 | Ga0268265_10223592 | |||
| 2236 | Ga0268265_10232679 | |||
| 2237 | Ga0268265_10255954 | |||
| 2238 | Ga0268265_10392731 | |||
| 2239 | Ga0268265_10642495 | |||
| 2240 | Ga0268264_10014193 | |||
| 2241 | Ga0268264_10111054 | |||
| 2242 | Ga0268264_10155027 | |||
| 2243 | Ga0268264_10177234 | |||
| 2244 | Ga0268264_10255397 | |||
| 2245 | Ga0265334_10083058 | |||
| 2246 | Ga0307517_10000125 | |||
| 2247 | Ga0307515_10158343 | |||
| 2248 | Ga0265338_10008624 | |||
| 2249 | Ga0265338_10090007 | |||
| 2250 | Ga0310982_100320 | |||
| 2251 | Ga0310981_1038706 | |||
| 2252 | Ga0307512_10142319 | |||
| 2253 | Ga0316182_1082465 | |||
| 2254 | Ga0265762_1001772 | |||
| 2255 | Ga0265777_103137 | |||
| 2256 | Ga0265328_10000041 | |||
| 2257 | Ga0265340_10107718 | |||
| 2258 | Ga0265316_10004234 | |||
| 2259 | Ga0307408_100158543 | |||
| 2260 | Ga0307408_100320780 | |||
| 2261 | Ga0307508_10165302 | |||
| 2262 | Ga0307508_10233855 | |||
| 2263 | Ga0265314_10110622 | |||
| 2264 | Ga0307516_10167169 | |||
| 2265 | Ga0307405_10187330 | |||
| 2266 | Ga0307405_10386933 | |||
| 2267 | Ga0307413_10070007 | |||
| 2268 | Ga0307413_10139134 | |||
| 2269 | Ga0307413_10314277 | |||
| 2270 | Ga0307410_10017505 | |||
| 2271 | Ga0307410_10063305 | |||
| 2272 | Ga0307410_10077593 | |||
| 2273 | Ga0307406_10029602 | |||
| 2274 | Ga0307406_10302389 | |||
| 2275 | Ga0307406_10470332 | |||
| 2276 | Ga0307407_10175875 | |||
| 2277 | Ga0307407_10195688 | |||
| 2278 | Ga0307412_10804726 | |||
| 2279 | Ga0307409_100008475 | |||
| 2280 | Ga0307409_100071714 | |||
| 2281 | Ga0307409_100743896 | |||
| 2282 | Ga0307409_100850841 | |||
| 2283 | Ga0307416_100015910 | |||
| 2284 | Ga0307416_100092003 | |||
| 2285 | Ga0307416_100651752 | |||
| 2286 | Ga0307416_101106873 | |||
| 2287 | Ga0307414_10628150 | |||
| 2288 | Ga0307415_100025248 | |||
| 2289 | Ga0307415_100206957 | |||
| 2290 | Ga0307415_100270244 | |||
| 2291 | Ga0307415_100427721 | |||
| 2292 | Ga0316596_1048376 | |||
| 2293 | Ga0373930_0019395 | |||
| 2294 | Ga0373950_0037319 | |||
| 2295 | Ga0373958_0011453 | |||
| 2296 | Ga0373959_0000924 | |||
| 2297 | Ga0373928_0003435 | |||
| 2298 | Ga0373929_0000116 | |||
| 2299 | Ga0373934_0002966 | |||
| 2300 | Ga0373934_0051027 | |||
| 2301 | Ga0373934_0113515 | |||
| 2302 | Ga0373940_0000084 | |||
| 2303 | Ga0373940_0064960 | |||
| 2304 | Ga0373949_0048079 | |||
| 2305 | Ga0373923_0000429 | |||
| 2306 | Ga0373923_0036628 | |||
| 2307 | Ga0373932_0000807 | |||
| 2308 | Ga0373932_0009460 | |||
| 2309 | Ga0373936_0010448 | |||
| 2310 | Ga0373939_0035172 | |||
| 2311 | Ga0373939_0048662 | |||
| 2312 | Ga0373941_0000161 | |||
| 2313 | Ga0373941_0015637 | |||
| 2314 | Ga0373941_0026257 | |||
| 2315 | Ga0373953_0000451 | |||
| 2316 | Ga0373953_0007154 | |||
| 2317 | Ga0373953_0071837 | |||
| 2318 | Ga0373954_0000482 | |||
| 2319 | Ga0373954_0003811 | |||
| 2320 | Ga0373954_0010828 | |||
| 2321 | Ga0373954_0090393 | |||
| 2322 | Ga0373956_0111852 | |||
| 2323 | Ga0373956_0186202 | |||
| 2324 | Ga0373957_0000922 | |||
| 2325 | Ga0373957_0101640 | |||
| 2326 | Ga0373960_0000753 | |||
| 2327 | Ga0373960_0040375 | |||
| 2328 | Ga0373946_0007337 | |||
| 2329 | Ga0373946_0014782 | |||
| 2330 | Ga0373955_0036421 | |||
| 2331 | Ga0373955_0145249 | |||
| 2332 | Ga0373955_0175916 | |||
| 2333 | Ga0373942_0001757 | |||
| 2334 | Ga0373961_0001371 | |||
| 2335 | Ga0373962_0000245 | |||
| 2336 | Ga0373962_0030916 | |||
| 2337 | Ga0373962_0105373 | |||
| 2338 | Ga0373924_0002270 | |||
| 2339 | Ga0373931_0009494 | |||
| 2340 | Ga0373931_0021342 | |||
| 2341 | Ga0373931_0180614 | |||
| 2342 | Ga0373935_0008830 | |||
| 2343 | Ga0373935_0053767 | |||
| 2344 | Ga0373935_0198302 | |||
| 2345 | Ga0373935_0777880 | |||
| 2346 | Ga0373927_0028727 | |||
| 2347 | Ga0373927_0059060 | |||
| 2348 | Ga0373927_0096376 | |||
| 2349 | Ga0373927_0132003 | |||
| 2350 | Ga0373927_0383836 | |||
| 2351 | Ga0373933_0003737 | |||
| 2352 | Ga0373947_0040913 | |||
| 2353 | Ga0373947_0043635 | |||
| 2354 | Ga0373937_0172438 | |||
| 2355 | Ga0373937_0210181 | |||
| 2356 | Ga0373937_0304832 | |||
| 2357 | Ga0373937_0373074 | |||
| 2358 | Ga0373937_0451068 | |||
| 2359 | Ga0373925_0005941 | |||
| 2360 | Ga0373925_0013826 | |||
| 2361 | Ga0373925_0174928 | |||
| 2362 | Ga0395900_0087991 | |||
| 2363 | Ga0395900_0141424 | |||
| 2364 | Ga0395900_0609373 | |||
| 2365 | Ga0395898_0156518 | |||
| 2366 | Ga0395898_0372873 | |||
| 2367 | Ga0395898_0620454 | |||
| 2368 | Ga0395905_0007428 | |||
| 2369 | Ga0395905_0012237 | |||
| 2370 | Ga0395905_0089423 | |||
| 2371 | Ga0395901_0032493 | |||
| 2372 | Ga0395901_0082956 | |||
| 2373 | Ga0395901_0877081 | |||
| 2374 | Ga0436365_0450041 | |||
| 2375 | Ga0436365_0697746 | |||
| 2376 | Ga0436365_1470057 | |||
| 2377 | Ga0436365_1620453 | |||
| 2378 | Ga0436365_1701482 | |||
| 2379 | Ga0436365_1935460 | |||
| 2380 | Ga0436360_0298195 | |||
| 2381 | Ga0436361_0730859 | |||
| 2382 | Ga0436363_0579133 | |||
| 2383 | Ga0436362_0946909 | |||
| 2384 | Ga0436362_1110265 | |||
| 2385 | Ga0439465_0050727 | |||
| 2386 | Ga0451841_0950211 | |||
| 2387 | Ga0451853_0777966 | |||
| 2388 | Ga0439455_0019852 | |||
| 2389 | Ga0450914_003561 | |||
| 2390 | Ga0450890_009528 | |||
| 2391 | Ga0439434_0167228 | |||
| 2392 | Ga0451577_0043475 | |||
| 2393 | Ga0466966_0014585 | |||
| 2394 | Ga0466966_0014913 | |||
| 2395 | Ga0466966_0093533 | |||
| 2396 | Ga0466961_0043541 | |||
| 2397 | Ga0466961_0115997 | |||
| 2398 | Ga0466961_0126535 | |||
| 2399 | Ga0466961_0311672 | |||
| 2400 | Ga0466963_0075586 | |||
| 2401 | Ga0466963_0437133 | |||
| 2402 | Ga0466963_0467393 | |||
| 2403 | Ga0466971_0119745 | |||
| 2404 | Ga0466957_0028757 | |||
| 2405 | Ga0466957_0227246 | |||
| 2406 | Ga0466960_0023207 | |||
| 2407 | Ga0466960_0035450 | |||
| 2408 | Ga0466959_0004261 | |||
| 2409 | Ga0466959_0151285 | |||
| 2410 | Ga0466959_0154099 | |||
| 2411 | Ga0451576_0055322 | |||
| 2412 | Ga0451576_0607998 | |||
| 2413 | Ga0466958_0002151 | |||
| 2414 | Ga0466958_0106918 | |||
| 2415 | Ga0466958_0121180 | |||
| 2416 | Ga0466958_0286919 | |||
| 2417 | Ga0466967_0068175 | |||
| 2418 | Ga0466967_0173578 | |||
| 2419 | Ga0466967_0226821 | |||
| 2420 | Ga0495592_0005638 | |||
| 2421 | Ga0495592_0028405 | |||
| 2422 | Ga0495592_0057907 | |||
| 2423 | Ga0495603_0039205 | |||
| 2424 | Ga0495629_0056581 | |||
| 2425 | Ga0495629_0159455 | |||
| 2426 | Ga0495638_0007730 | |||
| 2427 | Ga0495638_0133888 | |||
| 2428 | Ga0495641_0011057 | |||
| 2429 | Ga0495651_0004143 | |||
| 2430 | Ga0495651_0275165 | |||
| 2431 | Ga0495651_0442956 | |||
| 2432 | Ga0495653_0022129 | |||
| 2433 | Ga0495653_0294093 | |||
| 2434 | Ga0495580_0056214 | |||
| 2435 | Ga0495580_0133111 | |||
| 2436 | Ga0495580_0144381 | |||
| 2437 | Ga0495580_0198094 | |||
| 2438 | Ga0495582_0012275 | |||
| 2439 | Ga0495639_0001960 | |||
| 2440 | Ga0495639_0064911 | |||
| 2441 | Ga0495639_0093691 | |||
| 2442 | Ga0495662_0005450 | |||
| 2443 | Ga0495664_0003933 | |||
| 2444 | Ga0495584_0006905 | |||
| 2445 | Ga0495584_0099387 | |||
| 2446 | Ga0495584_0117331 | |||
| 2447 | Ga0495584_0153742 | |||
| 2448 | Ga0495596_0066806 | |||
| 2449 | Ga0495606_0199980 | |||
| 2450 | Ga0495608_0004188 | |||
| 2451 | Ga0495608_0007931 | |||
| 2452 | Ga0495608_0165211 | |||
| 2453 | Ga0495608_0193755 | |||
| 2454 | Ga0495610_0002336 | |||
| 2455 | Ga0495610_0106718 | |||
| 2456 | Ga0495616_0152174 | |||
| 2457 | Ga0495616_0154130 | |||
| 2458 | Ga0495618_0129668 | |||
| 2459 | Ga0495618_0145861 | |||
| 2460 | Ga0495620_0112262 | |||
| 2461 | Ga0495628_0036325 | |||
| 2462 | Ga0495628_0055686 | |||
| 2463 | Ga0495628_0203839 | |||
| 2464 | Ga0495630_0010900 | |||
| 2465 | Ga0495630_0057928 | |||
| 2466 | Ga0495631_0025969 | |||
| 2467 | Ga0495637_0075167 | |||
| 2468 | Ga0495644_0034036 | |||
| 2469 | Ga0495663_0006675 | |||
| 2470 | Ga0495642_0003089 | |||
| 2471 | Ga0495642_0146980 | |||
| 2472 | Ga0495652_0005494 | |||
| 2473 | Ga0495652_0050149 | |||
| 2474 | Ga0495652_0069819 | |||
| 2475 | Ga0495652_0081707 | |||
| 2476 | Ga0495665_0016354 | |||
| 2477 | Ga0495665_0103663 | |||
| 2478 | Ga0495640_0001806 | |||
| 2479 | Ga0495640_0014075 | |||
| 2480 | Ga0495640_0381402 | |||
| 2481 | Ga0495586_0003635 | |||
| 2482 | Ga0495586_0526242 | |||
| 2483 | Ga0495587_0002077 | |||
| 2484 | Ga0495587_0080839 | |||
| 2485 | Ga0495587_0091248 | |||
| 2486 | Ga0495587_0143446 | |||
| 2487 | Ga0495598_0063529 | |||
| 2488 | Ga0495621_0088457 | |||
| 2489 | Ga0495597_0135444 | |||
| 2490 | Ga0495645_0009908 | |||
| 2491 | Ga0495645_0027506 | |||
| 2492 | Ga0495645_0161506 | |||
| 2493 | Ga0495633_0073145 | |||
| 2494 | Ga0495667_0008752 | |||
| 2495 | Ga0495667_0023465 | |||
| 2496 | Ga0495667_0086457 | |||
| 2497 | Ga0495656_0030020 | |||
| 2498 | Ga0495656_0054523 | |||
| 2499 | Ga0495656_0355547 | |||
| 2500 | Ga0495668_0158961 | |||
| 2501 | Ga0495668_0217988 | |||
| 2502 | Ga0495668_0226306 | |||
| 2503 | Ga0495634_0227969 | |||
| 2504 | Ga0495611_0122721 | |||
| 2505 | Ga0495611_0159904 | |||
| 2506 | Ga0495588_0012687 | |||
| 2507 | Ga0495588_0233903 | |||
| 2508 | Ga0495657_0012725 | |||
| 2509 | Ga0495657_0103606 | |||
| 2510 | Ga0495599_0005317 | |||
| 2511 | Ga0495599_0032803 | |||
| 2512 | Ga0495599_0076546 | |||
| 2513 | Ga0495599_0087336 | |||
| 2514 | Ga0495599_0327801 | |||
| 2515 | Ga0495623_0175936 | |||
| 2516 | Ga0495623_0197658 | |||
| 2517 | Ga0495647_0058460 | |||
| 2518 | Ga0495647_0069026 | |||
| 2519 | Ga0495647_0095748 | |||
| 2520 | Ga0495647_0098992 | |||
| 2521 | Ga0495658_0124747 | |||
| 2522 | Ga0495658_0185194 | |||
| 2523 | Ga0495669_0000560 | |||
| 2524 | Ga0495669_0061694 | |||
| 2525 | Ga0495669_0073388 | |||
| 2526 | Ga0495669_0112861 | |||
| 2527 | Ga0495669_0122884 | |||
| 2528 | Ga0495669_0191115 | |||
| 2529 | Ga0495613_0013985 | |||
| 2530 | Ga0495613_0100399 | |||
| 2531 | Ga0495613_0150801 | |||
| 2532 | Ga0495613_0249178 | |||
| 2533 | Ga0495670_0164303 | |||
| 2534 | Ga0495649_0073198 | |||
| 2535 | Ga0495600_0002947 | |||
| 2536 | Ga0495581_0091051 | |||
| 2537 | Ga0495604_0006828 | |||
| 2538 | Ga0495604_0133762 | |||
| 2539 | Ga0495636_0001627 | |||
| 2540 | Ga0495636_0108087 | |||
| 2541 | Ga0495674_0005220 | |||
| 2542 | Ga0495674_0044746 | |||
| 2543 | Ga0495674_0099319 | |||
| 2544 | Ga0495672_0012941 | |||
| 2545 | Ga0495672_0068280 | |||
| 2546 | Ga0495676_0075687 | |||
| 2547 | Ga0495676_0198730 | |||
| 2548 | Ga0495680_0011364 | |||
| 2549 | Ga0495680_0084304 | |||
| 2550 | Ga0495680_0218492 | |||
| 2551 | Ga0495683_0128288 | |||
| 2552 | Ga0495675_0018560 | |||
| 2553 | Ga0495685_039324 | |||
| 2554 | Ga0495673_0072452 | |||
| 2555 | Ga0495673_0163128 | |||
| 2556 | Ga0495684_0009393 | |||
| 2557 | Ga0495684_0012445 | |||
| 2558 | Ga0495686_0091685 | |||
| 2559 | Ga0495602_0215107 | |||
| 2560 | Ga0495602_0295325 | |||
| 2561 | Ga0496100_0004796 | |||
| 2562 | Ga0496100_0006135 | |||
| 2563 | Ga0496100_0057191 | |||
| 2564 | Ga0496100_0291498 | |||
| 2565 | Ga0496101_0000396 | |||
| 2566 | Ga0496101_0091436 | |||
| 2567 | Ga0496101_0145159 | |||
| 2568 | Ga0496101_0257300 | |||
| 2569 | Ga0496101_0306051 | |||
| 2570 | Ga0496101_0327649 | |||
| 2571 | Ga0496101_0611376 | |||
| 2572 | Ga0496102_0008904 | |||
| 2573 | Ga0496102_0023775 | |||
| 2574 | Ga0496102_0186737 | |||
| 2575 | Ga0496102_0421928 | |||
| 2576 | Ga0496102_0749962 | |||
| 2577 | Ga0496103_0047199 | |||
| 2578 | Ga0496103_0078931 | |||
| 2579 | Ga0496103_0103504 | |||
| 2580 | Ga0496103_0164392 | |||
| 2581 | Ga0496103_0324263 | |||
| 2582 | Ga0496104_0017385 | |||
| 2583 | Ga0496104_0022306 | |||
| 2584 | Ga0496104_0051414 | |||
| 2585 | Ga0496104_0076019 | |||
| 2586 | Ga0496104_0096967 | |||
| 2587 | Ga0496104_0351678 | |||
| 2588 | Ga0496104_0691205 | |||
| 2589 | Ga0496105_0005725 | |||
| 2590 | Ga0496105_0114894 | |||
| 2591 | Ga0496105_0117251 | |||
| 2592 | Ga0496105_0268131 | |||
| 2593 | Ga0496105_0410374 | |||
| 2594 | Ga0496105_0437957 | |||
| 2595 | Ga0496106_0050105 | |||
| 2596 | Ga0496106_0318361 | |||
| 2597 | Ga0496106_0363627 | |||
| 2598 | Ga0496106_0483966 | |||
| 2599 | Ga0496107_0010686 | |||
| 2600 | Ga0496107_0028952 | |||
| 2601 | Ga0496107_0113730 | |||
| 2602 | Ga0496107_0650031 | |||
| 2603 | Ga0496108_0036186 | |||
| 2604 | Ga0496108_0401150 | |||
| 2605 | Ga0496109_0024415 | |||
| 2606 | Ga0496109_0171156 | |||
| 2607 | Ga0496109_0561392 | |||
| 2608 | Ga0496109_0708872 | |||
| 2609 | Ga0496110_0082246 | |||
| 2610 | Ga0496110_0088473 | |||
| 2611 | Ga0496110_0168247 | |||
| 2612 | Ga0496111_0024319 | |||
| 2613 | Ga0496111_0055372 | |||
| 2614 | Ga0496111_0123300 | |||
| 2615 | Ga0496112_0000021 | |||
| 2616 | Ga0496112_0016237 | |||
| 2617 | Ga0496112_0029065 | |||
| 2618 | Ga0496112_0162779 | |||
| 2619 | Ga0496112_0255816 | |||
| 2620 | Ga0496112_0295914 | |||
| 2621 | Ga0496112_0388942 | |||
| 2622 | Ga0496112_0417381 | |||
| 2623 | Ga0496113_0032056 | |||
| 2624 | Ga0496113_0231267 | |||
| 2625 | Ga0496114_0000246 | |||
| 2626 | Ga0496114_0059095 | |||
| 2627 | Ga0496114_0111094 | |||
| 2628 | Ga0496114_0148509 | |||
| 2629 | Ga0496114_0168207 | |||
| 2630 | Ga0496114_0288243 | |||
| 2631 | Ga0496114_0623350 | |||
| 2632 | Ga0496114_0837761 | |||
| 2633 | Ga0496115_0025980 | |||
| 2634 | Ga0496115_0038310 | |||
| 2635 | Ga0496115_0076504 | |||
| 2636 | Ga0496115_0132538 | |||
| 2637 | Ga0496116_0003008 | |||
| 2638 | Ga0496116_0150275 | |||
| 2639 | Ga0496117_0076188 | |||
| 2640 | Ga0496117_0214415 | |||
| 2641 | Ga0496118_0075512 | |||
| 2642 | Ga0496118_0179456 | |||
| 2643 | Ga0496119_0000469 | |||
| 2644 | Ga0496119_0000855 | |||
| 2645 | Ga0496119_0119768 | |||
| 2646 | Ga0496120_0000372 | |||
| 2647 | Ga0496120_0001942 | |||
| 2648 | Ga0496121_0066731 | |||
| 2649 | Ga0496122_0025808 | |||
| 2650 | Ga0496122_0147325 | |||
| 2651 | Ga0496123_0145460 | |||
| 2652 | Ga0496123_0196005 | |||
| 2653 | Ga0496123_0269995 | |||
| 2654 | Ga0496124_0000697 | |||
| 2655 | Ga0496124_0023250 | |||
| 2656 | Ga0496125_0050981 | |||
| 2657 | Ga0496125_0075979 | |||
| 2658 | Ga0496125_0084741 | |||
| 2659 | Ga0496125_0175500 | |||
| 2660 | Ga0496126_0024730 | |||
| 2661 | Ga0496126_0039091 | |||
| 2662 | Ga0496126_0131756 | |||
| 2663 | Ga0496126_0221452 | |||
| 2664 | Ga0501306_000191 | |||
| 2665 | Ga0501309_005550 | |||
| 2666 | Ga0501343_001886 | |||
| 2667 | Ga0501305_001225 | |||
| 2668 | Ga0501312_000027 | |||
| 2669 | Ga0501313_006374 | |||
| 2670 | Ga0501315_001573 | |||
| 2671 | Ga0501316_000050 | |||
| 2672 | Ga0501317_020591 | |||
| 2673 | Ga0501318_008883 | |||
| 2674 | Ga0501321_000062 | |||
| 2675 | Ga0501323_006864 | |||
| 2676 | Ga0501323_009825 | |||
| 2677 | Ga0501324_000425 | |||
| 2678 | Ga0501330_001473 | |||
| 2679 | Ga0501331_00589 | |||
| 2680 | Ga0501334_00263 | |||
| 2681 | Ga0501335_002359 | |||
| 2682 | Ga0501337_000411 | |||
| 2683 | Ga0501031_0026834 | |||
| 2684 | Ga0501032_0157219 | |||
| 2685 | Ga0501033_0020411 | |||
| 2686 | Ga0501036_0000860 | |||
| 2687 | Ga0501036_0002708 | |||
| 2688 | Ga0501036_0812469 | |||
| 2689 | Ga0501037_0140123 | |||
| 2690 | Ga0501037_0159544 | |||
| 2691 | Ga0501038_0001811 | |||
| 2692 | Ga0501038_0136222 | |||
| 2693 | Ga0501038_0140860 | |||
| 2694 | Ga0501038_0471655 | |||
| 2695 | Ga0501039_0001335 | |||
| 2696 | Ga0501039_0099511 | |||
| 2697 | Ga0501040_0011405 | |||
| 2698 | Ga0501040_0209109 | |||
| 2699 | Ga0501040_0217457 | |||
| 2700 | Ga0501042_0000788 | |||
| 2701 | Ga0501042_0000948 | |||
| 2702 | Ga0501042_0030263 | |||
| 2703 | Ga0501042_0309490 | |||
| 2704 | Ga0501046_0013103 | |||
| 2705 | Ga0501046_0072436 | |||
| 2706 | Ga0501046_0081548 | |||
| 2707 | Ga0501046_0254330 | |||
| 2708 | Ga0501047_0495817 | |||
| 2709 | Ga0501048_0010899 | |||
| 2710 | Ga0501048_0126860 | |||
| 2711 | Ga0501067_0316826 | |||
| 2712 | Ga0501068_0008573 | |||
| 2713 | Ga0501068_0285823 | |||
| 2714 | Ga0501068_0356357 | |||
| 2715 | Ga0501069_0120845 | |||
| 2716 | Ga0501069_0250475 | |||
| 2717 | Ga0501069_0394380 | |||
| 2718 | Ga0501070_0046253 | |||
| 2719 | Ga0501070_0176515 | |||
| 2720 | Ga0501071_0000849 | |||
| 2721 | Ga0501071_0017192 | |||
| 2722 | Ga0501071_0267403 | |||
| 2723 | Ga0501071_0327320 | |||
| 2724 | Ga0501072_0003324 | |||
| 2725 | Ga0501072_0005776 | |||
| 2726 | Ga0501072_0015507 | |||
| 2727 | Ga0501072_0104806 | |||
| 2728 | Ga0501072_0390925 | |||
| 2729 | Ga0501073_0030743 | |||
| 2730 | Ga0501073_0123746 | |||
| 2731 | Ga0501073_0217775 | |||
| 2732 | Ga0501074_0003006 | |||
| 2733 | Ga0501074_0030693 | |||
| 2734 | Ga0501074_0121731 | |||
| 2735 | Ga0501075_0001033 | |||
| 2736 | Ga0501075_0001990 | |||
| 2737 | Ga0501075_0062695 | |||
| 2738 | Ga0501075_0127092 | |||
| 2739 | Ga0501075_0193300 | |||
| 2740 | Ga0501075_0296467 | |||
| 2741 | Ga0501075_0471046 | |||
| 2742 | Ga0501076_0000979 | |||
| 2743 | Ga0501076_0007813 | |||
| 2744 | Ga0501076_0083902 | |||
| 2745 | Ga0501076_0167771 | |||
| 2746 | Ga0501076_0300849 | |||
| 2747 | Ga0501076_0837691 | |||
| 2748 | Ga0501077_0047329 | |||
| 2749 | Ga0501077_0116299 | |||
| 2750 | Ga0501077_0183440 | |||
| 2751 | Ga0501077_0211487 | |||
| 2752 | Ga0501079_0001475 | |||
| 2753 | Ga0501079_0006844 | |||
| 2754 | Ga0501079_0029406 | |||
| 2755 | Ga0501079_0155940 | |||
| 2756 | Ga0501079_0185343 | |||
| 2757 | Ga0501079_0208772 | |||
| 2758 | Ga0501080_0001334 | |||
| 2759 | Ga0501080_0056648 | |||
| 2760 | Ga0501081_0001239 | |||
| 2761 | Ga0501081_0002378 | |||
| 2762 | Ga0501081_0038071 | |||
| 2763 | Ga0501081_0167681 | |||
| 2764 | Ga0501083_0023121 | |||
| 2765 | Ga0501083_0055182 | |||
| 2766 | Ga0501083_0101198 | |||
| 2767 | Ga0501083_0145723 | |||
| 2768 | Ga0501279_004537 | |||
| 2769 | Ga0501035_0029667 | |||
| 2770 | Ga0501044_0479138 | |||
| 2771 | Ga0501044_0660016 | |||
| 2772 | Ga0501045_0000682 | |||
| 2773 | Ga0501045_0046088 | |||
| 2774 | Ga0501045_0054025 | |||
| 2775 | Ga0501045_0084069 | |||
| 2776 | Ga0501045_0201880 | |||
| 2777 | nmdc:mga03n38_108690_c1 | |||
| 2778 | nmdc:mga03n38_60592_c1 | |||
| 2779 | nmdc:mga00v17_105905_c1 | |||
| 2780 | nmdc:mga00v17_371009_c1 | |||
| 2781 | nmdc:mga00v17_94313_c1 | |||
| 2782 | nmdc:mga0yw44_270499_c1 | |||
| 2783 | nmdc:mga0yw44_36883_c1 | |||
| 2784 | nmdc:mga0yw44_70411_c1 | |||
| 2785 | nmdc:mga0k408_1106_c1 | |||
| 2786 | nmdc:mga0k408_259294_c1 | |||
| 2787 | nmdc:mga06z11_24896_c1 | |||
| 2788 | nmdc:mga06z11_60721_c1 | |||
| 2789 | nmdc:mga04h51_35660_c1 | |||
| 2790 | nmdc:mga07m45_201586_c1 | |||
| 2791 | nmdc:mga07m45_63339_c1 | |||
| 2792 | nmdc:mga05p37_13622_c1 | |||
| 2793 | nmdc:mga05p37_16973_c1 | |||
| 2794 | nmdc:mga05p37_202056_c1 | |||
| 2795 | nmdc:mga05p37_20610_c1 | |||
| 2796 | nmdc:mga05p37_246472_c1 | |||
| 2797 | nmdc:mga05p37_25099_c1 | |||
| 2798 | nmdc:mga05p37_3048_c1 | |||
| 2799 | nmdc:mga05p37_306353_c1 | |||
| 2800 | nmdc:mga05p37_3121_c1 | |||
| 2801 | nmdc:mga05p37_46662_c1 | |||
| 2802 | nmdc:mga05p37_595_c1 | |||
| 2803 | nmdc:mga05p37_613385_c1 | |||
| 2804 | nmdc:mga05p37_75038_c1 | |||
| 2805 | nmdc:mga05p37_84346_c1 | |||
| 2806 | nmdc:mga05p37_88852_c1 | |||
| 2807 | nmdc:mga09592_110445_c1 | |||
| 2808 | nmdc:mga09592_13724_c1 | |||
| 2809 | nmdc:mga09592_255574_c1 | |||
| 2810 | nmdc:mga09592_388521_c1 | |||
| 2811 | nmdc:mga09592_462264_c1 | |||
| 2812 | nmdc:mga09592_7943_c1 | |||
| 2813 | nmdc:mga0qj67_24449_c1 | |||
| 2814 | nmdc:mga0qj67_420840_c1 | |||
| 2815 | nmdc:mga0qj67_5121_c1 | |||
| 2816 | nmdc:mga0qj67_610644_c1 | |||
| 2817 | nmdc:mga06r32_350562_c1 | |||
| 2818 | nmdc:mga06r32_51901_c1 | |||
| 2819 | nmdc:mga06r32_545174_c1 | |||
| 2820 | nmdc:mga06r32_649826_c1 | |||
| 2821 | nmdc:mga06r32_86458_c1 | |||
| 2822 | nmdc:mga08y16_169354_c1 | |||
| 2823 | nmdc:mga08y16_17177_c1 | |||
| 2824 | nmdc:mga08y16_236383_c1 | |||
| 2825 | nmdc:mga08y16_371187_c1 | |||
| 2826 | nmdc:mga08y16_399570_c1 | |||
| 2827 | nmdc:mga08y16_4339_c1 | |||
| 2828 | nmdc:mga08y16_517196_c1 | |||
| 2829 | nmdc:mga08y16_927899_c1 | |||
| 2830 | nmdc:mga0n895_1001604_c1 | |||
| 2831 | nmdc:mga0n895_142639_c1 | |||
| 2832 | nmdc:mga0n895_17757_c1 | |||
| 2833 | nmdc:mga0n895_27160_c1 | |||
| 2834 | nmdc:mga0n895_602462_c1 | |||
| 2835 | nmdc:mga0n895_7101_c1 | |||
| 2836 | nmdc:mga0rr50_149780_c1 | |||
| 2837 | nmdc:mga0rr50_21352_c1 | |||
| 2838 | nmdc:mga0rr50_2205_c1 | |||
| 2839 | nmdc:mga0rr50_373_c1 | |||
| 2840 | nmdc:mga0rr50_39611_c1 | |||
| 2841 | nmdc:mga0rr50_60229_c1 | |||
| 2842 | nmdc:mga08x19_22597_c1 | |||
| 2843 | nmdc:mga08x19_34220_c1 | |||
| 2844 | nmdc:mga08x19_632680_c1 | |||
| 2845 | nmdc:mga08x19_90727_c1 | |||
| 2846 | nmdc:mga0a205_10346_c1 | |||
| 2847 | nmdc:mga0a205_106213_c1 | |||
| 2848 | nmdc:mga0a205_47564_c1 | |||
| 2849 | nmdc:mga0a205_608134_c1 | |||
| 2850 | nmdc:mga0a205_6655_c1 | |||
| 2851 | nmdc:mga0a205_72605_c1 | |||
| 2852 | nmdc:mga0a205_929598_c1 | |||
| 2853 | nmdc:mga0sz30_129744_c1 | |||
| 2854 | Ga0495601_0002901 | |||
| 2855 | Ga0495601_0028459 | |||
| 2856 | Ga0495601_0164829 | |||
| 2857 | Ga0495612_0202295 | |||
| 2858 | Ga0500610_0104299 | |||
| 2859 | Ga0500610_0111281 | |||
| 2860 | Ga0495655_0010860 | |||
| 2861 | Ga0495655_0026693 | |||
| 2862 | Ga0495655_0066699 | |||
| 2863 | Ga0495595_0001331 | |||
| 2864 | Ga0495595_0072896 | |||
| 2865 | Ga0495619_0004075 | |||
| 2866 | Ga0495619_0004232 | |||
| 2867 | Ga0495619_0010190 | |||
| 2868 | Ga0495619_0144447 | |||
| 2869 | Ga0495619_0161747 | |||
| 2870 | Ga0500646_0060290 | |||
| 2871 | Ga0500651_0004275 | |||
| 2872 | Ga0500651_0226764 | |||
| 2873 | Ga0500566_0018854 | |||
| 2874 | Ga0500641_0007395 | |||
| 2875 | Ga0500556_0082237 | |||
| 2876 | Ga0500595_001142 | |||
| 2877 | Ga0500595_008139 | |||
| 2878 | Ga0500595_009814 | |||
| 2879 | Ga0500607_017101 | |||
| 2880 | Ga0500608_077661 | |||
| 2881 | Ga0500618_009735 | |||
| 2882 | Ga0500642_0001169 | |||
| 2883 | Ga0500642_0097290 | |||
| 2884 | Ga0500655_000265 | |||
| 2885 | Ga0500559_0002179 | |||
| 2886 | Ga0500559_0034952 | |||
| 2887 | Ga0500559_0077114 | |||
| 2888 | Ga0500568_0006975 | |||
| 2889 | Ga0500568_0017398 | |||
| 2890 | Ga0500588_0014706 | |||
| 2891 | Ga0500589_108869 | |||
| 2892 | Ga0500590_004805 | |||
| 2893 | Ga0500622_0012750 | |||
| 2894 | Ga0500639_055045 | |||
| 2895 | Ga0500636_0039323 | |||
| 2896 | Ga0500636_0045197 | |||
| 2897 | Ga0500637_0004731 | |||
| 2898 | Ga0500570_032123 | |||
| 2899 | Ga0500645_004711 | |||
| 2900 | Ga0501084_0000677 | |||
| 2901 | Ga0501084_0004051 | |||
| 2902 | Ga0501084_0084348 | |||
| 2903 | Ga0501084_0176773 | |||
| 2904 | Ga0501084_1136244 | |||
| 2905 | Ga0500661_006321 | |||
| 2906 | Ga0590071_000185 | |||
| 2907 | Ga0590071_055211 | |||
| 2908 | Ga0590074_015090 | |||
| 2909 | Ga0590075_000204 | |||
| 2910 | Ga0590075_035646 | |||
| 2911 | Ga0590077_020629 | |||
| 2912 | Ga0587067_002632 | |||
| 2913 | Ga0587067_018834 | |||
| 2914 | Ga0587072_000329 | |||
| 2915 | Ga0587072_024465 | |||
| 2916 | Ga0501082_0002099 | |||
| 2917 | Ga0501082_0002693 | |||
| 2918 | Ga0501082_0025899 | |||
| 2919 | Ga0501082_0100518 | |||
| 2920 | Ga0501082_0200131 | |||
| 2921 | Ga0501082_0205454 | |||
| 2922 | Ga0501082_0246512 | |||
| 2923 | Ga0501082_1048034 | |||
| 2924 | Ga0530510_0001293 | |||
| 2925 | Ga0530510_0009637 | |||
| 2926 | Ga0530510_0058439 | |||
| 2927 | 2528204309 | |||
| 2928 | 2528212121 | |||
| 2929 | 2546946880 | |||
| 2930 | 2563930209 | |||
| 2931 | 2579747611 | |||
| 2932 | 2643738859 | |||
| 2933 | 2673167462 | |||
| 2934 | 2686543605 | |||
| 2935 | 2710602541 | |||
| 2936 | 2774867002 | |||
| 2937 | 2774902886 | |||
| 2938 | 2821118338 | |||
| 2939 | 2864738854 | |||
| 2940 | 2876810452 | |||
| 2941 | 2885529898 | |||
| 2942 | 2889047992 | |||
| 2943 | 2902335199 | |||
| 2944 | 2904168171 | |||
| 2945 | 2904496932 | |||
| 2946 | 2907208182 | |||
| 2947 | 2919166265 | |||
| 2948 | 2931385098 | |||
| 2949 | 2939685140 | |||
| 2950 | 2945996279 | |||
| 2951 | 2946058969 | |||
| 2952 | 637877936 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c9y-assembly1.cif.gz_A | structure of human adenylate kinase 2 | 0.8872 | 1 | 208 |
| 4np6-assembly1.cif.gz_B | crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor | 0.8796 | 1 | 207 |
| 2c9y-assembly1.cif.gz_A | structure of human adenylate kinase 2 | 0.8793 | 1 | 208 |
| 6s36-assembly1.cif.gz_A | crystal structure of e. coli adenylate kinase r119k mutant | 0.8755 | 1 | 207 |
| 2ak2-assembly1.cif.gz_A | adenylate kinase isoenzyme-2 | 0.8709 | 1 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D4A2_1_210_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8961 | 1 | 209 | 3.40.50.300 |
| af_A4I9I1_1_215_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8849 | 2 | 208 | 3.40.50.300 |
| af_Q4D4A2_1_210_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8761 | 1 | 209 | 3.40.50.300 |
| 1ak2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8667 | 1 | 205 | 3.40.50.300 |
| 3umfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8654 | 1 | 208 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A662SQD8-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9736 | 75 | 208 |
GO:0004017
GO:0005524 GO:0005737 |
| AF-A0A202DNJ0-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9731 | 87 | 208 |
GO:0004017
GO:0005524 GO:0005737 |
| AF-A0A6J6C4P5-F1-model_v4 | Unannotated protein | 0.96 | 63 | 205 |
GO:0004017
GO:0005524 GO:0005737 |
| AF-A0A3D3ZGD8-F1-model_v4 | deleted | 0.9544 | 84 | 207 |
|
| AF-A0A3D0HM98-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9543 | 78 | 207 |
GO:0004017
GO:0005524 GO:0005737 |