F494243

General Info

Members Datasets Scaffolds Average Seq Length
1476 543 2952 218

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100016422|Ga0070694_1000164227
Length 266
Sequence MALNLIMLGPPGAGKGTQAERFARTRGIPRISTGDILRDAVHEGTEIGKRAKAIMDRGELVGDDVMIGIVQERLDRPDAAGGFVLEGFPRTVAQATALDRIMTGRDPLIVVDIAVPETELVRRLAWRLICEVCGANAAMEDLGDGAPGVDGADRVVLPGANANAPETIAAVRAIAEPHRCRRCGGRLVQRSDDNDAIVRERLKVYQRQSEPLVEFYRERPTFRSISGAQPPDRVAADLTAAVEAAVARPPVGTRVVPGKARSGAQS

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
106 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
149 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
150 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
225 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
226 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
229 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
237 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
238 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
239 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
240 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
241 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
244 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
245 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
246 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
247 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
248 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
255 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
256 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
257 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
258 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
259 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
260 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
262 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
263 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
264 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
265 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
266 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
267 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
268 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
269 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
270 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
271 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
272 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
274 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
275 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
276 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
277 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
278 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
279 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
280 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
281 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
282 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
283 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
284 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
285 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
286 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
287 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
289 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
290 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
291 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
292 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
293 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
294 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
295 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
296 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
297 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
298 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
299 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
300 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
301 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
302 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
303 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
304 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
305 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
306 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
307 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
308 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
309 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
310 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
311 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
312 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
313 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
314 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
317 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
318 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
319 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
320 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
321 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
322 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
323 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
324 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
325 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
326 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
327 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
328 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
333 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
334 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
335 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
336 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
337 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
338 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
339 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
340 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
341 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
342 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
343 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
344 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
345 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
346 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
347 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
348 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
349 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
350 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
351 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
352 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
353 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
354 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
355 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
358 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
359 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
360 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
361 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
362 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
363 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
364 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
365 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
366 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
369 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
370 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
371 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
372 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
373 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
374 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
375 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
376 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
377 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
378 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
379 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
380 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
381 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
382 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
383 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
384 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
385 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
386 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
387 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
388 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
389 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
390 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
391 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
392 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
393 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
394 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
395 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
396 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
399 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
407 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
408 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
409 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
410 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
411 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
412 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
413 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
414 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
456 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
457 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
465 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
466 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
472 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
473 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
474 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
475 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
476 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
477 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
482 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
483 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
484 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
485 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
486 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
487 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
488 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
489 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
490 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
491 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
492 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
493 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
494 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
495 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
496 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
497 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
498 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
499 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
500 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
501 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
502 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
503 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
504 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
505 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
506 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
507 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
508 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
509 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
510 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
511 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
512 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
513 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
514 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
517 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
518 2527291627 Frankia casuarinae Thr Isolate Nodule
519 2527291629 Frankia sp. BMG5.23 Isolate Nodule
520 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
521 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
522 2576861822 Frankia sp. CeD Isolate Nodule
523 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
524 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
525 2684623036 Frankia sp. CgIM4 Isolate Nodule
526 2710264753 Frankia sp. KB5 Isolate Nodule
527 2773857924 Frankia sp. CgIS1 Isolate Nodule
528 2773857933 Frankia sp. BMG5.30 Isolate Nodule
529 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
530 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
531 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
532 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
533 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
534 2902330777 Methylobacterium sp. 2A Isolate Unclassified
535 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
536 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
537 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
538 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
539 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
540 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
541 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
542 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
543 637000116 Frankia casuarinae CcI3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 2.24
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0.81
Rhizoplane 5.22
Rhizosphere 85.03
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100016422 3300005444 Bacteria 4660
2 JGI25162J39368_1009314 3300002737 Bacteria 1323
3 JGI25151J46595_10028272 3300003187 Bacteria 2235
4 JGI25407J50210_10043710 3300003373 Bacteria 1144
5 Ga0055538_1000286 3300003751 Bacteria 25743
6 Ga0055531_10022595 3300003794 Bacteria 2391
7 Ga0065712_10010472 3300005290 Bacteria 2496
8 Ga0065715_10004682 3300005293 Bacteria 3980
9 Ga0065715_10138461 3300005293 Bacteria 1880
10 Ga0065707_10004657 3300005295 Bacteria 4532
11 Ga0065707_10305482 3300005295 Bacteria 983
12 Ga0070658_10000172 3300005327 Bacteria 56478
13 Ga0070658_10118295 3300005327 Bacteria 2200
14 Ga0070676_10010331 3300005328 Bacteria 5064
15 Ga0070676_10017267 3300005328 Bacteria 3994
16 Ga0070676_10064218 3300005328 Bacteria 2188
17 Ga0070676_10303732 3300005328 Bacteria 1083
18 Ga0070683_100334615 3300005329 Bacteria 1442
19 Ga0070683_100377411 3300005329 Bacteria 1351
20 Ga0070683_100828082 3300005329 Bacteria 887
21 Ga0070690_100006534 3300005330 Bacteria 6617
22 Ga0070690_100196991 3300005330 Bacteria 1400
23 Ga0070670_100082822 3300005331 Bacteria 2757
24 Ga0070677_10098834 3300005333 Bacteria 1283
25 Ga0070677_10151331 3300005333 Bacteria 1080
26 Ga0068869_100162850 3300005334 Bacteria 1737
27 Ga0068869_100163409 3300005334 Bacteria 1735
28 Ga0068869_100169508 3300005334 Bacteria 1705
29 Ga0068869_100188225 3300005334 Bacteria 1622
30 Ga0068869_100310801 3300005334 Bacteria 1275
31 Ga0068869_100414370 3300005334 Bacteria 1110
32 Ga0070666_10007809 3300005335 Bacteria 6607
33 Ga0070666_10356367 3300005335 Bacteria 1047
34 Ga0070680_100073734 3300005336 Bacteria 2808
35 Ga0070680_100136701 3300005336 Bacteria 2053
36 Ga0070680_100154450 3300005336 Bacteria 1927
37 Ga0070680_100233985 3300005336 Bacteria 1552
38 Ga0068868_100081704 3300005338 Bacteria 2591
39 Ga0068868_100221694 3300005338 Bacteria 1583
40 Ga0068868_100599576 3300005338 Bacteria 976
41 Ga0070660_100002987 3300005339 Bacteria 11642
42 Ga0070660_100007791 3300005339 Bacteria 7468
43 Ga0070660_100230165 3300005339 Bacteria 1508
44 Ga0070660_100267782 3300005339 Bacteria 1396
45 Ga0070660_100312906 3300005339 Bacteria 1289
46 Ga0070689_100064561 3300005340 Bacteria 2850
47 Ga0070689_100111866 3300005340 Bacteria 2173
48 Ga0070689_100118410 3300005340 Bacteria 2113
49 Ga0070691_10421015 3300005341 Bacteria 757
50 Ga0070687_100012998 3300005343 Bacteria 3696
51 Ga0070687_100030822 3300005343 Bacteria 2625
52 Ga0070687_100076243 3300005343 Bacteria 1816
53 Ga0070661_100195221 3300005344 Bacteria 1545
54 Ga0070661_100343556 3300005344 Bacteria 1170
55 Ga0070668_100000831 3300005347 Bacteria 21324
56 Ga0070668_100098740 3300005347 Bacteria 2311
57 Ga0070668_100108161 3300005347 Bacteria 2211
58 Ga0070668_100161136 3300005347 Bacteria 1820
59 Ga0070668_100206942 3300005347 Bacteria 1612
60 Ga0070668_100603160 3300005347 Bacteria 961
61 Ga0070669_100035389 3300005353 Bacteria 3617
62 Ga0070675_100000056 3300005354 Bacteria 66985
63 Ga0070675_100004703 3300005354 Bacteria 10420
64 Ga0070675_100401556 3300005354 Bacteria 1223
65 Ga0070675_100442461 3300005354 Bacteria 1165
66 Ga0070671_100024169 3300005355 Bacteria 4973
67 Ga0070671_100096780 3300005355 Bacteria 2475
68 Ga0070671_100260964 3300005355 Bacteria 1472
69 Ga0070671_100395569 3300005355 Bacteria 1182
70 Ga0070671_100453285 3300005355 Bacteria 1101
71 Ga0070671_100893792 3300005355 Bacteria 776
72 Ga0070674_100050917 3300005356 Bacteria 2852
73 Ga0070674_100118101 3300005356 Bacteria 1959
74 Ga0070674_100192087 3300005356 Bacteria 1571
75 Ga0070674_100208681 3300005356 Bacteria 1512
76 Ga0070674_100371545 3300005356 Bacteria 1161
77 Ga0070673_100003427 3300005364 Bacteria 9877
78 Ga0070673_100173677 3300005364 Bacteria 1841
79 Ga0070673_100324956 3300005364 Bacteria 1360
80 Ga0070673_100387519 3300005364 Bacteria 1247
81 Ga0070673_100966862 3300005364 Unclassified 792
82 Ga0070688_100070904 3300005365 Bacteria 2229
83 Ga0070688_100225636 3300005365 Bacteria 1323
84 Ga0070688_100239703 3300005365 Bacteria 1286
85 Ga0070659_100059884 3300005366 Bacteria 3007
86 Ga0070659_100300889 3300005366 Bacteria 1338
87 Ga0070667_100172226 3300005367 Bacteria 1911
88 Ga0070703_10227179 3300005406 Bacteria 746
89 Ga0070709_10004324 3300005434 Bacteria 7659
90 Ga0070709_10143061 3300005434 Bacteria 1645
91 Ga0070709_10694899 3300005434 Bacteria 791
92 Ga0070714_100282011 3300005435 Bacteria 1544
93 Ga0070714_100389823 3300005435 Bacteria 1315
94 Ga0070714_100505011 3300005435 Bacteria 1153
95 Ga0070714_100651634 3300005435 Bacteria 1014
96 Ga0070713_100000161 3300005436 Bacteria 45444
97 Ga0070713_100025501 3300005436 Bacteria 4622
98 Ga0070713_100025646 3300005436 Bacteria 4613
99 Ga0070713_100138736 3300005436 Bacteria 2151
100 Ga0070713_100176408 3300005436 Bacteria 1918
101 Ga0070710_10001033 3300005437 Bacteria 13226
102 Ga0070710_10009605 3300005437 Bacteria 4737
103 Ga0070701_10094219 3300005438 Bacteria 1647
104 Ga0070711_100297575 3300005439 Bacteria 1282
105 Ga0070711_100511941 3300005439 Bacteria 991
106 Ga0070705_100008402 3300005440 Bacteria 5115
107 Ga0070705_100492435 3300005440 Bacteria 929
108 Ga0070705_100732606 3300005440 Bacteria 780
109 Ga0070700_100040018 3300005441 Bacteria 2867
110 Ga0070700_100041014 3300005441 Bacteria 2836
111 Ga0070700_100223853 3300005441 Bacteria 1335
112 Ga0070708_100010139 3300005445 Bacteria 7624
113 Ga0070708_100028126 3300005445 Bacteria 4834
114 Ga0070708_100259760 3300005445 Bacteria 1633
115 Ga0070708_100725669 3300005445 Bacteria 935
116 Ga0070663_100239507 3300005455 Bacteria 1431
117 Ga0070678_100027149 3300005456 Bacteria 3883
118 Ga0070678_100120735 3300005456 Bacteria 2066
119 Ga0070678_100379642 3300005456 Bacteria 1222
120 Ga0070678_100483707 3300005456 Bacteria 1090
121 Ga0070662_100170816 3300005457 Bacteria 1707
122 Ga0070662_100224409 3300005457 Bacteria 1500
123 Ga0070662_100283201 3300005457 Bacteria 1342
124 Ga0070662_100336558 3300005457 Bacteria 1234
125 Ga0070662_100514343 3300005457 Bacteria 1000
126 Ga0070681_10018722 3300005458 Bacteria 6929
127 Ga0070681_10042357 3300005458 Bacteria 4563
128 Ga0070681_10047185 3300005458 Bacteria 4306
129 Ga0070681_10122730 3300005458 Bacteria 2531
130 Ga0070681_10579647 3300005458 Bacteria 1036
131 Ga0068867_100223195 3300005459 Bacteria 1519
132 Ga0068867_100420557 3300005459 Bacteria 1132
133 Ga0068867_100505350 3300005459 Bacteria 1040
134 Ga0070685_10071840 3300005466 Bacteria 2052
135 Ga0070706_100052012 3300005467 Bacteria 3782
136 Ga0070706_100994669 3300005467 Unclassified 773
137 Ga0070707_100119560 3300005468 Bacteria 2558
138 Ga0070707_100174339 3300005468 Bacteria 2096
139 Ga0070707_100463032 3300005468 Bacteria 1229
140 Ga0070707_100579001 3300005468 Bacteria 1085
141 Ga0070698_100042981 3300005471 Bacteria 4634
142 Ga0070698_100063884 3300005471 Bacteria 3711
143 Ga0070698_100114045 3300005471 Bacteria 2667
144 Ga0070698_100247677 3300005471 Bacteria 1715
145 Ga0070699_100006991 3300005518 Bacteria 9807
146 Ga0070699_100042746 3300005518 Bacteria 3922
147 Ga0070699_100182694 3300005518 Bacteria 1862
148 Ga0070699_100198658 3300005518 Bacteria 1783
149 Ga0070699_100522629 3300005518 Bacteria 1079
150 Ga0070679_100044653 3300005530 Bacteria 4415
151 Ga0070679_100087883 3300005530 Bacteria 3096
152 Ga0070679_100124874 3300005530 Bacteria 2557
153 Ga0070679_100325809 3300005530 Bacteria 1485
154 Ga0070679_100443557 3300005530 Bacteria 1243
155 Ga0070684_100100706 3300005535 Bacteria 2580
156 Ga0070684_100148186 3300005535 Bacteria 2125
157 Ga0070684_100716926 3300005535 Bacteria 933
158 Ga0070697_100022127 3300005536 Bacteria 5044
159 Ga0070697_100327097 3300005536 Bacteria 1321
160 Ga0068853_100030559 3300005539 Bacteria 4551
161 Ga0068853_100370174 3300005539 Bacteria 1336
162 Ga0068853_100848526 3300005539 Bacteria 876
163 Ga0068853_101093302 3300005539 Bacteria 769
164 Ga0070672_100139503 3300005543 Bacteria 1998
165 Ga0070672_100366412 3300005543 Bacteria 1230
166 Ga0070686_100002243 3300005544 Bacteria 10661
167 Ga0070686_100103111 3300005544 Bacteria 1930
168 Ga0070686_100147971 3300005544 Bacteria 1642
169 Ga0070686_100170290 3300005544 Bacteria 1540
170 Ga0070686_100588637 3300005544 Bacteria 875
171 Ga0070695_100003541 3300005545 Bacteria 9119
172 Ga0070695_100062147 3300005545 Bacteria 2425
173 Ga0070695_100114416 3300005545 Bacteria 1836
174 Ga0070695_100173196 3300005545 Bacteria 1524
175 Ga0070695_100395332 3300005545 Bacteria 1047
176 Ga0070696_100004194 3300005546 Bacteria 9602
177 Ga0070696_100182976 3300005546 Bacteria 1555
178 Ga0070693_100155270 3300005547 Bacteria 1453
179 Ga0070665_100000109 3300005548 Bacteria 155026
180 Ga0070665_100010437 3300005548 Bacteria 9398
181 Ga0070665_100188766 3300005548 Bacteria 2062
182 Ga0070665_100769035 3300005548 Bacteria 976
183 Ga0070704_100011568 3300005549 Bacteria 5415
184 Ga0070704_100019087 3300005549 Bacteria 4400
185 Ga0070704_100138326 3300005549 Bacteria 1898
186 Ga0068855_100017220 3300005563 Bacteria 8696
187 Ga0068855_100019504 3300005563 Bacteria 8149
188 Ga0068855_100191323 3300005563 Bacteria 2308
189 Ga0068855_100825222 3300005563 Bacteria 984
190 Ga0070664_100169782 3300005564 Bacteria 1934
191 Ga0070664_100390429 3300005564 Bacteria 1272
192 Ga0070664_100543812 3300005564 Bacteria 1073
193 Ga0068857_100063077 3300005577 Bacteria 3294
194 Ga0068857_100894793 3300005577 Bacteria 851
195 Ga0068854_100213124 3300005578 Bacteria 1524
196 Ga0068854_100277683 3300005578 Bacteria 1347
197 Ga0068854_100669936 3300005578 Bacteria 892
198 Ga0068856_100018557 3300005614 Bacteria 6740
199 Ga0068856_100254817 3300005614 Unclassified 1770
200 Ga0068856_100937987 3300005614 Bacteria 884
201 Ga0068852_100032860 3300005616 Bacteria 4301
202 Ga0068852_100305253 3300005616 Bacteria 1542
203 Ga0068852_100645832 3300005616 Unclassified 1065
204 Ga0068859_100021003 3300005617 Bacteria 6554
205 Ga0068859_100065113 3300005617 Bacteria 3679
206 Ga0068859_100219454 3300005617 Bacteria 1989
207 Ga0068859_100427652 3300005617 Bacteria 1421
208 Ga0068859_100650905 3300005617 Bacteria 1146
209 Ga0068859_100664279 3300005617 Bacteria 1134
210 Ga0068859_100869196 3300005617 Bacteria 987
211 Ga0068864_100023234 3300005618 Bacteria 5204
212 Ga0068864_100063762 3300005618 Bacteria 3194
213 Ga0068864_100830112 3300005618 Bacteria 910
214 Ga0068866_10013064 3300005718 Bacteria 3632
215 Ga0068866_10240660 3300005718 Bacteria 1102
216 Ga0068861_100067590 3300005719 Bacteria 2759
217 Ga0068861_100073792 3300005719 Bacteria 2651
218 Ga0068861_100095518 3300005719 Bacteria 2354
219 Ga0068861_100138254 3300005719 Bacteria 1985
220 Ga0068861_100200552 3300005719 Bacteria 1674
221 Ga0068861_100362892 3300005719 Bacteria 1274
222 Ga0068861_100436014 3300005719 Bacteria 1171
223 Ga0068861_100553653 3300005719 Bacteria 1048
224 Ga0068851_10465475 3300005834 Unclassified 753
225 Ga0068870_10017565 3300005840 Bacteria 3438
226 Ga0068870_10104977 3300005840 Bacteria 1604
227 Ga0068863_100000017 3300005841 Bacteria 207950
228 Ga0068863_100017228 3300005841 Bacteria 6929
229 Ga0068863_100091547 3300005841 Bacteria 2884
230 Ga0068863_100098324 3300005841 Bacteria 2779
231 Ga0068863_100177459 3300005841 Bacteria 2044
232 Ga0068863_100221469 3300005841 Bacteria 1823
233 Ga0068863_100269671 3300005841 Bacteria 1647
234 Ga0068863_100395752 3300005841 Bacteria 1350
235 Ga0068863_100682508 3300005841 Unclassified 1020
236 Ga0068858_100001254 3300005842 Bacteria 26256
237 Ga0068858_100036297 3300005842 Bacteria 4570
238 Ga0068858_100213833 3300005842 Bacteria 1825
239 Ga0068858_100304218 3300005842 Bacteria 1522
240 Ga0068858_100325108 3300005842 Bacteria 1470
241 Ga0068858_100341758 3300005842 Bacteria 1432
242 Ga0068858_100443973 3300005842 Bacteria 1250
243 Ga0068860_100196477 3300005843 Bacteria 1954
244 Ga0068860_100204933 3300005843 Bacteria 1912
245 Ga0068860_100222812 3300005843 Bacteria 1832
246 Ga0068862_100021021 3300005844 Bacteria 5453
247 Ga0068862_100243979 3300005844 Bacteria 1634
248 Ga0068862_100256173 3300005844 Bacteria 1596
249 Ga0068862_100388290 3300005844 Bacteria 1303
250 Ga0068862_100477468 3300005844 Bacteria 1180
251 Ga0068862_100654087 3300005844 Bacteria 1014
252 Ga0081455_10020035 3300005937 Bacteria 6313
253 Ga0081455_10062986 3300005937 Bacteria 3114
254 Ga0081455_10094886 3300005937 Bacteria 2409
255 Ga0081455_10196227 3300005937 Bacteria 1516
256 Ga0081538_10028271 3300005981 Bacteria 3861
257 Ga0081538_10159526 3300005981 Bacteria 1005
258 Ga0081540_1029909 3300005983 Bacteria 3026
259 Ga0081540_1060207 3300005983 Bacteria 1818
260 Ga0081539_10028512 3300005985 Bacteria 3509
261 Ga0070717_10058494 3300006028 Bacteria 3188
262 Ga0070717_10078925 3300006028 Bacteria 2759
263 Ga0070717_10083134 3300006028 Bacteria 2691
264 Ga0070717_10210245 3300006028 Bacteria 1707
265 Ga0070717_10242212 3300006028 Bacteria 1591
266 Ga0075365_10064596 3300006038 Bacteria 2452
267 Ga0075365_10150506 3300006038 Bacteria 1619
268 Ga0075365_10183350 3300006038 Bacteria 1464
269 Ga0075368_10029905 3300006042 Bacteria 2107
270 Ga0075364_10034870 3300006051 Bacteria 3250
271 Ga0070715_10001976 3300006163 Bacteria 6174
272 Ga0070716_100009024 3300006173 Bacteria 4962
273 Ga0070716_100087778 3300006173 Bacteria 1875
274 Ga0070716_100149702 3300006173 Bacteria 1499
275 Ga0070716_100545086 3300006173 Bacteria 864
276 Ga0070712_100013564 3300006175 Bacteria 5211
277 Ga0070712_100059771 3300006175 Bacteria 2685
278 Ga0075362_10019673 3300006177 Bacteria 2811
279 Ga0075362_10074422 3300006177 Bacteria 1556
280 Ga0075367_10011148 3300006178 Bacteria 4743
281 Ga0075367_10096682 3300006178 Bacteria 1801
282 Ga0075367_10138559 3300006178 Bacteria 1506
283 Ga0075369_10052067 3300006186 Bacteria 1774
284 Ga0075369_10056907 3300006186 Bacteria 1700
285 Ga0075369_10256154 3300006186 Bacteria 813
286 Ga0075366_10003380 3300006195 Bacteria 8406
287 Ga0075366_10077818 3300006195 Bacteria 1979
288 Ga0075366_10301324 3300006195 Bacteria 980
289 Ga0097621_100006061 3300006237 Bacteria 8549
290 Ga0097621_100015176 3300006237 Bacteria 5787
291 Ga0097621_100139647 3300006237 Bacteria 2070
292 Ga0097621_100193670 3300006237 Bacteria 1761
293 Ga0068871_100001728 3300006358 Bacteria 14706
294 Ga0068871_100088164 3300006358 Bacteria 2581
295 Ga0068871_100113852 3300006358 Bacteria 2278
296 Ga0068871_100270635 3300006358 Bacteria 1484
297 Ga0068871_100318050 3300006358 Bacteria 1370
298 Ga0068871_100360462 3300006358 Bacteria 1288
299 Ga0075428_100002425 3300006844 Bacteria 20258
300 Ga0075428_100040963 3300006844 Bacteria 5093
301 Ga0075428_100055934 3300006844 Bacteria 4322
302 Ga0075428_100070820 3300006844 Bacteria 3811
303 Ga0075428_100238517 3300006844 Bacteria 1962
304 Ga0075428_100835067 3300006844 Bacteria 979
305 Ga0075430_100063762 3300006846 Bacteria 3095
306 Ga0075430_100237034 3300006846 Bacteria 1512
307 Ga0075430_100409994 3300006846 Bacteria 1118
308 Ga0075431_100003805 3300006847 Bacteria 14672
309 Ga0075431_100006978 3300006847 Bacteria 11229
310 Ga0075431_100052518 3300006847 Bacteria 4203
311 Ga0075431_100342636 3300006847 Bacteria 1504
312 Ga0075433_10095035 3300006852 Bacteria 2638
313 Ga0075433_10096964 3300006852 Bacteria 2610
314 Ga0075433_10114798 3300006852 Bacteria 2389
315 Ga0075433_10142642 3300006852 Bacteria 2129
316 Ga0075433_10206637 3300006852 Bacteria 1746
317 Ga0075433_10373859 3300006852 Unclassified 1258
318 Ga0075434_100123476 3300006871 Bacteria 2605
319 Ga0075434_100146743 3300006871 Bacteria 2379
320 Ga0075434_100208694 3300006871 Bacteria 1974
321 Ga0075434_100224809 3300006871 Bacteria 1897
322 Ga0075434_100240424 3300006871 Bacteria 1830
323 Ga0075434_100543569 3300006871 Bacteria 1182
324 Ga0075434_100777727 3300006871 Bacteria 974
325 Ga0075429_100004225 3300006880 Bacteria 12307
326 Ga0075429_100010320 3300006880 Bacteria 8081
327 Ga0075429_100067833 3300006880 Bacteria 3105
328 Ga0075429_100078704 3300006880 Bacteria 2873
329 Ga0068865_100468691 3300006881 Bacteria 1044
330 Ga0075436_100028497 3300006914 Bacteria 3842
331 Ga0075436_100031296 3300006914 Bacteria 3663
332 Ga0075436_100049304 3300006914 Bacteria 2905
333 Ga0075436_100057089 3300006914 Bacteria 2696
334 Ga0075436_100058745 3300006914 Bacteria 2656
335 Ga0075436_100100249 3300006914 Bacteria 2017
336 Ga0075436_100109094 3300006914 Bacteria 1931
337 Ga0097620_100021003 3300006931 Bacteria 6554
338 Ga0097620_100065113 3300006931 Bacteria 3679
339 Ga0097620_100219454 3300006931 Bacteria 1989
340 Ga0097620_100427650 3300006931 Bacteria 1421
341 Ga0097620_100650838 3300006931 Bacteria 1146
342 Ga0097620_100664276 3300006931 Bacteria 1134
343 Ga0097620_100869340 3300006931 Bacteria 987
344 Ga0079104_1024112 3300006946 Bacteria 1607
345 Ga0075435_100001542 3300007076 Bacteria 14846
346 Ga0075435_100001694 3300007076 Bacteria 14328
347 Ga0075435_100039831 3300007076 Bacteria 3751
348 Ga0075435_100070719 3300007076 Bacteria 2848
349 Ga0075435_100083105 3300007076 Bacteria 2632
350 Ga0075435_100283065 3300007076 Bacteria 1416
351 Ga0075435_100343739 3300007076 Bacteria 1278
352 Ga0099794_10012544 3300007265 Bacteria 3661
353 Ga0099794_10028448 3300007265 Bacteria 2600
354 Ga0099794_10064512 3300007265 Bacteria 1785
355 Ga0099794_10077253 3300007265 Bacteria 1638
356 Ga0099794_10119509 3300007265 Bacteria 1325
357 Ga0099794_10152346 3300007265 Bacteria 1174
358 Ga0099795_10044771 3300007788 Bacteria 1589
359 Ga0105251_10038598 3300009011 Bacteria 2339
360 Ga0105244_10017034 3300009036 Bacteria 4119
361 Ga0105244_10032973 3300009036 Bacteria 2735
362 Ga0105240_10045226 3300009093 Bacteria 5587
363 Ga0105240_10077161 3300009093 Bacteria 4106
364 Ga0105240_10287205 3300009093 Bacteria 1887
365 Ga0105240_10363484 3300009093 Bacteria 1638
366 Ga0111539_10000566 3300009094 Bacteria 47366
367 Ga0111539_10007255 3300009094 Bacteria 14196
368 Ga0111539_10170273 3300009094 Bacteria 2545
369 Ga0111539_10286952 3300009094 Bacteria 1915
370 Ga0111539_10514804 3300009094 Bacteria 1394
371 Ga0111539_10520909 3300009094 Bacteria 1385
372 Ga0111539_10903261 3300009094 Bacteria 1027
373 Ga0111539_11122142 3300009094 Bacteria 914
374 Ga0105245_10026276 3300009098 Bacteria 5123
375 Ga0105245_10068939 3300009098 Bacteria 3206
376 Ga0105245_10144359 3300009098 Bacteria 2245
377 Ga0105245_10238041 3300009098 Bacteria 1763
378 Ga0105245_10276752 3300009098 Bacteria 1639
379 Ga0105245_10395640 3300009098 Bacteria 1379
380 Ga0105245_10586056 3300009098 Bacteria 1140
381 Ga0105245_11385278 3300009098 Bacteria 753
382 Ga0105247_10000016 3300009101 Bacteria 263389
383 Ga0105247_10004209 3300009101 Bacteria 9230
384 Ga0105247_10009289 3300009101 Bacteria 5972
385 Ga0105247_10024345 3300009101 Bacteria 3648
386 Ga0105247_10056718 3300009101 Bacteria 2420
387 Ga0105247_10127988 3300009101 Bacteria 1652
388 Ga0105247_10391050 3300009101 Bacteria 988
389 Ga0114129_10000431 3300009147 Bacteria 49869
390 Ga0114129_10001150 3300009147 Bacteria 35034
391 Ga0114129_10002840 3300009147 Bacteria 24196
392 Ga0114129_10004861 3300009147 Bacteria 18961
393 Ga0114129_10060820 3300009147 Bacteria 5280
394 Ga0114129_10078194 3300009147 Bacteria 4602
395 Ga0114129_10106586 3300009147 Bacteria 3871
396 Ga0114129_10122991 3300009147 Bacteria 3570
397 Ga0114129_10201915 3300009147 Bacteria 2692
398 Ga0114129_10220032 3300009147 Bacteria 2562
399 Ga0114129_10359401 3300009147 Bacteria 1927
400 Ga0114129_10381813 3300009147 Bacteria 1860
401 Ga0114129_10546194 3300009147 Bacteria 1507
402 Ga0114129_10788848 3300009147 Bacteria 1213
403 Ga0114129_11063128 3300009147 Bacteria 1015
404 Ga0114129_11118264 3300009147 Unclassified 985
405 Ga0114129_11245379 3300009147 Bacteria 925
406 Ga0105243_10301519 3300009148 Bacteria 1452
407 Ga0105243_10611995 3300009148 Bacteria 1050
408 Ga0105241_10087967 3300009174 Bacteria 2446
409 Ga0105242_10184408 3300009176 Bacteria 1843
410 Ga0105242_10223480 3300009176 Bacteria 1684
411 Ga0105242_10228102 3300009176 Bacteria 1668
412 Ga0105242_10386775 3300009176 Bacteria 1302
413 Ga0105242_10607423 3300009176 Bacteria 1057
414 Ga0105248_10002899 3300009177 Bacteria 19028
415 Ga0105248_10019507 3300009177 Bacteria 7503
416 Ga0105248_10088320 3300009177 Bacteria 3489
417 Ga0105248_10088554 3300009177 Bacteria 3484
418 Ga0105248_10094826 3300009177 Bacteria 3360
419 Ga0105248_10110426 3300009177 Bacteria 3100
420 Ga0105248_10125984 3300009177 Bacteria 2889
421 Ga0105248_10135047 3300009177 Bacteria 2783
422 Ga0105248_10169500 3300009177 Bacteria 2461
423 Ga0105248_10280794 3300009177 Bacteria 1875
424 Ga0105248_10371694 3300009177 Bacteria 1609
425 Ga0105248_10910328 3300009177 Bacteria 993
426 Ga0105248_11118400 3300009177 Bacteria 890
427 Ga0105248_11158940 3300009177 Bacteria 874
428 Ga0105237_10210301 3300009545 Bacteria 1945
429 Ga0105237_10354917 3300009545 Bacteria 1471
430 Ga0105237_10408686 3300009545 Bacteria 1362
431 Ga0105238_10658969 3300009551 Bacteria 1057
432 Ga0105249_10020004 3300009553 Bacteria 5978
433 Ga0105249_10048671 3300009553 Bacteria 3864
434 Ga0105249_10184437 3300009553 Bacteria 2032
435 Ga0105249_10508957 3300009553 Bacteria 1250
436 Ga0105249_10546879 3300009553 Bacteria 1208
437 Ga0099796_10011242 3300010159 Bacteria 2491
438 Ga0099796_10040627 3300010159 Bacteria 1571
439 Ga0105239_10386387 3300010375 Bacteria 1583
440 Ga0105239_10561888 3300010375 Bacteria 1300
441 Ga0105239_10950756 3300010375 Bacteria 987
442 Ga0105246_10000488 3300011119 Bacteria 21462
443 Ga0105246_10002877 3300011119 Bacteria 10417
444 Ga0105246_10048926 3300011119 Bacteria 2892
445 Ga0105246_10345968 3300011119 Bacteria 1217
446 Ga0105246_10609482 3300011119 Bacteria 945
447 Ga0157370_10256810 3300013104 Bacteria 1615
448 Ga0157369_10316730 3300013105 Bacteria 1622
449 Ga0157374_10216462 3300013296 Bacteria 1879
450 Ga0157374_10224096 3300013296 Bacteria 1846
451 Ga0157374_10338628 3300013296 Bacteria 1493
452 Ga0157374_10353337 3300013296 Bacteria 1461
453 Ga0157378_10052663 3300013297 Bacteria 3621
454 Ga0157378_10145914 3300013297 Bacteria 2201
455 Ga0157378_10391315 3300013297 Bacteria 1367
456 Ga0163162_10115851 3300013306 Bacteria 2780
457 Ga0163162_10229606 3300013306 Bacteria 1986
458 Ga0163162_10330796 3300013306 Bacteria 1656
459 Ga0163162_10392743 3300013306 Bacteria 1520
460 Ga0163162_11158825 3300013306 Bacteria 877
461 Ga0157372_10964963 3300013307 Bacteria 988
462 Ga0157375_10139830 3300013308 Bacteria 2547
463 Ga0157375_10173554 3300013308 Bacteria 2304
464 Ga0157375_10435333 3300013308 Bacteria 1477
465 Ga0157375_10519216 3300013308 Unclassified 1354
466 Ga0157375_10662569 3300013308 Bacteria 1199
467 Ga0157375_10871853 3300013308 Bacteria 1046
468 Ga0157375_10926635 3300013308 Bacteria 1014
469 Ga0163163_10024877 3300014325 Bacteria 5701
470 Ga0163163_10064535 3300014325 Bacteria 3633
471 Ga0163163_10257855 3300014325 Bacteria 1794
472 Ga0163163_10559923 3300014325 Bacteria 1206
473 Ga0163163_11345461 3300014325 Bacteria 776
474 Ga0157380_10223651 3300014326 Bacteria 1686
475 Ga0157380_10245428 3300014326 Bacteria 1617
476 Ga0157380_10347519 3300014326 Bacteria 1386
477 Ga0157380_10390373 3300014326 Bacteria 1317
478 Ga0157380_10391620 3300014326 Bacteria 1315
479 Ga0157380_11292685 3300014326 Bacteria 776
480 Ga0182008_10004904 3300014497 Bacteria 7714
481 Ga0157377_10001603 3300014745 Bacteria 9842
482 Ga0157377_10078424 3300014745 Bacteria 1925
483 Ga0157377_10158199 3300014745 Bacteria 1406
484 Ga0157377_10270263 3300014745 Bacteria 1110
485 Ga0157377_10377577 3300014745 Bacteria 959
486 Ga0157377_10467160 3300014745 Bacteria 875
487 Ga0157379_10011242 3300014968 Bacteria 7798
488 Ga0157379_10079775 3300014968 Bacteria 2932
489 Ga0157379_10082081 3300014968 Bacteria 2888
490 Ga0157379_10144530 3300014968 Bacteria 2145
491 Ga0157379_10886060 3300014968 Bacteria 846
492 Ga0157376_10247505 3300014969 Bacteria 1663
493 Ga0157376_10278620 3300014969 Bacteria 1574
494 Ga0157376_10401297 3300014969 Bacteria 1326
495 Ga0157376_10508397 3300014969 Bacteria 1185
496 Ga0182007_10006522 3300015262 Bacteria 5005
497 Ga0163161_10259062 3300017792 Bacteria 1358
498 Ga0163161_10285545 3300017792 Bacteria 1296
499 Ga0163161_10388868 3300017792 Bacteria 1116
500 Ga0197907_10958534 3300020069 Eukaryota 813
501 Ga0206352_10045669 3300020078 Eukaryota 843
502 Ga0206350_10423989 3300020080 Unclassified 851
503 Ga0206354_10580180 3300020081 Eukaryota 815
504 Ga0213872_10091145 3300021361 Bacteria 1364
505 Ga0213874_10076065 3300021377 Bacteria 1080
506 Ga0213876_10003406 3300021384 Bacteria 9099
507 Ga0213876_10023171 3300021384 Bacteria 3280
508 Ga0213871_10052803 3300021441 Bacteria 1117
509 Ga0224712_10220596 3300022467 Eukaryota 868
510 Ga0209784_100141 3300025224 Bacteria 67045
511 Ga0209437_100331 3300025233 Bacteria 58796
512 Ga0209130_1043281 3300025284 Bacteria 857
513 Ga0209675_1015955 3300025291 Bacteria 2207
514 Ga0209025_1000976 3300025294 Bacteria 42839
515 Ga0209758_1000216 3300025297 Bacteria 125352
516 Ga0209758_1027215 3300025297 Bacteria 2449
517 Ga0209256_1010676 3300025299 Bacteria 3804
518 Ga0209257_1020704 3300025304 Bacteria 2417
519 Ga0207697_10074714 3300025315 Bacteria 1424
520 Ga0207655_1016982 3300025728 Bacteria 3949
521 Ga0207655_1053672 3300025728 Bacteria 1609
522 Ga0207713_1029603 3300025735 Bacteria 2450
523 Ga0207653_10042327 3300025885 Bacteria 1498
524 Ga0207653_10250200 3300025885 Bacteria 679
525 Ga0207692_10011948 3300025898 Bacteria 3716
526 Ga0207692_10034935 3300025898 Bacteria 2438
527 Ga0207710_10000017 3300025900 Bacteria 370962
528 Ga0207710_10015930 3300025900 Bacteria 3179
529 Ga0207710_10028646 3300025900 Bacteria 2418
530 Ga0207710_10040258 3300025900 Bacteria 2071
531 Ga0207710_10091273 3300025900 Bacteria 1426
532 Ga0207688_10010927 3300025901 Bacteria 4941
533 Ga0207688_10065624 3300025901 Bacteria 2052
534 Ga0207688_10156735 3300025901 Bacteria 1348
535 Ga0207680_10006153 3300025903 Bacteria 5788
536 Ga0207685_10050135 3300025905 Bacteria 1607
537 Ga0207685_10057475 3300025905 Bacteria 1526
538 Ga0207699_10028394 3300025906 Bacteria 3109
539 Ga0207699_10141559 3300025906 Bacteria 1581
540 Ga0207699_10364227 3300025906 Bacteria 1023
541 Ga0207699_10469485 3300025906 Bacteria 905
542 Ga0207699_10614083 3300025906 Bacteria 792
543 Ga0207645_10120859 3300025907 Bacteria 1700
544 Ga0207645_10220500 3300025907 Bacteria 1250
545 Ga0207643_10002622 3300025908 Bacteria 9735
546 Ga0207643_10058965 3300025908 Bacteria 2189
547 Ga0207643_10139071 3300025908 Bacteria 1449
548 Ga0207705_10000002 3300025909 Bacteria 2046852
549 Ga0207705_10246651 3300025909 Bacteria 1361
550 Ga0207705_10574388 3300025909 Bacteria 876
551 Ga0207684_10284308 3300025910 Bacteria 1426
552 Ga0207654_10040688 3300025911 Bacteria 2620
553 Ga0207707_10016379 3300025912 Bacteria 6465
554 Ga0207707_10358042 3300025912 Bacteria 1257
555 Ga0207695_10247709 3300025913 Bacteria 1682
556 Ga0207671_10122202 3300025914 Bacteria 1991
557 Ga0207693_10001926 3300025915 Bacteria 18180
558 Ga0207693_10021188 3300025915 Bacteria 5167
559 Ga0207693_10129942 3300025915 Bacteria 1980
560 Ga0207693_10162845 3300025915 Bacteria 1755
561 Ga0207663_10000218 3300025916 Bacteria 25518
562 Ga0207663_10028223 3300025916 Bacteria 3282
563 Ga0207663_10123632 3300025916 Bacteria 1776
564 Ga0207663_10151603 3300025916 Bacteria 1627
565 Ga0207660_10014904 3300025917 Bacteria 5124
566 Ga0207660_10359614 3300025917 Bacteria 1168
567 Ga0207662_10000683 3300025918 Bacteria 15427
568 Ga0207662_10061436 3300025918 Bacteria 2256
569 Ga0207662_10147552 3300025918 Bacteria 1494
570 Ga0207657_10007500 3300025919 Bacteria 11182
571 Ga0207657_10013143 3300025919 Bacteria 8130
572 Ga0207657_10044526 3300025919 Bacteria 3901
573 Ga0207657_10171327 3300025919 Bacteria 1758
574 Ga0207657_10523273 3300025919 Bacteria 928
575 Ga0207649_10036860 3300025920 Bacteria 2949
576 Ga0207649_10276746 3300025920 Bacteria 1219
577 Ga0207649_10280726 3300025920 Bacteria 1211
578 Ga0207649_10497928 3300025920 Bacteria 926
579 Ga0207652_10014975 3300025921 Bacteria 6291
580 Ga0207652_10016976 3300025921 Bacteria 5954
581 Ga0207652_10077073 3300025921 Bacteria 2908
582 Ga0207652_10243407 3300025921 Bacteria 1622
583 Ga0207652_10259532 3300025921 Bacteria 1567
584 Ga0207652_10281349 3300025921 Bacteria 1501
585 Ga0207646_10221868 3300025922 Bacteria 1708
586 Ga0207681_10031902 3300025923 Bacteria 3444
587 Ga0207681_10260818 3300025923 Bacteria 1357
588 Ga0207650_10138625 3300025925 Bacteria 1910
589 Ga0207650_10438518 3300025925 Bacteria 1086
590 Ga0207659_10001213 3300025926 Bacteria 15413
591 Ga0207659_10028998 3300025926 Bacteria 3766
592 Ga0207659_10113563 3300025926 Bacteria 2063
593 Ga0207687_10015651 3300025927 Bacteria 4977
594 Ga0207687_10108277 3300025927 Bacteria 2058
595 Ga0207687_10191387 3300025927 Bacteria 1593
596 Ga0207687_10384467 3300025927 Bacteria 1151
597 Ga0207687_10906365 3300025927 Bacteria 754
598 Ga0207700_10021547 3300025928 Bacteria 4403
599 Ga0207700_10130792 3300025928 Bacteria 2049
600 Ga0207700_10450251 3300025928 Bacteria 1135
601 Ga0207664_10008551 3300025929 Bacteria 7147
602 Ga0207664_10045656 3300025929 Bacteria 3436
603 Ga0207664_10079107 3300025929 Bacteria 2668
604 Ga0207664_10527278 3300025929 Bacteria 1059
605 Ga0207664_10693924 3300025929 Bacteria 915
606 Ga0207644_10000145 3300025931 Bacteria 50586
607 Ga0207644_10138035 3300025931 Bacteria 1874
608 Ga0207644_10203491 3300025931 Bacteria 1562
609 Ga0207644_10205130 3300025931 Bacteria 1556
610 Ga0207690_10126838 3300025932 Bacteria 1862
611 Ga0207690_10574478 3300025932 Bacteria 918
612 Ga0207706_10002966 3300025933 Bacteria 16372
613 Ga0207706_10120457 3300025933 Bacteria 2307
614 Ga0207706_10207924 3300025933 Bacteria 1716
615 Ga0207706_10329771 3300025933 Bacteria 1328
616 Ga0207706_10345338 3300025933 Bacteria 1294
617 Ga0207706_10418351 3300025933 Bacteria 1161
618 Ga0207706_10424115 3300025933 Bacteria 1152
619 Ga0207686_10072906 3300025934 Bacteria 2214
620 Ga0207709_10056127 3300025935 Bacteria 2436
621 Ga0207709_10102289 3300025935 Bacteria 1897
622 Ga0207709_10255332 3300025935 Bacteria 1282
623 Ga0207670_10023176 3300025936 Bacteria 3860
624 Ga0207670_10046448 3300025936 Bacteria 2885
625 Ga0207670_10109566 3300025936 Bacteria 1987
626 Ga0207670_10168401 3300025936 Bacteria 1641
627 Ga0207669_10040380 3300025937 Bacteria 2706
628 Ga0207669_10387170 3300025937 Bacteria 1091
629 Ga0207704_10108603 3300025938 Bacteria 1869
630 Ga0207704_10214793 3300025938 Bacteria 1418
631 Ga0207704_10240334 3300025938 Bacteria 1353
632 Ga0207665_10005572 3300025939 Bacteria 8396
633 Ga0207665_10006881 3300025939 Bacteria 7529
634 Ga0207665_10046790 3300025939 Bacteria 2899
635 Ga0207665_10058141 3300025939 Bacteria 2613
636 Ga0207665_10095992 3300025939 Bacteria 2061
637 Ga0207665_10627843 3300025939 Bacteria 841
638 Ga0207691_10033820 3300025940 Bacteria 4759
639 Ga0207691_10142665 3300025940 Bacteria 2110
640 Ga0207691_10328703 3300025940 Bacteria 1310
641 Ga0207691_10365725 3300025940 Bacteria 1233
642 Ga0207691_10407998 3300025940 Bacteria 1158
643 Ga0207691_10463962 3300025940 Bacteria 1077
644 Ga0207711_10002995 3300025941 Bacteria 14760
645 Ga0207711_10007764 3300025941 Bacteria 8964
646 Ga0207711_10053527 3300025941 Bacteria 3461
647 Ga0207711_10077530 3300025941 Bacteria 2897
648 Ga0207711_10087655 3300025941 Bacteria 2731
649 Ga0207711_10980799 3300025941 Bacteria 784
650 Ga0207711_11016856 3300025941 Bacteria 769
651 Ga0207689_10008393 3300025942 Bacteria 8995
652 Ga0207689_10198876 3300025942 Bacteria 1654
653 Ga0207689_10262806 3300025942 Bacteria 1428
654 Ga0207689_10288884 3300025942 Bacteria 1358
655 Ga0207689_10306829 3300025942 Bacteria 1316
656 Ga0207689_10383677 3300025942 Bacteria 1170
657 Ga0207661_10423854 3300025944 Bacteria 1209
658 Ga0207661_10700780 3300025944 Bacteria 931
659 Ga0207661_10894155 3300025944 Bacteria 818
660 Ga0207679_10130543 3300025945 Bacteria 2015
661 Ga0207679_10231023 3300025945 Bacteria 1562
662 Ga0207667_10012912 3300025949 Bacteria 9594
663 Ga0207667_10023790 3300025949 Bacteria 6741
664 Ga0207667_10227475 3300025949 Bacteria 1910
665 Ga0207667_10876575 3300025949 Bacteria 891
666 Ga0207651_10109469 3300025960 Bacteria 2070
667 Ga0207651_10336789 3300025960 Bacteria 1266
668 Ga0207712_10024731 3300025961 Bacteria 3982
669 Ga0207712_10379238 3300025961 Bacteria 1183
670 Ga0207668_10008013 3300025972 Bacteria 6287
671 Ga0207668_10036515 3300025972 Bacteria 3279
672 Ga0207668_10094916 3300025972 Bacteria 2200
673 Ga0207668_10111996 3300025972 Bacteria 2049
674 Ga0207640_10022062 3300025981 Bacteria 3805
675 Ga0207640_10327560 3300025981 Bacteria 1222
676 Ga0207677_10076376 3300026023 Bacteria 2385
677 Ga0207677_10217805 3300026023 Bacteria 1529
678 Ga0207677_10347872 3300026023 Bacteria 1241
679 Ga0207703_10012018 3300026035 Bacteria 6743
680 Ga0207703_10048528 3300026035 Bacteria 3428
681 Ga0207703_10094107 3300026035 Bacteria 2525
682 Ga0207703_10184440 3300026035 Bacteria 1843
683 Ga0207703_10213190 3300026035 Bacteria 1723
684 Ga0207703_10269770 3300026035 Bacteria 1541
685 Ga0207703_10318319 3300026035 Bacteria 1424
686 Ga0207703_10322304 3300026035 Bacteria 1415
687 Ga0207639_10113371 3300026041 Bacteria 2214
688 Ga0207639_10140499 3300026041 Bacteria 2011
689 Ga0207639_10251013 3300026041 Bacteria 1543
690 Ga0207639_10338062 3300026041 Bacteria 1342
691 Ga0207678_10045312 3300026067 Bacteria 3804
692 Ga0207678_10095940 3300026067 Bacteria 2534
693 Ga0207678_10139610 3300026067 Bacteria 2068
694 Ga0207708_10022090 3300026075 Bacteria 4805
695 Ga0207708_10165085 3300026075 Bacteria 1750
696 Ga0207708_10461978 3300026075 Bacteria 1059
697 Ga0207708_10511065 3300026075 Bacteria 1008
698 Ga0207702_10248289 3300026078 Bacteria 1670
699 Ga0207702_10290442 3300026078 Bacteria 1549
700 Ga0207641_10000036 3300026088 Bacteria 213165
701 Ga0207641_10001674 3300026088 Bacteria 21561
702 Ga0207641_10006011 3300026088 Bacteria 10288
703 Ga0207641_10125366 3300026088 Bacteria 2298
704 Ga0207641_10424049 3300026088 Bacteria 1281
705 Ga0207641_10445859 3300026088 Bacteria 1250
706 Ga0207641_10986217 3300026088 Bacteria 839
707 Ga0207648_10005612 3300026089 Bacteria 12612
708 Ga0207648_10038262 3300026089 Bacteria 4222
709 Ga0207648_10143468 3300026089 Bacteria 2106
710 Ga0207648_10708539 3300026089 Bacteria 933
711 Ga0207676_10118955 3300026095 Bacteria 2224
712 Ga0207676_10342233 3300026095 Bacteria 1380
713 Ga0207676_10716459 3300026095 Bacteria 971
714 Ga0207674_10084505 3300026116 Bacteria 3172
715 Ga0207674_10089883 3300026116 Bacteria 3063
716 Ga0207674_10190001 3300026116 Bacteria 2003
717 Ga0207674_10396355 3300026116 Bacteria 1334
718 Ga0207675_100003007 3300026118 Bacteria 16534
719 Ga0207675_100036086 3300026118 Bacteria 4611
720 Ga0207675_100082556 3300026118 Bacteria 3014
721 Ga0207675_100182641 3300026118 Bacteria 2009
722 Ga0207675_100405621 3300026118 Bacteria 1344
723 Ga0207675_100627022 3300026118 Bacteria 1080
724 Ga0207675_100951657 3300026118 Bacteria 876
725 Ga0207675_101416959 3300026118 Bacteria 716
726 Ga0207683_10015654 3300026121 Bacteria 6455
727 Ga0207683_10032201 3300026121 Bacteria 4554
728 Ga0207683_10207216 3300026121 Bacteria 1784
729 Ga0207683_10254803 3300026121 Bacteria 1602
730 Ga0207683_10282128 3300026121 Bacteria 1518
731 Ga0207683_10454525 3300026121 Bacteria 1181
732 Ga0207698_10092615 3300026142 Bacteria 2478
733 Ga0207698_10173647 3300026142 Bacteria 1901
734 Ga0207698_10335106 3300026142 Bacteria 1423
735 Ga0207698_10375678 3300026142 Bacteria 1351
736 Ga0207698_10388390 3300026142 Bacteria 1330
737 Ga0207698_10529446 3300026142 Bacteria 1151
738 Ga0207698_11032515 3300026142 Bacteria 833
739 Ga0209281_1029026 3300027111 Bacteria 1001
740 Ga0209489_109706 3300027361 Bacteria 11675
741 Ga0209700_100031 3300027363 Bacteria 207349
742 Ga0209588_1015432 3300027671 Bacteria 2349
743 Ga0209588_1043115 3300027671 Bacteria 1457
744 Ga0209588_1063219 3300027671 Bacteria 1196
745 Ga0209813_10028535 3300027866 Bacteria 1628
746 Ga0207428_10000032 3300027907 Bacteria 232162
747 Ga0207428_10070330 3300027907 Bacteria 2751
748 Ga0207428_10111063 3300027907 Bacteria 2110
749 Ga0207428_10230665 3300027907 Bacteria 1386
750 Ga0207428_10250355 3300027907 Bacteria 1321
751 Ga0268266_10000560 3300028379 Bacteria 51866
752 Ga0268266_10029767 3300028379 Bacteria 4639
753 Ga0268266_10240360 3300028379 Bacteria 1671
754 Ga0268266_10624126 3300028379 Bacteria 1036
755 Ga0268266_11305718 3300028379 Bacteria 701
756 Ga0268265_10043571 3300028380 Bacteria 3337
757 Ga0268265_10201099 3300028380 Bacteria 1728
758 Ga0268265_10203711 3300028380 Bacteria 1718
759 Ga0268265_10223592 3300028380 Bacteria 1649
760 Ga0268265_10232679 3300028380 Bacteria 1620
761 Ga0268265_10255954 3300028380 Bacteria 1553
762 Ga0268265_10392731 3300028380 Bacteria 1280
763 Ga0268265_10642495 3300028380 Bacteria 1019
764 Ga0268264_10014193 3300028381 Bacteria 6550
765 Ga0268264_10111054 3300028381 Bacteria 2401
766 Ga0268264_10155027 3300028381 Bacteria 2058
767 Ga0268264_10177234 3300028381 Bacteria 1933
768 Ga0268264_10255397 3300028381 Bacteria 1630
769 Ga0265334_10083058 3300028573 Unclassified 1178
770 Ga0307517_10000125 3300028786 Bacteria 115466
771 Ga0307515_10158343 3300028794 Bacteria 2324
772 Ga0265338_10008624 3300028800 Bacteria 12331
773 Ga0265338_10090007 3300028800 Bacteria 2541
774 Ga0310982_100320 3300029283 Bacteria 1188
775 Ga0310981_1038706 3300029285 Bacteria 878
776 Ga0307512_10142319 3300030522 Bacteria 1464
777 Ga0316182_1082465 3300030745 Bacteria 1272
778 Ga0265762_1001772 3300030760 Bacteria 3918
779 Ga0265777_103137 3300030877 Bacteria 1001
780 Ga0265328_10000041 3300031239 Bacteria 89398
781 Ga0265340_10107718 3300031247 Bacteria 1291
782 Ga0265316_10004234 3300031344 Bacteria 14337
783 Ga0307408_100158543 3300031548 Bacteria 1795
784 Ga0307408_100320780 3300031548 Bacteria 1305
785 Ga0307508_10165302 3300031616 Bacteria 1816
786 Ga0307508_10233855 3300031616 Bacteria 1436
787 Ga0265314_10110622 3300031711 Bacteria 1746
788 Ga0307516_10167169 3300031730 Bacteria 1943
789 Ga0307405_10187330 3300031731 Bacteria 1491
790 Ga0307405_10386933 3300031731 Bacteria 1091
791 Ga0307413_10070007 3300031824 Bacteria 2204
792 Ga0307413_10139134 3300031824 Bacteria 1675
793 Ga0307413_10314277 3300031824 Bacteria 1194
794 Ga0307410_10017505 3300031852 Bacteria 4306
795 Ga0307410_10063305 3300031852 Bacteria 2537
796 Ga0307410_10077593 3300031852 Bacteria 2323
797 Ga0307406_10029602 3300031901 Bacteria 3317
798 Ga0307406_10302389 3300031901 Bacteria 1230
799 Ga0307406_10470332 3300031901 Bacteria 1013
800 Ga0307407_10175875 3300031903 Bacteria 1414
801 Ga0307407_10195688 3300031903 Bacteria 1351
802 Ga0307412_10804726 3300031911 Bacteria 816
803 Ga0307409_100008475 3300031995 Bacteria 6244
804 Ga0307409_100071714 3300031995 Bacteria 2755
805 Ga0307409_100743896 3300031995 Bacteria 984
806 Ga0307409_100850841 3300031995 Bacteria 923
807 Ga0307416_100015910 3300032002 Bacteria 5211
808 Ga0307416_100092003 3300032002 Bacteria 2607
809 Ga0307416_100651752 3300032002 Bacteria 1138
810 Ga0307416_101106873 3300032002 Bacteria 897
811 Ga0307414_10628150 3300032004 Bacteria 966
812 Ga0307415_100025248 3300032126 Bacteria 3725
813 Ga0307415_100206957 3300032126 Bacteria 1562
814 Ga0307415_100270244 3300032126 Bacteria 1392
815 Ga0307415_100427721 3300032126 Bacteria 1138
816 Ga0316596_1048376 3300033541 Bacteria 1123
817 Ga0373930_0019395 3300034816 Bacteria 1316
818 Ga0373950_0037319 3300034818 Bacteria 919
819 Ga0373958_0011453 3300034819 Bacteria 1499
820 Ga0373959_0000924 3300034820 Bacteria 4951
821 Ga0373928_0003435 3300035084 Bacteria 3015
822 Ga0373929_0000116 3300035085 Bacteria 13311
823 Ga0373934_0002966 3300035086 Bacteria 6200
824 Ga0373934_0051027 3300035086 Bacteria 1640
825 Ga0373934_0113515 3300035086 Bacteria 1100
826 Ga0373940_0000084 3300035088 Bacteria 11367
827 Ga0373940_0064960 3300035088 Bacteria 1051
828 Ga0373949_0048079 3300035090 Bacteria 1068
829 Ga0373923_0000429 3300035111 Bacteria 9865
830 Ga0373923_0036628 3300035111 Bacteria 2004
831 Ga0373932_0000807 3300035112 Bacteria 9293
832 Ga0373932_0009460 3300035112 Bacteria 2344
833 Ga0373936_0010448 3300035113 Bacteria 3502
834 Ga0373939_0035172 3300035114 Bacteria 1474
835 Ga0373939_0048662 3300035114 Bacteria 1307
836 Ga0373941_0000161 3300035115 Bacteria 12224
837 Ga0373941_0015637 3300035115 Bacteria 2051
838 Ga0373941_0026257 3300035115 Bacteria 1690
839 Ga0373953_0000451 3300035117 Bacteria 11279
840 Ga0373953_0007154 3300035117 Bacteria 3723
841 Ga0373953_0071837 3300035117 Bacteria 1428
842 Ga0373954_0000482 3300035118 Bacteria 14947
843 Ga0373954_0003811 3300035118 Bacteria 6442
844 Ga0373954_0010828 3300035118 Bacteria 4031
845 Ga0373954_0090393 3300035118 Bacteria 1470
846 Ga0373956_0111852 3300035119 Bacteria 1271
847 Ga0373956_0186202 3300035119 Bacteria 982
848 Ga0373957_0000922 3300035120 Bacteria 7704
849 Ga0373957_0101640 3300035120 Bacteria 1152
850 Ga0373960_0000753 3300035121 Bacteria 6755
851 Ga0373960_0040375 3300035121 Bacteria 1347
852 Ga0373946_0007337 3300035171 Bacteria 4026
853 Ga0373946_0014782 3300035171 Bacteria 2949
854 Ga0373955_0036421 3300035172 Bacteria 2610
855 Ga0373955_0145249 3300035172 Bacteria 1393
856 Ga0373955_0175916 3300035172 Bacteria 1268
857 Ga0373942_0001757 3300035207 Bacteria 5486
858 Ga0373961_0001371 3300035241 Bacteria 7313
859 Ga0373962_0000245 3300035242 Bacteria 11519
860 Ga0373962_0030916 3300035242 Bacteria 1467
861 Ga0373962_0105373 3300035242 Bacteria 884
862 Ga0373924_0002270 3300035410 Bacteria 6451
863 Ga0373931_0009494 3300035691 Bacteria 4653
864 Ga0373931_0021342 3300035691 Bacteria 3248
865 Ga0373931_0180614 3300035691 Bacteria 1249
866 Ga0373935_0008830 3300035692 Bacteria 6033
867 Ga0373935_0053767 3300035692 Bacteria 2562
868 Ga0373935_0198302 3300035692 Bacteria 1386
869 Ga0373935_0777880 3300035692 Bacteria 706
870 Ga0373927_0028727 3300035695 Bacteria 3628
871 Ga0373927_0059060 3300035695 Bacteria 2481
872 Ga0373927_0096376 3300035695 Bacteria 1923
873 Ga0373927_0132003 3300035695 Bacteria 1632
874 Ga0373927_0383836 3300035695 Bacteria 926
875 Ga0373933_0003737 3300035724 Bacteria 8413
876 Ga0373947_0040913 3300035725 Bacteria 2762
877 Ga0373947_0043635 3300035725 Bacteria 2679
878 Ga0373937_0172438 3300036401 Bacteria 2030
879 Ga0373937_0210181 3300036401 Bacteria 1831
880 Ga0373937_0304832 3300036401 Bacteria 1506
881 Ga0373937_0373074 3300036401 Bacteria 1353
882 Ga0373937_0451068 3300036401 Bacteria 1221
883 Ga0373925_0005941 3300037068 Bacteria 9044
884 Ga0373925_0013826 3300037068 Bacteria 5843
885 Ga0373925_0174928 3300037068 Bacteria 1696
886 Ga0395900_0087991 3300037418 Bacteria 3193
887 Ga0395900_0141424 3300037418 Bacteria 2464
888 Ga0395900_0609373 3300037418 Unclassified 1032
889 Ga0395898_0156518 3300037466 Bacteria 2180
890 Ga0395898_0372873 3300037466 Bacteria 1361
891 Ga0395898_0620454 3300037466 Bacteria 1024
892 Ga0395905_0007428 3300037471 Bacteria 10895
893 Ga0395905_0012237 3300037471 Bacteria 8263
894 Ga0395905_0089423 3300037471 Bacteria 2886
895 Ga0395901_0032493 3300038443 Bacteria 5384
896 Ga0395901_0082956 3300038443 Bacteria 3350
897 Ga0395901_0877081 3300038443 Bacteria 881
898 Ga0436365_0450041 3300039437 Bacteria 910
899 Ga0436365_0697746 3300039437 Bacteria 24050
900 Ga0436365_1470057 3300039437 Bacteria 969
901 Ga0436365_1620453 3300039437 Bacteria 934
902 Ga0436365_1701482 3300039437 Bacteria 3380
903 Ga0436365_1935460 3300039437 Bacteria 13309
904 Ga0436360_0298195 3300039438 Bacteria 2647
905 Ga0436361_0730859 3300039447 Bacteria 1628
906 Ga0436363_0579133 3300039450 Bacteria 3940
907 Ga0436362_0946909 3300039453 Bacteria 1298
908 Ga0436362_1110265 3300039453 Bacteria 2448
909 Ga0439465_0050727 3300041413 Bacteria 1358
910 Ga0451841_0950211 3300041498 Bacteria 1723
911 Ga0451853_0777966 3300041512 Bacteria 1286
912 Ga0439455_0019852 3300042012 Bacteria 1588
913 Ga0450914_003561 3300042118 Bacteria 1207
914 Ga0450890_009528 3300042127 Bacteria 1245
915 Ga0439434_0167228 3300042435 Bacteria 733
916 Ga0451577_0043475 3300042876 Bacteria 4024
917 Ga0466966_0014585 3300044684 Bacteria 5202
918 Ga0466966_0014913 3300044684 Bacteria 5143
919 Ga0466966_0093533 3300044684 Bacteria 1864
920 Ga0466961_0043541 3300044693 Bacteria 2875
921 Ga0466961_0115997 3300044693 Bacteria 1683
922 Ga0466961_0126535 3300044693 Bacteria 1603
923 Ga0466961_0311672 3300044693 Bacteria 960
924 Ga0466963_0075586 3300044694 Bacteria 2274
925 Ga0466963_0437133 3300044694 Bacteria 923
926 Ga0466963_0467393 3300044694 Bacteria 890
927 Ga0466971_0119745 3300044719 Bacteria 1218
928 Ga0466957_0028757 3300044842 Bacteria 3311
929 Ga0466957_0227246 3300044842 Bacteria 1234
930 Ga0466960_0023207 3300044901 Bacteria 2783
931 Ga0466960_0035450 3300044901 Bacteria 2332
932 Ga0466959_0004261 3300045049 Bacteria 9543
933 Ga0466959_0151285 3300045049 Bacteria 1636
934 Ga0466959_0154099 3300045049 Bacteria 1618
935 Ga0451576_0055322 3300045051 Bacteria 4152
936 Ga0451576_0607998 3300045051 Bacteria 1149
937 Ga0466958_0002151 3300045836 Bacteria 9809
938 Ga0466958_0106918 3300045836 Bacteria 1745
939 Ga0466958_0121180 3300045836 Bacteria 1638
940 Ga0466958_0286919 3300045836 Bacteria 1055
941 Ga0466967_0068175 3300045976 Bacteria 3176
942 Ga0466967_0173578 3300045976 Bacteria 2030
943 Ga0466967_0226821 3300045976 Bacteria 1777
944 Ga0495592_0005638 3300046454 Bacteria 9255
945 Ga0495592_0028405 3300046454 Bacteria 4237
946 Ga0495592_0057907 3300046454 Bacteria 2859
947 Ga0495603_0039205 3300046455 Bacteria 2839
948 Ga0495629_0056581 3300046459 Bacteria 2742
949 Ga0495629_0159455 3300046459 Bacteria 1567
950 Ga0495638_0007730 3300046460 Bacteria 7682
951 Ga0495638_0133888 3300046460 Bacteria 1453
952 Ga0495641_0011057 3300046461 Bacteria 5170
953 Ga0495651_0004143 3300046462 Bacteria 11106
954 Ga0495651_0275165 3300046462 Bacteria 1140
955 Ga0495651_0442956 3300046462 Bacteria 841
956 Ga0495653_0022129 3300046463 Bacteria 5144
957 Ga0495653_0294093 3300046463 Bacteria 1061
958 Ga0495580_0056214 3300046472 Bacteria 2772
959 Ga0495580_0133111 3300046472 Bacteria 1724
960 Ga0495580_0144381 3300046472 Bacteria 1649
961 Ga0495580_0198094 3300046472 Bacteria 1384
962 Ga0495582_0012275 3300046473 Bacteria 4720
963 Ga0495639_0001960 3300046475 Bacteria 9132
964 Ga0495639_0064911 3300046475 Bacteria 1679
965 Ga0495639_0093691 3300046475 Bacteria 1412
966 Ga0495662_0005450 3300046476 Bacteria 6370
967 Ga0495664_0003933 3300046477 Bacteria 8107
968 Ga0495584_0006905 3300046491 Bacteria 5932
969 Ga0495584_0099387 3300046491 Bacteria 1470
970 Ga0495584_0117331 3300046491 Bacteria 1347
971 Ga0495584_0153742 3300046491 Bacteria 1169
972 Ga0495596_0066806 3300046500 Bacteria 1398
973 Ga0495606_0199980 3300046507 Bacteria 1139
974 Ga0495608_0004188 3300046511 Bacteria 10337
975 Ga0495608_0007931 3300046511 Bacteria 7461
976 Ga0495608_0165211 3300046511 Bacteria 1406
977 Ga0495608_0193755 3300046511 Bacteria 1282
978 Ga0495610_0002336 3300046512 Bacteria 16035
979 Ga0495610_0106718 3300046512 Bacteria 1246
980 Ga0495616_0152174 3300046513 Bacteria 1046
981 Ga0495616_0154130 3300046513 Bacteria 1037
982 Ga0495618_0129668 3300046514 Bacteria 1613
983 Ga0495618_0145861 3300046514 Bacteria 1513
984 Ga0495620_0112262 3300046515 Bacteria 1079
985 Ga0495628_0036325 3300046516 Bacteria 3955
986 Ga0495628_0055686 3300046516 Bacteria 3114
987 Ga0495628_0203839 3300046516 Bacteria 1489
988 Ga0495630_0010900 3300046517 Bacteria 6565
989 Ga0495630_0057928 3300046517 Bacteria 2904
990 Ga0495631_0025969 3300046518 Bacteria 2693
991 Ga0495637_0075167 3300046520 Bacteria 1356
992 Ga0495644_0034036 3300046523 Bacteria 1923
993 Ga0495663_0006675 3300046525 Bacteria 3184
994 Ga0495642_0003089 3300046528 Bacteria 6619
995 Ga0495642_0146980 3300046528 Bacteria 1019
996 Ga0495652_0005494 3300046529 Bacteria 11936
997 Ga0495652_0050149 3300046529 Bacteria 3570
998 Ga0495652_0069819 3300046529 Bacteria 2939
999 Ga0495652_0081707 3300046529 Bacteria 2665
1000 Ga0495665_0016354 3300046531 Bacteria 3998
1001 Ga0495665_0103663 3300046531 Bacteria 1492
1002 Ga0495640_0001806 3300046533 Bacteria 16965
1003 Ga0495640_0014075 3300046533 Bacteria 6066
1004 Ga0495640_0381402 3300046533 Bacteria 867
1005 Ga0495586_0003635 3300046535 Bacteria 8263
1006 Ga0495586_0526242 3300046535 Bacteria 682
1007 Ga0495587_0002077 3300046536 Bacteria 13382
1008 Ga0495587_0080839 3300046536 Bacteria 1883
1009 Ga0495587_0091248 3300046536 Bacteria 1760
1010 Ga0495587_0143446 3300046536 Bacteria 1362
1011 Ga0495598_0063529 3300046537 Bacteria 1145
1012 Ga0495621_0088457 3300046539 Bacteria 1165
1013 Ga0495597_0135444 3300046542 Bacteria 1019
1014 Ga0495645_0009908 3300046543 Bacteria 6669
1015 Ga0495645_0027506 3300046543 Bacteria 4132
1016 Ga0495645_0161506 3300046543 Bacteria 1549
1017 Ga0495633_0073145 3300046558 Bacteria 1598
1018 Ga0495667_0008752 3300046559 Bacteria 6878
1019 Ga0495667_0023465 3300046559 Bacteria 4157
1020 Ga0495667_0086457 3300046559 Bacteria 2033
1021 Ga0495656_0030020 3300046615 Bacteria 2194
1022 Ga0495656_0054523 3300046615 Bacteria 1720
1023 Ga0495656_0355547 3300046615 Unclassified 760
1024 Ga0495668_0158961 3300046616 Bacteria 1238
1025 Ga0495668_0217988 3300046616 Bacteria 1045
1026 Ga0495668_0226306 3300046616 Bacteria 1024
1027 Ga0495634_0227969 3300046642 Bacteria 1147
1028 Ga0495611_0122721 3300046648 Bacteria 1211
1029 Ga0495611_0159904 3300046648 Bacteria 1052
1030 Ga0495588_0012687 3300046674 Bacteria 3991
1031 Ga0495588_0233903 3300046674 Bacteria 969
1032 Ga0495657_0012725 3300046675 Bacteria 6240
1033 Ga0495657_0103606 3300046675 Bacteria 1810
1034 Ga0495599_0005317 3300046678 Bacteria 7682
1035 Ga0495599_0032803 3300046678 Bacteria 3260
1036 Ga0495599_0076546 3300046678 Bacteria 2089
1037 Ga0495599_0087336 3300046678 Bacteria 1947
1038 Ga0495599_0327801 3300046678 Bacteria 921
1039 Ga0495623_0175936 3300046679 Bacteria 1247
1040 Ga0495623_0197658 3300046679 Bacteria 1158
1041 Ga0495647_0058460 3300046681 Bacteria 1515
1042 Ga0495647_0069026 3300046681 Bacteria 1411
1043 Ga0495647_0095748 3300046681 Bacteria 1223
1044 Ga0495647_0098992 3300046681 Bacteria 1205
1045 Ga0495658_0124747 3300046683 Bacteria 1561
1046 Ga0495658_0185194 3300046683 Bacteria 1293
1047 Ga0495669_0000560 3300046684 Bacteria 16456
1048 Ga0495669_0061694 3300046684 Bacteria 1697
1049 Ga0495669_0073388 3300046684 Bacteria 1562
1050 Ga0495669_0112861 3300046684 Bacteria 1270
1051 Ga0495669_0122884 3300046684 Bacteria 1218
1052 Ga0495669_0191115 3300046684 Bacteria 977
1053 Ga0495613_0013985 3300046689 Bacteria 5957
1054 Ga0495613_0100399 3300046689 Bacteria 2090
1055 Ga0495613_0150801 3300046689 Bacteria 1658
1056 Ga0495613_0249178 3300046689 Bacteria 1240
1057 Ga0495670_0164303 3300046691 Bacteria 1167
1058 Ga0495649_0073198 3300046694 Bacteria 1836
1059 Ga0495600_0002947 3300046809 Bacteria 9920
1060 Ga0495581_0091051 3300047315 Bacteria 1769
1061 Ga0495604_0006828 3300047317 Bacteria 9045
1062 Ga0495604_0133762 3300047317 Bacteria 1779
1063 Ga0495636_0001627 3300047318 Bacteria 8550
1064 Ga0495636_0108087 3300047318 Bacteria 1222
1065 Ga0495674_0005220 3300047319 Bacteria 12468
1066 Ga0495674_0044746 3300047319 Bacteria 3934
1067 Ga0495674_0099319 3300047319 Bacteria 2478
1068 Ga0495672_0012941 3300047320 Bacteria 5784
1069 Ga0495672_0068280 3300047320 Bacteria 2021
1070 Ga0495676_0075687 3300047321 Bacteria 2573
1071 Ga0495676_0198730 3300047321 Bacteria 1394
1072 Ga0495680_0011364 3300047322 Bacteria 7884
1073 Ga0495680_0084304 3300047322 Bacteria 2395
1074 Ga0495680_0218492 3300047322 Bacteria 1362
1075 Ga0495683_0128288 3300047323 Bacteria 1198
1076 Ga0495675_0018560 3300047444 Bacteria 4416
1077 Ga0495685_039324 3300047447 Bacteria 1619
1078 Ga0495673_0072452 3300047469 Bacteria 1446
1079 Ga0495673_0163128 3300047469 Bacteria 854
1080 Ga0495684_0009393 3300047471 Bacteria 7549
1081 Ga0495684_0012445 3300047471 Bacteria 6558
1082 Ga0495686_0091685 3300047472 Bacteria 1844
1083 Ga0495602_0215107 3300048088 Bacteria 1455
1084 Ga0495602_0295325 3300048088 Bacteria 1188
1085 Ga0496100_0004796 3300048903 Bacteria 7222
1086 Ga0496100_0006135 3300048903 Bacteria 6537
1087 Ga0496100_0057191 3300048903 Bacteria 2554
1088 Ga0496100_0291498 3300048903 Bacteria 1219
1089 Ga0496101_0000396 3300048904 Bacteria 28444
1090 Ga0496101_0091436 3300048904 Bacteria 2265
1091 Ga0496101_0145159 3300048904 Bacteria 1811
1092 Ga0496101_0257300 3300048904 Bacteria 1361
1093 Ga0496101_0306051 3300048904 Bacteria 1245
1094 Ga0496101_0327649 3300048904 Bacteria 1202
1095 Ga0496101_0611376 3300048904 Bacteria 862
1096 Ga0496102_0008904 3300048905 Bacteria 8613
1097 Ga0496102_0023775 3300048905 Bacteria 5445
1098 Ga0496102_0186737 3300048905 Bacteria 1953
1099 Ga0496102_0421928 3300048905 Bacteria 1253
1100 Ga0496102_0749962 3300048905 Bacteria 899
1101 Ga0496103_0047199 3300048906 Bacteria 2660
1102 Ga0496103_0078931 3300048906 Bacteria 2068
1103 Ga0496103_0103504 3300048906 Bacteria 1804
1104 Ga0496103_0164392 3300048906 Bacteria 1424
1105 Ga0496103_0324263 3300048906 Bacteria 991
1106 Ga0496104_0017385 3300048907 Bacteria 6549
1107 Ga0496104_0022306 3300048907 Bacteria 5815
1108 Ga0496104_0051414 3300048907 Bacteria 3890
1109 Ga0496104_0076019 3300048907 Bacteria 3198
1110 Ga0496104_0096967 3300048907 Bacteria 2821
1111 Ga0496104_0351678 3300048907 Bacteria 1386
1112 Ga0496104_0691205 3300048907 Bacteria 928
1113 Ga0496105_0005725 3300048908 Bacteria 9460
1114 Ga0496105_0114894 3300048908 Bacteria 2220
1115 Ga0496105_0117251 3300048908 Bacteria 2196
1116 Ga0496105_0268131 3300048908 Bacteria 1379
1117 Ga0496105_0410374 3300048908 Bacteria 1074
1118 Ga0496105_0437957 3300048908 Bacteria 1033
1119 Ga0496106_0050105 3300048909 Bacteria 3146
1120 Ga0496106_0318361 3300048909 Bacteria 1248
1121 Ga0496106_0363627 3300048909 Bacteria 1162
1122 Ga0496106_0483966 3300048909 Bacteria 994
1123 Ga0496107_0010686 3300048910 Bacteria 6384
1124 Ga0496107_0028952 3300048910 Bacteria 3939
1125 Ga0496107_0113730 3300048910 Bacteria 1991
1126 Ga0496107_0650031 3300048910 Bacteria 777
1127 Ga0496108_0036186 3300048911 Bacteria 4106
1128 Ga0496108_0401150 3300048911 Bacteria 1198
1129 Ga0496109_0024415 3300048912 Bacteria 5374
1130 Ga0496109_0171156 3300048912 Bacteria 2038
1131 Ga0496109_0561392 3300048912 Bacteria 1077
1132 Ga0496109_0708872 3300048912 Bacteria 944
1133 Ga0496110_0082246 3300048913 Bacteria 2872
1134 Ga0496110_0088473 3300048913 Bacteria 2766
1135 Ga0496110_0168247 3300048913 Bacteria 1988
1136 Ga0496111_0024319 3300048914 Bacteria 4263
1137 Ga0496111_0055372 3300048914 Bacteria 2868
1138 Ga0496111_0123300 3300048914 Bacteria 1915
1139 Ga0496112_0000021 3300048915 Bacteria 156561
1140 Ga0496112_0016237 3300048915 Bacteria 6967
1141 Ga0496112_0029065 3300048915 Bacteria 5344
1142 Ga0496112_0162779 3300048915 Bacteria 2197
1143 Ga0496112_0255816 3300048915 Bacteria 1701
1144 Ga0496112_0295914 3300048915 Bacteria 1564
1145 Ga0496112_0388942 3300048915 Bacteria 1335
1146 Ga0496112_0417381 3300048915 Bacteria 1281
1147 Ga0496113_0032056 3300048916 Bacteria 3817
1148 Ga0496113_0231267 3300048916 Bacteria 1474
1149 Ga0496114_0000246 3300048917 Bacteria 39480
1150 Ga0496114_0059095 3300048917 Bacteria 3202
1151 Ga0496114_0111094 3300048917 Bacteria 2348
1152 Ga0496114_0148509 3300048917 Bacteria 2033
1153 Ga0496114_0168207 3300048917 Bacteria 1909
1154 Ga0496114_0288243 3300048917 Bacteria 1448
1155 Ga0496114_0623350 3300048917 Bacteria 950
1156 Ga0496114_0837761 3300048917 Bacteria 799
1157 Ga0496115_0025980 3300048918 Bacteria 4565
1158 Ga0496115_0038310 3300048918 Bacteria 3803
1159 Ga0496115_0076504 3300048918 Bacteria 2720
1160 Ga0496115_0132538 3300048918 Bacteria 2054
1161 Ga0496116_0003008 3300048919 Bacteria 17086
1162 Ga0496116_0150275 3300048919 Bacteria 1295
1163 Ga0496117_0076188 3300048920 Bacteria 2225
1164 Ga0496117_0214415 3300048920 Bacteria 1077
1165 Ga0496118_0075512 3300048921 Bacteria 2403
1166 Ga0496118_0179456 3300048921 Bacteria 1281
1167 Ga0496119_0000469 3300048922 Bacteria 54992
1168 Ga0496119_0000855 3300048922 Bacteria 40135
1169 Ga0496119_0119768 3300048922 Bacteria 1449
1170 Ga0496120_0000372 3300048923 Bacteria 72951
1171 Ga0496120_0001942 3300048923 Bacteria 22686
1172 Ga0496121_0066731 3300048924 Bacteria 2920
1173 Ga0496122_0025808 3300048925 Bacteria 5088
1174 Ga0496122_0147325 3300048925 Bacteria 1460
1175 Ga0496123_0145460 3300048926 Bacteria 1288
1176 Ga0496123_0196005 3300048926 Bacteria 1040
1177 Ga0496123_0269995 3300048926 Bacteria 828
1178 Ga0496124_0000697 3300048927 Bacteria 55040
1179 Ga0496124_0023250 3300048927 Bacteria 5663
1180 Ga0496125_0050981 3300048928 Bacteria 3419
1181 Ga0496125_0075979 3300048928 Bacteria 2596
1182 Ga0496125_0084741 3300048928 Bacteria 2405
1183 Ga0496125_0175500 3300048928 Bacteria 1434
1184 Ga0496126_0024730 3300048929 Bacteria 5793
1185 Ga0496126_0039091 3300048929 Bacteria 4406
1186 Ga0496126_0131756 3300048929 Bacteria 2160
1187 Ga0496126_0221452 3300048929 Bacteria 1589
1188 Ga0501306_000191 3300049127 Bacteria 4081
1189 Ga0501309_005550 3300049129 Bacteria 1508
1190 Ga0501343_001886 3300049132 Bacteria 1458
1191 Ga0501305_001225 3300049161 Bacteria 2459
1192 Ga0501312_000027 3300049528 Bacteria 8927
1193 Ga0501313_006374 3300049529 Bacteria 1277
1194 Ga0501315_001573 3300049531 Bacteria 1990
1195 Ga0501316_000050 3300049532 Bacteria 5210
1196 Ga0501317_020591 3300049533 Bacteria 890
1197 Ga0501318_008883 3300049534 Bacteria 1084
1198 Ga0501321_000062 3300049537 Bacteria 4755
1199 Ga0501323_006864 3300049539 Bacteria 1283
1200 Ga0501323_009825 3300049539 Bacteria 1132
1201 Ga0501324_000425 3300049540 Bacteria 2250
1202 Ga0501330_001473 3300049546 Bacteria 1223
1203 Ga0501331_00589 3300049547 Bacteria 1538
1204 Ga0501334_00263 3300049550 Bacteria 2190
1205 Ga0501335_002359 3300049551 Bacteria 1527
1206 Ga0501337_000411 3300049553 Bacteria 2076
1207 Ga0501031_0026834 3300049568 Bacteria 3755
1208 Ga0501032_0157219 3300049569 Bacteria 1493
1209 Ga0501033_0020411 3300049570 Bacteria 5004
1210 Ga0501036_0000860 3300049572 Bacteria 22572
1211 Ga0501036_0002708 3300049572 Bacteria 13991
1212 Ga0501036_0812469 3300049572 Bacteria 770
1213 Ga0501037_0140123 3300049573 Bacteria 1731
1214 Ga0501037_0159544 3300049573 Bacteria 1608
1215 Ga0501038_0001811 3300049574 Bacteria 19789
1216 Ga0501038_0136222 3300049574 Bacteria 2012
1217 Ga0501038_0140860 3300049574 Bacteria 1973
1218 Ga0501038_0471655 3300049574 Bacteria 963
1219 Ga0501039_0001335 3300049575 Bacteria 18046
1220 Ga0501039_0099511 3300049575 Bacteria 2269
1221 Ga0501040_0011405 3300049576 Bacteria 5819
1222 Ga0501040_0209109 3300049576 Bacteria 1387
1223 Ga0501040_0217457 3300049576 Bacteria 1359
1224 Ga0501042_0000788 3300049578 Bacteria 17357
1225 Ga0501042_0000948 3300049578 Bacteria 16341
1226 Ga0501042_0030263 3300049578 Bacteria 3822
1227 Ga0501042_0309490 3300049578 Bacteria 1141
1228 Ga0501046_0013103 3300049580 Bacteria 7039
1229 Ga0501046_0072436 3300049580 Bacteria 2675
1230 Ga0501046_0081548 3300049580 Bacteria 2498
1231 Ga0501046_0254330 3300049580 Bacteria 1292
1232 Ga0501047_0495817 3300049581 Bacteria 1048
1233 Ga0501048_0010899 3300049582 Bacteria 6779
1234 Ga0501048_0126860 3300049582 Bacteria 1804
1235 Ga0501067_0316826 3300049583 Bacteria 869
1236 Ga0501068_0008573 3300049584 Bacteria 5695
1237 Ga0501068_0285823 3300049584 Bacteria 1054
1238 Ga0501068_0356357 3300049584 Bacteria 941
1239 Ga0501069_0120845 3300049585 Bacteria 1496
1240 Ga0501069_0250475 3300049585 Bacteria 1033
1241 Ga0501069_0394380 3300049585 Bacteria 819
1242 Ga0501070_0046253 3300049586 Bacteria 3619
1243 Ga0501070_0176515 3300049586 Bacteria 1759
1244 Ga0501071_0000849 3300049587 Bacteria 16382
1245 Ga0501071_0017192 3300049587 Bacteria 4985
1246 Ga0501071_0267403 3300049587 Bacteria 1292
1247 Ga0501071_0327320 3300049587 Bacteria 1164
1248 Ga0501072_0003324 3300049588 Bacteria 12098
1249 Ga0501072_0005776 3300049588 Bacteria 9420
1250 Ga0501072_0015507 3300049588 Bacteria 5840
1251 Ga0501072_0104806 3300049588 Bacteria 2248
1252 Ga0501072_0390925 3300049588 Bacteria 1103
1253 Ga0501073_0030743 3300049589 Bacteria 3833
1254 Ga0501073_0123746 3300049589 Bacteria 1793
1255 Ga0501073_0217775 3300049589 Bacteria 1319
1256 Ga0501074_0003006 3300049590 Bacteria 11867
1257 Ga0501074_0030693 3300049590 Bacteria 3895
1258 Ga0501074_0121731 3300049590 Bacteria 1866
1259 Ga0501075_0001033 3300049591 Bacteria 17853
1260 Ga0501075_0001990 3300049591 Bacteria 13490
1261 Ga0501075_0062695 3300049591 Bacteria 2802
1262 Ga0501075_0127092 3300049591 Bacteria 1941
1263 Ga0501075_0193300 3300049591 Bacteria 1552
1264 Ga0501075_0296467 3300049591 Bacteria 1232
1265 Ga0501075_0471046 3300049591 Bacteria 958
1266 Ga0501076_0000979 3300049592 Bacteria 18705
1267 Ga0501076_0007813 3300049592 Bacteria 7796
1268 Ga0501076_0083902 3300049592 Bacteria 2559
1269 Ga0501076_0167771 3300049592 Bacteria 1789
1270 Ga0501076_0300849 3300049592 Bacteria 1315
1271 Ga0501076_0837691 3300049592 Bacteria 759
1272 Ga0501077_0047329 3300049593 Bacteria 2732
1273 Ga0501077_0116299 3300049593 Bacteria 1695
1274 Ga0501077_0183440 3300049593 Bacteria 1330
1275 Ga0501077_0211487 3300049593 Bacteria 1232
1276 Ga0501079_0001475 3300049741 Bacteria 16640
1277 Ga0501079_0006844 3300049741 Bacteria 8584
1278 Ga0501079_0029406 3300049741 Bacteria 4218
1279 Ga0501079_0155940 3300049741 Bacteria 1780
1280 Ga0501079_0185343 3300049741 Bacteria 1625
1281 Ga0501079_0208772 3300049741 Bacteria 1525
1282 Ga0501080_0001334 3300049742 Bacteria 20578
1283 Ga0501080_0056648 3300049742 Bacteria 3649
1284 Ga0501081_0001239 3300049743 Bacteria 15520
1285 Ga0501081_0002378 3300049743 Bacteria 11848
1286 Ga0501081_0038071 3300049743 Bacteria 3284
1287 Ga0501081_0167681 3300049743 Bacteria 1584
1288 Ga0501083_0023121 3300049744 Bacteria 4312
1289 Ga0501083_0055182 3300049744 Bacteria 2665
1290 Ga0501083_0101198 3300049744 Bacteria 1900
1291 Ga0501083_0145723 3300049744 Bacteria 1550
1292 Ga0501279_004537 3300049775 Bacteria 1825
1293 Ga0501035_0029667 3300049822 Bacteria 4988
1294 Ga0501044_0479138 3300049823 Bacteria 1148
1295 Ga0501044_0660016 3300049823 Archaea 934
1296 Ga0501045_0000682 3300049824 Bacteria 21537
1297 Ga0501045_0046088 3300049824 Bacteria 3175
1298 Ga0501045_0054025 3300049824 Bacteria 2936
1299 Ga0501045_0084069 3300049824 Bacteria 2348
1300 Ga0501045_0201880 3300049824 Bacteria 1481
1301 nmdc:mga03n38_108690_c1 3300050490 Bacteria 1347
1302 nmdc:mga03n38_60592_c1 3300050490 Bacteria 1721
1303 nmdc:mga00v17_105905_c1 3300050491 Bacteria 1780
1304 nmdc:mga00v17_371009_c1 3300050491 Bacteria 930
1305 nmdc:mga00v17_94313_c1 3300050491 Bacteria 1883
1306 nmdc:mga0yw44_270499_c1 3300050492 Bacteria 1134
1307 nmdc:mga0yw44_36883_c1 3300050492 Bacteria 2883
1308 nmdc:mga0yw44_70411_c1 3300050492 Bacteria 2168
1309 nmdc:mga0k408_1106_c1 3300050493 Bacteria 14761
1310 nmdc:mga0k408_259294_c1 3300050493 Bacteria 1038
1311 nmdc:mga06z11_24896_c1 3300050494 Bacteria 2830
1312 nmdc:mga06z11_60721_c1 3300050494 Bacteria 1969
1313 nmdc:mga04h51_35660_c1 3300050495 Bacteria 1596
1314 nmdc:mga07m45_201586_c1 3300050496 Bacteria 1157
1315 nmdc:mga07m45_63339_c1 3300050496 Bacteria 2097
1316 nmdc:mga05p37_13622_c1 3300050507 Bacteria 9746
1317 nmdc:mga05p37_16973_c1 3300050507 Bacteria 8780
1318 nmdc:mga05p37_202056_c1 3300050507 Bacteria 2406
1319 nmdc:mga05p37_20610_c1 3300050507 Bacteria 7977
1320 nmdc:mga05p37_246472_c1 3300050507 Bacteria 2145
1321 nmdc:mga05p37_25099_c1 3300050507 Bacteria 7247
1322 nmdc:mga05p37_3048_c1 3300050507 Bacteria 19460
1323 nmdc:mga05p37_306353_c1 3300050507 Bacteria 1885
1324 nmdc:mga05p37_3121_c1 3300050507 Bacteria 19253
1325 nmdc:mga05p37_46662_c1 3300050507 Bacteria 5326
1326 nmdc:mga05p37_595_c1 3300050507 Bacteria 25325
1327 nmdc:mga05p37_613385_c1 3300050507 Bacteria 1226
1328 nmdc:mga05p37_75038_c1 3300050507 Bacteria 4163
1329 nmdc:mga05p37_84346_c1 3300050507 Bacteria 3914
1330 nmdc:mga05p37_88852_c1 3300050507 Bacteria 3808
1331 nmdc:mga09592_110445_c1 3300050508 Bacteria 2359
1332 nmdc:mga09592_13724_c1 3300050508 Bacteria 6620
1333 nmdc:mga09592_255574_c1 3300050508 Bacteria 1519
1334 nmdc:mga09592_388521_c1 3300050508 Bacteria 1206
1335 nmdc:mga09592_462264_c1 3300050508 Bacteria 1094
1336 nmdc:mga09592_7943_c1 3300050508 Bacteria 8620
1337 nmdc:mga0qj67_24449_c1 3300050509 Bacteria 4656
1338 nmdc:mga0qj67_420840_c1 3300050509 Bacteria 1077
1339 nmdc:mga0qj67_5121_c1 3300050509 Bacteria 9545
1340 nmdc:mga0qj67_610644_c1 3300050509 Bacteria 872
1341 nmdc:mga06r32_350562_c1 3300050510 Bacteria 1460
1342 nmdc:mga06r32_51901_c1 3300050510 Bacteria 3926
1343 nmdc:mga06r32_545174_c1 3300050510 Bacteria 1134
1344 nmdc:mga06r32_649826_c1 3300050510 Bacteria 1023
1345 nmdc:mga06r32_86458_c1 3300050510 Bacteria 3058
1346 nmdc:mga08y16_169354_c1 3300050511 Bacteria 2269
1347 nmdc:mga08y16_17177_c1 3300050511 Bacteria 7617
1348 nmdc:mga08y16_236383_c1 3300050511 Bacteria 1889
1349 nmdc:mga08y16_371187_c1 3300050511 Bacteria 1468
1350 nmdc:mga08y16_399570_c1 3300050511 Bacteria 1407
1351 nmdc:mga08y16_4339_c1 3300050511 Bacteria 14819
1352 nmdc:mga08y16_517196_c1 3300050511 Bacteria 1211
1353 nmdc:mga08y16_927899_c1 3300050511 Bacteria 855
1354 nmdc:mga0n895_1001604_c1 3300050512 Bacteria 817
1355 nmdc:mga0n895_142639_c1 3300050512 Bacteria 2424
1356 nmdc:mga0n895_17757_c1 3300050512 Bacteria 6566
1357 nmdc:mga0n895_27160_c1 3300050512 Bacteria 5435
1358 nmdc:mga0n895_602462_c1 3300050512 Bacteria 1101
1359 nmdc:mga0n895_7101_c1 3300050512 Bacteria 9574
1360 nmdc:mga0rr50_149780_c1 3300050513 Bacteria 1884
1361 nmdc:mga0rr50_21352_c1 3300050513 Bacteria 4418
1362 nmdc:mga0rr50_2205_c1 3300050513 Bacteria 10927
1363 nmdc:mga0rr50_373_c1 3300050513 Bacteria 24506
1364 nmdc:mga0rr50_39611_c1 3300050513 Bacteria 3420
1365 nmdc:mga0rr50_60229_c1 3300050513 Bacteria 2855
1366 nmdc:mga08x19_22597_c1 3300050514 Bacteria 3896
1367 nmdc:mga08x19_34220_c1 3300050514 Bacteria 3210
1368 nmdc:mga08x19_632680_c1 3300050514 Bacteria 759
1369 nmdc:mga08x19_90727_c1 3300050514 Bacteria 2017
1370 nmdc:mga0a205_10346_c1 3300050515 Bacteria 8575
1371 nmdc:mga0a205_106213_c1 3300050515 Bacteria 2706
1372 nmdc:mga0a205_47564_c1 3300050515 Bacteria 4140
1373 nmdc:mga0a205_608134_c1 3300050515 Bacteria 946
1374 nmdc:mga0a205_6655_c1 3300050515 Bacteria 10458
1375 nmdc:mga0a205_72605_c1 3300050515 Bacteria 3325
1376 nmdc:mga0a205_929598_c1 3300050515 Bacteria 716
1377 nmdc:mga0sz30_129744_c1 3300050516 Bacteria 1110
1378 Ga0495601_0002901 3300053077 Bacteria 9754
1379 Ga0495601_0028459 3300053077 Bacteria 3461
1380 Ga0495601_0164829 3300053077 Bacteria 1448
1381 Ga0495612_0202295 3300053078 Bacteria 876
1382 Ga0500610_0104299 3300053079 Bacteria 1464
1383 Ga0500610_0111281 3300053079 Bacteria 1408
1384 Ga0495655_0010860 3300053083 Bacteria 1812
1385 Ga0495655_0026693 3300053083 Bacteria 1363
1386 Ga0495655_0066699 3300053083 Bacteria 996
1387 Ga0495595_0001331 3300053084 Bacteria 9608
1388 Ga0495595_0072896 3300053084 Bacteria 1626
1389 Ga0495619_0004075 3300053085 Bacteria 9360
1390 Ga0495619_0004232 3300053085 Bacteria 9147
1391 Ga0495619_0010190 3300053085 Bacteria 5920
1392 Ga0495619_0144447 3300053085 Bacteria 1640
1393 Ga0495619_0161747 3300053085 Bacteria 1546
1394 Ga0500646_0060290 3300053090 Bacteria 1115
1395 Ga0500651_0004275 3300053093 Bacteria 7979
1396 Ga0500651_0226764 3300053093 Bacteria 1094
1397 Ga0500566_0018854 3300053094 Bacteria 4051
1398 Ga0500641_0007395 3300053096 Bacteria 3916
1399 Ga0500556_0082237 3300053104 Bacteria 1219
1400 Ga0500595_001142 3300053119 Bacteria 14731
1401 Ga0500595_008139 3300053119 Bacteria 4302
1402 Ga0500595_009814 3300053119 Bacteria 3844
1403 Ga0500607_017101 3300053121 Bacteria 4143
1404 Ga0500608_077661 3300053122 Bacteria 1572
1405 Ga0500618_009735 3300053125 Bacteria 2612
1406 Ga0500642_0001169 3300053130 Bacteria 7523
1407 Ga0500642_0097290 3300053130 Bacteria 1365
1408 Ga0500655_000265 3300053133 Bacteria 12247
1409 Ga0500559_0002179 3300053136 Bacteria 10352
1410 Ga0500559_0034952 3300053136 Bacteria 2168
1411 Ga0500559_0077114 3300053136 Bacteria 1509
1412 Ga0500568_0006975 3300053139 Bacteria 5597
1413 Ga0500568_0017398 3300053139 Bacteria 3175
1414 Ga0500588_0014706 3300053146 Bacteria 1990
1415 Ga0500589_108869 3300053147 Bacteria 1191
1416 Ga0500590_004805 3300053148 Bacteria 6438
1417 Ga0500622_0012750 3300053156 Bacteria 4544
1418 Ga0500639_055045 3300053163 Bacteria 2064
1419 Ga0500636_0039323 3300053177 Bacteria 2797
1420 Ga0500636_0045197 3300053177 Bacteria 2598
1421 Ga0500637_0004731 3300053178 Bacteria 6508
1422 Ga0500570_032123 3300053724 Bacteria 2826
1423 Ga0500645_004711 3300053730 Bacteria 5179
1424 Ga0501084_0000677 3300054114 Bacteria 25964
1425 Ga0501084_0004051 3300054114 Bacteria 11934
1426 Ga0501084_0084348 3300054114 Bacteria 2667
1427 Ga0501084_0176773 3300054114 Bacteria 1802
1428 Ga0501084_1136244 3300054114 Bacteria 656
1429 Ga0500661_006321 3300055283 Bacteria 2204
1430 Ga0590071_000185 3300059421 Bacteria 18146
1431 Ga0590071_055211 3300059421 Bacteria 965
1432 Ga0590074_015090 3300059423 Bacteria 1309
1433 Ga0590075_000204 3300059424 Bacteria 16569
1434 Ga0590075_035646 3300059424 Bacteria 1267
1435 Ga0590077_020629 3300059426 Bacteria 1399
1436 Ga0587067_002632 3300059640 Bacteria 2154
1437 Ga0587067_018834 3300059640 Bacteria 1163
1438 Ga0587072_000329 3300059643 Bacteria 4520
1439 Ga0587072_024465 3300059643 Bacteria 1092
1440 Ga0501082_0002099 3300060353 Bacteria 17551
1441 Ga0501082_0002693 3300060353 Bacteria 15524
1442 Ga0501082_0025899 3300060353 Bacteria 5055
1443 Ga0501082_0100518 3300060353 Bacteria 2502
1444 Ga0501082_0200131 3300060353 Bacteria 1738
1445 Ga0501082_0205454 3300060353 Bacteria 1714
1446 Ga0501082_0246512 3300060353 Bacteria 1555
1447 Ga0501082_1048034 3300060353 Bacteria 713
1448 Ga0530510_0001293 3300061734 Bacteria 16724
1449 Ga0530510_0009637 3300061734 Bacteria 6776
1450 Ga0530510_0058439 3300061734 Bacteria 2788
1451 2528204309 2527291627 Bacteria 5309833
1452 2528212121 2527291629 Bacteria 5267418
1453 2546946880 2546825537 Bacteria 5389291
1454 2563930209 2563366752 Bacteria 4961801
1455 2579747611 2576861822 Bacteria 5004595
1456 2643738859 2643221543 Bacteria 6628015
1457 2673167462 2671180531 Bacteria 9045424
1458 2686543605 2684623036 Bacteria 5199090
1459 2710602541 2710264753 Bacteria 5455564
1460 2774867002 2773857924 Bacteria 5256821
1461 2774902886 2773857933 Bacteria 5818019
1462 2821118338 2821111986 Bacteria 6894338
1463 2864738854 2864733723 Bacteria 6770668
1464 2876810452 2876808645 Bacteria 8824342
1465 2885529898 2885526491 Bacteria 7164189
1466 2889047992 2889042446 Bacteria 7618936
1467 2902335199 2902330777 Bacteria 6395352
1468 2904168171 2904162308 Bacteria 7086713
1469 2904496932 2904490793 Bacteria 7046938
1470 2907208182 2907202186 Bacteria 6632024
1471 2919166265 2919160200 Bacteria 6929020
1472 2931385098 2931384279 Bacteria 7299545
1473 2939685140 2939679117 Bacteria 6921672
1474 2945996279 2945991243 Bacteria 7008369
1475 2946058969 2946053406 Bacteria 6978655
1476 637877936 637000116 Bacteria 5433628
1477 Ga0070694_100016422
1478 JGI25162J39368_1009314
1479 JGI25151J46595_10028272
1480 JGI25407J50210_10043710
1481 Ga0055538_1000286
1482 Ga0055531_10022595
1483 Ga0065712_10010472
1484 Ga0065715_10004682
1485 Ga0065715_10138461
1486 Ga0065707_10004657
1487 Ga0065707_10305482
1488 Ga0070658_10000172
1489 Ga0070658_10118295
1490 Ga0070676_10010331
1491 Ga0070676_10017267
1492 Ga0070676_10064218
1493 Ga0070676_10303732
1494 Ga0070683_100334615
1495 Ga0070683_100377411
1496 Ga0070683_100828082
1497 Ga0070690_100006534
1498 Ga0070690_100196991
1499 Ga0070670_100082822
1500 Ga0070677_10098834
1501 Ga0070677_10151331
1502 Ga0068869_100162850
1503 Ga0068869_100163409
1504 Ga0068869_100169508
1505 Ga0068869_100188225
1506 Ga0068869_100310801
1507 Ga0068869_100414370
1508 Ga0070666_10007809
1509 Ga0070666_10356367
1510 Ga0070680_100073734
1511 Ga0070680_100136701
1512 Ga0070680_100154450
1513 Ga0070680_100233985
1514 Ga0068868_100081704
1515 Ga0068868_100221694
1516 Ga0068868_100599576
1517 Ga0070660_100002987
1518 Ga0070660_100007791
1519 Ga0070660_100230165
1520 Ga0070660_100267782
1521 Ga0070660_100312906
1522 Ga0070689_100064561
1523 Ga0070689_100111866
1524 Ga0070689_100118410
1525 Ga0070691_10421015
1526 Ga0070687_100012998
1527 Ga0070687_100030822
1528 Ga0070687_100076243
1529 Ga0070661_100195221
1530 Ga0070661_100343556
1531 Ga0070668_100000831
1532 Ga0070668_100098740
1533 Ga0070668_100108161
1534 Ga0070668_100161136
1535 Ga0070668_100206942
1536 Ga0070668_100603160
1537 Ga0070669_100035389
1538 Ga0070675_100000056
1539 Ga0070675_100004703
1540 Ga0070675_100401556
1541 Ga0070675_100442461
1542 Ga0070671_100024169
1543 Ga0070671_100096780
1544 Ga0070671_100260964
1545 Ga0070671_100395569
1546 Ga0070671_100453285
1547 Ga0070671_100893792
1548 Ga0070674_100050917
1549 Ga0070674_100118101
1550 Ga0070674_100192087
1551 Ga0070674_100208681
1552 Ga0070674_100371545
1553 Ga0070673_100003427
1554 Ga0070673_100173677
1555 Ga0070673_100324956
1556 Ga0070673_100387519
1557 Ga0070673_100966862
1558 Ga0070688_100070904
1559 Ga0070688_100225636
1560 Ga0070688_100239703
1561 Ga0070659_100059884
1562 Ga0070659_100300889
1563 Ga0070667_100172226
1564 Ga0070703_10227179
1565 Ga0070709_10004324
1566 Ga0070709_10143061
1567 Ga0070709_10694899
1568 Ga0070714_100282011
1569 Ga0070714_100389823
1570 Ga0070714_100505011
1571 Ga0070714_100651634
1572 Ga0070713_100000161
1573 Ga0070713_100025501
1574 Ga0070713_100025646
1575 Ga0070713_100138736
1576 Ga0070713_100176408
1577 Ga0070710_10001033
1578 Ga0070710_10009605
1579 Ga0070701_10094219
1580 Ga0070711_100297575
1581 Ga0070711_100511941
1582 Ga0070705_100008402
1583 Ga0070705_100492435
1584 Ga0070705_100732606
1585 Ga0070700_100040018
1586 Ga0070700_100041014
1587 Ga0070700_100223853
1588 Ga0070708_100010139
1589 Ga0070708_100028126
1590 Ga0070708_100259760
1591 Ga0070708_100725669
1592 Ga0070663_100239507
1593 Ga0070678_100027149
1594 Ga0070678_100120735
1595 Ga0070678_100379642
1596 Ga0070678_100483707
1597 Ga0070662_100170816
1598 Ga0070662_100224409
1599 Ga0070662_100283201
1600 Ga0070662_100336558
1601 Ga0070662_100514343
1602 Ga0070681_10018722
1603 Ga0070681_10042357
1604 Ga0070681_10047185
1605 Ga0070681_10122730
1606 Ga0070681_10579647
1607 Ga0068867_100223195
1608 Ga0068867_100420557
1609 Ga0068867_100505350
1610 Ga0070685_10071840
1611 Ga0070706_100052012
1612 Ga0070706_100994669
1613 Ga0070707_100119560
1614 Ga0070707_100174339
1615 Ga0070707_100463032
1616 Ga0070707_100579001
1617 Ga0070698_100042981
1618 Ga0070698_100063884
1619 Ga0070698_100114045
1620 Ga0070698_100247677
1621 Ga0070699_100006991
1622 Ga0070699_100042746
1623 Ga0070699_100182694
1624 Ga0070699_100198658
1625 Ga0070699_100522629
1626 Ga0070679_100044653
1627 Ga0070679_100087883
1628 Ga0070679_100124874
1629 Ga0070679_100325809
1630 Ga0070679_100443557
1631 Ga0070684_100100706
1632 Ga0070684_100148186
1633 Ga0070684_100716926
1634 Ga0070697_100022127
1635 Ga0070697_100327097
1636 Ga0068853_100030559
1637 Ga0068853_100370174
1638 Ga0068853_100848526
1639 Ga0068853_101093302
1640 Ga0070672_100139503
1641 Ga0070672_100366412
1642 Ga0070686_100002243
1643 Ga0070686_100103111
1644 Ga0070686_100147971
1645 Ga0070686_100170290
1646 Ga0070686_100588637
1647 Ga0070695_100003541
1648 Ga0070695_100062147
1649 Ga0070695_100114416
1650 Ga0070695_100173196
1651 Ga0070695_100395332
1652 Ga0070696_100004194
1653 Ga0070696_100182976
1654 Ga0070693_100155270
1655 Ga0070665_100000109
1656 Ga0070665_100010437
1657 Ga0070665_100188766
1658 Ga0070665_100769035
1659 Ga0070704_100011568
1660 Ga0070704_100019087
1661 Ga0070704_100138326
1662 Ga0068855_100017220
1663 Ga0068855_100019504
1664 Ga0068855_100191323
1665 Ga0068855_100825222
1666 Ga0070664_100169782
1667 Ga0070664_100390429
1668 Ga0070664_100543812
1669 Ga0068857_100063077
1670 Ga0068857_100894793
1671 Ga0068854_100213124
1672 Ga0068854_100277683
1673 Ga0068854_100669936
1674 Ga0068856_100018557
1675 Ga0068856_100254817
1676 Ga0068856_100937987
1677 Ga0068852_100032860
1678 Ga0068852_100305253
1679 Ga0068852_100645832
1680 Ga0068859_100021003
1681 Ga0068859_100065113
1682 Ga0068859_100219454
1683 Ga0068859_100427652
1684 Ga0068859_100650905
1685 Ga0068859_100664279
1686 Ga0068859_100869196
1687 Ga0068864_100023234
1688 Ga0068864_100063762
1689 Ga0068864_100830112
1690 Ga0068866_10013064
1691 Ga0068866_10240660
1692 Ga0068861_100067590
1693 Ga0068861_100073792
1694 Ga0068861_100095518
1695 Ga0068861_100138254
1696 Ga0068861_100200552
1697 Ga0068861_100362892
1698 Ga0068861_100436014
1699 Ga0068861_100553653
1700 Ga0068851_10465475
1701 Ga0068870_10017565
1702 Ga0068870_10104977
1703 Ga0068863_100000017
1704 Ga0068863_100017228
1705 Ga0068863_100091547
1706 Ga0068863_100098324
1707 Ga0068863_100177459
1708 Ga0068863_100221469
1709 Ga0068863_100269671
1710 Ga0068863_100395752
1711 Ga0068863_100682508
1712 Ga0068858_100001254
1713 Ga0068858_100036297
1714 Ga0068858_100213833
1715 Ga0068858_100304218
1716 Ga0068858_100325108
1717 Ga0068858_100341758
1718 Ga0068858_100443973
1719 Ga0068860_100196477
1720 Ga0068860_100204933
1721 Ga0068860_100222812
1722 Ga0068862_100021021
1723 Ga0068862_100243979
1724 Ga0068862_100256173
1725 Ga0068862_100388290
1726 Ga0068862_100477468
1727 Ga0068862_100654087
1728 Ga0081455_10020035
1729 Ga0081455_10062986
1730 Ga0081455_10094886
1731 Ga0081455_10196227
1732 Ga0081538_10028271
1733 Ga0081538_10159526
1734 Ga0081540_1029909
1735 Ga0081540_1060207
1736 Ga0081539_10028512
1737 Ga0070717_10058494
1738 Ga0070717_10078925
1739 Ga0070717_10083134
1740 Ga0070717_10210245
1741 Ga0070717_10242212
1742 Ga0075365_10064596
1743 Ga0075365_10150506
1744 Ga0075365_10183350
1745 Ga0075368_10029905
1746 Ga0075364_10034870
1747 Ga0070715_10001976
1748 Ga0070716_100009024
1749 Ga0070716_100087778
1750 Ga0070716_100149702
1751 Ga0070716_100545086
1752 Ga0070712_100013564
1753 Ga0070712_100059771
1754 Ga0075362_10019673
1755 Ga0075362_10074422
1756 Ga0075367_10011148
1757 Ga0075367_10096682
1758 Ga0075367_10138559
1759 Ga0075369_10052067
1760 Ga0075369_10056907
1761 Ga0075369_10256154
1762 Ga0075366_10003380
1763 Ga0075366_10077818
1764 Ga0075366_10301324
1765 Ga0097621_100006061
1766 Ga0097621_100015176
1767 Ga0097621_100139647
1768 Ga0097621_100193670
1769 Ga0068871_100001728
1770 Ga0068871_100088164
1771 Ga0068871_100113852
1772 Ga0068871_100270635
1773 Ga0068871_100318050
1774 Ga0068871_100360462
1775 Ga0075428_100002425
1776 Ga0075428_100040963
1777 Ga0075428_100055934
1778 Ga0075428_100070820
1779 Ga0075428_100238517
1780 Ga0075428_100835067
1781 Ga0075430_100063762
1782 Ga0075430_100237034
1783 Ga0075430_100409994
1784 Ga0075431_100003805
1785 Ga0075431_100006978
1786 Ga0075431_100052518
1787 Ga0075431_100342636
1788 Ga0075433_10095035
1789 Ga0075433_10096964
1790 Ga0075433_10114798
1791 Ga0075433_10142642
1792 Ga0075433_10206637
1793 Ga0075433_10373859
1794 Ga0075434_100123476
1795 Ga0075434_100146743
1796 Ga0075434_100208694
1797 Ga0075434_100224809
1798 Ga0075434_100240424
1799 Ga0075434_100543569
1800 Ga0075434_100777727
1801 Ga0075429_100004225
1802 Ga0075429_100010320
1803 Ga0075429_100067833
1804 Ga0075429_100078704
1805 Ga0068865_100468691
1806 Ga0075436_100028497
1807 Ga0075436_100031296
1808 Ga0075436_100049304
1809 Ga0075436_100057089
1810 Ga0075436_100058745
1811 Ga0075436_100100249
1812 Ga0075436_100109094
1813 Ga0097620_100021003
1814 Ga0097620_100065113
1815 Ga0097620_100219454
1816 Ga0097620_100427650
1817 Ga0097620_100650838
1818 Ga0097620_100664276
1819 Ga0097620_100869340
1820 Ga0079104_1024112
1821 Ga0075435_100001542
1822 Ga0075435_100001694
1823 Ga0075435_100039831
1824 Ga0075435_100070719
1825 Ga0075435_100083105
1826 Ga0075435_100283065
1827 Ga0075435_100343739
1828 Ga0099794_10012544
1829 Ga0099794_10028448
1830 Ga0099794_10064512
1831 Ga0099794_10077253
1832 Ga0099794_10119509
1833 Ga0099794_10152346
1834 Ga0099795_10044771
1835 Ga0105251_10038598
1836 Ga0105244_10017034
1837 Ga0105244_10032973
1838 Ga0105240_10045226
1839 Ga0105240_10077161
1840 Ga0105240_10287205
1841 Ga0105240_10363484
1842 Ga0111539_10000566
1843 Ga0111539_10007255
1844 Ga0111539_10170273
1845 Ga0111539_10286952
1846 Ga0111539_10514804
1847 Ga0111539_10520909
1848 Ga0111539_10903261
1849 Ga0111539_11122142
1850 Ga0105245_10026276
1851 Ga0105245_10068939
1852 Ga0105245_10144359
1853 Ga0105245_10238041
1854 Ga0105245_10276752
1855 Ga0105245_10395640
1856 Ga0105245_10586056
1857 Ga0105245_11385278
1858 Ga0105247_10000016
1859 Ga0105247_10004209
1860 Ga0105247_10009289
1861 Ga0105247_10024345
1862 Ga0105247_10056718
1863 Ga0105247_10127988
1864 Ga0105247_10391050
1865 Ga0114129_10000431
1866 Ga0114129_10001150
1867 Ga0114129_10002840
1868 Ga0114129_10004861
1869 Ga0114129_10060820
1870 Ga0114129_10078194
1871 Ga0114129_10106586
1872 Ga0114129_10122991
1873 Ga0114129_10201915
1874 Ga0114129_10220032
1875 Ga0114129_10359401
1876 Ga0114129_10381813
1877 Ga0114129_10546194
1878 Ga0114129_10788848
1879 Ga0114129_11063128
1880 Ga0114129_11118264
1881 Ga0114129_11245379
1882 Ga0105243_10301519
1883 Ga0105243_10611995
1884 Ga0105241_10087967
1885 Ga0105242_10184408
1886 Ga0105242_10223480
1887 Ga0105242_10228102
1888 Ga0105242_10386775
1889 Ga0105242_10607423
1890 Ga0105248_10002899
1891 Ga0105248_10019507
1892 Ga0105248_10088320
1893 Ga0105248_10088554
1894 Ga0105248_10094826
1895 Ga0105248_10110426
1896 Ga0105248_10125984
1897 Ga0105248_10135047
1898 Ga0105248_10169500
1899 Ga0105248_10280794
1900 Ga0105248_10371694
1901 Ga0105248_10910328
1902 Ga0105248_11118400
1903 Ga0105248_11158940
1904 Ga0105237_10210301
1905 Ga0105237_10354917
1906 Ga0105237_10408686
1907 Ga0105238_10658969
1908 Ga0105249_10020004
1909 Ga0105249_10048671
1910 Ga0105249_10184437
1911 Ga0105249_10508957
1912 Ga0105249_10546879
1913 Ga0099796_10011242
1914 Ga0099796_10040627
1915 Ga0105239_10386387
1916 Ga0105239_10561888
1917 Ga0105239_10950756
1918 Ga0105246_10000488
1919 Ga0105246_10002877
1920 Ga0105246_10048926
1921 Ga0105246_10345968
1922 Ga0105246_10609482
1923 Ga0157370_10256810
1924 Ga0157369_10316730
1925 Ga0157374_10216462
1926 Ga0157374_10224096
1927 Ga0157374_10338628
1928 Ga0157374_10353337
1929 Ga0157378_10052663
1930 Ga0157378_10145914
1931 Ga0157378_10391315
1932 Ga0163162_10115851
1933 Ga0163162_10229606
1934 Ga0163162_10330796
1935 Ga0163162_10392743
1936 Ga0163162_11158825
1937 Ga0157372_10964963
1938 Ga0157375_10139830
1939 Ga0157375_10173554
1940 Ga0157375_10435333
1941 Ga0157375_10519216
1942 Ga0157375_10662569
1943 Ga0157375_10871853
1944 Ga0157375_10926635
1945 Ga0163163_10024877
1946 Ga0163163_10064535
1947 Ga0163163_10257855
1948 Ga0163163_10559923
1949 Ga0163163_11345461
1950 Ga0157380_10223651
1951 Ga0157380_10245428
1952 Ga0157380_10347519
1953 Ga0157380_10390373
1954 Ga0157380_10391620
1955 Ga0157380_11292685
1956 Ga0182008_10004904
1957 Ga0157377_10001603
1958 Ga0157377_10078424
1959 Ga0157377_10158199
1960 Ga0157377_10270263
1961 Ga0157377_10377577
1962 Ga0157377_10467160
1963 Ga0157379_10011242
1964 Ga0157379_10079775
1965 Ga0157379_10082081
1966 Ga0157379_10144530
1967 Ga0157379_10886060
1968 Ga0157376_10247505
1969 Ga0157376_10278620
1970 Ga0157376_10401297
1971 Ga0157376_10508397
1972 Ga0182007_10006522
1973 Ga0163161_10259062
1974 Ga0163161_10285545
1975 Ga0163161_10388868
1976 Ga0197907_10958534
1977 Ga0206352_10045669
1978 Ga0206350_10423989
1979 Ga0206354_10580180
1980 Ga0213872_10091145
1981 Ga0213874_10076065
1982 Ga0213876_10003406
1983 Ga0213876_10023171
1984 Ga0213871_10052803
1985 Ga0224712_10220596
1986 Ga0209784_100141
1987 Ga0209437_100331
1988 Ga0209130_1043281
1989 Ga0209675_1015955
1990 Ga0209025_1000976
1991 Ga0209758_1000216
1992 Ga0209758_1027215
1993 Ga0209256_1010676
1994 Ga0209257_1020704
1995 Ga0207697_10074714
1996 Ga0207655_1016982
1997 Ga0207655_1053672
1998 Ga0207713_1029603
1999 Ga0207653_10042327
2000 Ga0207653_10250200
2001 Ga0207692_10011948
2002 Ga0207692_10034935
2003 Ga0207710_10000017
2004 Ga0207710_10015930
2005 Ga0207710_10028646
2006 Ga0207710_10040258
2007 Ga0207710_10091273
2008 Ga0207688_10010927
2009 Ga0207688_10065624
2010 Ga0207688_10156735
2011 Ga0207680_10006153
2012 Ga0207685_10050135
2013 Ga0207685_10057475
2014 Ga0207699_10028394
2015 Ga0207699_10141559
2016 Ga0207699_10364227
2017 Ga0207699_10469485
2018 Ga0207699_10614083
2019 Ga0207645_10120859
2020 Ga0207645_10220500
2021 Ga0207643_10002622
2022 Ga0207643_10058965
2023 Ga0207643_10139071
2024 Ga0207705_10000002
2025 Ga0207705_10246651
2026 Ga0207705_10574388
2027 Ga0207684_10284308
2028 Ga0207654_10040688
2029 Ga0207707_10016379
2030 Ga0207707_10358042
2031 Ga0207695_10247709
2032 Ga0207671_10122202
2033 Ga0207693_10001926
2034 Ga0207693_10021188
2035 Ga0207693_10129942
2036 Ga0207693_10162845
2037 Ga0207663_10000218
2038 Ga0207663_10028223
2039 Ga0207663_10123632
2040 Ga0207663_10151603
2041 Ga0207660_10014904
2042 Ga0207660_10359614
2043 Ga0207662_10000683
2044 Ga0207662_10061436
2045 Ga0207662_10147552
2046 Ga0207657_10007500
2047 Ga0207657_10013143
2048 Ga0207657_10044526
2049 Ga0207657_10171327
2050 Ga0207657_10523273
2051 Ga0207649_10036860
2052 Ga0207649_10276746
2053 Ga0207649_10280726
2054 Ga0207649_10497928
2055 Ga0207652_10014975
2056 Ga0207652_10016976
2057 Ga0207652_10077073
2058 Ga0207652_10243407
2059 Ga0207652_10259532
2060 Ga0207652_10281349
2061 Ga0207646_10221868
2062 Ga0207681_10031902
2063 Ga0207681_10260818
2064 Ga0207650_10138625
2065 Ga0207650_10438518
2066 Ga0207659_10001213
2067 Ga0207659_10028998
2068 Ga0207659_10113563
2069 Ga0207687_10015651
2070 Ga0207687_10108277
2071 Ga0207687_10191387
2072 Ga0207687_10384467
2073 Ga0207687_10906365
2074 Ga0207700_10021547
2075 Ga0207700_10130792
2076 Ga0207700_10450251
2077 Ga0207664_10008551
2078 Ga0207664_10045656
2079 Ga0207664_10079107
2080 Ga0207664_10527278
2081 Ga0207664_10693924
2082 Ga0207644_10000145
2083 Ga0207644_10138035
2084 Ga0207644_10203491
2085 Ga0207644_10205130
2086 Ga0207690_10126838
2087 Ga0207690_10574478
2088 Ga0207706_10002966
2089 Ga0207706_10120457
2090 Ga0207706_10207924
2091 Ga0207706_10329771
2092 Ga0207706_10345338
2093 Ga0207706_10418351
2094 Ga0207706_10424115
2095 Ga0207686_10072906
2096 Ga0207709_10056127
2097 Ga0207709_10102289
2098 Ga0207709_10255332
2099 Ga0207670_10023176
2100 Ga0207670_10046448
2101 Ga0207670_10109566
2102 Ga0207670_10168401
2103 Ga0207669_10040380
2104 Ga0207669_10387170
2105 Ga0207704_10108603
2106 Ga0207704_10214793
2107 Ga0207704_10240334
2108 Ga0207665_10005572
2109 Ga0207665_10006881
2110 Ga0207665_10046790
2111 Ga0207665_10058141
2112 Ga0207665_10095992
2113 Ga0207665_10627843
2114 Ga0207691_10033820
2115 Ga0207691_10142665
2116 Ga0207691_10328703
2117 Ga0207691_10365725
2118 Ga0207691_10407998
2119 Ga0207691_10463962
2120 Ga0207711_10002995
2121 Ga0207711_10007764
2122 Ga0207711_10053527
2123 Ga0207711_10077530
2124 Ga0207711_10087655
2125 Ga0207711_10980799
2126 Ga0207711_11016856
2127 Ga0207689_10008393
2128 Ga0207689_10198876
2129 Ga0207689_10262806
2130 Ga0207689_10288884
2131 Ga0207689_10306829
2132 Ga0207689_10383677
2133 Ga0207661_10423854
2134 Ga0207661_10700780
2135 Ga0207661_10894155
2136 Ga0207679_10130543
2137 Ga0207679_10231023
2138 Ga0207667_10012912
2139 Ga0207667_10023790
2140 Ga0207667_10227475
2141 Ga0207667_10876575
2142 Ga0207651_10109469
2143 Ga0207651_10336789
2144 Ga0207712_10024731
2145 Ga0207712_10379238
2146 Ga0207668_10008013
2147 Ga0207668_10036515
2148 Ga0207668_10094916
2149 Ga0207668_10111996
2150 Ga0207640_10022062
2151 Ga0207640_10327560
2152 Ga0207677_10076376
2153 Ga0207677_10217805
2154 Ga0207677_10347872
2155 Ga0207703_10012018
2156 Ga0207703_10048528
2157 Ga0207703_10094107
2158 Ga0207703_10184440
2159 Ga0207703_10213190
2160 Ga0207703_10269770
2161 Ga0207703_10318319
2162 Ga0207703_10322304
2163 Ga0207639_10113371
2164 Ga0207639_10140499
2165 Ga0207639_10251013
2166 Ga0207639_10338062
2167 Ga0207678_10045312
2168 Ga0207678_10095940
2169 Ga0207678_10139610
2170 Ga0207708_10022090
2171 Ga0207708_10165085
2172 Ga0207708_10461978
2173 Ga0207708_10511065
2174 Ga0207702_10248289
2175 Ga0207702_10290442
2176 Ga0207641_10000036
2177 Ga0207641_10001674
2178 Ga0207641_10006011
2179 Ga0207641_10125366
2180 Ga0207641_10424049
2181 Ga0207641_10445859
2182 Ga0207641_10986217
2183 Ga0207648_10005612
2184 Ga0207648_10038262
2185 Ga0207648_10143468
2186 Ga0207648_10708539
2187 Ga0207676_10118955
2188 Ga0207676_10342233
2189 Ga0207676_10716459
2190 Ga0207674_10084505
2191 Ga0207674_10089883
2192 Ga0207674_10190001
2193 Ga0207674_10396355
2194 Ga0207675_100003007
2195 Ga0207675_100036086
2196 Ga0207675_100082556
2197 Ga0207675_100182641
2198 Ga0207675_100405621
2199 Ga0207675_100627022
2200 Ga0207675_100951657
2201 Ga0207675_101416959
2202 Ga0207683_10015654
2203 Ga0207683_10032201
2204 Ga0207683_10207216
2205 Ga0207683_10254803
2206 Ga0207683_10282128
2207 Ga0207683_10454525
2208 Ga0207698_10092615
2209 Ga0207698_10173647
2210 Ga0207698_10335106
2211 Ga0207698_10375678
2212 Ga0207698_10388390
2213 Ga0207698_10529446
2214 Ga0207698_11032515
2215 Ga0209281_1029026
2216 Ga0209489_109706
2217 Ga0209700_100031
2218 Ga0209588_1015432
2219 Ga0209588_1043115
2220 Ga0209588_1063219
2221 Ga0209813_10028535
2222 Ga0207428_10000032
2223 Ga0207428_10070330
2224 Ga0207428_10111063
2225 Ga0207428_10230665
2226 Ga0207428_10250355
2227 Ga0268266_10000560
2228 Ga0268266_10029767
2229 Ga0268266_10240360
2230 Ga0268266_10624126
2231 Ga0268266_11305718
2232 Ga0268265_10043571
2233 Ga0268265_10201099
2234 Ga0268265_10203711
2235 Ga0268265_10223592
2236 Ga0268265_10232679
2237 Ga0268265_10255954
2238 Ga0268265_10392731
2239 Ga0268265_10642495
2240 Ga0268264_10014193
2241 Ga0268264_10111054
2242 Ga0268264_10155027
2243 Ga0268264_10177234
2244 Ga0268264_10255397
2245 Ga0265334_10083058
2246 Ga0307517_10000125
2247 Ga0307515_10158343
2248 Ga0265338_10008624
2249 Ga0265338_10090007
2250 Ga0310982_100320
2251 Ga0310981_1038706
2252 Ga0307512_10142319
2253 Ga0316182_1082465
2254 Ga0265762_1001772
2255 Ga0265777_103137
2256 Ga0265328_10000041
2257 Ga0265340_10107718
2258 Ga0265316_10004234
2259 Ga0307408_100158543
2260 Ga0307408_100320780
2261 Ga0307508_10165302
2262 Ga0307508_10233855
2263 Ga0265314_10110622
2264 Ga0307516_10167169
2265 Ga0307405_10187330
2266 Ga0307405_10386933
2267 Ga0307413_10070007
2268 Ga0307413_10139134
2269 Ga0307413_10314277
2270 Ga0307410_10017505
2271 Ga0307410_10063305
2272 Ga0307410_10077593
2273 Ga0307406_10029602
2274 Ga0307406_10302389
2275 Ga0307406_10470332
2276 Ga0307407_10175875
2277 Ga0307407_10195688
2278 Ga0307412_10804726
2279 Ga0307409_100008475
2280 Ga0307409_100071714
2281 Ga0307409_100743896
2282 Ga0307409_100850841
2283 Ga0307416_100015910
2284 Ga0307416_100092003
2285 Ga0307416_100651752
2286 Ga0307416_101106873
2287 Ga0307414_10628150
2288 Ga0307415_100025248
2289 Ga0307415_100206957
2290 Ga0307415_100270244
2291 Ga0307415_100427721
2292 Ga0316596_1048376
2293 Ga0373930_0019395
2294 Ga0373950_0037319
2295 Ga0373958_0011453
2296 Ga0373959_0000924
2297 Ga0373928_0003435
2298 Ga0373929_0000116
2299 Ga0373934_0002966
2300 Ga0373934_0051027
2301 Ga0373934_0113515
2302 Ga0373940_0000084
2303 Ga0373940_0064960
2304 Ga0373949_0048079
2305 Ga0373923_0000429
2306 Ga0373923_0036628
2307 Ga0373932_0000807
2308 Ga0373932_0009460
2309 Ga0373936_0010448
2310 Ga0373939_0035172
2311 Ga0373939_0048662
2312 Ga0373941_0000161
2313 Ga0373941_0015637
2314 Ga0373941_0026257
2315 Ga0373953_0000451
2316 Ga0373953_0007154
2317 Ga0373953_0071837
2318 Ga0373954_0000482
2319 Ga0373954_0003811
2320 Ga0373954_0010828
2321 Ga0373954_0090393
2322 Ga0373956_0111852
2323 Ga0373956_0186202
2324 Ga0373957_0000922
2325 Ga0373957_0101640
2326 Ga0373960_0000753
2327 Ga0373960_0040375
2328 Ga0373946_0007337
2329 Ga0373946_0014782
2330 Ga0373955_0036421
2331 Ga0373955_0145249
2332 Ga0373955_0175916
2333 Ga0373942_0001757
2334 Ga0373961_0001371
2335 Ga0373962_0000245
2336 Ga0373962_0030916
2337 Ga0373962_0105373
2338 Ga0373924_0002270
2339 Ga0373931_0009494
2340 Ga0373931_0021342
2341 Ga0373931_0180614
2342 Ga0373935_0008830
2343 Ga0373935_0053767
2344 Ga0373935_0198302
2345 Ga0373935_0777880
2346 Ga0373927_0028727
2347 Ga0373927_0059060
2348 Ga0373927_0096376
2349 Ga0373927_0132003
2350 Ga0373927_0383836
2351 Ga0373933_0003737
2352 Ga0373947_0040913
2353 Ga0373947_0043635
2354 Ga0373937_0172438
2355 Ga0373937_0210181
2356 Ga0373937_0304832
2357 Ga0373937_0373074
2358 Ga0373937_0451068
2359 Ga0373925_0005941
2360 Ga0373925_0013826
2361 Ga0373925_0174928
2362 Ga0395900_0087991
2363 Ga0395900_0141424
2364 Ga0395900_0609373
2365 Ga0395898_0156518
2366 Ga0395898_0372873
2367 Ga0395898_0620454
2368 Ga0395905_0007428
2369 Ga0395905_0012237
2370 Ga0395905_0089423
2371 Ga0395901_0032493
2372 Ga0395901_0082956
2373 Ga0395901_0877081
2374 Ga0436365_0450041
2375 Ga0436365_0697746
2376 Ga0436365_1470057
2377 Ga0436365_1620453
2378 Ga0436365_1701482
2379 Ga0436365_1935460
2380 Ga0436360_0298195
2381 Ga0436361_0730859
2382 Ga0436363_0579133
2383 Ga0436362_0946909
2384 Ga0436362_1110265
2385 Ga0439465_0050727
2386 Ga0451841_0950211
2387 Ga0451853_0777966
2388 Ga0439455_0019852
2389 Ga0450914_003561
2390 Ga0450890_009528
2391 Ga0439434_0167228
2392 Ga0451577_0043475
2393 Ga0466966_0014585
2394 Ga0466966_0014913
2395 Ga0466966_0093533
2396 Ga0466961_0043541
2397 Ga0466961_0115997
2398 Ga0466961_0126535
2399 Ga0466961_0311672
2400 Ga0466963_0075586
2401 Ga0466963_0437133
2402 Ga0466963_0467393
2403 Ga0466971_0119745
2404 Ga0466957_0028757
2405 Ga0466957_0227246
2406 Ga0466960_0023207
2407 Ga0466960_0035450
2408 Ga0466959_0004261
2409 Ga0466959_0151285
2410 Ga0466959_0154099
2411 Ga0451576_0055322
2412 Ga0451576_0607998
2413 Ga0466958_0002151
2414 Ga0466958_0106918
2415 Ga0466958_0121180
2416 Ga0466958_0286919
2417 Ga0466967_0068175
2418 Ga0466967_0173578
2419 Ga0466967_0226821
2420 Ga0495592_0005638
2421 Ga0495592_0028405
2422 Ga0495592_0057907
2423 Ga0495603_0039205
2424 Ga0495629_0056581
2425 Ga0495629_0159455
2426 Ga0495638_0007730
2427 Ga0495638_0133888
2428 Ga0495641_0011057
2429 Ga0495651_0004143
2430 Ga0495651_0275165
2431 Ga0495651_0442956
2432 Ga0495653_0022129
2433 Ga0495653_0294093
2434 Ga0495580_0056214
2435 Ga0495580_0133111
2436 Ga0495580_0144381
2437 Ga0495580_0198094
2438 Ga0495582_0012275
2439 Ga0495639_0001960
2440 Ga0495639_0064911
2441 Ga0495639_0093691
2442 Ga0495662_0005450
2443 Ga0495664_0003933
2444 Ga0495584_0006905
2445 Ga0495584_0099387
2446 Ga0495584_0117331
2447 Ga0495584_0153742
2448 Ga0495596_0066806
2449 Ga0495606_0199980
2450 Ga0495608_0004188
2451 Ga0495608_0007931
2452 Ga0495608_0165211
2453 Ga0495608_0193755
2454 Ga0495610_0002336
2455 Ga0495610_0106718
2456 Ga0495616_0152174
2457 Ga0495616_0154130
2458 Ga0495618_0129668
2459 Ga0495618_0145861
2460 Ga0495620_0112262
2461 Ga0495628_0036325
2462 Ga0495628_0055686
2463 Ga0495628_0203839
2464 Ga0495630_0010900
2465 Ga0495630_0057928
2466 Ga0495631_0025969
2467 Ga0495637_0075167
2468 Ga0495644_0034036
2469 Ga0495663_0006675
2470 Ga0495642_0003089
2471 Ga0495642_0146980
2472 Ga0495652_0005494
2473 Ga0495652_0050149
2474 Ga0495652_0069819
2475 Ga0495652_0081707
2476 Ga0495665_0016354
2477 Ga0495665_0103663
2478 Ga0495640_0001806
2479 Ga0495640_0014075
2480 Ga0495640_0381402
2481 Ga0495586_0003635
2482 Ga0495586_0526242
2483 Ga0495587_0002077
2484 Ga0495587_0080839
2485 Ga0495587_0091248
2486 Ga0495587_0143446
2487 Ga0495598_0063529
2488 Ga0495621_0088457
2489 Ga0495597_0135444
2490 Ga0495645_0009908
2491 Ga0495645_0027506
2492 Ga0495645_0161506
2493 Ga0495633_0073145
2494 Ga0495667_0008752
2495 Ga0495667_0023465
2496 Ga0495667_0086457
2497 Ga0495656_0030020
2498 Ga0495656_0054523
2499 Ga0495656_0355547
2500 Ga0495668_0158961
2501 Ga0495668_0217988
2502 Ga0495668_0226306
2503 Ga0495634_0227969
2504 Ga0495611_0122721
2505 Ga0495611_0159904
2506 Ga0495588_0012687
2507 Ga0495588_0233903
2508 Ga0495657_0012725
2509 Ga0495657_0103606
2510 Ga0495599_0005317
2511 Ga0495599_0032803
2512 Ga0495599_0076546
2513 Ga0495599_0087336
2514 Ga0495599_0327801
2515 Ga0495623_0175936
2516 Ga0495623_0197658
2517 Ga0495647_0058460
2518 Ga0495647_0069026
2519 Ga0495647_0095748
2520 Ga0495647_0098992
2521 Ga0495658_0124747
2522 Ga0495658_0185194
2523 Ga0495669_0000560
2524 Ga0495669_0061694
2525 Ga0495669_0073388
2526 Ga0495669_0112861
2527 Ga0495669_0122884
2528 Ga0495669_0191115
2529 Ga0495613_0013985
2530 Ga0495613_0100399
2531 Ga0495613_0150801
2532 Ga0495613_0249178
2533 Ga0495670_0164303
2534 Ga0495649_0073198
2535 Ga0495600_0002947
2536 Ga0495581_0091051
2537 Ga0495604_0006828
2538 Ga0495604_0133762
2539 Ga0495636_0001627
2540 Ga0495636_0108087
2541 Ga0495674_0005220
2542 Ga0495674_0044746
2543 Ga0495674_0099319
2544 Ga0495672_0012941
2545 Ga0495672_0068280
2546 Ga0495676_0075687
2547 Ga0495676_0198730
2548 Ga0495680_0011364
2549 Ga0495680_0084304
2550 Ga0495680_0218492
2551 Ga0495683_0128288
2552 Ga0495675_0018560
2553 Ga0495685_039324
2554 Ga0495673_0072452
2555 Ga0495673_0163128
2556 Ga0495684_0009393
2557 Ga0495684_0012445
2558 Ga0495686_0091685
2559 Ga0495602_0215107
2560 Ga0495602_0295325
2561 Ga0496100_0004796
2562 Ga0496100_0006135
2563 Ga0496100_0057191
2564 Ga0496100_0291498
2565 Ga0496101_0000396
2566 Ga0496101_0091436
2567 Ga0496101_0145159
2568 Ga0496101_0257300
2569 Ga0496101_0306051
2570 Ga0496101_0327649
2571 Ga0496101_0611376
2572 Ga0496102_0008904
2573 Ga0496102_0023775
2574 Ga0496102_0186737
2575 Ga0496102_0421928
2576 Ga0496102_0749962
2577 Ga0496103_0047199
2578 Ga0496103_0078931
2579 Ga0496103_0103504
2580 Ga0496103_0164392
2581 Ga0496103_0324263
2582 Ga0496104_0017385
2583 Ga0496104_0022306
2584 Ga0496104_0051414
2585 Ga0496104_0076019
2586 Ga0496104_0096967
2587 Ga0496104_0351678
2588 Ga0496104_0691205
2589 Ga0496105_0005725
2590 Ga0496105_0114894
2591 Ga0496105_0117251
2592 Ga0496105_0268131
2593 Ga0496105_0410374
2594 Ga0496105_0437957
2595 Ga0496106_0050105
2596 Ga0496106_0318361
2597 Ga0496106_0363627
2598 Ga0496106_0483966
2599 Ga0496107_0010686
2600 Ga0496107_0028952
2601 Ga0496107_0113730
2602 Ga0496107_0650031
2603 Ga0496108_0036186
2604 Ga0496108_0401150
2605 Ga0496109_0024415
2606 Ga0496109_0171156
2607 Ga0496109_0561392
2608 Ga0496109_0708872
2609 Ga0496110_0082246
2610 Ga0496110_0088473
2611 Ga0496110_0168247
2612 Ga0496111_0024319
2613 Ga0496111_0055372
2614 Ga0496111_0123300
2615 Ga0496112_0000021
2616 Ga0496112_0016237
2617 Ga0496112_0029065
2618 Ga0496112_0162779
2619 Ga0496112_0255816
2620 Ga0496112_0295914
2621 Ga0496112_0388942
2622 Ga0496112_0417381
2623 Ga0496113_0032056
2624 Ga0496113_0231267
2625 Ga0496114_0000246
2626 Ga0496114_0059095
2627 Ga0496114_0111094
2628 Ga0496114_0148509
2629 Ga0496114_0168207
2630 Ga0496114_0288243
2631 Ga0496114_0623350
2632 Ga0496114_0837761
2633 Ga0496115_0025980
2634 Ga0496115_0038310
2635 Ga0496115_0076504
2636 Ga0496115_0132538
2637 Ga0496116_0003008
2638 Ga0496116_0150275
2639 Ga0496117_0076188
2640 Ga0496117_0214415
2641 Ga0496118_0075512
2642 Ga0496118_0179456
2643 Ga0496119_0000469
2644 Ga0496119_0000855
2645 Ga0496119_0119768
2646 Ga0496120_0000372
2647 Ga0496120_0001942
2648 Ga0496121_0066731
2649 Ga0496122_0025808
2650 Ga0496122_0147325
2651 Ga0496123_0145460
2652 Ga0496123_0196005
2653 Ga0496123_0269995
2654 Ga0496124_0000697
2655 Ga0496124_0023250
2656 Ga0496125_0050981
2657 Ga0496125_0075979
2658 Ga0496125_0084741
2659 Ga0496125_0175500
2660 Ga0496126_0024730
2661 Ga0496126_0039091
2662 Ga0496126_0131756
2663 Ga0496126_0221452
2664 Ga0501306_000191
2665 Ga0501309_005550
2666 Ga0501343_001886
2667 Ga0501305_001225
2668 Ga0501312_000027
2669 Ga0501313_006374
2670 Ga0501315_001573
2671 Ga0501316_000050
2672 Ga0501317_020591
2673 Ga0501318_008883
2674 Ga0501321_000062
2675 Ga0501323_006864
2676 Ga0501323_009825
2677 Ga0501324_000425
2678 Ga0501330_001473
2679 Ga0501331_00589
2680 Ga0501334_00263
2681 Ga0501335_002359
2682 Ga0501337_000411
2683 Ga0501031_0026834
2684 Ga0501032_0157219
2685 Ga0501033_0020411
2686 Ga0501036_0000860
2687 Ga0501036_0002708
2688 Ga0501036_0812469
2689 Ga0501037_0140123
2690 Ga0501037_0159544
2691 Ga0501038_0001811
2692 Ga0501038_0136222
2693 Ga0501038_0140860
2694 Ga0501038_0471655
2695 Ga0501039_0001335
2696 Ga0501039_0099511
2697 Ga0501040_0011405
2698 Ga0501040_0209109
2699 Ga0501040_0217457
2700 Ga0501042_0000788
2701 Ga0501042_0000948
2702 Ga0501042_0030263
2703 Ga0501042_0309490
2704 Ga0501046_0013103
2705 Ga0501046_0072436
2706 Ga0501046_0081548
2707 Ga0501046_0254330
2708 Ga0501047_0495817
2709 Ga0501048_0010899
2710 Ga0501048_0126860
2711 Ga0501067_0316826
2712 Ga0501068_0008573
2713 Ga0501068_0285823
2714 Ga0501068_0356357
2715 Ga0501069_0120845
2716 Ga0501069_0250475
2717 Ga0501069_0394380
2718 Ga0501070_0046253
2719 Ga0501070_0176515
2720 Ga0501071_0000849
2721 Ga0501071_0017192
2722 Ga0501071_0267403
2723 Ga0501071_0327320
2724 Ga0501072_0003324
2725 Ga0501072_0005776
2726 Ga0501072_0015507
2727 Ga0501072_0104806
2728 Ga0501072_0390925
2729 Ga0501073_0030743
2730 Ga0501073_0123746
2731 Ga0501073_0217775
2732 Ga0501074_0003006
2733 Ga0501074_0030693
2734 Ga0501074_0121731
2735 Ga0501075_0001033
2736 Ga0501075_0001990
2737 Ga0501075_0062695
2738 Ga0501075_0127092
2739 Ga0501075_0193300
2740 Ga0501075_0296467
2741 Ga0501075_0471046
2742 Ga0501076_0000979
2743 Ga0501076_0007813
2744 Ga0501076_0083902
2745 Ga0501076_0167771
2746 Ga0501076_0300849
2747 Ga0501076_0837691
2748 Ga0501077_0047329
2749 Ga0501077_0116299
2750 Ga0501077_0183440
2751 Ga0501077_0211487
2752 Ga0501079_0001475
2753 Ga0501079_0006844
2754 Ga0501079_0029406
2755 Ga0501079_0155940
2756 Ga0501079_0185343
2757 Ga0501079_0208772
2758 Ga0501080_0001334
2759 Ga0501080_0056648
2760 Ga0501081_0001239
2761 Ga0501081_0002378
2762 Ga0501081_0038071
2763 Ga0501081_0167681
2764 Ga0501083_0023121
2765 Ga0501083_0055182
2766 Ga0501083_0101198
2767 Ga0501083_0145723
2768 Ga0501279_004537
2769 Ga0501035_0029667
2770 Ga0501044_0479138
2771 Ga0501044_0660016
2772 Ga0501045_0000682
2773 Ga0501045_0046088
2774 Ga0501045_0054025
2775 Ga0501045_0084069
2776 Ga0501045_0201880
2777 nmdc:mga03n38_108690_c1
2778 nmdc:mga03n38_60592_c1
2779 nmdc:mga00v17_105905_c1
2780 nmdc:mga00v17_371009_c1
2781 nmdc:mga00v17_94313_c1
2782 nmdc:mga0yw44_270499_c1
2783 nmdc:mga0yw44_36883_c1
2784 nmdc:mga0yw44_70411_c1
2785 nmdc:mga0k408_1106_c1
2786 nmdc:mga0k408_259294_c1
2787 nmdc:mga06z11_24896_c1
2788 nmdc:mga06z11_60721_c1
2789 nmdc:mga04h51_35660_c1
2790 nmdc:mga07m45_201586_c1
2791 nmdc:mga07m45_63339_c1
2792 nmdc:mga05p37_13622_c1
2793 nmdc:mga05p37_16973_c1
2794 nmdc:mga05p37_202056_c1
2795 nmdc:mga05p37_20610_c1
2796 nmdc:mga05p37_246472_c1
2797 nmdc:mga05p37_25099_c1
2798 nmdc:mga05p37_3048_c1
2799 nmdc:mga05p37_306353_c1
2800 nmdc:mga05p37_3121_c1
2801 nmdc:mga05p37_46662_c1
2802 nmdc:mga05p37_595_c1
2803 nmdc:mga05p37_613385_c1
2804 nmdc:mga05p37_75038_c1
2805 nmdc:mga05p37_84346_c1
2806 nmdc:mga05p37_88852_c1
2807 nmdc:mga09592_110445_c1
2808 nmdc:mga09592_13724_c1
2809 nmdc:mga09592_255574_c1
2810 nmdc:mga09592_388521_c1
2811 nmdc:mga09592_462264_c1
2812 nmdc:mga09592_7943_c1
2813 nmdc:mga0qj67_24449_c1
2814 nmdc:mga0qj67_420840_c1
2815 nmdc:mga0qj67_5121_c1
2816 nmdc:mga0qj67_610644_c1
2817 nmdc:mga06r32_350562_c1
2818 nmdc:mga06r32_51901_c1
2819 nmdc:mga06r32_545174_c1
2820 nmdc:mga06r32_649826_c1
2821 nmdc:mga06r32_86458_c1
2822 nmdc:mga08y16_169354_c1
2823 nmdc:mga08y16_17177_c1
2824 nmdc:mga08y16_236383_c1
2825 nmdc:mga08y16_371187_c1
2826 nmdc:mga08y16_399570_c1
2827 nmdc:mga08y16_4339_c1
2828 nmdc:mga08y16_517196_c1
2829 nmdc:mga08y16_927899_c1
2830 nmdc:mga0n895_1001604_c1
2831 nmdc:mga0n895_142639_c1
2832 nmdc:mga0n895_17757_c1
2833 nmdc:mga0n895_27160_c1
2834 nmdc:mga0n895_602462_c1
2835 nmdc:mga0n895_7101_c1
2836 nmdc:mga0rr50_149780_c1
2837 nmdc:mga0rr50_21352_c1
2838 nmdc:mga0rr50_2205_c1
2839 nmdc:mga0rr50_373_c1
2840 nmdc:mga0rr50_39611_c1
2841 nmdc:mga0rr50_60229_c1
2842 nmdc:mga08x19_22597_c1
2843 nmdc:mga08x19_34220_c1
2844 nmdc:mga08x19_632680_c1
2845 nmdc:mga08x19_90727_c1
2846 nmdc:mga0a205_10346_c1
2847 nmdc:mga0a205_106213_c1
2848 nmdc:mga0a205_47564_c1
2849 nmdc:mga0a205_608134_c1
2850 nmdc:mga0a205_6655_c1
2851 nmdc:mga0a205_72605_c1
2852 nmdc:mga0a205_929598_c1
2853 nmdc:mga0sz30_129744_c1
2854 Ga0495601_0002901
2855 Ga0495601_0028459
2856 Ga0495601_0164829
2857 Ga0495612_0202295
2858 Ga0500610_0104299
2859 Ga0500610_0111281
2860 Ga0495655_0010860
2861 Ga0495655_0026693
2862 Ga0495655_0066699
2863 Ga0495595_0001331
2864 Ga0495595_0072896
2865 Ga0495619_0004075
2866 Ga0495619_0004232
2867 Ga0495619_0010190
2868 Ga0495619_0144447
2869 Ga0495619_0161747
2870 Ga0500646_0060290
2871 Ga0500651_0004275
2872 Ga0500651_0226764
2873 Ga0500566_0018854
2874 Ga0500641_0007395
2875 Ga0500556_0082237
2876 Ga0500595_001142
2877 Ga0500595_008139
2878 Ga0500595_009814
2879 Ga0500607_017101
2880 Ga0500608_077661
2881 Ga0500618_009735
2882 Ga0500642_0001169
2883 Ga0500642_0097290
2884 Ga0500655_000265
2885 Ga0500559_0002179
2886 Ga0500559_0034952
2887 Ga0500559_0077114
2888 Ga0500568_0006975
2889 Ga0500568_0017398
2890 Ga0500588_0014706
2891 Ga0500589_108869
2892 Ga0500590_004805
2893 Ga0500622_0012750
2894 Ga0500639_055045
2895 Ga0500636_0039323
2896 Ga0500636_0045197
2897 Ga0500637_0004731
2898 Ga0500570_032123
2899 Ga0500645_004711
2900 Ga0501084_0000677
2901 Ga0501084_0004051
2902 Ga0501084_0084348
2903 Ga0501084_0176773
2904 Ga0501084_1136244
2905 Ga0500661_006321
2906 Ga0590071_000185
2907 Ga0590071_055211
2908 Ga0590074_015090
2909 Ga0590075_000204
2910 Ga0590075_035646
2911 Ga0590077_020629
2912 Ga0587067_002632
2913 Ga0587067_018834
2914 Ga0587072_000329
2915 Ga0587072_024465
2916 Ga0501082_0002099
2917 Ga0501082_0002693
2918 Ga0501082_0025899
2919 Ga0501082_0100518
2920 Ga0501082_0200131
2921 Ga0501082_0205454
2922 Ga0501082_0246512
2923 Ga0501082_1048034
2924 Ga0530510_0001293
2925 Ga0530510_0009637
2926 Ga0530510_0058439
2927 2528204309
2928 2528212121
2929 2546946880
2930 2563930209
2931 2579747611
2932 2643738859
2933 2673167462
2934 2686543605
2935 2710602541
2936 2774867002
2937 2774902886
2938 2821118338
2939 2864738854
2940 2876810452
2941 2885529898
2942 2889047992
2943 2902335199
2944 2904168171
2945 2904496932
2946 2907208182
2947 2919166265
2948 2931385098
2949 2939685140
2950 2945996279
2951 2946058969
2952 637877936

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

7

221

0.98

PF13207

AAA_17

AAA domain

8

127

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.8872 1 208
4np6-assembly1.cif.gz_B crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor 0.8796 1 207
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.8793 1 208
6s36-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119k mutant 0.8755 1 207
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.8709 1 208
ID Description Score Start End Superfamily
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8961 1 209 3.40.50.300
af_A4I9I1_1_215_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8849 2 208 3.40.50.300
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8761 1 209 3.40.50.300
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8667 1 205 3.40.50.300
3umfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8654 1 208 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A662SQD8-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9736 75 208 GO:0004017
GO:0005524
GO:0005737
AF-A0A202DNJ0-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9731 87 208 GO:0004017
GO:0005524
GO:0005737
AF-A0A6J6C4P5-F1-model_v4 Unannotated protein 0.96 63 205 GO:0004017
GO:0005524
GO:0005737
AF-A0A3D3ZGD8-F1-model_v4 deleted 0.9544 84 207
AF-A0A3D0HM98-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9543 78 207 GO:0004017
GO:0005524
GO:0005737

Map